(data stored in ACNUC7421 zone)

EMBL: CP002399

ID   CP002399; SV 1; circular; genomic DNA; STD; PRO; 6962533 BP.
XX
AC   CP002399; ADGV01000000-ADGV01000177;
XX
PR   Project:PRJNA38291;
XX
DT   24-JAN-2011 (Rel. 107, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Micromonospora sp. L5, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Micromonospora sp. L5
OC   Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae;
OC   Micromonospora.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-6962533
RX   PUBMED; 24072863.
RA   Hirsch A.M., Alvarado J., Bruce D., Chertkov O., De Hoff P.L., Detter J.C.,
RA   Fujishige N.A., Goodwin L.A., Han J., Han S., Ivanova N., Land M.L.,
RA   Lum M.R., Milani-Nejad N., Nolan M., Pati A., Pitluck S., Tran S.S.,
RA   Woyke T., Valdes M.;
RT   "Complete Genome Sequence of Micromonospora Strain L5, a Potential
RT   Plant-Growth-Regulating Actinomycete, Originally Isolated from Casuarina
RT   equisetifolia Root Nodules";
RL   Genome Announc 1(5):e00759-13(2013).
XX
RN   [2]
RP   1-6962533
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Saunders E., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G., De Hoff P.L.,
RA   Hirsch A.M., Woyke T.;
RT   "Complete sequence of Micromonospora sp. L5";
RL   Unpublished.
XX
RN   [3]
RP   1-6962533
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Saunders E., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G., De Hoff P.L.,
RA   Hirsch A.M., Woyke T.;
RT   ;
RL   Submitted (16-DEC-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f5efcea15fa25e69016497986be7df2f.
DR   BioSample; SAMN00008473.
DR   EnsemblGenomes-Gn; EBG00001127665.
DR   EnsemblGenomes-Gn; EBG00001127666.
DR   EnsemblGenomes-Gn; EBG00001127667.
DR   EnsemblGenomes-Gn; EBG00001127668.
DR   EnsemblGenomes-Gn; EBG00001127669.
DR   EnsemblGenomes-Gn; EBG00001127670.
DR   EnsemblGenomes-Gn; EBG00001127671.
DR   EnsemblGenomes-Gn; EBG00001127672.
DR   EnsemblGenomes-Gn; EBG00001127673.
DR   EnsemblGenomes-Gn; EBG00001127674.
DR   EnsemblGenomes-Gn; EBG00001127675.
DR   EnsemblGenomes-Gn; EBG00001127676.
DR   EnsemblGenomes-Gn; EBG00001127677.
DR   EnsemblGenomes-Gn; EBG00001127678.
DR   EnsemblGenomes-Gn; EBG00001127679.
DR   EnsemblGenomes-Gn; EBG00001127680.
DR   EnsemblGenomes-Gn; EBG00001127681.
DR   EnsemblGenomes-Gn; EBG00001127682.
DR   EnsemblGenomes-Gn; EBG00001127683.
DR   EnsemblGenomes-Gn; EBG00001127684.
DR   EnsemblGenomes-Gn; EBG00001127685.
DR   EnsemblGenomes-Gn; EBG00001127686.
DR   EnsemblGenomes-Gn; EBG00001127687.
DR   EnsemblGenomes-Gn; EBG00001127688.
DR   EnsemblGenomes-Gn; EBG00001127689.
DR   EnsemblGenomes-Gn; EBG00001127690.
DR   EnsemblGenomes-Gn; EBG00001127691.
DR   EnsemblGenomes-Gn; EBG00001127692.
DR   EnsemblGenomes-Gn; EBG00001127693.
DR   EnsemblGenomes-Gn; EBG00001127694.
DR   EnsemblGenomes-Gn; EBG00001127695.
DR   EnsemblGenomes-Gn; EBG00001127696.
DR   EnsemblGenomes-Gn; EBG00001127697.
DR   EnsemblGenomes-Gn; EBG00001127698.
DR   EnsemblGenomes-Gn; EBG00001127699.
DR   EnsemblGenomes-Gn; EBG00001127700.
DR   EnsemblGenomes-Gn; EBG00001127701.
DR   EnsemblGenomes-Gn; EBG00001127702.
DR   EnsemblGenomes-Gn; EBG00001127703.
DR   EnsemblGenomes-Gn; EBG00001127704.
DR   EnsemblGenomes-Gn; EBG00001127705.
DR   EnsemblGenomes-Gn; EBG00001127706.
DR   EnsemblGenomes-Gn; EBG00001127707.
DR   EnsemblGenomes-Gn; EBG00001127708.
DR   EnsemblGenomes-Gn; EBG00001127709.
DR   EnsemblGenomes-Gn; EBG00001127710.
DR   EnsemblGenomes-Gn; EBG00001127711.
DR   EnsemblGenomes-Gn; EBG00001127712.
DR   EnsemblGenomes-Gn; EBG00001127713.
DR   EnsemblGenomes-Gn; EBG00001127714.
DR   EnsemblGenomes-Gn; EBG00001127715.
DR   EnsemblGenomes-Gn; EBG00001127716.
DR   EnsemblGenomes-Gn; EBG00001127717.
DR   EnsemblGenomes-Gn; EBG00001127718.
DR   EnsemblGenomes-Gn; EBG00001127719.
DR   EnsemblGenomes-Gn; EBG00001127720.
DR   EnsemblGenomes-Gn; EBG00001127721.
DR   EnsemblGenomes-Gn; EBG00001127722.
DR   EnsemblGenomes-Gn; EBG00001127723.
DR   EnsemblGenomes-Gn; EBG00001127724.
DR   EnsemblGenomes-Gn; EBG00001127725.
DR   EnsemblGenomes-Gn; EBG00001127726.
DR   EnsemblGenomes-Gn; EBG00001127727.
DR   EnsemblGenomes-Gn; EBG00001127728.
DR   EnsemblGenomes-Gn; EBG00001127729.
DR   EnsemblGenomes-Gn; EBG00001127730.
DR   EnsemblGenomes-Gn; EBG00001127731.
DR   EnsemblGenomes-Gn; EBG00001127732.
DR   EnsemblGenomes-Gn; EBG00001127733.
DR   EnsemblGenomes-Gn; EBG00001127734.
DR   EnsemblGenomes-Gn; EBG00001127735.
DR   EnsemblGenomes-Gn; EBG00001127736.
DR   EnsemblGenomes-Gn; EBG00001127737.
DR   EnsemblGenomes-Gn; EBG00001127738.
DR   EnsemblGenomes-Gn; EBG00001127739.
DR   EnsemblGenomes-Gn; EBG00001127740.
DR   EnsemblGenomes-Gn; EBG00001127741.
DR   EnsemblGenomes-Gn; EBG00001127742.
DR   EnsemblGenomes-Gn; EBG00001127743.
DR   EnsemblGenomes-Gn; EBG00001127744.
DR   EnsemblGenomes-Gn; EBG00001127745.
DR   EnsemblGenomes-Gn; EBG00001127746.
DR   EnsemblGenomes-Gn; EBG00001127747.
DR   EnsemblGenomes-Gn; EBG00001127748.
DR   EnsemblGenomes-Gn; EBG00001127749.
DR   EnsemblGenomes-Gn; EBG00001127750.
DR   EnsemblGenomes-Gn; EBG00001127751.
DR   EnsemblGenomes-Gn; EBG00001127752.
DR   EnsemblGenomes-Gn; EBG00001127753.
DR   EnsemblGenomes-Gn; EBG00001127754.
DR   EnsemblGenomes-Gn; EBG00001127755.
DR   EnsemblGenomes-Gn; EBG00001127756.
DR   EnsemblGenomes-Gn; EBG00001127757.
DR   EnsemblGenomes-Gn; EBG00001127758.
DR   EnsemblGenomes-Gn; EBG00001127759.
DR   EnsemblGenomes-Gn; EBG00001127760.
DR   EnsemblGenomes-Gn; EBG00001127761.
DR   EnsemblGenomes-Gn; EBG00001127762.
DR   EnsemblGenomes-Gn; EBG00001127763.
DR   EnsemblGenomes-Gn; ML5_R0001.
DR   EnsemblGenomes-Gn; ML5_R0002.
DR   EnsemblGenomes-Gn; ML5_R0003.
DR   EnsemblGenomes-Gn; ML5_R0004.
DR   EnsemblGenomes-Gn; ML5_R0005.
DR   EnsemblGenomes-Gn; ML5_R0006.
DR   EnsemblGenomes-Gn; ML5_R0007.
DR   EnsemblGenomes-Gn; ML5_R0008.
DR   EnsemblGenomes-Gn; ML5_R0009.
DR   EnsemblGenomes-Gn; ML5_R0010.
DR   EnsemblGenomes-Gn; ML5_R0011.
DR   EnsemblGenomes-Gn; ML5_R0012.
DR   EnsemblGenomes-Gn; ML5_R0013.
DR   EnsemblGenomes-Gn; ML5_R0014.
DR   EnsemblGenomes-Gn; ML5_R0015.
DR   EnsemblGenomes-Gn; ML5_R0016.
DR   EnsemblGenomes-Gn; ML5_R0017.
DR   EnsemblGenomes-Gn; ML5_R0018.
DR   EnsemblGenomes-Gn; ML5_R0019.
DR   EnsemblGenomes-Gn; ML5_R0020.
DR   EnsemblGenomes-Gn; ML5_R0021.
DR   EnsemblGenomes-Gn; ML5_R0022.
DR   EnsemblGenomes-Gn; ML5_R0023.
DR   EnsemblGenomes-Gn; ML5_R0024.
DR   EnsemblGenomes-Gn; ML5_R0025.
DR   EnsemblGenomes-Gn; ML5_R0026.
DR   EnsemblGenomes-Gn; ML5_R0027.
DR   EnsemblGenomes-Gn; ML5_R0028.
DR   EnsemblGenomes-Gn; ML5_R0029.
DR   EnsemblGenomes-Gn; ML5_R0030.
DR   EnsemblGenomes-Gn; ML5_R0031.
DR   EnsemblGenomes-Gn; ML5_R0032.
DR   EnsemblGenomes-Gn; ML5_R0033.
DR   EnsemblGenomes-Gn; ML5_R0034.
DR   EnsemblGenomes-Gn; ML5_R0035.
DR   EnsemblGenomes-Gn; ML5_R0036.
DR   EnsemblGenomes-Gn; ML5_R0037.
DR   EnsemblGenomes-Gn; ML5_R0038.
DR   EnsemblGenomes-Gn; ML5_R0039.
DR   EnsemblGenomes-Gn; ML5_R0040.
DR   EnsemblGenomes-Gn; ML5_R0041.
DR   EnsemblGenomes-Gn; ML5_R0042.
DR   EnsemblGenomes-Gn; ML5_R0043.
DR   EnsemblGenomes-Gn; ML5_R0044.
DR   EnsemblGenomes-Gn; ML5_R0045.
DR   EnsemblGenomes-Gn; ML5_R0046.
DR   EnsemblGenomes-Gn; ML5_R0047.
DR   EnsemblGenomes-Gn; ML5_R0048.
DR   EnsemblGenomes-Gn; ML5_R0049.
DR   EnsemblGenomes-Gn; ML5_R0050.
DR   EnsemblGenomes-Gn; ML5_R0051.
DR   EnsemblGenomes-Gn; ML5_R0052.
DR   EnsemblGenomes-Gn; ML5_R0053.
DR   EnsemblGenomes-Gn; ML5_R0054.
DR   EnsemblGenomes-Gn; ML5_R0055.
DR   EnsemblGenomes-Gn; ML5_R0056.
DR   EnsemblGenomes-Gn; ML5_R0057.
DR   EnsemblGenomes-Gn; ML5_R0058.
DR   EnsemblGenomes-Gn; ML5_R0059.
DR   EnsemblGenomes-Gn; ML5_R0060.
DR   EnsemblGenomes-Gn; ML5_R0061.
DR   EnsemblGenomes-Gn; ML5_R0062.
DR   EnsemblGenomes-Gn; ML5_R0063.
DR   EnsemblGenomes-Gn; ML5_R0064.
DR   EnsemblGenomes-Gn; ML5_R0065.
DR   EnsemblGenomes-Tr; EBT00001719172.
DR   EnsemblGenomes-Tr; EBT00001719173.
DR   EnsemblGenomes-Tr; EBT00001719174.
DR   EnsemblGenomes-Tr; EBT00001719175.
DR   EnsemblGenomes-Tr; EBT00001719176.
DR   EnsemblGenomes-Tr; EBT00001719177.
DR   EnsemblGenomes-Tr; EBT00001719178.
DR   EnsemblGenomes-Tr; EBT00001719179.
DR   EnsemblGenomes-Tr; EBT00001719180.
DR   EnsemblGenomes-Tr; EBT00001719181.
DR   EnsemblGenomes-Tr; EBT00001719182.
DR   EnsemblGenomes-Tr; EBT00001719183.
DR   EnsemblGenomes-Tr; EBT00001719184.
DR   EnsemblGenomes-Tr; EBT00001719185.
DR   EnsemblGenomes-Tr; EBT00001719186.
DR   EnsemblGenomes-Tr; EBT00001719187.
DR   EnsemblGenomes-Tr; EBT00001719188.
DR   EnsemblGenomes-Tr; EBT00001719189.
DR   EnsemblGenomes-Tr; EBT00001719190.
DR   EnsemblGenomes-Tr; EBT00001719191.
DR   EnsemblGenomes-Tr; EBT00001719192.
DR   EnsemblGenomes-Tr; EBT00001719193.
DR   EnsemblGenomes-Tr; EBT00001719194.
DR   EnsemblGenomes-Tr; EBT00001719195.
DR   EnsemblGenomes-Tr; EBT00001719196.
DR   EnsemblGenomes-Tr; EBT00001719197.
DR   EnsemblGenomes-Tr; EBT00001719198.
DR   EnsemblGenomes-Tr; EBT00001719199.
DR   EnsemblGenomes-Tr; EBT00001719200.
DR   EnsemblGenomes-Tr; EBT00001719201.
DR   EnsemblGenomes-Tr; EBT00001719202.
DR   EnsemblGenomes-Tr; EBT00001719203.
DR   EnsemblGenomes-Tr; EBT00001719204.
DR   EnsemblGenomes-Tr; EBT00001719205.
DR   EnsemblGenomes-Tr; EBT00001719206.
DR   EnsemblGenomes-Tr; EBT00001719207.
DR   EnsemblGenomes-Tr; EBT00001719208.
DR   EnsemblGenomes-Tr; EBT00001719209.
DR   EnsemblGenomes-Tr; EBT00001719210.
DR   EnsemblGenomes-Tr; EBT00001719211.
DR   EnsemblGenomes-Tr; EBT00001719212.
DR   EnsemblGenomes-Tr; EBT00001719213.
DR   EnsemblGenomes-Tr; EBT00001719214.
DR   EnsemblGenomes-Tr; EBT00001719215.
DR   EnsemblGenomes-Tr; EBT00001719216.
DR   EnsemblGenomes-Tr; EBT00001719217.
DR   EnsemblGenomes-Tr; EBT00001719218.
DR   EnsemblGenomes-Tr; EBT00001719219.
DR   EnsemblGenomes-Tr; EBT00001719220.
DR   EnsemblGenomes-Tr; EBT00001719221.
DR   EnsemblGenomes-Tr; EBT00001719222.
DR   EnsemblGenomes-Tr; EBT00001719223.
DR   EnsemblGenomes-Tr; EBT00001719224.
DR   EnsemblGenomes-Tr; EBT00001719225.
DR   EnsemblGenomes-Tr; EBT00001719226.
DR   EnsemblGenomes-Tr; EBT00001719227.
DR   EnsemblGenomes-Tr; EBT00001719228.
DR   EnsemblGenomes-Tr; EBT00001719229.
DR   EnsemblGenomes-Tr; EBT00001719230.
DR   EnsemblGenomes-Tr; EBT00001719231.
DR   EnsemblGenomes-Tr; EBT00001719232.
DR   EnsemblGenomes-Tr; EBT00001719233.
DR   EnsemblGenomes-Tr; EBT00001719234.
DR   EnsemblGenomes-Tr; EBT00001719235.
DR   EnsemblGenomes-Tr; EBT00001719236.
DR   EnsemblGenomes-Tr; EBT00001719237.
DR   EnsemblGenomes-Tr; EBT00001719238.
DR   EnsemblGenomes-Tr; EBT00001719239.
DR   EnsemblGenomes-Tr; EBT00001719240.
DR   EnsemblGenomes-Tr; EBT00001719241.
DR   EnsemblGenomes-Tr; EBT00001719242.
DR   EnsemblGenomes-Tr; EBT00001719243.
DR   EnsemblGenomes-Tr; EBT00001719244.
DR   EnsemblGenomes-Tr; EBT00001719245.
DR   EnsemblGenomes-Tr; EBT00001719246.
DR   EnsemblGenomes-Tr; EBT00001719247.
DR   EnsemblGenomes-Tr; EBT00001719248.
DR   EnsemblGenomes-Tr; EBT00001719249.
DR   EnsemblGenomes-Tr; EBT00001719250.
DR   EnsemblGenomes-Tr; EBT00001719251.
DR   EnsemblGenomes-Tr; EBT00001719252.
DR   EnsemblGenomes-Tr; EBT00001719253.
DR   EnsemblGenomes-Tr; EBT00001719254.
DR   EnsemblGenomes-Tr; EBT00001719255.
DR   EnsemblGenomes-Tr; EBT00001719256.
DR   EnsemblGenomes-Tr; EBT00001719257.
DR   EnsemblGenomes-Tr; EBT00001719258.
DR   EnsemblGenomes-Tr; EBT00001719259.
DR   EnsemblGenomes-Tr; EBT00001719260.
DR   EnsemblGenomes-Tr; EBT00001719261.
DR   EnsemblGenomes-Tr; EBT00001719262.
DR   EnsemblGenomes-Tr; EBT00001719263.
DR   EnsemblGenomes-Tr; EBT00001719264.
DR   EnsemblGenomes-Tr; EBT00001719265.
DR   EnsemblGenomes-Tr; EBT00001719266.
DR   EnsemblGenomes-Tr; EBT00001719267.
DR   EnsemblGenomes-Tr; EBT00001719268.
DR   EnsemblGenomes-Tr; EBT00001719269.
DR   EnsemblGenomes-Tr; EBT00001719270.
DR   EnsemblGenomes-Tr; ML5_R0001-1.
DR   EnsemblGenomes-Tr; ML5_R0002-1.
DR   EnsemblGenomes-Tr; ML5_R0003-1.
DR   EnsemblGenomes-Tr; ML5_R0004-1.
DR   EnsemblGenomes-Tr; ML5_R0005-1.
DR   EnsemblGenomes-Tr; ML5_R0006-1.
DR   EnsemblGenomes-Tr; ML5_R0007-1.
DR   EnsemblGenomes-Tr; ML5_R0008-1.
DR   EnsemblGenomes-Tr; ML5_R0009-1.
DR   EnsemblGenomes-Tr; ML5_R0010-1.
DR   EnsemblGenomes-Tr; ML5_R0011-1.
DR   EnsemblGenomes-Tr; ML5_R0012-1.
DR   EnsemblGenomes-Tr; ML5_R0013-1.
DR   EnsemblGenomes-Tr; ML5_R0014-1.
DR   EnsemblGenomes-Tr; ML5_R0015-1.
DR   EnsemblGenomes-Tr; ML5_R0016-1.
DR   EnsemblGenomes-Tr; ML5_R0017-1.
DR   EnsemblGenomes-Tr; ML5_R0018-1.
DR   EnsemblGenomes-Tr; ML5_R0019-1.
DR   EnsemblGenomes-Tr; ML5_R0020-1.
DR   EnsemblGenomes-Tr; ML5_R0021-1.
DR   EnsemblGenomes-Tr; ML5_R0022-1.
DR   EnsemblGenomes-Tr; ML5_R0023-1.
DR   EnsemblGenomes-Tr; ML5_R0024-1.
DR   EnsemblGenomes-Tr; ML5_R0025-1.
DR   EnsemblGenomes-Tr; ML5_R0026-1.
DR   EnsemblGenomes-Tr; ML5_R0027-1.
DR   EnsemblGenomes-Tr; ML5_R0028-1.
DR   EnsemblGenomes-Tr; ML5_R0029-1.
DR   EnsemblGenomes-Tr; ML5_R0030-1.
DR   EnsemblGenomes-Tr; ML5_R0031-1.
DR   EnsemblGenomes-Tr; ML5_R0032-1.
DR   EnsemblGenomes-Tr; ML5_R0033-1.
DR   EnsemblGenomes-Tr; ML5_R0034-1.
DR   EnsemblGenomes-Tr; ML5_R0035-1.
DR   EnsemblGenomes-Tr; ML5_R0036-1.
DR   EnsemblGenomes-Tr; ML5_R0037-1.
DR   EnsemblGenomes-Tr; ML5_R0038-1.
DR   EnsemblGenomes-Tr; ML5_R0039-1.
DR   EnsemblGenomes-Tr; ML5_R0040-1.
DR   EnsemblGenomes-Tr; ML5_R0041-1.
DR   EnsemblGenomes-Tr; ML5_R0042-1.
DR   EnsemblGenomes-Tr; ML5_R0043-1.
DR   EnsemblGenomes-Tr; ML5_R0044-1.
DR   EnsemblGenomes-Tr; ML5_R0045-1.
DR   EnsemblGenomes-Tr; ML5_R0046-1.
DR   EnsemblGenomes-Tr; ML5_R0047-1.
DR   EnsemblGenomes-Tr; ML5_R0048-1.
DR   EnsemblGenomes-Tr; ML5_R0049-1.
DR   EnsemblGenomes-Tr; ML5_R0050-1.
DR   EnsemblGenomes-Tr; ML5_R0051-1.
DR   EnsemblGenomes-Tr; ML5_R0052-1.
DR   EnsemblGenomes-Tr; ML5_R0053-1.
DR   EnsemblGenomes-Tr; ML5_R0054-1.
DR   EnsemblGenomes-Tr; ML5_R0055-1.
DR   EnsemblGenomes-Tr; ML5_R0056-1.
DR   EnsemblGenomes-Tr; ML5_R0057-1.
DR   EnsemblGenomes-Tr; ML5_R0058-1.
DR   EnsemblGenomes-Tr; ML5_R0059-1.
DR   EnsemblGenomes-Tr; ML5_R0060-1.
DR   EnsemblGenomes-Tr; ML5_R0061-1.
DR   EnsemblGenomes-Tr; ML5_R0062-1.
DR   EnsemblGenomes-Tr; ML5_R0063-1.
DR   EnsemblGenomes-Tr; ML5_R0064-1.
DR   EnsemblGenomes-Tr; ML5_R0065-1.
DR   EuropePMC; PMC3370544; 22492446.
DR   EuropePMC; PMC3784783; 24072863.
DR   EuropePMC; PMC3811353; 23892741.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01382; HIV-1_SL4.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002399.
DR   SILVA-SSU; CP002399.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086087
CC   Source DNA and organism available from Ann M. Hirsch
CC   (ahirsch@ucla.edu)
CC   Contacts: Ann M. Hirsch (ahirsch@ucla.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Micromonospora sp L5
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Fresh water, Soil
CC   num_replicons       :: 1
CC   ref_biomaterial     :: Missing
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Aerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02096
CC   Greengenes ID       :: 110081
CC   Sporulation         :: Sporulating
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram+
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6962533
FT                   /organism="Micromonospora sp. L5"
FT                   /strain="L5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:648999"
FT   gene            314..2143
FT                   /locus_tag="ML5_0001"
FT   CDS_pept        314..2143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   saq:Sare_0001 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05555"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADU05555.1"
FT                   /translation="MTGATDLAAVWTATTDELADEIISAQQRAYLRLTRLRAIVEDTAL
FT                   LSVPDAFTRDVIESRLRPAITEALSRRLGRPIQVAVTVRVADDPGARPAGTVYRSGPEP
FT                   LPEHDAAAPLPGFDQPGPPASAFPSPRPEPGYTEAGYAEPRPEQPLDEPAPRQRTADGG
FT                   GRPHLIPAGRDAQDTLFSAAFAEPVRTAPERRAFDERTRIEPPVPDAGGYEPRYRESPP
FT                   ADPAPMRGLPRDGATDNGPGRGGADHHRPGGGQADRRLPGGTESGGNRLNPKYMFETFV
FT                   IGSSNRFAHAASVAVAESPAKAYNPLFIYGSSGLGKTHLLHAIGHYATTLGNARSVRYV
FT                   STEEFTNDFINSLRDDKTSAFQRRYRDVDILLIDDIQFLENRERTQEEFFHTFNTLHNA
FT                   NKQIVITSDRSPKQLATLEDRLRTRFEWGLLADIQPPDLETRIAILQKKAAQERLFAPP
FT                   DVLEFIASRVSNSIRELEGALIRVTAFASLTRSSVELSLAEEVLRDFIPDGAGPEITAD
FT                   QIMVSTADYFGVSLEDLRGHSRSRVLVNARQVAMYLCRELTDLSLPRIGQAFGGRDHTT
FT                   VMHADRKIRQQMAERRSLYNQIAELTNRIKQNT"
FT   gene            3200..4333
FT                   /locus_tag="ML5_0002"
FT   CDS_pept        3200..4333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: stp:Strop_0003 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05556"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADU05556.1"
FT                   /translation="MKFRVERDALAEAVAWTAKSLPNRPSVPVLAGVMLRVTDGNLQVS
FT                   GFDYEVSSQVTVEVQGDADGAALVSGRLLAEITKALPAKPVDIAAVGAHLELVCGSARF
FT                   TLPTMPVEDYPTLPEMPESAGTVDAAAFASAVAQVAVAAGRDETLPMMTGVRIELSGST
FT                   MAMLATDRYRLALREMEWNPDDPEISLNALVPARTLHDTAKALGPLGGHVTMALSSGGA
FT                   GEGMIGFSGGTRRTTSRLLDGANYPPVRSLFPADHNAEARVAVAALIEVVKRVALVAER
FT                   TTPVLLSFSADGLVVEAGGTEEARASEAMEATFSGEPLTIGFNPQYLIDGLANLGAQHA
FT                   LLRFVDAFKPAVISPAGEDGEVIPGYRYLIMPIRVSR"
FT   gene            4374..5246
FT                   /locus_tag="ML5_0003"
FT   CDS_pept        4374..5246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="KEGG: stp:Strop_0004 6-phosphogluconate
FT                   dehydrogenase-like protein; TIGRFAM: 6-phosphogluconate
FT                   dehydrogenase, decarboxylating; PFAM: 6-phosphogluconate
FT                   dehydrogenase NAD-binding; 6-phosphogluconate dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05557"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ADU05557.1"
FT                   /translation="MQLGLVGLGRMGGNMRERLRAAGHEVVGYDHNPEISDAASLAELA
FT                   EKLQSPRAVWVMVPAGVTDATIDELADVLGEGDIIIDGGNSRFSDDAPRAERLNEQGIG
FT                   YIDVGVSGGVWGRQNGYALMVGGAQEHVERLMPIFESLKPEGEFGFVHAGPVGAGHYAK
FT                   MVHNGIEYGLMHAYAEGYELLAASELVTNVPGVFKSWREGTVVRSWLLDLLDRALDEDP
FT                   ELAELSGYTEDTGEGRWTVDEAVRLAVPLNVITASLFARFASRQDDSPAMKAVAALRQQ
FT                   FGGHAVHKR"
FT   gene            5263..6393
FT                   /locus_tag="ML5_0004"
FT   CDS_pept        5263..6393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: saq:Sare_0004 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05558"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADU05558.1"
FT                   /translation="MYVRRLELVDFRSYERVGVDLEPGPNVLVGANGVGKTNLVEALGY
FT                   VATLDSHRVATDAPLVRMGAASAVIRCAVVHEGRELLVELEIVPGKANRARLGRSPARR
FT                   ARDVLGALRLVLFAPEDLELVRGDPAERRRYLDDLLVTRQPRYAGVRADYERVVKQRNA
FT                   LLRTSYLARKTGGTRGGDLSTLAVWDAHLAQHGADLLAGRLELVAALTPHVAKAYDAVA
FT                   AGRGAAGIAYRPSVELPEPGADRAALAEALAAALTANRAAEIERGTTLVGPHRDDLALT
FT                   LGPLPAKGYASHGESWSYALALRLAGYDLLRADGIEPVLVLDDVFAELDTGRRERLAEL
FT                   VGGASQLLVTCAVDDDVPATLRGTRYAVGEGTVRRA"
FT   gene            6386..6991
FT                   /locus_tag="ML5_0005"
FT   CDS_pept        6386..6991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   saq:Sare_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05559"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADU05559.1"
FT                   /translation="MPDDEVQLPPARLGPGRDARTPGKPADGEPAAKLPEGTAGPELAR
FT                   AVLDAAKARRQAAAPRRRGAVRGDGEKRLRGYSGPGPDPRDPQPLGAVLDKLMKARGWQ
FT                   QPAAEATVFGAWEKVVGPEVAQHSRPVKLEDGELTVEARSTAWATQLRLLAGSLLQQIA
FT                   REVGHNVVRKLHIHGPAAPSWSRGPRRVRGRGPRDTYG"
FT   gene            complement(6982..7221)
FT                   /locus_tag="ML5_0006"
FT   CDS_pept        complement(6982..7221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ago:AGOS_ADL028W ADL028Wp"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05560"
FT                   /inference="similar to AA sequence:KEGG:AGOS_ADL028W"
FT                   /protein_id="ADU05560.1"
FT                   /translation="MSDDEQVGDASGKGGRLLGWVFRNLAGPSQVQGAVQGGSKLARDA
FT                   WKEDLERRKQWSREQRELKRARREARRSGGVGQP"
FT   gene            7303..7791
FT                   /locus_tag="ML5_0007"
FT   CDS_pept        7303..7791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0007"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: gob:Gobs_2803 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05561"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU05561.1"
FT                   /translation="MTDGIEEDPLALEQQVCFALSVAARSVVAVYRPLLEPMGLTHPQY
FT                   LVMLALWQHAPLSGRDLSRLLQLDPGTLSPLLKRLEAAGYIRRERDAADERSLAVSLTA
FT                   EGQALRAQAERIPPAIVQRLGLPLADLRHLHTALTEVIAAANQATSSSGAAAPGQASA"
FT   gene            complement(7776..8330)
FT                   /locus_tag="ML5_0008"
FT   CDS_pept        complement(7776..8330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05562"
FT                   /inference="similar to AA sequence:KEGG:Strop_0007"
FT                   /protein_id="ADU05562.1"
FT                   /translation="MGLDNVAVHWPRTGRFYDPVAPAEFVDFGEIVDMPRISAPTAALA
FT                   ELIAKTGTVRATAYTELVDLILGLENVLYATENAVEDEDPVIDPDGCSWIAEGVEKFVA
FT                   RHRPYGEPVTFESVSEVLRALLGDGRLAEQQLRWLDSRLDRLRDESGDPPQWNFTCAEL
FT                   SVLAAFYRRCAERGFAVYADA"
FT   gene            8878..10824
FT                   /locus_tag="ML5_0009"
FT   CDS_pept        8878..10824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0009"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: stp:Strop_0008 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05563"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADU05563.1"
FT                   /translation="MAAEDNKKYGAESITVLEGLEAVRKRPGMYIGSTGERGLHHLVWE
FT                   VVDNAVDEALAGHCDTIDVVLLADGGVRVTDNGRGFPVDLHPKLKKPGVEVALTVLHAG
FT                   GKFDGKAYAVSGGLHGVGVSVVNALSTRMAVEIHKDGFVWRQQYHHSKPTPLEKGEATD
FT                   RTGSAVSFWPDPDVFETVDFDFHTIYRRLQEMAFLTRGLTIHLLDERVPEDEDGKTREV
FT                   TFHYEGGIADFVRHLNASKSPIHKTVVEFGAEETGMSVEIAMQWNESYGESVYTFANNI
FT                   NTHEGGTHEEGFRAALTSVVNRYGAEKKLLKGDERLSGEDIREGLAAIISVKLTDPQFE
FT                   GQTKTKLGNTPVKGFVQRVCNESLVDWFDRNPAEAKIIIQKASQAARARIAAQQARKLA
FT                   RRKSLLESGSMPGKLADCQSTDPRESEVFIVEGDSAGGSAKQGRDPRTQAILPIRGKIL
FT                   NVEKARIDRVLKNNEVQALITALGTGIHDDFDIEKLRYHKIVLMADADVDGQHIQTLLL
FT                   TLLFRFMRPLVELGHVYLAAPPLYKIKWNKKGDDAQYAYSDRERDGLIALRQQKKPNAR
FT                   PDDIQRFKGLGEMNYPELWETTMNPATRTLRQVTLDDAATADELFSVLMGEDVEARRSF
FT                   IQRNAKDVRFLDI"
FT   gene            10955..13474
FT                   /locus_tag="ML5_0010"
FT   CDS_pept        10955..13474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0010"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: stp:Strop_0009 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05564"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADU05564.1"
FT                   /translation="MTDTPESTPNEPETPEPLAAVVQHDRIEPVGLEVEMQRSYLDYAM
FT                   SVIVGRALPDVRDGLKPVHRKILYAMFDSGYRPDRGYVKCSRVVGDVMGQFHPHGDSAI
FT                   YDALVRMAQPWSLRYPLVDGNGNFGSPGNDPAAAMRYTECKLDPLAMEMLRDIDEDTVD
FT                   LQDNYDGRAKEPTILPSRIPNLLINGSEGIAVGMATKIPPHNLREIGAAVQWCLEHPEA
FT                   DEATTLEALLEIVKGPDFPTHGLIVGQAGIQDAYRTGRGSIRMRAVVEVEEDKRGRPAL
FT                   VVSELPYQVNPDNLAERIAELIKEGKLAGIADIRDESSGRTGMRIVLVLKRDAVAKVVL
FT                   NNLYKHTQLQETFGANMLALVDGVPRTLNLAQFIRYYVEHQIEVIRRRTAFRLRKAEER
FT                   AHILRGLSKALDALDEVIALIRRSPTVEDARQGLIRLLDIDEVQATAILDMQLRRLAAL
FT                   ERQRILDDLAKLEVEIADLKDILAKPERQRRIVSEELGEIVAKWGDDRRTKIVPFDGEV
FT                   SMEDLIAREDVVVTITRTGYAKRTKVDLYRSQRRGGKGVSGATLRQDDIVSHFFVCSTH
FT                   DWILFFTNKGRVYRAKAYELPEASRVAKGQHVANLLAFQPDEQIAQIIEIPNYQVAPYL
FT                   VLATKNGLVKKTRLEEFDSNRSGGIIAINLRDEDELVGAVLVAPEDDLLLVSKNAQAIR
FT                   FNATDEALRPMGRATSGVIGMRFSGEDELLAVEVVREGLDVLVATNGGYAKRTPIEEYP
FT                   VQGRGGKGVLTAKITERRGGLVGAVVIDPEDELFAITSNGGVIRTPVKPVRRTRDRNTM
FT                   GVKLMDLPDGVTIVAIARNADEPDEQD"
FT   gene            13478..14404
FT                   /locus_tag="ML5_0011"
FT   CDS_pept        13478..14404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0011"
FT                   /product="Protein of unknown function DUF3566,
FT                   transmembrane"
FT                   /note="PFAM: Protein of unknown function DUF3566.
FT                   transmembrane; KEGG: stp:Strop_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05565"
FT                   /inference="protein motif:PFAM:PF12089"
FT                   /protein_id="ADU05565.1"
FT                   /translation="MTETQAKSGNKGTSATPVEEEAAQGGTPATGRAAVGRATVPADAP
FT                   APKFTRAPGMAPPPDKPAEDSGSRDSAETKVDAPTSADGLAAPAAKPANATSTQPIKTP
FT                   SAAGRASTGTTGTQPRIGAGLGTAPKTSPDGSRPSGAASAQARPANGGGLPPGISGAAA
FT                   VGAARVGEAVRAARTSVSSAASRGPRRARLNLKRIDPWSVMKFAFAVSVVLFIVVVVAT
FT                   SVLYLALDAMGVFKSVNDSLTDLVNAGGGQGGGGFRITAKGVILTSALIGLVNVVLFTA
FT                   LATLSAFVYNVCADLVGGIELTLAERD"
FT   gene            14549..14625
FT                   /locus_tag="ML5_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            14549..14625
FT                   /locus_tag="ML5_R0001"
FT                   /product="tRNA-Ile"
FT   gene            14666..14794
FT                   /locus_tag="ML5_0012"
FT   CDS_pept        14666..14794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05566"
FT                   /inference="similar to AA sequence:KEGG:Strop_0012"
FT                   /protein_id="ADU05566.1"
FT                   /translation="MFKKLLILAGIVGVAAVVAKKVKASNDERALWHEATTAPDLR"
FT   sig_peptide     14666..14725
FT                   /locus_tag="ML5_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.845 at
FT                   residue 20"
FT   gene            14805..14880
FT                   /locus_tag="ML5_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            14805..14880
FT                   /locus_tag="ML5_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(15133..16164)
FT                   /locus_tag="ML5_0013"
FT   CDS_pept        complement(15133..16164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0013"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: sro:Sros_7788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05567"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU05567.1"
FT                   /translation="MRRNLPPTVGRGTLYILLAAIAWGTGGAAAAVLYDTSGLGPVAVS
FT                   FWRFAGGVLLLAAGHLTRRRPSSRIRVVSTRPRHRWRQVVTTGVGLAVYQTAYFAAVGY
FT                   AGLAVATMVTLGAGPVLIALGSRLALGERLGRSGGVTVVTALVGLVLLLGGGSAGSAPA
FT                   PLLGLACALLSAAGYAAVTLLNRKLGRDGGWHTPLLGGFAVGMICLLPLALLEGILPTA
FT                   GDIRQTVGLLAFLAVGPTAVAYTLFFAGLASVRATTASVIALVEPVTAALIAVLLLDER
FT                   LTVTAVLGSIVLLAAVVTLMLGEPGPAPSSTAALRDRDADMRNRRRPRRARAGGGVATR
FT                   RPG"
FT   sig_peptide     complement(16072..16164)
FT                   /locus_tag="ML5_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.878 at
FT                   residue 31"
FT   gene            complement(16287..16853)
FT                   /locus_tag="ML5_0014"
FT   CDS_pept        complement(16287..16853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0014"
FT                   /product="ATP-binding protein"
FT                   /note="KEGG: ccs:CCNA_00911 ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05568"
FT                   /inference="similar to AA sequence:KEGG:CCNA_00911"
FT                   /protein_id="ADU05568.1"
FT                   /translation="MPGFILTGAPGSGKTAILRHLEVDGHPVVEEAATDVIALHQALGR
FT                   PEPWREPDFAERVLALQRRRRRRAEAHAGEIVFHDRSPVCTLALCRHLGSTPPSALLDE
FT                   VERLTTERRHYERTVFFVRNQGFVEATAARRISFEESLVFERVHELTYRDAGFDLVEVP
FT                   AGPLATRVAAIKQAVDRLRAARVRT"
FT   gene            16905..17210
FT                   /locus_tag="ML5_0015"
FT   CDS_pept        16905..17210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0015"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: mjl:Mjls_5643 ArsR family transcriptional
FT                   regulator; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05569"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADU05569.1"
FT                   /translation="MVGDVGDLYQALADPTRRLILDELTERDGQTLFEICGRLATKHQV
FT                   GSSRQAISQHLDVLEAAGLIVTRRQGRYKFHHLDTRPLRSITERWLRSDAPTQENP"
FT   gene            17207..17593
FT                   /locus_tag="ML5_0016"
FT   CDS_pept        17207..17593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0016"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: msm:MSMEG_5678
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05570"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADU05570.1"
FT                   /translation="MRINLTSVYVDDQDKALRFYTEVLGFVKKTDVPTGEYRWLTVVSP
FT                   DAPDGVELLLEPDAHPAAKAFKEALAGDGIPLTQFAVDDVAAEHDRLRGLGVLFTQEPV
FT                   DMGPVTTAVFDDTCGNLIQIAQYR"
FT   gene            17604..18152
FT                   /locus_tag="ML5_0017"
FT   CDS_pept        17604..18152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_3153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05571"
FT                   /inference="similar to AA sequence:KEGG:Kfla_3153"
FT                   /protein_id="ADU05571.1"
FT                   /translation="MAGPWRSPALAVAVACLEDEIRDAWARLRGELDVAPGSPEESELA
FT                   WLVVDDPGAYDWRTVDGAVDRLTCPDCGARLTAGPATCETCEFRHRMRFGARERDRPHV
FT                   PPGNEHALRVATAVTRSRHRYSPRARVGYELVLPDLLAGALPTTPQAQAAKALVNTLTD
FT                   DECDRVVSLAEVVELARGR"
FT   gene            18195..18884
FT                   /locus_tag="ML5_0018"
FT   CDS_pept        18195..18884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_2519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05572"
FT                   /inference="similar to AA sequence:KEGG:SAV_2519"
FT                   /protein_id="ADU05572.1"
FT                   /translation="MTVWRRPYSLDLTTSGFMVVAVLAVGFFVLLVFEVRSGRMPGRDA
FT                   VFLGVWNAAGLAVAVRRAMLGVWVSPVGVRSRSLLRTTTVPWASVAEIHSGTGSIVGLD
FT                   VGRDAIVIERIDGEPVQTPIQSGAVVRPFRLELTRLVTWPEHYDEILVNLRECHRNARP
FT                   PEQRAAASPAPDPVRTDRPDPPGQIRRLAPSAAQRRDIHALTRQHERGVLTDAEYAAAL
FT                   ARLRGDE"
FT   gene            complement(18888..19478)
FT                   /locus_tag="ML5_0019"
FT   CDS_pept        complement(18888..19478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0019"
FT                   /product="dienelactone hydrolase"
FT                   /note="KEGG: nca:Noca_3343 dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05573"
FT                   /inference="similar to AA sequence:KEGG:Noca_3343"
FT                   /protein_id="ADU05573.1"
FT                   /translation="MAEIVLFHHIQGLTDGVRALAGSLRSGGHTVHVPDLFDGERPATI
FT                   SDGAALIKRIGGDVLDQRADALVAGLPAGLVYAGVSWGAAIAQRLAQTRAGARAALLYE
FT                   ACLPVTGEWAIGPWPDGVAVQVHGMERDPFFGLEGDVDAARELVSIVGPERGELYVYPG
FT                   DRHLFTDSSLPSYDAEATALVVSRSRELLDRLG"
FT   gene            19544..20134
FT                   /locus_tag="ML5_0020"
FT   CDS_pept        19544..20134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0020"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: bcv:Bcav_3725 transcriptional regulator, ArsR
FT                   family; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05574"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADU05574.1"
FT                   /translation="MSVNERIPDYDLDDLLVVTAPEQLRALADPLRSTLLELLLERAAT
FT                   VNEMARAVDRPKSSVAYHVNQLVDAGLLRVVRTRRVRAIEERFYGRVARTYYVGALSRA
FT                   EDKQVVSRINGLAEAAAESAAAHAADELRCTLVHARIPIEDVREFWAEVQALARRFAQI
FT                   PRAGDQVYGFAAGLYPTDAPTLPDTEPATDPRD"
FT   gene            20200..21171
FT                   /locus_tag="ML5_0021"
FT   CDS_pept        20200..21171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0021"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="KEGG: stp:Strop_0016 SUA5/YciO/YrdC/YwlC family
FT                   protein; TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05575"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ADU05575.1"
FT                   /translation="MSIGSPRVLPAERGIDEAAAVLRAGGLVAFPTETVYGLGANALDA
FT                   RAAARIFEAKARPSFDPLISHLADAADLAALVGEVPAAVAELAKRFWPGPLTLIVDRPE
FT                   IIPPIVTSGLDTMAVRVPDESSARALIAAAGVPVAAPSANRFGQLSPTRAEHVVAGLGG
FT                   AVDVVLDGGPTRCGIESTIVDARGERPVVLRLGALPVEALVEAVGPVEVRQGSSGQPVA
FT                   PGTLAAHYAPRTPLRLGAAAEPGGGRRGFLAFREPPADGDWAAVEVLSPDGDVTAAAAR
FT                   LFDALHRLDAAGVTEIVAEPVPETGVGRAINDRLRRAAATWR"
FT   gene            complement(21168..25667)
FT                   /locus_tag="ML5_0022"
FT   CDS_pept        complement(21168..25667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0022"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="KEGG: saq:Sare_0021 ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC; TIGRFAM: ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; cation transporting
FT                   ATPase domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05576"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ADU05576.1"
FT                   /translation="MTSLGRFAGLLLSPTVVPETAARVARTVGSALPTDAVPARVSEVA
FT                   GSVGTAAARLARLTGLTSRRVWSQDGRHHIEVHGVCQDGGDRLARQVEAALESMPGVAW
FT                   ARVNAPSGRVVVATGDPAPKLRDLIATVARVEQTCPYEPDPEIEPPQPPEDGPRTARTF
FT                   GALLSDVLGLSISAATRVLPLTPIPAEVAGLLGAVDLHPKLHALAGLGIRADPRAEVLF
FT                   PLAEAVVQGLTGGWAGIVLDGAQRVVQWGEGAAQLNAWRRAEPHLTGDPERAVARVPDG
FT                   ERPCPVPDGQPERYAKRVLPAGAVAGAAALPVLGPKRAAALALSSLPKAPGSGREGYGA
FT                   QLGRMLARRGVIAMDRSVLRELDRIDTVVLDAAVLGSDRGVLADLAPLADADTGQVAAR
FT                   AFALFDPAEPDAVRAAEGWRIGPLDRLGADDPGDTPDSARLRADGGRLLGLAENGRLAA
FT                   VLRVEPEPAPGVDALASAARQAGLRLVVGGADDGRYDFADLLVPGGARLADAVHDLQRE
FT                   GAVVMVVSGERSALAASDCGLGVYGPDDLPPWGAHLLVGDDLRVPALLVDAVGVARRMT
FT                   EQNVRISMAGSGLGALAAFTADRRRLPRPTLAAVNGAAALAFAHGVFRAHRLPDRTGAP
FT                   MPALTAWHLMPAQTVLDQLATDPSGLAEDEAARRRRVEVGDEHGPAGLLRAFVEELSNP
FT                   LTPVLAAGAVLSAAFGSLVDAALVGGVVGGSALVGAVHQRNTERSLAELLSRSAVTARV
FT                   LRDGAERVVPAEELVRGDVITVSSGDAVPADCRVLTSDGLEADESSLTGESLPVAKSPE
FT                   PVVAAAIAERHSMLFEGTTVAAGHGTAVVVATGAETEAGRSLAMARQAPPASGVEARLG
FT                   RLTSSAVPLAAASAIAVAGAGLLRGVPLAETAATAANLAVASVPEGLPFLVSAAQLAAA
FT                   RRLAEHGALVRNPRTIEALGRVDVLCFDKTGTLTEGKLLLAGVGTGDGRYGVLDELDEP
FT                   LRSTLAAAVRATPAAADPDELPQQTDRAVRHGADAAGVTEQTGAAEWTATAGMPFEPSR
FT                   GYSATVGRAADGLLLSVKGAPESVLPRCASRRTAEGDRPLDAAGREEVQAMLAGRAGAG
FT                   HRILAVAECQVSIEQVSDEQVDGLVFVGFLTLADGVRESARPAVARIRAAGVHTVMITG
FT                   DHPATAEAIAAKISPDDGGQRVVTATDLDRLDDAALAERLMATDVVARCTPAHKVRIIQ
FT                   ALQRQDRTVAMTGDGANDAPAIRLADVGIALGQRGTPAARAAADLVVTDDRLETIIATL
FT                   VEGRAMWSSVRHALSILVGGNLGEIAFSVLTAAATGRSALTGRQLLLVNLLTDLAPALA
FT                   IAVRPPADDSADHLLREGPDSSLGVTMTREIGLRAASTTLGATAGWTIARWTGTQRRAS
FT                   TVALASLIGTQLGQTVLAGGTSPSVLAATAASVGVLVAVVQTPGVSQFFGCTPLGPVGW
FT                   TIATGSALGATFANGALTKLVDRLPQPGSHRRPDADQS"
FT   gene            25879..27255
FT                   /locus_tag="ML5_0023"
FT   CDS_pept        25879..27255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0023"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   kfl:Kfla_6909 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05577"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU05577.1"
FT                   /translation="MTSTTAVPADPPVDLWSPRLRAMTVGSVALVSLLAFEALAVGTAM
FT                   PTVARSLDGLGLYALAFGGSFASGVVAMVASGIWCDARGPRPAMWHGVVWFVAGLVVAG
FT                   AATTMEVLVVGRVVQGFGSGLVSVALYVVVGQAYPEQLRRRIFAAFAAAWVVPSLVGPA
FT                   LAGLIVEHLGWRWVFLAVPAVAIPAALLVQPGLRALTATVATRPPAGALARIGWACGAG
FT                   ASAALLHYGGQQRGVLAAALIAGALAGLFVCVPHLLPAGFLRAARGLPTVIGLRALASA
FT                   AFVAAEVVIPLMLSRERGFSPTGAGLVLTVGALSWSVGSWIQGRIRSPRSAATLPRAGL
FT                   ACITIGTAGVASALVPGLPVLPAVLSWSVAGLGMGLLYPSLSVLTLEQSAPAEQGRNSS
FT                   ALQLGDSLAAATVLALTGAVLAAGASPGPAGFATTLAVAATCGLLGLLLAGRVVLRPTP
FT                   "
FT   gene            27502..28281
FT                   /locus_tag="ML5_0024"
FT   CDS_pept        27502..28281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_2006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05578"
FT                   /inference="similar to AA sequence:KEGG:SACE_2006"
FT                   /protein_id="ADU05578.1"
FT                   /translation="MRVLVTGATGRLGRVAVPRLRDEGFTLRAMSRGPRTGDGVEWVTA
FT                   DLATGAGLAEAVAGVDAVLHLASSPQRRTHDIDVLGTRRLAVAAGHAGVRHLVFVSIVG
FT                   VDRVPLGYYRHKLAAEQVVAAGPVPWSVLRATQFPEFLEGLLSGASRLGPVIGDRAVLA
FT                   QPVDPGEVADRLAVLLLAGPSNRVEDFGGPEVLRYDDAARAWLAARRVRRPLLPVRIPG
FT                   RLGRELRAGGLTTTATPTGTRTWADHLADTYGGTAGR"
FT   gene            28318..28515
FT                   /locus_tag="ML5_0025"
FT   CDS_pept        28318..28515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05579"
FT                   /inference="similar to AA sequence:KEGG:Sare_0023"
FT                   /protein_id="ADU05579.1"
FT                   /translation="MLVFVATVVLYVFGFVFLYGVIRVGVRHGIEDAEANRPEVLRRRQ
FT                   LTTTESRDFAQENAFLTNPN"
FT   gene            28575..29123
FT                   /locus_tag="ML5_0026"
FT   CDS_pept        28575..29123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0026"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: tfu:Tfu_0591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05580"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ADU05580.1"
FT                   /translation="MGTLKTEPARTRLDLLAPPVAAALQDWPAEAPVDVDDVLVAPIDA
FT                   DLADTAAFCEAYGVGLEESANCVVVAGKRGGETRYAACVVLATTRADVNGVVRKLLDVR
FT                   KASFAPMAEAVESSGMEYGGITPIGLPADWPILVDSRVIATPHVIIGSGVRHSKIALPG
FT                   PALGALPGARVVEDLARPA"
FT   gene            complement(29160..29792)
FT                   /locus_tag="ML5_0027"
FT   CDS_pept        complement(29160..29792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0027"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: saq:Sare_0024 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05581"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADU05581.1"
FT                   /translation="MDIEIYADVVCPWCWIGKRRLEQALESYDGEVNVRFRPFQLDPTP
FT                   VTEPKPLLEALGDKFGGRDKAEGMAAHVTGVAAGAGLDLRFDRAVAANTFDAHRLVRFA
FT                   TEHGRSAEMVERLYRAHFHDGIDVGSIDALVTLAGEAGLDETEARQYLESNLGRREVAA
FT                   DLSTAHQLGVSSVPTFVLAGKYAVTGAQEPETLLAALREVAQREAAA"
FT   gene            complement(29813..30238)
FT                   /locus_tag="ML5_0028"
FT   CDS_pept        complement(29813..30238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0028"
FT                   /product="Fe-S metabolism associated SufE"
FT                   /note="PFAM: Fe-S metabolism associated SufE; KEGG:
FT                   saq:Sare_0025 Fe-S metabolism associated SufE"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05582"
FT                   /inference="protein motif:PFAM:PF02657"
FT                   /protein_id="ADU05582.1"
FT                   /translation="MPEMPTKLAEIVDEFAAAPRDVVLEMLLEFADVIPPLPEGVNREE
FT                   LEQVPECQTAFFLRAEVNADKTVSTVFDCPPEAPTTRAFAGILAEGLAGASAEEVLAVP
FT                   DDLYQRMGLAQAISPLRVRGGTAILARLKRQVREQIS"
FT   gene            complement(30317..30736)
FT                   /locus_tag="ML5_0029"
FT   CDS_pept        complement(30317..30736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0029"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="KEGG: stp:Strop_0022 signal-transduction protein;
FT                   PFAM: CBS domain containing protein; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05583"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADU05583.1"
FT                   /translation="MFRVSDVMTRQVVYLSAETPLDEAARVMKESDIGDVVVTDGATLA
FT                   GMLTDRDIVVRAVAERADPGTTTIGSIITREVVMIEQHCTANEAAALMRERNIRRVLVC
FT                   DSDRKLVGIVSLGDLAMQLDPHSALSDISEAAPNV"
FT   gene            complement(30791..32560)
FT                   /locus_tag="ML5_0030"
FT   CDS_pept        complement(30791..32560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0030"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="KEGG: saq:Sare_3553 prolyl-tRNA synthetase; TIGRFAM:
FT                   prolyl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); YbaK/prolyl-tRNA synthetase associated region;
FT                   Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05584"
FT                   /inference="protein motif:TFAM:TIGR00409"
FT                   /protein_id="ADU05584.1"
FT                   /translation="MLLRMSTLLLRTLREDPADAEVPSHRLLLRAGYVRRAAPGGYTWL
FT                   PLGKLVLDRITAIVRDEMTGIGDQEVHFPALLPAEPYRTSGRWTEYGDDIFTLADRKGA
FT                   EHLLAPTHEELAALLVKDLFTSYRDFPVTLFQIQTKFRDEARPRAGLLRGREFLMKDAY
FT                   SFDLDEAGLQAAYDRHRAAYERVFTRLGLDFTTVHAMSGAMGGSASEEFLAATPVGEDT
FT                   FVGCTACDYAANTEAVVTRAPAAGDPDAYPPAEVHDTPETPTIAALVELAEARELGGRT
FT                   GWTAADTLKNVVLTVRRAGAEQGEPLVIGLPGDREVDLKRVEAVLAPATVAVFEDWDAH
FT                   PELVRGYIGPQILAKHGIRYLVDPRVVPGTSWLTGANEPGRHATDVVCGRDFVPDGTIE
FT                   AAEVRPGDSCPACADGELTIRRGIEIGHIFQLGRRYTDAFAVDVLGPEGKPVRPTMGCY
FT                   GIGVSRAVAAVAEQHHDDRGLVWPAAVAPCDVHLIAAGKGPQLDAALDLGGRLAAAGLR
FT                   VLVDDRTHVSAGVKFTDAELIGIPRAVVVGRRLAEGYVELRDRATGERTELPVEAIVER
FT                   LRDEAGATRRDGV"
FT   gene            32735..33109
FT                   /locus_tag="ML5_0031"
FT   CDS_pept        32735..33109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05585"
FT                   /inference="similar to AA sequence:KEGG:SGR_3077"
FT                   /protein_id="ADU05585.1"
FT                   /translation="MAERPLMKLTTTVLDAPSAEDLAAFYERLLGWSRREDESDWVVLA
FT                   PPDGGTWLAFQDEPAYVRPVWPAGPGDPPMMTHLDIKVDDLEAASAYAVSVGATLADFQ
FT                   PQDDVRVHLDPAGHPFCLYL"
FT   gene            complement(33134..33898)
FT                   /locus_tag="ML5_0032"
FT   CDS_pept        complement(33134..33898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0032"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bcv:Bcav_1034
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05586"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADU05586.1"
FT                   /translation="MTIHVLSDTGTLTGRSLRHILRSPDTIITTAVTPVALMLLFVYVL
FT                   GGAINTGSGESYINYMLPGILLITIASGIAYTAYRLFLDMQGGIFERFQSMPIPRPSVL
FT                   WAHVLTSLVANLASLVIVTGVALIMGFRTGASVVGWLAAAGILILFTLALTWVAVIAGL
FT                   SAKTVDGASAFSYPLIFLPFISSAFVPTDSMPGPVAWFADNQPVTSIVNTLRALFAQQP
FT                   VGNDVWIALAWCAGLLLAAYAAATAIYRTKVS"
FT   gene            complement(33895..34707)
FT                   /locus_tag="ML5_0033"
FT   CDS_pept        complement(33895..34707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0033"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bcv:Bcav_1033 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05587"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU05587.1"
FT                   /translation="MTTATREPAIRVRGITKSYKDLHVLRGVDFEVTAGSIFALLGSNG
FT                   AGKTTLVRILSTLLKADTGTATVHGFDVASVPAEVRKSISLTGQFAAVDEVLTGRENLV
FT                   LVAKLRHLRNPGAVADDMLARFSLTDAANRRAGTYSGGMRRRLDIAMSLVGNPPVVFLD
FT                   EPTTGLDPQARIEVWRTVRQLAEDGTTILLTTQYLDEAEQLADRIAILHEGTIIQNGTL
FT                   AELKRLLPTAKVEYVEKQPTLEDVFLALVGHTARAADKAAVPAGEESR"
FT   gene            complement(34704..35081)
FT                   /locus_tag="ML5_0034"
FT   CDS_pept        complement(34704..35081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0034"
FT                   /product="Uncharacterized conserved protein UCP029876"
FT                   /note="PFAM: Uncharacterised conserved protein UCP029876;
FT                   KEGG: aau:AAur_3849 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05588"
FT                   /inference="protein motif:PFAM:PF06304"
FT                   /protein_id="ADU05588.1"
FT                   /translation="MAAKWIETLVGSLDQKKQYKRHMARMEALPEPHRSAAKALQRYFM
FT                   YQGGIVDGNTLVAMLGDSVDLWERAVADNTPVRAIVGDDPVEFAETFVSAYSGRQWMDK
FT                   ERERLRKAIDAAAGNSGEEHS"
FT   gene            complement(35084..35431)
FT                   /locus_tag="ML5_0035"
FT   CDS_pept        complement(35084..35431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0035"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: bcv:Bcav_1031 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05589"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADU05589.1"
FT                   /translation="MANQMTEMLKGTLEGIVLAILARRSAYGYEITAWLRDRGFSDIAE
FT                   GTIYALLVRVEQRGFVDVEKVPSEKGPPRKVYSINAKGRDQLAEFWRTWSVLAERIDHL
FT                   RDNDDRHDEGA"
FT   gene            35552..36319
FT                   /locus_tag="ML5_0036"
FT   CDS_pept        35552..36319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0036"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: kfl:Kfla_2348
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05590"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADU05590.1"
FT                   /translation="MTTTPSARAVSQYATTTGNLTARIALHSYGTNPQGWFAWLGERLP
FT                   LTGDVLEVGAGTGELWRRVGRRGRLTLTDFSPAMCARLREVPGARVLRCDATYLPFRAG
FT                   VADAVIANSMLYHLDDPDAALREFARVLRPGGRLAVAVNGRDHLAELNTLGPVIGRPDL
FT                   AVRFHDRNDVTAEATPARVAAHFDDVTVERYPDELVVPAAEPILAYVASMIGPLTAAQE
FT                   AAARAAIQARIDAEGAFRVRKHTVLISAARGSR"
FT   gene            complement(36294..36485)
FT                   /locus_tag="ML5_0037"
FT   CDS_pept        complement(36294..36485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0037"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   saq:Sare_2601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05591"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ADU05591.1"
FT                   /translation="MELIGAVWRKSTRSGQSECVEVADNLAGVVGVRDSKDPAGPVLTF
FT                   TPDAWRAFVRVSGSRAPR"
FT   gene            complement(36476..37279)
FT                   /locus_tag="ML5_0038"
FT   CDS_pept        complement(36476..37279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0038"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   saq:Sare_0926 helix-turn-helix domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05592"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADU05592.1"
FT                   /translation="MENEPTAELIRAQLRRLRLRAELSQEEFGRLVHFSGSQVSAVELG
FT                   HRPLDRFFLARADEVLGTGGLLMSLLKLAERDGQPSWFRPWLEAERQAQQLRCYQPSLI
FT                   PGLLQTENYARAMIRTDDMLADQEAERRLAVRLDRQAVLAGADPPKFVAVIEETVLRRA
FT                   DESFRGLMSQQVAHLIEASSHPHVAVHVIPADAGLHIGLTGPFTLARGGDGGWIGYLEN
FT                   QLGGTVIYKDEDVAILLSRWESVRSEALSRRQSIELMKEVVESWS"
FT   gene            37375..37710
FT                   /locus_tag="ML5_0039"
FT   CDS_pept        37375..37710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0039"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05593"
FT                   /inference="similar to AA sequence:KEGG:Strop_0101"
FT                   /protein_id="ADU05593.1"
FT                   /translation="MNLPVPRLGPYPDRPRPYPPDHPAHLPIRPLWLCRACGGPWPCAK
FT                   ARLLLKVEYADHPVDLAVYLSGLYHEATHDLFRLNPHDGPTPRELFERFVGWGPYRRSI
FT                   TDTMPAT"
FT   gene            37707..38264
FT                   /locus_tag="ML5_0040"
FT   CDS_pept        37707..38264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_4488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05594"
FT                   /inference="similar to AA sequence:KEGG:SACE_4488"
FT                   /protein_id="ADU05594.1"
FT                   /translation="MTAPGDFDLTTDELREVARYAVRHAEDVLPVYERAVPGDPRPRAA
FT                   VDAAWTFVRGAARTKLQRIASLDAHRAARSAPTEAARLAARAAGDAAAAAYLHPIAKAT
FT                   QVGHILRAAANAARVAELEAGGDETAGEALLERSRRLATPVLVDVLRRYPPVTGGGSRV
FT                   ARLMSSLDHDLRRGDAGAEVAP"
FT   gene            38261..38776
FT                   /locus_tag="ML5_0041"
FT   CDS_pept        38261..38776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_0341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05595"
FT                   /inference="similar to AA sequence:KEGG:Namu_0341"
FT                   /protein_id="ADU05595.1"
FT                   /translation="MILPKIRDPRFTTIRRGGTLTDEHHHLLALWAATCAEHVLGLFEA
FT                   VRPDDSRPREAIEHARAWVRGEVRMMEARAAGGHAMGAARDLRGAARNAAYAAGQAAVV
FT                   AHVAAHELGAAAYAIKAVRAAAPAGLGEAAGRDECRWQRDQLPAEIRDLVLDDQRLRND
FT                   ICWSVFDC"
FT   gene            38891..39421
FT                   /locus_tag="ML5_0042"
FT   CDS_pept        38891..39421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0042"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: stp:Strop_3158 sigma-70 region 4
FT                   domain-containing protein; TIGRFAM: RNA polymerase sigma-70
FT                   factor, sigma-E family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05596"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADU05596.1"
FT                   /translation="MDPLLNEFDLFVRTRTPALLRSAYLLTGDQHLAEDLVQSALARTH
FT                   RAWNRLHETGNAEAYTRKIMYHLQVSWWRRRRVAESMPGDMPEPRGGDSTPDHAQQTTL
FT                   RLTLRSALARLSAKQRAVLVLRFFEDRTESEAADLLGVTVGTVKSQTSKALAKLRSVAP
FT                   ELAELYVTEGTAR"
FT   gene            39418..40548
FT                   /locus_tag="ML5_0043"
FT   CDS_pept        39418..40548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05597"
FT                   /inference="similar to AA sequence:KEGG:Strop_3157"
FT                   /protein_id="ADU05597.1"
FT                   /translation="MNQDRLRFDLADLAEEVTPVDLRDRALRTSRRLGIQRAVATSAAA
FT                   LVVLAAATGTALAIRPNSQAPAPAGPSVTVTAPPVEPSRTPSTDPSRTSSADASTATGQ
FT                   AQSSLAGTRYYLQQTSTRSRIHEVRGTQDRVVHEVVHEAASRCEANTVSISPDGKRVVW
FT                   VQDSTDNANGVLLIATVGEKGATTLAEGISCLGARPLRWKGDDLLMVQRKNRQSVLYDV
FT                   TANKQVVGDPGQETKRCWSADGTWLAAESDGKPYVSDTTDLRQYTYTPPQQEAAKWDGW
FT                   EARSVSTDGRYVAVGWIGTDPSRRDGSFAVVDTRTSKVVDLPGTGEVRSILFSADGTVL
FT                   LRRGTGVTVLDREFKPLGTVTEPAPTRNRALLAYVP"
FT   gene            40651..41733
FT                   /locus_tag="ML5_0044"
FT   CDS_pept        40651..41733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05598"
FT                   /inference="similar to AA sequence:KEGG:Strop_3157"
FT                   /protein_id="ADU05598.1"
FT                   /translation="MQIETDVWECIRDAHQPTPEDRIVNVIVTSARGLRTVAALAAAAF
FT                   VAVGVSACGDGGSTPSAPAAGQSSAAAPSSAAPSPSDASSAALPGTRYYLSFGEQAAEV
FT                   HVVKGGTDRVSASVPYGGGDCVRNTITISPYGERLAWVEGAAGAEAGKLVTTRIDGSDR
FT                   ATIAAEPPFSGKAPCDGGDPLVWNTNDRVLVQQDGHMALIDLSSRKPADGDAGNETLKW
FT                   WTPDGRNWAAVSEGRPYATTDPKVTFYRYTPPAAQAARYDGWRVRSVSADGRYVAVGWI
FT                   NKDETRNDGSFAVVDTRTSKVVDLPGTGEVRGILFSTDGTVLVRRDNGISVLDKRFQPV
FT                   GTVTEPAGLSGAPLLAYVPA"
FT   gene            complement(41786..43141)
FT                   /locus_tag="ML5_0045"
FT   CDS_pept        complement(41786..43141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_3286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05599"
FT                   /inference="similar to AA sequence:KEGG:Sros_3286"
FT                   /protein_id="ADU05599.1"
FT                   /translation="MTYQHQQPPPAAPKRRGRVALLVAGGLVAVLAVAAGTAYGVSRLV
FT                   GGDDDDGRKLRTAWVLDFPERQRNGLKTYDGQDMFGAWLVGDAVVRAQPDGIIAYRLGD
FT                   GAQAWGVPAPQASSLCAAAQTLAEGRGVVALGSADSCDTLVGFDAAGGTQTWRATFPVE
FT                   RRTGRSEIVAPDLSVAAGQVVVRSGESVLGYSLADGKRLWQTDADRLLPGRDCRLTQTQ
FT                   AAGTQAVVTARCDGDQGALLGLDPATGKPRWQQKLPAAQQSAGVLSVDPLVSLPGLVSE
FT                   TFVARDAAGKARATFGNPVDGTRFSDLPINRSNTVSGPEIRPYLADADTLYLPTEATNV
FT                   GGKMRQANQVVAIDLATGKRRWVSAGHTDGEVELIRLDEQGVLAWEVGDRRDLAPRLVR
FT                   IDPATGAVSVLAEAPLSAGTEGSDAKVLERDGTVVLVPWKHVTADAAITVLR"
FT   sig_peptide     complement(43037..43141)
FT                   /locus_tag="ML5_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.481 at
FT                   residue 35"
FT   gene            complement(43161..44642)
FT                   /locus_tag="ML5_0046"
FT   CDS_pept        complement(43161..44642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_3285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05600"
FT                   /inference="similar to AA sequence:KEGG:Sros_3285"
FT                   /protein_id="ADU05600.1"
FT                   /translation="MTQGHPPAGWPPPGNADPRYAAAPPPAQPGPWGPPPATPKSRRGL
FT                   WIGLAAGALALALCAGTAVGVGLGLRGDDEEGPAPKAAAGANGVTVTNAELTALLDRHS
FT                   KALAAKDLDGYLAAFDPARKELIAGQTQLFRNLGKLPLSVARYETIERQGRAGDAFGQG
FT                   VTFQLDVSFVHQLDGFDLAPVTEWYRWTIVRTGKDAPIRVTAVTGAPAAGNGGSKTVHY
FT                   PGPWDKWREIHVERTPHALLIADAARAGVAKRYAPAADVAVTNGLAVWRASGPPGPVPS
FT                   GFVITLADGKDEMTSLYRIGTEKATEAGFSLGLVAAERKDGKATIGGTRIVVDTRDRYF
FT                   TRTGGDNDARMVLRHEVAHSLMTPRTDLTAVDAFSKLDEWVVEGFAEYIAFHGRPLGAS
FT                   ERTAQARQVVRGGWNGTLPGNGEWDDPDRLSFHYWLGHAAMNHLAEKHGEVKLFRFVEA
FT                   VYGGTPTDRAARDVLGVSLDEFQAGWAAYVRAQAR"
FT   gene            44897..45667
FT                   /locus_tag="ML5_0047"
FT   CDS_pept        44897..45667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0047"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   saq:Sare_0027 GDSL family lipase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05601"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADU05601.1"
FT                   /translation="MRWRSYVAVGDSFTEGMDDAYPDGSYRGWADLVATRLAAEAGPDF
FT                   GYANLAIRGRLFPNVVAEQVPSALAMKPDLISFAAGGNDVLRRSFDPDSFVPRFDSVVQ
FT                   RLRSGGSDVVLFRFADVMARLPGQRLVAPRVALLNRAVGEVAERHGAILVDLYADDTYL
FT                   NPLLWSTDRLHLSAAGHRRVAAQVLTALGIGCEEEWLMVPPHPAPSPWLAARAADLRWA
FT                   GRHLAPWIKRRLTGRSSGDFVTAKRPVLGPVERD"
FT   gene            45670..46116
FT                   /locus_tag="ML5_0048"
FT   CDS_pept        45670..46116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_4826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05602"
FT                   /inference="similar to AA sequence:KEGG:SAV_4826"
FT                   /protein_id="ADU05602.1"
FT                   /translation="MRTVHAADLLRLTPDDPPRTGLAVVVAGDRVEAIVPTAELSGAYP
FT                   GVRVRRWAGTLGPALVHDGPLPPAPTPRERVHALFRLGVAAVLDEHVTDPALRSAAARN
FT                   EVAVLPTVRPPALVTGGRADLAVFDADGSCLATVVAGRLVHRRA"
FT   gene            46157..47059
FT                   /locus_tag="ML5_0049"
FT   CDS_pept        46157..47059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0049"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: saq:Sare_0028 rhodanese domain-containing
FT                   protein; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05603"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADU05603.1"
FT                   /translation="MPVPSDPHPHLQSYADPQRLVTTEWLAEHLGDEGLVVVESDEDVL
FT                   LYDTGHIPGAVKVDWHTELNDQVTRDYLDAASFAELCAAKGIGRDDTVVFYGDNFNWWA
FT                   AYALWVFSLFGHQDVRLLDGGRQKWIAEGRELTRDKVSRPRASYPVPERNDAPIRAYRE
FT                   QVMAHVAAGRPLVDVRSPGEYTGEMLHMPDYPQEGALRGGHIPGAVSKPWKSAANDDGT
FT                   FKSADELRTIYGDQLGLSPSDDVVAYCRIGERSSHTWFVLHHLLGFPQVRNYDGSWTEW
FT                   GNLVRAPVVKGDQPGGLTR"
FT   gene            complement(47141..48334)
FT                   /locus_tag="ML5_0050"
FT   CDS_pept        complement(47141..48334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0050"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_4783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05604"
FT                   /inference="similar to AA sequence:KEGG:Kfla_4783"
FT                   /protein_id="ADU05604.1"
FT                   /translation="MSEPELTRLLTRAAEEIRPTRPAEAGWERAGRVRRARRAAGAAAV
FT                   AVVLLGGGTTALLHRSGPPPAAPPRPTVTAAPSAPVVQRPPDRLGEAGDPLGRLGDRVA
FT                   FALSDRPVSRALALYQPVDPETGDAGPVRVLGDDGMVRELDVVTLAPTRDAEGNEATPL
FT                   KPGSLSPDGRTAAFAQTGEVVVVGLTDGAVRRYPLTGYLEHVLWAGDRLLVGDNDTTHE
FT                   LDRRTGSARKLAVDPWTLVVPEPARSGDLFTVGGWSGDGGLAVRRFPASGGAPERRPVT
FT                   AGELPPGYQLNEVYGRGWQRGDRIAQAGWTTTAGTAGTMSGAEGVAVLDARTGAVTRLL
FT                   DLGREGRTKGCCEVYGWTADGAVLLRYDAGLARWRPETGAVDWVASNVPGRLSIAAR"
FT   gene            complement(48331..48861)
FT                   /locus_tag="ML5_0051"
FT   CDS_pept        complement(48331..48861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0051"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: stp:Strop_4572 sigma-70, region 4 type 2;
FT                   TIGRFAM: RNA polymerase sigma-70 factor, sigma-E family;
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05605"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADU05605.1"
FT                   /translation="MGRDADDGRADYLAFVEAHQHRLLRAAYLICGNRHQAEDLLQDAL
FT                   LKLALRWPSVRDGDPAAYVRAILYRDAVSWWRRRRREWLSAYPPDRPGADADAALRLTV
FT                   RAALDRLPPRQRAVVVLRYFEDLTEVATAEALGVTVGTVKSQCHDALRKLRDVVPAPGT
FT                   SGDGLVTGMEANP"
FT   gene            complement(48878..49477)
FT                   /locus_tag="ML5_0052"
FT   CDS_pept        complement(48878..49477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0052"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: kfl:Kfla_0041
FT                   regulatory protein TetR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05606"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU05606.1"
FT                   /translation="MDVTEPATRARRSDATRAAILRAARERFATDGYDRATIRAIAADA
FT                   RIDPSMVMRYYGSKEGLFAAAAEFDLRLPDLAEVPPDRLGETLTRHFVRRWEADGTLVA
FT                   LLRAAATNPGAAERMRGVFAGQLATAVARRVADPATAARRAGLVASQILGLALTRYVVR
FT                   LPPVVDLDPEELAAWVGPTIQRYLTQPLPPSRASGG"
FT   gene            49569..50714
FT                   /locus_tag="ML5_0053"
FT   CDS_pept        49569..50714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0053"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: mpt:Mpe_A1733
FT                   2-polyprenyl-6-methoxyphenol hydroxylase-related
FT                   FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05607"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADU05607.1"
FT                   /translation="MLPERTDVLVVGAGPTGLAVAVTLAGHGVTATVVDRLAEPPVTSR
FT                   AAVVHAGTLEVLDRIGIAAPLAARGLRSARFSVRDRDRVLVTVPFDRLPSRYPYALLIS
FT                   QAETEAVLADRLTALGGRVLRPYEMTGLDLDGDGAVARFGGGRAVRARWVVGADGMHSR
FT                   VRELAGIGFGGPADPGESFLLADVHVDSTLPRDQVSLFLSRQGPLVWAPLPDGTVRLVA
FT                   TVDDAPRDPQAHHFQALLDERGPARRPDRVTGMAWSSRFRIHHRIASTYRSGPVLLAGD
FT                   AAHVHSPAGGQGMNLGLRDAVALGDALAAGPQALDGYATDRRPLAEEVLGFAAGLTRLA
FT                   AAPPAVRPLRNLLLRAVSTLPPVRHRIAVRLAGFEPARPDS"
FT   gene            complement(50732..52003)
FT                   /locus_tag="ML5_0054"
FT   CDS_pept        complement(50732..52003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0054"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_6301 antibiotic transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05608"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU05608.1"
FT                   /translation="MTITAVPGRDYRLLWSAAVCSQVGDSLRTPALALLAATLTRDPRA
FT                   VAAVTVAGLLPPLLFGLLSGVYADRWDRRRTMAVVDGGRAVVVAALAWSVATGHAGIAT
FT                   LVVVASLLALLGTLFDASAYALLPTVVPPERLAGANARLQAGTAVAGGFVGAPLAGVLF
FT                   AVSPALPFTADALTFALAAVLILAIPAPAPRRSCTFRPGKDAQKGQSRGHNRKINENKG
FT                   GVWEGIRFLRRDRVLWALTVGTAGSNLAIGGLASVLVLYALAVLRVPEAAYGLFAAGAI
FT                   AGGLGGALFAGRLAARFGTLPTLRVVLLGQTLALAGFALARHPLTGGLAMAGFTAGSTI
FT                   WNSLRAAYGQRHVPPDLLGRVGAAQRVAGLAAAPAGAVLAGLAAQAFGLTPVPWAAAAV
FT                   FALVTAAVWVTFRARTGPPAAPPH"
FT   gene            52122..53915
FT                   /locus_tag="ML5_0055"
FT   CDS_pept        52122..53915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0055"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: tcu:Tcur_4208 ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05609"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU05609.1"
FT                   /translation="MDRTFQVDLRGVVDLLSHHLYGSPRVYVRELLQNAVDAITARRST
FT                   EPKAPARVRIEPPELTGDGTLRVHDTGIGLTEAQVHELLATIGRSSKRDELGFSRHEFL
FT                   GQFGIGLLSCFLVADEIRVVTRHADEPTVLWTGWSDGRYAVRLAEPDQARDEPGTTVTL
FT                   VPRRDADQWLGVPTVTELARLYGGLLPVDVRVGDTPTTAGPPPWPTTPGAPVDRAALQR
FT                   YAQELLGFVPFDVVPLSVPEAGLTGVAFILPAAVNPAARAGHRVYLKRMLLSEHADGLL
FT                   PEWAFFAHCVVDASELRPTASREALYEDALLTSVREALGDQIRGWLVRLAKHDPRRLGE
FT                   FLQVHHLGVKALAMHDDEMLRLVDQWWPMDTNVGTMTLAEFRQRHGVLRYAASLDEFRQ
FT                   LAAVAAAQDVAVVNGGYTYDTELIERLPTVDRSVLIERLEPSDLTTRFEILDPATELAL
FT                   RPFLTAAQRALERLGCEVVIRAYDPVSLPALYLVSRSAAFHDQLAASRDRADELWGGVL
FT                   DALAASAPPDRPQLVLNHRNPLVRRVTTLADPELVGLAVEALYGQALLLGHHPIRAADA
FT                   ALLNSSFLGLLGRAVPGETRD"
FT   gene            53908..56751
FT                   /locus_tag="ML5_0056"
FT   CDS_pept        53908..56751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0056"
FT                   /product="tetratricopeptide TPR_4"
FT                   /note="KEGG: tcu:Tcur_4207 tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05610"
FT                   /inference="similar to AA sequence:KEGG:Tcur_4207"
FT                   /protein_id="ADU05610.1"
FT                   /translation="MTDDDLWRMHHEIESMPYGPGQIAALEQLLRRADAGDDRHLAFAA
FT                   RVTGTTAYVYGGEPAKSFVTFSWCLAEYDKDPQPYHQRYTHQLLWFFKYMVNAMVKFPE
FT                   LPLDRTYAVLDDMERRYRDSGHSLQAVYKHRYLVAAHLGDDEAAEQWYRKWMTTPRDTL
FT                   SDCAGCDPTTQVAHLVRHGRHEEAVALAEPVLAGRLTCSEQPQGILTALLTPYRETGRT
FT                   DAARDAHREAYRRVRGHLADLWDIADHVEFCTVTGNEARALELVERHLDWLDRAPTPAA
FT                   AMHFAAAASAALRQVPAELTVHRRASGERAAADVPAGALADELAGTATALAERFDARNG
FT                   TTHQSGLIARKLAAGPVGEHLPLSASLRRPAVPAPRAGSDAPVASPQPVTVPADAGADE
FT                   LLALAEECWRTNRRDGLVAALHAYDERFGDADVPATTRAWRLELRAGELSQDDDGVPVA
FT                   IEVNREALAAWREVPDPLRAQVVAGRLGVLLSMVEESADEGITLARESAGYLTEHGEPR
FT                   DRAAGWDRLALAHVHREQWAEALDALDRAEAEADADPWLAGRVALHRTHVLEQLERAEE
FT                   FRDAAARSRRLAGELGDAEMLTGACLAYARATDDPADAVAACEEALSVAPAGAQLPLRV
FT                   TRGRALMAADRAGEAVEDLAEAVTLCVEQGLEGDALLRWELAEAYRVAGRLAEAAEVAE
FT                   EAVLGLDRAGAQAEADRCRHMLAGIYAGLGETDLALTVLDTLAENLDGPDNLPHRAQVL
FT                   EESGGLLYDADRDALAAQRFAAAATAWRLAGFQVDEMRARRRELLALHWSGDLPAAVAA
FT                   IERVDEAAAALPAEADEAPVVTYERAMAADAVARVLIGEDRLTAALDRVDGVPERLRSI
FT                   EAFGEAAQVEVLTGELLLRDGRPEQAEGLLRPVLGGLPSGSRPATQAAWLLARALDEQG
FT                   REAEASKVRADHGIEED"
FT   gene            56823..57437
FT                   /locus_tag="ML5_0057"
FT   CDS_pept        56823..57437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0057"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: saq:Sare_0030
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05611"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU05611.1"
FT                   /translation="MAVEQQARGAAGAARRRSRRDEILEIAVGLFAARGYHGVSMDDIG
FT                   AAAGVTGPALYHHFAGKEAMLVAALIPVSEGLLAGGRERAAGHPGDPRAALESLIDFHV
FT                   DFALANPAVIALHLHELDRLPDEPRRRIRRLQRMYVEEWVTVLTALHPGLPDGAARVLA
FT                   HAAFGLMNSTPFLGGEVDRRRRAELLRGATLAALLAPTDPT"
FT   gene            57506..58852
FT                   /locus_tag="ML5_0058"
FT   CDS_pept        57506..58852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0058"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   stp:Strop_0025 carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05612"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADU05612.1"
FT                   /translation="MQKMIESLLVANRGEIARRIIRTGRRLGIRTIAVHSEADGALPFV
FT                   TEADEAVCVGPANPAQSYRNVEAILDAARSTGAQAIHPGYGFLSENADFARTVEGAGLI
FT                   WVGPGADAISAMGDKINARNLMAAAGVPVAPGTTEPASDLDAAVAAAAEIGYPVMVKAA
FT                   AGGGGMGMGVAADEAALRTEYDKVRAFAERMFGDGSVLIERYFPRVRHVEVQILGLADG
FT                   RVVALGERECSVQRRNQKLVEESPSPAVSPELRERFLAAAVRAGEAVNYRNAGTVECLL
FT                   DPSTQEFFFLEMNTRLQVEHPVTEYVYGVDLVEEQLRVASGLAPTFDPDALTPRGHAIE
FT                   LRINAEDPKRFLPGPGAITTWNEPSGTGVRVDSGYVAGNTVTPFYDSLMAKLILTGATR
FT                   EEAVERARAAVAQFEIAGPKCNLPFFAELLENPEFLSGDYDTGIVSRMR"
FT   gene            58878..59798
FT                   /locus_tag="ML5_0059"
FT   CDS_pept        58878..59798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0059"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   saq:Sare_0032 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05613"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADU05613.1"
FT                   /translation="MAELPDSVSIREVGPRDGLQNEEPIPTDAKVRLLDALSRTGVRRI
FT                   EAVSFVHPKAIPQMADADEVWQRAEKVDGVRYSALVPNTRGAQRALAAGFTEIEVVVSA
FT                   SDTHNRRNVNRSTDESLDDIAELIDLLHGAGATAEVIVATSFGCPYEGDVDPRRVSAIV
FT                   DRVARDGADRVAFGDTTGMGTPRRVRELVTAVRDRNAHLPVLLHFHNTRGTALANMLTA
FT                   MELGITEFDASVGGLGGCPYAPGASGNLATEEAVHMLHDMGIDTGIDLDALIEAAELAE
FT                   TLVGKKLPSGVLRAGPRTRLTPRPA"
FT   gene            59956..61488
FT                   /locus_tag="ML5_0060"
FT   CDS_pept        59956..61488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0060"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="KEGG: saq:Sare_0033 propionyl-CoA carboxylase; PFAM:
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05614"
FT                   /inference="protein motif:PRIAM:6.4.1.3"
FT                   /protein_id="ADU05614.1"
FT                   /translation="MTLDGEALEQLRKRARAGGADKYHAANAAKGKLFARERVAYLVDE
FT                   GSFVEDGLYANAMADGLPADGVVTGTATIDGRQVCLMANDSTVKAGSWGARTVEKIIRI
FT                   IERAYATGVPMVYLVDSAGARITDQVDLFPGRRGAGKIFWNQVRASGSIPQVCALFGPS
FT                   AAGGAYIPAFCDVVAMVDGNASMYLGSDRMVEMVTGEKTTLEAMGGAKVHCAESGVGHF
FT                   LCKTENDALDVVRTYLSYLPSNWKQDPPAAEAVAAPEKADLAALVPASERQAFDMRRYV
FT                   KGLLDSGSFFEIQALWAKELTIGFGRLNGEVVGVVGNNSMFKGGVLFVDSADKATRFVQ
FT                   LCDAFNVPLLFLSDVPGFMVGSAVEKQGIIRHGAKMITAISEATVPKICVVVRKAYGAG
FT                   LYAMAGPGFEPDATIALPTAKIAVMGAEAAVNAVYANKIAAISDEAERAAFVAAKREEY
FT                   ERDIDVVRLASELVVDAIVEPHELRAELVRRFTAARGKERHFSRRRHGVTPV"
FT   gene            61607..62755
FT                   /locus_tag="ML5_0061"
FT   CDS_pept        61607..62755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0061"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: saq:Sare_0034 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05615"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADU05615.1"
FT                   /translation="MDFRLDEEQQALRESVREFAREVVAPTIAEHYEQHTFPYEIVRQM
FT                   GKMGLFGLPFAEEHGGMGGDYFALCLALEELARVDSSVAITLEAAVSLGAMPIYRFGTE
FT                   EQKAQWLPKLLSGEALAGFGLTEPGTGSDAGGTRTRAVLDGDEWVINGSKAFITNSGTD
FT                   ITALVTVTAVTGTRPDGGKELSTIIVPSGTPGFTVAPGYSKVGWNASDTHELTFDDCRV
FT                   PAANLLGERGRGFAQFLRILDEGRIAIAALAVGLAQGCVDESIKYAKERQAFGQPIGNY
FT                   QAIQFKIADMEMKAHTARLAYYDAAARMLAGEPFKRQAAIAKLHASTVAVDNAREATQI
FT                   HGGYGFMNEYPVARFWRDSKILEIGEGTSEVQRMIIARDLGM"
FT   gene            62856..65393
FT                   /locus_tag="ML5_0062"
FT   CDS_pept        62856..65393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0062"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: saq:Sare_0035 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05616"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU05616.1"
FT                   /translation="MTPDHDRARGPGGRTGLADLLRGHRLAVGLTQAELAGRAGVGVRT
FT                   VRDLERGRATRPQRTTVDLLADALGLSGDERREFVDTARPAASRLPAAGAAADDPPVAL
FT                   PQPVPLLGRERDVAEVSGLLDAYPVVSLVGLAGVGKTALAVTVAHAVAARHPAGVAGVL
FT                   VGEGSDAADVLAASASTFGVNRLADLSCRIGDRRALLLVDAVDRAPEPVAEALRVLTAA
FT                   VPTLRVLVTGRRPVGLAGEMVRPVAPLDVPPAGTEPADRAGLDRWPAAALFAARFAQAR
FT                   REPPTPAELPALAALVRRLGGLPLAIELMAARGRILDVTELLDRYGDRVLDLTGVRPGW
FT                   EPADPSAGTVTLRDAVATSYHLLASADRAALRRLSAFRNRWSVELAEDLLADGGRRWDA
FT                   APMLDRLRELGLLSVRGTGPFRFRLLDAVRDFAAEQADLEGETARIRMRHAAVIAGLVH
FT                   RTAPGLVGAQMSGAVHVLDEATSDITAALAYAAEYAPETALLLAASLPRWWRLRGRDVS
FT                   GRGRLRRLLADPRTAGARPTLRAWAMLGAARLAAEHGAGAEELPAARAALVVFAEAGDV
FT                   TGELSARSVLCALLLGLGAHDEAREQAEAALASATRHHRVREMAVAQAHLTWHDVREGR
FT                   LAGARRRLATVDRLAAQCGDQRLRVLARADQAELTRLEGRYAEAVEQGRRVAAALAELG
FT                   DPGRRRRTVGAVGLALAHAGRTDEALATIAELWPSGVVPGRRRPPAVEMLDPPGPGGDA
FT                   RTEDALRGLIEGHVALHRGDRELAAEWFAAAADAAEGVADRRDLVEALVGLAVSTADPA
FT                   VLDRLDAARQVTGVSLLPQEEELLFSLTARRGR"
FT   gene            complement(65675..66166)
FT                   /locus_tag="ML5_0063"
FT   CDS_pept        complement(65675..66166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0063"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: stp:Strop_0030 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05617"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU05617.1"
FT                   /translation="MDQNVFDDPRITAVGLLVEAHAGLAARFAAQFEEHGLSPVEFEVL
FT                   TRLARSPNNQLRMTDLAAQTSLSTSGVTRVVDRMERDGLICRRACPSDRRSSFAVVTTA
FT                   GLSRLDDVLPGHLRIIEQWFTSQLDPAQLDGLLDGLRRVRDAVHPGATAGSTEPVEDAA
FT                   "
FT   gene            66268..66849
FT                   /locus_tag="ML5_0064"
FT   CDS_pept        66268..66849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0064"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: tbi:Tbis_0122 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05618"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADU05618.1"
FT                   /translation="MTSSTEATTRDWEGLTIPTPGTYVLDAAHKRVGFVARHMMVSKVR
FT                   GEFADATATITVTDDPMQSSVTASIQAASINTAQADRDAHLRSPEFLDAEQFSTLEFRS
FT                   TEVKSREGNEFVLVGELTIKGVTRQVELEVEFEGVGRSPFGQDIFGFSASTEIDREDFG
FT                   LTWNVALETGGVLVGRKVKIEIEGEAIRQG"
FT   gene            67103..68581
FT                   /locus_tag="ML5_0065"
FT   CDS_pept        67103..68581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05619"
FT                   /inference="similar to AA sequence:KEGG:Sare_0037"
FT                   /protein_id="ADU05619.1"
FT                   /translation="MGRDVEQGAFSREDRVRYRQKVRRCLDVFALMLDDFGFDADRPMT
FT                   GLEIELNLIDAAAEPAMRNDQILADIADPLFQTELGQFNLELNASPRLIEGSGFADYEQ
FT                   DLRSSLSRADERAAKSDATIMMVGILPTLTERHLVADNLSTNERYRVLNDQIVGARGED
FT                   IELDINGVERLRTHTDSIAPEAACTSLQFHLQVAPDSFADYWNASQAIAGVQVAVGANS
FT                   PFLYGRQLWAETRIALFQQATDTRPDELKAQGVRPRVWFGERWITSIFDLFEENVRYFP
FT                   PLLPICEEEDPVEVLHAGGVPTLGELRLHNGTVYRWNRPVYDIMNDRPHLRVENRVLPA
FT                   GPTVVDMLANAAFYFGLARGLAESDRPIWSQLTFSSAEENFHAAARRGIEAVLHWPRLG
FT                   DVPVTTLVLDTLLPVAAQGLDRFGVAPAERDRLLGVIEGRCRTGRNGAVWQTETVWAAE
FT                   RSRGLDREAALHHMVQRYAELQRGNEPVHTWPVD"
FT   gene            complement(68786..70174)
FT                   /locus_tag="ML5_0066"
FT   CDS_pept        complement(68786..70174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05620"
FT                   /inference="similar to AA sequence:KEGG:Sare_0038"
FT                   /protein_id="ADU05620.1"
FT                   /translation="MVRRGWGGSTAAALGVAAGAGAAQLGFGYGLGIINWVPDGAVRAE
FT                   AAWVASLAWATWIAATSVIVGAVCAQRLRGGDDESPGTLPRLGLALAAGVGAIVTVLLV
FT                   AVPARAARVPDVSSPQAVAAAYAGAGLVLGVLLAVWALHTRAAATNLIATTGWLWLLAV
FT                   VSVVDGVIAGRGLTTAQLGIWQISADRGAFWIRDYFYWPGALLSVLSALVIGLVAARRA
FT                   ARAPEIRVGAAASGAAGPLLVALAYLLAVPRLAGIAAEQLSAHLIAPYAVIAGVGGSMV
FT                   MAALAQRAERRSAERVTVPHQRTGEPAPVDGEPAIGEDTAEPDGGSTSGRSASDLSGRT
FT                   TLPDTEPNASAGSLRDAAVDDGPGVTSGRTETDRGRATRSTTGRRGRAVPPQRQPESPT
FT                   QAGSHDKGSTADEPNPRSTTASPQDDSSSPTASPGQTGSSGQTGSSGQADPPPPTDTTR
FT                   RRGR"
FT   sig_peptide     complement(70106..70174)
FT                   /locus_tag="ML5_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.862 at
FT                   residue 23"
FT   gene            70260..70949
FT                   /locus_tag="ML5_0067"
FT   CDS_pept        70260..70949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0067"
FT                   /product="PASTA domain containing protein"
FT                   /note="KEGG: lxx:Lxx03600 penicillin-binding protein; PFAM:
FT                   PASTA domain containing protein; SMART: PASTA domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05621"
FT                   /inference="protein motif:PFAM:PF03793"
FT                   /protein_id="ADU05621.1"
FT                   /translation="MIGAGSMTDERQPAGDGSGPGRGRLLLGGGVAVALLAVIGASVGW
FT                   ILAGEPERSAAPGDSAPPAAASTSASATTAPPATAAQPSGTRTSAPAGLTVPEVVGADF
FT                   EQARRDLRERRLGWRLVFGTGTGRTVERTSPAPGTPVKRGTTVTVWVSGPAPAVTVPDV
FT                   GTLSCSDAADDLVEAGLYPRYATGRQGPVTAQEPVAGGTARWNDQVTLTCGDKASTPPT
FT                   VSPPPTP"
FT   gene            71047..71946
FT                   /locus_tag="ML5_0068"
FT   CDS_pept        71047..71946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0068"
FT                   /product="PASTA domain containing protein"
FT                   /note="KEGG: stp:Strop_0033 PASTA domain-containing
FT                   protein; PFAM: PASTA domain containing protein; SMART:
FT                   PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05622"
FT                   /inference="protein motif:PFAM:PF03793"
FT                   /protein_id="ADU05622.1"
FT                   /translation="MSDDRQEPPAGDADATRALPPDADATRAMPRDASGHDADATGAMP
FT                   RDAAGHDADATRAMPRNAAEEDVEATRAMPRNAGDATRPLPGGPAGQGGSRRPLDATTP
FT                   QEPVGAWSGRAGVPPPRPAGYPEPGSEWYGDEQAGRRWWMPILLGILALLLLGLIGAGV
FT                   WLALRAADRNSDPGPPVPSVSAQTSAAPTTAAPTSAAPSSSPPSTPATTAPLEVPMPPL
FT                   VGLPEAAARAALDRLDLDYRVQRRASDRPAGTVISTDPEAGYPVGEDDRVTIVVAVPAP
FT                   PTSGPSTPGSAPATTTTP"
FT   gene            complement(71950..72423)
FT                   /locus_tag="ML5_0069"
FT   CDS_pept        complement(71950..72423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05623"
FT                   /inference="similar to AA sequence:KEGG:Sare_0039"
FT                   /protein_id="ADU05623.1"
FT                   /translation="MVNLPAARRHHRSRIGYALGLFLFLVTATALALAVRHPAFSATQQ
FT                   LAEPVPAPEITVAGENGRTESDTADSDAAESDAAESDAHSDGSDDEDGWAAADPAEDED
FT                   EPAAGAGGGEGALAERPTGATDDLSRSLFYSGLLGLAISLAGLGLVGTRRRQW"
FT   sig_peptide     complement(72298..72423)
FT                   /locus_tag="ML5_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.943 at
FT                   residue 42"
FT   gene            complement(72528..72815)
FT                   /locus_tag="ML5_0070"
FT   CDS_pept        complement(72528..72815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05624"
FT                   /inference="similar to AA sequence:KEGG:Sare_0040"
FT                   /protein_id="ADU05624.1"
FT                   /translation="MLPRSGDVLHVTRAASVQFLRPIMFRVIRVLDWPTYDGWLWLDGY
FT                   ELNAAGDAVNRRSIFVLQEGLRQLQAAPAPRQHTVRTARRPAVRTPVRVG"
FT   gene            73442..74323
FT                   /locus_tag="ML5_0071"
FT   CDS_pept        73442..74323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0071"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: saq:Sare_0041 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05625"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU05625.1"
FT                   /translation="MSERRSPTIRRRRLGAELRRQREAAGITIEVVAEQLECSASKISR
FT                   IETGHTTATPRDVRDMLRIYGVVGAESDELVQIAREARQKGWWHPYSTVLVGAYVGLEA
FT                   AASSIRAYEQQVVPGLLETEEYAGAMIRAARPDFTDEQVDQRVRVRLGRQSLLTQDDPV
FT                   DLWVVLDEAVLSRPVGGDVVMRGQLKRLVEVAELPNVTVQVLPFEVGAHAGMDGTFTIL
FT                   SFPEPSDPDVVYAENATGGLFLEKSDELQKYSFIFDHIRAAAMRPEESIAHIAKLAEEP
FT                   LWKWRPRSSPWT"
FT   gene            74287..74514
FT                   /locus_tag="ML5_0072"
FT   CDS_pept        74287..74514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0072"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   saq:Sare_0042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05626"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ADU05626.1"
FT                   /translation="MEMATKEFPVDLTQATWFKSSKSGPNCDNCVEVAYVTGAVGVRDS
FT                   KDKTGPALVFAPGDWHAFVARARNGVFGRS"
FT   gene            74664..75062
FT                   /locus_tag="ML5_0073"
FT   CDS_pept        74664..75062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05627"
FT                   /inference="similar to AA sequence:KEGG:Sare_0043"
FT                   /protein_id="ADU05627.1"
FT                   /translation="MTTIGSENLTSGPGKPERFGGKYRGARRDTVLTEVVSGDGEDARE
FT                   SGVPEQATAPLSLPSLDPNPLTEPSFPPSGWPVEQQESLVDHPLLRGLLMELPPKGSVP
FT                   PPGWLDRWFEATRAILELLYVQGASRSR"
FT   gene            complement(75030..75632)
FT                   /locus_tag="ML5_0074"
FT   CDS_pept        complement(75030..75632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0074"
FT                   /product="uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /note="KEGG: ske:Sked_22090 uncharacterized membrane
FT                   protein, putative virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05628"
FT                   /inference="similar to AA sequence:KEGG:Sked_22090"
FT                   /protein_id="ADU05628.1"
FT                   /translation="MDDRLALLLPVAAVWLAAGLVAEGLPGLDRARALRRRTGWLSVLV
FT                   LTGLALTAAVLAAGLQSAGDTTVDRAAAALGVAAVPAAVVAVCTVRRVRRLRSGAGAFA
FT                   AAPETPAPHGLRAAAAHPLIALPLQATAIAVLVAVLPAIGVDLFTAPGVAGPVITVGVL
FT                   GVCAIGVRHALRHNRLAERAMPAAEAVSARPARALHV"
FT   sig_peptide     complement(75564..75632)
FT                   /locus_tag="ML5_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.912 at
FT                   residue 23"
FT   gene            complement(75719..76525)
FT                   /locus_tag="ML5_0075"
FT   CDS_pept        complement(75719..76525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0075"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="KEGG: stp:Strop_0040 WecB/TagA/CpsF family glycosyl
FT                   transferase; TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05629"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADU05629.1"
FT                   /translation="MTAGTKRNVLGVGVDATDYARATEAVVAAAHERRPLALTALAVHG
FT                   VMTGVLDPAHNARLNSFDVVTPDGQPVRWALNLLHGAGLTDRVYGPELTLRVLARFAEE
FT                   GLPVYLYGSTEETLSRLVPALERKFPALKVAGVEPSKFRAVAPGEDAEIADRIRASGAR
FT                   LVLVGLGCPRQEVFAYAMRPLLDMPLMAVGAAFDYHAGLLRNPPPWMQRAGLEWFWRLG
FT                   LEPKRLWRRYVILNPAYLARLAAQKTGLWKATPPAPATGRPATFDV"
FT   gene            complement(76522..77595)
FT                   /locus_tag="ML5_0076"
FT   CDS_pept        complement(76522..77595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0076"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   sna:Snas_0259 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05630"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADU05630.1"
FT                   /translation="MTVALVTGSGGLIGSEAARHFAGLGLDVVGIDNDMRRYFFGEDGS
FT                   TAWSLDRLAADLGSAYTHHAVDIRDRDGLEQVFKRYGKDIAVVIHSAAQPSHDWAAKEP
FT                   FTDFDVNAGGTLNVLENTRRHAVDAPFIHCSTNKVYGDRPNSLPLIELETRYELPEDHR
FT                   WYDGITEDMSIDESLHSIFGASKVASDVMVQEYGRYFDMRTACFRGGTLTGPAHSAAEL
FT                   HGFLAYLMRCVMEGRTYNLFGYKGKMVRDAIHSHDVLTAFEAFFREPRSAQVYNLGGGR
FT                   HSNTSHIEAFRVAQEITGREARINYVEQARTGDHQWYVSSMARFEEHYPSWKITYDVPM
FT                   ILREIYEANADKWVPKA"
FT   gene            complement(77703..77788)
FT                   /locus_tag="ML5_R0003"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(77703..77788)
FT                   /locus_tag="ML5_R0003"
FT                   /product="tRNA-Leu"
FT   gene            78025..78786
FT                   /locus_tag="ML5_0077"
FT   CDS_pept        78025..78786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0077"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: saq:Sare_0047 FHA domain-containing protein;
FT                   PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05631"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADU05631.1"
FT                   /translation="MSVLQRFEKRLEGLVEGAFAKVFKGVVHPVEILNAMQREAEAHKA
FT                   ILAGGRTLVPNRYVIDLSPYDHSRLAPYAAALAQELAQSQAEFIGEQAWTVYGDVIVEV
FT                   ERGEGLDTGMFRVTAEVYTGGDVAPVSAPGGYDAGPAYPAYDQGGGYGPPPGHGGGRNV
FT                   RLVSGDGRTYPLQMGSTVIGRGDQANLRLPDVGISRRHARLDFDGGQVVLTDLGSTNGT
FT                   MVNGQRVSAVALNPGDMIQLGTTTLTFRVDG"
FT   gene            78793..79278
FT                   /locus_tag="ML5_0078"
FT   CDS_pept        78793..79278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0078"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: stp:Strop_0043 FHA domain-containing protein;
FT                   PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05632"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADU05632.1"
FT                   /translation="MPELVITVARFGFLILLWIFVFTVVGVIRRDLFAGARSGRLVAAP
FT                   RGIGASTGQPGKPAKAKRGRAAHQLVVTAGQLAGTRITLGEAQITIGRAEDSTLVITDD
FT                   YASARHARLVPRDGQWYVEDLGSTNGTYLDRAKVTGPTPVPLGVPIRIGRTSLELRP"
FT   gene            79275..80711
FT                   /locus_tag="ML5_0079"
FT   CDS_pept        79275..80711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0079"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: saq:Sare_0049 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05633"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ADU05633.1"
FT                   /translation="MTLTLRYAAHSDRGLIRDGNQDSVYAGPRLLAVADGMGGMAAGDV
FT                   ASNIVIGAMAPLDEDVPGDALVDALRSAVGTANQQLRDTVDANPQLEGMGTTLTATLFS
FT                   GSKLGMVHIGDSRAYLLRNGEFAQITKDDTYVQMLVDEGRISAEEASSHPQRSLLTRAL
FT                   DGRDIDPEYSVRQVLPGDRYLICSDGLSGVVSAETIADTMREYPDPQRCVERLVQLALR
FT                   GGGPDNITVIIADATDQDIVEASPIVGGAAARDRGMATSADDSTPAARASALSAPRPPA
FT                   PEEPADNRDDEPERRRRRPLRTVAMVLALAVIVGGGAFGGWTYTQRQFYVGATDDGQLA
FT                   VFRGVPGQVAGLDLSNVHERSEARLDDLTLAAQERVKQGIQARNEPDAERRLAELTSED
FT                   PANPNLKPLCPPDPSPGATSPSPAAGGLNPQVSGSPAPSVPPAGSPSPGASTPLTTITP
FT                   DAVPSDTVPPADPAGCRSPE"
FT   gene            80740..82230
FT                   /locus_tag="ML5_0080"
FT   CDS_pept        80740..82230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0080"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: saq:Sare_0050 cell
FT                   cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05634"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADU05634.1"
FT                   /translation="MTAAAVPAASPASTGEESGVRLARSRRNAELSLLLLAMVLVAAYA
FT                   AMIEAKALDTITPDFWIPAAALGLVFLGLHLVIRWLAPYADPALLPAVALLNGIGVGFL
FT                   RRYDLAKATPAEREDLAVFAGTGGRQLAWTLAAVVLAAALLAILRDHRSLSRYAYTLGL
FT                   AGIVLVMIPAVLPSRFSEINGAKLWIKFGGFSIQPGEFAKLALLTFFAYYLVRKREVLS
FT                   LASRRVLGIDFPRGRDLGPVLVVWLVSLLVLIFEKDLGTSLLYFGMFVVTLYIATERVS
FT                   WLLIGLILFFGGAYLAYVLGSTVGGPFANFYDRAQIWLDPFAEPYDRGYQLVQGLLTLG
FT                   TGGLFGAGPGGGQPALLPEVQTDFIFAGIGEEIGLFGLSALLVIYLLIVERGLRAALAV
FT                   RDSFGKLLAGGLAFTLGLQVFVIVGGISKLIPLTGQTTPFLSAGGSSLMANWLLIALLL
FT                   RVSDGARRPVTGGGGPAARPAGGPPEQLHGAPTEVIRP"
FT   gene            82227..83735
FT                   /locus_tag="ML5_0081"
FT   CDS_pept        82227..83735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0081"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: stp:Strop_0046 peptidoglycan
FT                   glycosyltransferase; PFAM: penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05635"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADU05635.1"
FT                   /translation="MNAPLRRVGVVVMVLFGLLFANLNWIQAYKADEYRNSDYNGRVQV
FT                   AEYDRKRGNIEVGGTAYAVSKETGGELKYQRTYPGGAMYAHVLGWKPVNGSASGIERVE
FT                   NDFLAGTSDALIASRIKDMFTGDETGGGNVLLTLSKRAQETAYKQLNDNQVGATKGAAI
FT                   AIDPRTGAVQALVSMPSFDPNPLASHNSTEADRAYNTLEKDKDRPLANRALSETLPPGS
FT                   TFKIIMAAAALENGVGQQTRIPAGSSYTAPGAGQPIRNAAPSICPESQVTLREAVTESC
FT                   NTGFAQLGVRLGSDKVKEKAKQFGFEQEDLTVGQLGEGGLPVAASRTGDMQNPDGSTDQ
FT                   AALAQSSIGQNNVRMTPLQGAMIAAAVANKDGKQMRPYLVKQLLGPDRTTVYDAAQPRE
FT                   LRRPISGQVAADLRDMMQNVVKEGTGRRAAIDGFLVGGKTGTAQSGPNTPDHGWFIGFA
FT                   LDKDGTPLSAVCVELEQAGSGGSAEAARIAGRIMAAAIADSGRR"
FT   gene            83737..85122
FT                   /locus_tag="ML5_0082"
FT   CDS_pept        83737..85122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0082"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: saq:Sare_0052 serine/threonine protein kinase;
FT                   PFAM: Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05636"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADU05636.1"
FT                   /translation="MLGPGVKLGNRYRLDERIASGGMGDVWRGTDQVLGRTVAVKSLLP
FT                   ALLDEPGFAERFRGEARTMATINHPGVVDVYDFGSDQHIAFLVMEYVEGDALSATLSRV
FT                   GRLTPARTMALLAQAADALHAAHEKGIVHRDVKPGNLLVRPNGTLVLTDFGIARSDLVG
FT                   QLTAAGSVLGTASYISPEQATGAVATPASDVYALGVVAYQCLAGRRPFEGDNPLEIAMK
FT                   HVRDTPRALPADIPPQVRAIVERAMAKDPAARWPSAAALASIARQAKLALSQAARSGHP
FT                   ISGVPASPAAPVARAQVPTAAPRPQPPSAAPRPQPRPPVSPARPPVAAPRPAVIAHPAP
FT                   QPRPPVAPRGAAPVPQPRPVPQHNPLGYARPPAAAPPRRSRSGLWTTAIVVAVLVILCS
FT                   GVISFLYRKYGATASASASVSVTSGAVQPYGGDYPVRTSYRREVRLLPAGGGTTTSEGR
FT                   ETR"
FT   gene            85119..86951
FT                   /locus_tag="ML5_0083"
FT   CDS_pept        85119..86951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0083"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="KEGG: stp:Strop_0048 protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; PASTA domain
FT                   containing protein; SMART: serine/threonine protein kinase;
FT                   Tyrosine-protein kinase, catalytic domain; PASTA domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05637"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADU05637.1"
FT                   /translation="MTAQARLLGGRYQVGELLGYGGMAEVHRGRDLRLGRDVAIKMLRA
FT                   DLARDATFQMRFRREAQNAASLNHPAIVAVYDTGEETAPTGETLPFIVMEFVNGRTLKE
FT                   VLGVEGRLQPRRALEICADMCAALEFSHRHGIIHRDIKPGNVMLTQTGQVKVMDFGIAR
FT                   ALASGATTMTQTSAVIGTAQYLSPEQARGEAVDARSDVYAAGCVLFELLCGHPPFVGDS
FT                   PVSVAYQHVREQPPTPSTINPDVNPAVDAIVLKALSKNPLNRYQSAGEMRADLLRAAAG
FT                   RPVLATPVMPAEETMPMGAAAGGYHQAQQTQMMGPQTRQQPAARVGDPGKRKSSSWVIA
FT                   AFATLGVLAVIALGTALWLNQAGNEKVSVPQLVGRSQAEAQAALNQAGLRFTAGDPVQN
FT                   TTCEKGSVVDQSPSFGQRVEKDTEVTVNVCTGPGQVTIPTGLKGSTKDAAQTRLREQKL
FT                   VPVVEEVNNSAPKDQVVDVSPNEGSPVAEGSKVTLKVSRGNVSEVPNVRGYTEDQATQR
FT                   LKEAGYEVRVQEGDEVDPAEAGKVSSQSPRAGTSLAKGERVTIRVDVPREEEPTSPTPS
FT                   GSPSTSPSTPGNGGGNGGGSGFPFPPVAPTRTDR"
FT   gene            complement(87126..87776)
FT                   /locus_tag="ML5_0084"
FT   CDS_pept        complement(87126..87776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0084"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: saq:Sare_0054 para-aminobenzoate synthase
FT                   component II; TIGRFAM: glutamine amidotransferase of
FT                   anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05638"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADU05638.1"
FT                   /translation="MRVLVIDNYDSFVFNLVQYLGQLGADCEVRRNDEIDVAEVGRAGA
FT                   AGVLLSPGPGSPDRAGICLDVIREYAGKLPIFGVCLGHQAIGEAFGATVARAPELLHGK
FT                   TSEVRHDGVGVLAGLPDPFTATRYHSLAVLPETLPDELEVTGRTASGVVMAMRHRTLPI
FT                   EGVQFHPESVLTEGGHLMLANWLAACGFPAALERAPELAAEVDARRQAAFSPA"
FT   gene            complement(87782..88054)
FT                   /locus_tag="ML5_0085"
FT   CDS_pept        complement(87782..88054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05639"
FT                   /inference="similar to AA sequence:KEGG:Strop_0050"
FT                   /protein_id="ADU05639.1"
FT                   /translation="MYSWIWRKLPFGLPGKLFGSLVLATATVALLWFVVFPWAEPLLPF
FT                   DDVQVTQDSGVPGDGGITEPTGLPGEEELPYSTETNNAPPSTPNR"
FT   sig_peptide     complement(87935..88054)
FT                   /locus_tag="ML5_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.951 at
FT                   residue 40"
FT   gene            complement(88058..88960)
FT                   /locus_tag="ML5_0086"
FT   CDS_pept        complement(88058..88960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0086"
FT                   /product="sortase family protein"
FT                   /note="KEGG: stp:Strop_0051 sortase family protein;
FT                   TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05640"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ADU05640.1"
FT                   /translation="MLPAVTRPPADPHLDATGLMGAVPPAPDDGDGGGGGAEPPAEPPR
FT                   PRRGERVVQLRPEQTGDGYRSVYSELTRPTVGSRLRTVVRGTGELLITFGLVVLLFAGY
FT                   EIWGKAVIVEAHQSDLNSQLAQEWDAAADPTVGPTTGPTVKPKPPAEGRPVAGLYIPKF
FT                   DKHWVVVEGVSPEDIRYAPGRYPDSAMPGEVGNFSVAGHRIRSTFWRLDEMKTGDAIVV
FT                   ETKTEWLVYRVYQQRIVKPSQVEVVAPVPGKPGQKPTEKLLTLTTCNPKFDNYQRLIIH
FT                   ARLDHTQAKSAGRPAELEA"
FT   gene            complement(89752..90558)
FT                   /locus_tag="ML5_0087"
FT   CDS_pept        complement(89752..90558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0087"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   saq:Sare_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05641"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ADU05641.1"
FT                   /translation="MEYTSGAASWQKVLRRAAAALLPRRARQRRPGWSVGVPLIAAAAG
FT                   LLFTTTATTAGGTSLREDRRPQLTQLIEDRREEVAASEAKAARLRAEVEEQTEALAGAD
FT                   GPIKTERDRAAASRQGAGFTALTGSGVTVELNDADRRPDQPLPKGASNDDLVVHQGDVQ
FT                   AVVNALWAGGAEAMSIMNVRVLSTSAVRCVGNTLLLHGRVYSPPFKIVAIGDPAELQRA
FT                   LAASEGVRVFKEVADHYQLGYVERVSTVTVPAFEDSTALQSATVPR"
FT   gene            90789..91052
FT                   /locus_tag="ML5_0088"
FT   CDS_pept        90789..91052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0088"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   stp:Strop_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05642"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ADU05642.1"
FT                   /translation="MPKSQVRKKKVYTPPTDVRPTATASTRKPSPIWLPVTAVTLIVAG
FT                   IGWLVLYYLSEQAYPVASWGYWNLAVGFGAMVSSLILLSRWR"
FT   gene            91233..93431
FT                   /locus_tag="ML5_0089"
FT   CDS_pept        91233..93431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0089"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: saq:Sare_0059
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05643"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADU05643.1"
FT                   /translation="MGSVQIVTTILAAAITAVAVWLAVRAVMKMTAVIRLGQPAPERFG
FT                   DKGARTKKMLVETAGHTRMLKWSVVGAAHWFVMVGFIVLSLLVLEAYFEVVSTGGGLPI
FT                   IGHWTIFGLVTEWIGILGLVGILVLMAIRLRNRPGRAENRSRFTGSTMWQGYFVEWVVL
FT                   LVLIFGFVIRGFKVATDHFEYPVWAAPLSHAVGSVLPDWEAGVSVAALIKIAISMTWLI
FT                   VISLNVTMGVAWHRFLAFPNIFFKRDPEKPAGSGLGPLRPMTSEGKPLDFEEADPEKDQ
FT                   FGVAQVEQFTWKGLLDFSTCTECGRCQSQCPAWNTGKPLSPKLLVLSLRDHAYAKAPYL
FT                   LAGGGKDLTGEEKATQEQLAGVDVLAMAEADRPLIGTAEEGGVIDPDVLWSCTTCGACV
FT                   EQCPVDIEHVDHIVDMRRYQVLIESSFPSEAGVMLRNLENKGNPWGAPQNTREDWTKGL
FT                   GFEVPRVGEVDDFEYLFWVGCAGAFEDRAKKTTRAVATLLNEAGVKFAILGEGETCSGD
FT                   PARRIGNEFVFQMLAQQNVETLNEAFEGREKSKRKIVATCPHCFNTLGNEYGQLGGEFE
FT                   VVHHTQLLAHLVSAGKLTPVQPVDGGVTYHDPCYLGRHNRIFAAPREVLGDSIQGELTE
FT                   MPRNSERSFCCGAGGARMWMEEKIGKRINVDRVEEAMSTGAKTIAVGCPFCSTMLNDGV
FT                   NGKGAGEQVEVVDVASVLLRSVKPEAPAGEPEVAPTAS"
FT   gene            complement(93499..94233)
FT                   /locus_tag="ML5_0090"
FT   CDS_pept        complement(93499..94233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_0084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05644"
FT                   /inference="similar to AA sequence:KEGG:Amir_0084"
FT                   /protein_id="ADU05644.1"
FT                   /translation="MRVIVARARRWRTPRSVVRMDGLLLTDELVLLAYDDGGTNRLGSP
FT                   HLGYGLAGAVLLELALTGRVEVADKRLVVTDPTPTGVPLLDEALATVGSGRPRKPKDWI
FT                   GKLAKGLPERVLGGLVDAGVLRRESDRVLLVFPRTRYPSPTGAEPAVETAARERMAAAL
FT                   TGDGPVDARTAALLTLTRAVGLDRKIFRELPKERVKARIDEIAAGDWASAAVKKAIEEM
FT                   QAALMVAMTAGTSAAIMTTTTS"
FT   gene            94259..95566
FT                   /locus_tag="ML5_0091"
FT   CDS_pept        94259..95566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0091"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   sna:Snas_6404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05645"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADU05645.1"
FT                   /translation="MPLVGFVLLTAGNAFFVAAEFALVTVDRAEIDRRADEGDGRAATV
FT                   RRALRELSFQLSGAQLGITLTALLTGYLAEPALARLFAPLLHPLGGAERFSGLLALALA
FT                   TLISMLFGELVPKNLALARPMPAALATAAPMRAFSRTFGWLIRLLNESANRLVRRLGVE
FT                   PQEELASARSPEELGLLAAISARAGALPPDTAMLLRRTIRFGDKRAAEAMTPRVDVTAL
FT                   RATTTVAELLEASRRTGRTRFPVYEETLDLVTGVAGVPDALGVPLARRAATTVAAVARE
FT                   PVYVPESLNLNGVLAALKAAGADLAIVVDEYGGTDGVVTVEDLVEELVGEIADEFDPDA
FT                   VDGFGPVELTVPGGERTVLTDGVLRADELVEQTGFRLPDGPYETLGGFLMARLGHIPVP
FT                   GEAVDEAGYEFTVVEVDRHRIEQVRVVRPEEPDGGA"
FT   gene            95559..96563
FT                   /locus_tag="ML5_0092"
FT   CDS_pept        95559..96563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0092"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; KEGG: sna:Snas_6403 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05646"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADU05646.1"
FT                   /translation="MPELLVAVGLLLGNAFFVGSEFALIASRRTVIEPLAATSKRARLA
FT                   LAAMNQIPLMIAGAQLGITVCSLGLGAIAEPALAHLLEPAFAALGLPASAVHPVSFVIA
FT                   LAVVVFLHTVVGEMVPKNITLAGPEPSALWLGPAMLAFCLATKPLLLAMKWASRQVLRW
FT                   WRVEATDAVKTVFTAEELAGLVSQARTEGLLDAEEHARITGALALHSRTAADALQPWST
FT                   VTTVAEDVSPASLEVLATRTGRSRFPVVQRSTRRVLGFVHVKDVLGYAGASRRAPVPAE
FT                   IYRPLAVVPPDRTLADLLLAMRRERRHMVLVSDGRRPMGVVTLDDVLTAIVGR"
FT   gene            96734..97744
FT                   /locus_tag="ML5_0093"
FT   CDS_pept        96734..97744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0093"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: saq:Sare_0060 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05647"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADU05647.1"
FT                   /translation="MATTPPQRHAPSAPPGRRAGFRRVVHGLVTLVAAAAVGAGMLTAP
FT                   AHAAPSVDEIDAQIDKQWQQLEPTIEQFNKVRSQLRANQKKSKALKDKMVPLELASTLA
FT                   MNKVGDIAARYYIQGPSQELGALLVNSKPGALAEQLVMLDRIAEDQRRQIAGVLKVRDE
FT                   YNKQKEKLDALIALEIKQQNDLAAKKKQIDSEIKRLTAMLPVTSIRPAGCPAVDGVVSS
FT                   AARTAIKTACAQVGDPYVWGATGPNSFDCSGLTQYAYKAAGISLTHFTGAQWNEGRRIS
FT                   RSEARPGDLVFFGSDLHHVGLYLGNGVMVHAPRTGKPVQVSSISTMPIAGFVRVA"
FT   sig_peptide     96734..96880
FT                   /locus_tag="ML5_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.919 at
FT                   residue 49"
FT   gene            complement(97815..99848)
FT                   /locus_tag="ML5_0094"
FT   CDS_pept        complement(97815..99848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0094"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="KEGG: sro:Sros_8138 negative regulator of
FT                   beta-lactamase expression-like protein; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SMART:
FT                   N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05648"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADU05648.1"
FT                   /translation="MHLSAPPSGRRILLAAAVATATALATTGPVTAAPDTSAPASDRQQ
FT                   QYAAAAAEYGVPQNVLLGVSYLESRWDTHTGQPSTSGGYGPMHLTDAAHILAMPGSAHV
FT                   DEDEDPRGDDSRPLKLDPATAAAPERETPLPPASLQTLDAAAALTGLDAGTLRTDPAAN
FT                   IRGGAALLASYQKALGGPVGAGTDPAAWYGAVARYSGADTSDAAAAFADEVYDQLGQGA
FT                   SRTTDDGQRVTLAATAAKPDRSRLARLGLRNAERPDGLECPVRLACEWIPAPYEQLSDD
FT                   PGDYGNHDLGDRPKQQKIEYIVIHDTEGYFGPSVDLVKRADYLGWHYTLRSVDGYIAQH
FT                   IKTKDVGWHAGNWYVNAKSIGLEHEGFAGQGTWYTEAMYRTSAKLVRHLALKLGIPMDR
FT                   QHIIGHDNVPGINAGAVGGMHWDPGPYWDWSHYFDLMKAPFRSTGTPRTGLVTIDPDFA
FT                   TNRPAFFGCNQQPPGVPTPRPPAEPCPSRGSSSVILRTAPSPDAPLVNDLGLRPDGTPD
FT                   TMYISDHGARASAGQTYALAGRQGDWTAIWYLGQKAWFLNPASAPTAKWATGFVVTPRP
FT                   GKATIPVYGRAYPEQAAYPDTIPYQTISPLQYTFAAGQRYAVGGVLPGEYYRAVSFDGS
FT                   APGDRTVVRGENRYVQVQFGHRIMFVNLDDVLILPSPVGAPR"
FT   sig_peptide     complement(99750..99848)
FT                   /locus_tag="ML5_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.990 at
FT                   residue 33"
FT   gene            100235..101266
FT                   /locus_tag="ML5_0095"
FT   CDS_pept        100235..101266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0095"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: stp:Strop_0055 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05649"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADU05649.1"
FT                   /translation="MALHAPRPSSSRSVDRSTAVPRTRWSRFTTALAALVGTAVVLTGG
FT                   ATAAHAEPSVAEIEAQIDRDWNKLEPVIEQVNAVREQLAARRKQADALGRQIAPLQARV
FT                   DAALGQVGGLAADAYKGDNLSTVNALLGSRSPGDLVNGLELLDRFAHRQHEQVRSVAAL
FT                   RDELAAKKKPLDEMIAGLARTEAQLAAKKKQIDAEIARLQKLRLKVYGNGGGGPLRPAP
FT                   CPAGYPGGAAGAAVKFACAQIGKIYVWGAAGPDHFDCSGLTMAAWAKGGVSLPHNARQQ
FT                   HGMTKRVSRAELRAGDLVFYYSDLHHVAMYVGDGWVVHASQSGKPITMKRVDDGDINSY
FT                   GRV"
FT   sig_peptide     100235..100390
FT                   /locus_tag="ML5_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.955 at
FT                   residue 52"
FT   gene            complement(101331..101909)
FT                   /locus_tag="ML5_0096"
FT   CDS_pept        complement(101331..101909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0096"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="KEGG: stp:Strop_0056 deoxycytidine triphosphate
FT                   deaminase; TIGRFAM: deoxycytidine triphosphate deaminase;
FT                   PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05650"
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /protein_id="ADU05650.1"
FT                   /translation="MLLSDRDLVSEIKAGTLALEPFEPTLVQPSSIDVRLDRLFRVFNN
FT                   HLYTHIDPSIQQDDLTSMVEVPEGQPFVLHPGEFVLASTLEVISLGDQLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHVTLELSNVANLPITLWPGMKIGQLCIFRLSSPAEHPYG
FT                   SAVYGSRYQGQRGPTPSRSWQSWRTWPTR"
FT   gene            101988..102533
FT                   /locus_tag="ML5_0097"
FT   CDS_pept        101988..102533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0097"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: stp:Strop_0057 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05651"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADU05651.1"
FT                   /translation="MASWSEFAADEPRLADEIRLLMQQYGPGFGYLATVRADGGPRVHP
FT                   VSPVFTADGLWCFVIDSPKRRDLERDGRYALHSFPPEESDDEAYVAGRARPVTDPATVA
FT                   RLARIGRASPQGDWRLFEFTVEAAMLTRRDPVAQPGAAPPQVRVWLDPRGAEPARRDPL
FT                   AAEGRRGRHGFDTRRPAA"
FT   gene            complement(102603..103595)
FT                   /locus_tag="ML5_0098"
FT   CDS_pept        complement(102603..103595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0098"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05652"
FT                   /inference="similar to AA sequence:KEGG:Sare_0063"
FT                   /protein_id="ADU05652.1"
FT                   /translation="MGLRPNLLTRRTAGVATSTLALLLSTAAVGVVPAASAFSAAPAGV
FT                   CAEPADAHADEHANARVAKGGNAKLDPNHLTTKQVRDREADLAAAQRERASFRTGAVAP
FT                   LATVTIPVVVHVIQENSTRAGGNITDSMINQQITVLNQSYAGSTGGAATAFGFQLTKIN
FT                   RVTNPSWYPIVQGSSAERSMKTSLREGGKNTLNIYLGELSNGLLGWATFPKRTLDKMDG
FT                   VVVLNESLPGGTATNYNQGDTGTHEVGHWLNLYHTFQGGCSGSGDSVSDTPAEASPAYQ
FT                   CPTGRDTCSTAGKDPITNFMDYTYDSCMYQFTAGQASRMLTAWNAYRAA"
FT   sig_peptide     complement(103476..103595)
FT                   /locus_tag="ML5_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.650 at
FT                   residue 40"
FT   gene            103840..103913
FT                   /locus_tag="ML5_R0004"
FT                   /note="tRNA-Gly1"
FT   tRNA            103840..103913
FT                   /locus_tag="ML5_R0004"
FT                   /product="tRNA-Gly"
FT   gene            104363..104782
FT                   /locus_tag="ML5_0099"
FT   CDS_pept        104363..104782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gob:Gobs_4773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05653"
FT                   /inference="similar to AA sequence:KEGG:Gobs_4773"
FT                   /protein_id="ADU05653.1"
FT                   /translation="MKSMNDVFNEAVDYGAEGVVPVGTPVGVEKLSHVHRVFNAVMGGG
FT                   LGFAVEVLEPDDFRRAVEGFRYLDLGEVANLLAELVDSYGSSDYDVRKEEILDGLLVGA
FT                   LVDDAFRRKVSQAPSDFGFDGSVLQDPAAQQRQLR"
FT   gene            104985..105404
FT                   /locus_tag="ML5_0100"
FT   CDS_pept        104985..105404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_5747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05654"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_5747"
FT                   /protein_id="ADU05654.1"
FT                   /translation="MQLRLKYAPVPENAARFAGDIVVSAAQVSAVHLDYTPDSLTSVDA
FT                   ILDGFRAEGLTAGQVAETLFGFGCYVGEVLTRHAGGRWRATTADELAVVGWPMVVELAG
FT                   QGWCNPIAKAFKRLENGPEDSLRYFYAVFAPGGAR"
FT   gene            105492..105959
FT                   /locus_tag="ML5_0101"
FT   CDS_pept        105492..105959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_3521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05655"
FT                   /inference="similar to AA sequence:KEGG:AMED_3521"
FT                   /protein_id="ADU05655.1"
FT                   /translation="MTTTGVQVRETATVDLPTSAEAAFGFMEDPASLVVLDDSIEIGVT
FT                   LPGPKGAGEIQAFVHRSPDGRLGIMHEVVEVEPGRRAVTRTLTSGYSSGGVLTVVPLGP
FT                   DSCRLTQEIWAELPAGVLVGVDAQLRHEYRTWLAELMRRLTAWAAHAPRCR"
FT   gene            106143..106385
FT                   /locus_tag="ML5_0102"
FT   CDS_pept        106143..106385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gym:GYMC10_2335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05656"
FT                   /inference="similar to AA sequence:KEGG:GYMC10_2335"
FT                   /protein_id="ADU05656.1"
FT                   /translation="MAAELTRDEAIALVERIMSVDYADEGELGGWLDQLERDLVCPGGY
FT                   VSNLIYWSDPELTAAEVVDRALAYQPIQMRSTPWT"
FT   gene            complement(106398..107135)
FT                   /locus_tag="ML5_0103"
FT   CDS_pept        complement(106398..107135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_3115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05657"
FT                   /inference="similar to AA sequence:KEGG:Sros_3115"
FT                   /protein_id="ADU05657.1"
FT                   /translation="MIPDRTEVSDLLEKALAGAAATFQGMTAHRQESNCECHWGSAEEL
FT                   ALLKTPDVPLDEDLLRRTYWATDWRYPGPLLRRILPQLTRSLVAGRVMPMAGMDSLGYL
FT                   FTTARWREWPKGQRDALREFLDAWWLHALVEPDAKVPAHEALELIAETTGKLTPWLAVW
FT                   TESLADAVARRRLVTAVEEWVDDLVVDRLPWSSWHKEDTWGAALSLWVIRHAPIPLREH
FT                   NASSDVLDHIGLLALPYADRWDK"
FT   gene            107251..107796
FT                   /locus_tag="ML5_0104"
FT   CDS_pept        107251..107796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05658"
FT                   /inference="similar to AA sequence:KEGG:Sros_0198"
FT                   /protein_id="ADU05658.1"
FT                   /translation="MTPNASPTVDRLAGLFDWDGATETEIDWTALTEAAGHPFPEDYRR
FT                   FVERFPHGSIGFLEVLHPSDWGVPEFLRYARNWHHVMNKRAECTGGFPYHFGTSPGDLR
FT                   VWGAVNFDYLLCWHLDDGPPEQWPTVVCDTALIDPPEPYAGTATALLVEIAELRNPVPV
FT                   IGYVTEIDGVPFRLVRHE"
FT   gene            complement(107774..108076)
FT                   /locus_tag="ML5_0105"
FT   CDS_pept        complement(107774..108076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_09950 RNAse PH"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05659"
FT                   /inference="similar to AA sequence:KEGG:Ksed_09950"
FT                   /protein_id="ADU05659.1"
FT                   /translation="MDFVELVIDGQIDIDRDDLEDALNEALVGRGEVTGAGTSEHGSHL
FT                   DVDVLVTADRRAVLDAVFGVLAALDLGDSVRVRPGDGQTWIRPGQWTRSTRAGRA"
FT   gene            108154..108765
FT                   /locus_tag="ML5_0106"
FT   CDS_pept        108154..108765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0106"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: nml:Namu_1616 bifunctional
FT                   deaminase-reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05660"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADU05660.1"
FT                   /translation="MGKLIVTEFLTLDGVAQAPGEPDEDREGGFSHGGWQMPLLDEKSG
FT                   AVMFQQASSMDALLLGRKTYDIFAGYWPKAPADIPFTGLLNGVPKYVASRTLAEPLTWT
FT                   NSSLVKGDLAERVTEMNGRHGEVHVIGSLDLVQSLLRLGLVDRLNLWVYPVVLGTGKRL
FT                   FGEGTVPSALRLTESVTHAHGTLQLTYEPAGAPTYGDAAA"
FT   gene            complement(108744..109310)
FT                   /locus_tag="ML5_0107"
FT   CDS_pept        complement(108744..109310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0107"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sna:Snas_3209 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05661"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU05661.1"
FT                   /translation="MPELERLAAHHAPAVLRFERENRAYFARYVPGRGDDFFTGYAARH
FT                   AALLDEQERGTCHFHVLVGDHGAVLGRFNLVDVAGGSAELGYRVAERAAGRGLASEGVR
FT                   RVCELARTEYGLRRLVASAALANPASLAVLKRAGFVLDGSERGDSVHDGSVRSGSVSGC
FT                   EVDLDGEPGLRHVLDLRAPYAAASP"
FT   gene            complement(109320..109715)
FT                   /locus_tag="ML5_0108"
FT   CDS_pept        complement(109320..109715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0108"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sro:Sros_0848 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05662"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADU05662.1"
FT                   /translation="MHNHLVTVTGFDHLVLSVSDVERSLDFYCSTLGLAPVRVARWRAG
FT                   EVPFPSVRVDAGTIIDLIEGDPTGSNVDHFCLVVEPVDWQRVVDSGVFTVLTGPVPRFG
FT                   ARGTATSIYVSDPDGNTIELRCYPADA"
FT   gene            109804..110697
FT                   /locus_tag="ML5_0109"
FT   CDS_pept        109804..110697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0109"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: sro:Sros_0846 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05663"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU05663.1"
FT                   /translation="MLERYEVETFLTLAEELHFGRTAERLRVSTGRVSHVVRKLERRIG
FT                   APLFERTSRVVRLTPIGARLAEEMRPLVAGIEAAVQRAVDAGRGLTGELRVAYVGESTA
FT                   PVLLRAVALFTERHPDCEVHVHEAPLASTRSSLLDGTIDVLIASYPFDGMANGPVLLRE
FT                   RRVLAVAADHPLAAEESVSLEVLGDHPVVQYPAVTSAAFKQDRTPDRTPSGRPVPKGPV
FT                   GGSFSEMLALVAMGRGVLPVGEQARQFYARPDVAYVPIHDAPPICRGPVWPAGNTTSRV
FT                   REFVRAAADANPLPPD"
FT   gene            110730..111296
FT                   /locus_tag="ML5_0110"
FT   CDS_pept        110730..111296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0110"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: kfl:Kfla_6947 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05664"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADU05664.1"
FT                   /translation="MRDEIRALVEELPPGDELEARHREAALAWLAATDDIFRRVKPRTP
FT                   SPHLVAYFLLRDPADGAVLLVDHRLAGMWLPSGGHVEPGEHPAYTVRRELREELGVAAV
FT                   FAPPFGERPAFLTVTETVGPPEHRHTDVSLWYVLSADRDQRFTPDPVEFAGIRWWTPAE
FT                   VNEAPTGTIEPHLGRMLTKLATTTP"
FT   gene            111373..112425
FT                   /locus_tag="ML5_0111"
FT   CDS_pept        111373..112425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0111"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="PFAM: regulatory protein MerR; Protein phosphatase
FT                   2C-like; KEGG: stp:Strop_2316 regulatory protein, MerR;
FT                   SMART: regulatory protein MerR; protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05665"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADU05665.1"
FT                   /translation="MRLLTIGAFARATGLSAKALRIYDDCGLLPPAAVDPHSGYRYYAP
FT                   EQADRARLIAGLRRAGMPLAEIRTVCGLPPAAAAEALDAWWRRVSADTAARGRAVALLV
FT                   DRLSERGTTMSETTFRYATGCETGTVRDSNEDTAYASAALLAVADGVRGPAGSTASAAA
FT                   VDALRPLEQADASGADLLAALADAVNRADRAVRAHATDADQPATTLTALVRRGTRLALV
FT                   HVGDSRAYLLRGGELSRLTQDHTYVQTLVDQGRLTPAEALAHPQRALLARALGAGAEVE
FT                   ADLALRTALPGDRYLLCSDGLSAVVDPGALHAALAEADDPAAAVERLVEQAYAAGAPDN
FT                   IACVVADLAA"
FT   gene            112447..113358
FT                   /locus_tag="ML5_0112"
FT   CDS_pept        112447..113358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0112"
FT                   /product="Luciferas family protein"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: saq:Sare_0082
FT                   luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05666"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADU05666.1"
FT                   /translation="MSGPGRTLAIMRIGIVILPDQRWSEARRRWAQVDEWGFDHAWTYD
FT                   HLGWRDLVDGPWFDSWTTLTAAAGVTSRVKLGTLVASPNFRHPAAFARQVTALDDVSDG
FT                   RVLLGLGAGGIGFDSAVLGGETLPPRQRVDRFAEFTELLDLILREDGTTWRGEWFTAVD
FT                   ARNNPGCVQQPRVPFVMAANGPRSMRLVARFGQGWVTTGLGGDDIEAWWGTVAELSDRM
FT                   TRTLEQAGRDPATLDRYLSLDSAPVFSLTSADFLAEQVARAARLGFTDVVTHWPRASSW
FT                   YAGDEAVLVEAAALLPELRRAG"
FT   gene            complement(113355..113768)
FT                   /locus_tag="ML5_0113"
FT   CDS_pept        complement(113355..113768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0113"
FT                   /product="protein of unknown function DUF437"
FT                   /note="PFAM: protein of unknown function DUF437; KEGG:
FT                   sco:SCO4741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05667"
FT                   /inference="protein motif:PFAM:PF04266"
FT                   /protein_id="ADU05667.1"
FT                   /translation="MWPRIGGLRALALGTPGELRTRLNTLVLSGAKTATAGLVQEYDDE
FT                   NEELEYVGERLVLVDDNDALVGVVEVTGVEVVRFADVPWDFARAEGEGDRSIEEWREGH
FT                   GAYWARQRTPVTDDTRIVCLRFRLVSTEGSVGT"
FT   gene            complement(113809..114348)
FT                   /locus_tag="ML5_0114"
FT   CDS_pept        complement(113809..114348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0114"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   stp:Strop_0086 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05668"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADU05668.1"
FT                   /translation="MLSRRLVELFEWIDPGPGSTHLVSDISGWWRDPDVLAQVGPALAG
FT                   LFPEDRPTVVIAPEVTGLLLGPLVAVAAGAGFLPAYKDGGERRRAGPTRWAETPPDYRG
FT                   RRLRVGVDGRRLNPGDRVLLVDDWVDTGAQLDALRRVVRDAGAGLIGAAALVATCPPEV
FT                   AARLRLRALLTGADLP"
FT   gene            114517..115149
FT                   /locus_tag="ML5_0115"
FT   CDS_pept        114517..115149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0115"
FT                   /product="rare lipoprotein A"
FT                   /note="KEGG: saq:Sare_0084 rare lipoprotein A; TIGRFAM:
FT                   rare lipoprotein A; PFAM: Rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05669"
FT                   /inference="protein motif:TFAM:TIGR00413"
FT                   /protein_id="ADU05669.1"
FT                   /translation="MAARHLRTRKFSSPAAIAATAAVGVALAVGGTVGAVRLTSAEPPA
FT                   EPAVVETLPSTPAPTSAAPSPSASASPSASLSPSPKATPSPKASRTQAASRSKARTASP
FT                   SPTAKKTSSPKVVDSGSCGASFYAEGQMTANGETFNPDALTAAHKTLPFNTKVRVTNPA
FT                   NGKSVVVRINDRGPFIDGRCLDLSRAAFATIAATSLGHVNVRYEVLG"
FT   sig_peptide     114517..114603
FT                   /locus_tag="ML5_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 29"
FT   gene            115218..116342
FT                   /locus_tag="ML5_0116"
FT   CDS_pept        115218..116342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0116"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: saq:Sare_0085 protein serine/threonine
FT                   phosphatase; PFAM: Stage II sporulation protein E; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05670"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADU05670.1"
FT                   /translation="MLSDVRTQPFQPGRGPLSPGSRAGLGAALALLAIVVAVELADGRP
FT                   AHYLALMVVAPLLAAALASWRVVLAVGGLATAIGIGFAVAERGSPLVTVVNVTAVGVAT
FT                   AIAAATAAIRQRQADRIAELSRLASVAQQAVLRPLGPQVGTLAVAARYISSTATAEIGG
FT                   DLYEVMDTPYGVRMIIGDVRGKGLDAVRLASIVLGSYRHVAYERADLRAVVTDLDRAVA
FT                   RNVGDEDFVTAALIEERGGTLTIVNCGHPSPLLLRRGAVIPLEPPAPAPPLGFMPVVRP
FT                   RVERLEPGDRLLLFTDGLGEARRDGEFFPTADRAWRLLGHGTVADGLASLETALVEWVH
FT                   GRLDDDIALVLMEYVGPRSTTATPVPSWEVGAAD"
FT   gene            116463..118319
FT                   /locus_tag="ML5_0117"
FT   CDS_pept        116463..118319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0117"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: stp:Strop_0089 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05671"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADU05671.1"
FT                   /translation="MTHYKSNVRDLEFNLFEVFGADRTFGQAPYTDLDVDTARSFLSEV
FT                   DRLAREDLAASYSDSDRNPPVFDPATFTAPLPESFKKSYKAFMDSEFWRLDLPETLGGT
FT                   NAPRALWWSLAELVLGANAPIWMYASGPSFAHVLHVEGTEEQKKWARLFIEKQWGSTMV
FT                   LTEPDAGSDVGAGRTRAIQQPDGSWHIEGVKRFITSGEHDLSDNIVHYVLARPVGVEGV
FT                   GGPGTKGLSLFVVPKYHFDAETGELGERNGVYATNVEHKMGLKVSNTCEVTFGEHGVPA
FT                   KGWLLGEKHDGIRQMFMIIEYARMMVGTKAIATLSTGYLNALEYAKNRVQGADLVQMTD
FT                   KTAPRVTITHHPDVRRSLLLQKSYAEGLRALVCYTASWQDKVAIAEAAGDEKATKLAKR
FT                   VNDLLLPLVKGVGSERAYELLGHESLQTYGGSGFLQDYPLEQYVRDAKIDTLYEGTTAI
FT                   QSLDLIFRKIVRDNGKALMAVAAEIQEHIASEAGNGQLKEERQALGKALAEIQNILGVM
FT                   TGWLGEAQGGDTRALYKVGLSSRRFLLAIGDLVVGWLLQKQADVALKALAGEVSAADKS
FT                   FYTGKVAAARFFAREVLPRIGADRRIIEGTDLEIMDLPEEAF"
FT   gene            118504..118773
FT                   /locus_tag="ML5_0118"
FT   CDS_pept        118504..118773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05672"
FT                   /inference="similar to AA sequence:KEGG:Sare_0087"
FT                   /protein_id="ADU05672.1"
FT                   /translation="MGIGSAIFLIALGAIMTFAIRANVWWIDLRAVGWVFILAGLGVLL
FT                   TTLWFWQDRRKRARTLIVEENRLSHPTAMMPPPPDPPPPTAPPS"
FT   sig_peptide     118504..118572
FT                   /locus_tag="ML5_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.786 at
FT                   residue 23"
FT   gene            complement(118783..119649)
FT                   /locus_tag="ML5_0119"
FT   CDS_pept        complement(118783..119649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0119"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: cai:Caci_5769
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05673"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU05673.1"
FT                   /translation="MARTTLPGGTWTLGDLTVTRFGYGAMQLAGPWVMGPPADHDGALA
FT                   VLREAVALGITHIDTSAAYGPYVTNRLIREALHPYPESLHVVTKVGADRDEQGGWPTAR
FT                   DPQSLRRQVRENLETLGVDALGLVNLRLGDATGPQPGSLAEALETLVALRQEGLIRHLG
FT                   LSNVTPEQVAEAQTIAPIVCVQNRYNLAHRGDDDLIDELARQGVAYVPFFPLGGFTPLQ
FT                   SSALSAVAERLGATPMGVALAWLLRRSPNILLIPGTKSVAHLRENVAGAGLALSGDDLA
FT                   ELDRIGR"
FT   gene            119800..120207
FT                   /locus_tag="ML5_0120"
FT   CDS_pept        119800..120207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0120"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   cai:Caci_5768 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05674"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADU05674.1"
FT                   /translation="MSKAEYDAFLAQCPSRQLLDRIADKWVTLVLAALRSDGSHRFGAD
FT                   CAGVPRPMRYSELSRTLAGVSQKMLTQTLRALERDGLVTRTVEPTVPVTVTYELTALGL
FT                   SLLKTIQGLKVWAETHMDDVLTNREAYDSRV"
FT   gene            complement(120218..120754)
FT                   /locus_tag="ML5_0121"
FT   CDS_pept        complement(120218..120754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0121"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: saq:Sare_0088
FT                   putative phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05675"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADU05675.1"
FT                   /translation="MTDGRNGQRTLVLLRHAKAEQSADGPDAERSLTARGHADAAAAGA
FT                   WLARQGLLPDVVLCSPARRTRQTWHDVAMGMTGSPPEGGPAGSRPAVRYEAAAYDAHPD
FT                   QLLALVRTVEPTAGTVLLVAHNPGVSLLSALLDPQRADPDGLRTTDLVVHRPTTRWAEL
FT                   ALGGAPLTARHTARA"
FT   gene            120872..121162
FT                   /locus_tag="ML5_0122"
FT   CDS_pept        120872..121162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05676"
FT                   /inference="similar to AA sequence:KEGG:Sare_0087"
FT                   /protein_id="ADU05676.1"
FT                   /translation="MGIGASIFLIALGAIFAFAIDADLGWLNLNVVGWVLMLAGVAGLL
FT                   TTLYFWNSRRRVVAAPVREQVVAEPVVPVRDDRVVREEYREVRRPGSGYPA"
FT   sig_peptide     120872..120931
FT                   /locus_tag="ML5_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.747 at
FT                   residue 20"
FT   gene            complement(121227..121904)
FT                   /locus_tag="ML5_0123"
FT   CDS_pept        complement(121227..121904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0123"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="manually curated; TIGRFAM: channel protein,
FT                   hemolysin III family; KEGG: saq:Sare_0093 hemolysin III
FT                   family channel protein; PFAM: Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05677"
FT                   /inference="protein motif:TFAM:TIGR01065"
FT                   /protein_id="ADU05677.1"
FT                   /translation="MTTSAPFRLRPADIGKPRMRGWLHAYAFFAALVCGIVLCSIAAGR
FT                   PGWAPLVSCLIYSFTVCGLFGTSALYHRRVWTERGYQIMRRMDHSMIFVFIAGTYTPFC
FT                   ALLLDNRQATIMLSLVWGGAIAGVAVKLIWPHAPRWVSAPLYLALGWVAVAMLPQILHS
FT                   GGVTALVLLSVGGAIYSVGAVFYALRRPNPWPTVFGHHEFFHACTLVAAICHHIAIYFA
FT                   LFA"
FT   gene            121980..122594
FT                   /locus_tag="ML5_0124"
FT   CDS_pept        121980..122594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0124"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="KEGG: stp:Strop_0097 allophanate hydrolase subunit
FT                   1; PFAM: Allophanate hydrolase subunit 1; SMART:
FT                   Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05678"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ADU05678.1"
FT                   /translation="MRIRPVGAHALLLDCDDAEQAQAWGAELWHRREAGELTATEIVPG
FT                   AVTVLLDGVPDPQAAAARIAAWHPRTAASGAATTEVRVPVVYDGEDIPLVAGHWNVDVP
FT                   AVVDRLRRTEFRVAFCGFAPGFAYLTGLPPELAVPRLATPRTRVPAGSVALAGPYAGIY
FT                   PAASPGGWLLVGRTDLPLFDVHADPPARLTPGTRVRLVDAS"
FT   gene            122591..123460
FT                   /locus_tag="ML5_0125"
FT   CDS_pept        122591..123460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0125"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: stp:Strop_0098 UreA
FT                   amidolyase related protein; SMART: Allophanate hydrolase
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05679"
FT                   /inference="protein motif:TFAM:TIGR00724"
FT                   /protein_id="ADU05679.1"
FT                   /translation="MIEVLRAGALTTVQDQGRPGWAHLGVPRSGALDPAALRLANRLVG
FT                   NDEHAAGLEITVTGCTLRFTRAVAVALTGAPADVVVEWRAGSARRRPGDVGRPLALPAG
FT                   AVLRVGPARAGVRTWLAVSGGIAVEPVLGSRATDTLSGLGPPPLRDGDRLPIGTPAGPP
FT                   APVDLAVTRPVPDELRLTVRPGPRQDWFTPEALDVLCRTAYTVSPDSNRVGARLAGAAV
FT                   TRAVAGELLSEGLVLGAVQVPPDGRPLVFLADHPTTGGYPVIGVVDDVTPLAQARPGTT
FT                   VTFHGPQR"
FT   gene            123444..124193
FT                   /locus_tag="ML5_0126"
FT   CDS_pept        123444..124193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0126"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: saq:Sare_0096
FT                   LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05680"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ADU05680.1"
FT                   /translation="MDLNADLGEGFGSWRLGDDHALLDLISSANVACGFHAGDAATMHR
FT                   VCAGAAERGVAVGAQVGYRDLAGFGRRHIAYDFAELRDETIYQLGALDAFCRLYRTRVR
FT                   YLKPHGALYHAAARDEGQAAALVAAISGYDHELPVLCQPGTVLAQLAAGAGLRVVAEGF
FT                   ADRNYLPNGTLVPRSSPDALVTDPEQVAVRAVRMAVERTLVAVDGTVIPAPVESICLHG
FT                   DTPGAVRCTELVRAALIDAGVTLTPFA"
FT   gene            complement(124254..126086)
FT                   /locus_tag="ML5_0127"
FT   CDS_pept        complement(124254..126086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0127"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; NHL repeat containing protein;
FT                   KEGG: saq:Sare_0097 alkyl hydroperoxide reductase/thiol
FT                   specific antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05681"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADU05681.1"
FT                   /translation="MSARVRAPELRGRAWLNTGGKAVTLADLRGKIVLLDFWTFCCINC
FT                   LHVLDELRPLEDKYGDVLVVIGVHSPKFEHEKDPAALAAAVERYGVHHPVLDDAEMDMW
FT                   QQYAAKAWPTLAVVDPEGYVVATMAGEGHAEGLARLIDELIAGHEAKGTLHRGEGPYVP
FT                   PAEPDTVLRFPGKALPLDGGNLLVSDSARHSLVELAADGETVVRRIGTGSRGRTDGPAS
FT                   AATFAEPQGLCLLPPHVAEVAGYDVVVADTVNHLLRGVRLSSGEVVTVAGTGRQWRSTV
FT                   DDHAHDARAVDLSSPWDVAWYDDRVVVAMAGIHQLWWFDPIKRTAGMYAGTTVEALRDG
FT                   PLPDVWMAQPSGLSVSADGSRLWVADSETSAIRWVSDGEMHTAVGQGLFDFGHVDGPAD
FT                   QALLQHPLGVCALPDGSVLIADTYNGAVRRFDPETGQVGTVADGLAEPSDLVLTGEGDV
FT                   LVVESAAHRLTRLAPGALTSAGANTVDGPRHRLERKPTDVAAGELTLDVIFTPAPGQKL
FT                   DETYGPSTRLVISASPPELLVEGAGTTTDLSRKLVVSGDVAQGVLQVTAQAATCDADVE
FT                   HAACHLTRQDWGVPVRVVTGGATRVPLVLRGMDA"
FT   gene            complement(126206..128983)
FT                   /locus_tag="ML5_0128"
FT   CDS_pept        complement(126206..128983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05682"
FT                   /inference="similar to AA sequence:KEGG:Sare_0105"
FT                   /protein_id="ADU05682.1"
FT                   /translation="MTSEAPHRPGQEPGEVSPGTGGPVPYGDQPAQQDNGYNGAPDLGW
FT                   APPPPAGRPAQPAPAWAANDDQPPAWAPPAGQPVTGRATAQVPQPAWGGNDQGNPAWAG
FT                   SGGPSWGNQEQSGPDRGAEQAPPAWAATPPGSPAEPSQAPWAAEQNRPGWGSGEQPGWS
FT                   PSGDPAARGTGYVPAPATVPNETWVTPAPADDPHRSGGFAPTGGQHEDASGRAGGWAAA
FT                   QQQDDPNRSGGWNPRDEQPAASDDPNRSGGWNPRESQPAWAPGQQTGATWPPADPPARA
FT                   AAAVSVPGAARPDNAWSTPEQSDQDNRSVEDSGGWRATGGPQHDEGQRSGGWPAPQAEN
FT                   RSGGWDEPARPEDPDRSGGWAAGRAASPAEAAQPGGWEPNQSRQVGGWGDDTAVPQQRD
FT                   SGEQAGAWSGAASVPQQHEPGRPSDEPAQPAWGAAAPAEARASVSVPSSDAPAGWGGNQ
FT                   DERAAAPSPEPWSPAEAWGRSEDSAPAYQPAPAPGISPGNAVPLPAQQQRVPGAALAAS
FT                   SPADHPGPEPQGYEPERGDGGWNEPQSPAVPGPRTSPEGGPVSASASVPVASRVTPPSD
FT                   QPLPTSGPAPQPRVYGRPARPEPDEAPEQDESGFPGQDGPHGNGFPGPQSRSEDADGPH
FT                   GYAGAPSSPAAPPAFPVGVPSFVDTPGNTRPANGVHPGGEQPDASRDPFGGPQSPYGAP
FT                   GGQDAFGGPGGRPDPFGAPGGQQDAFGGPGQQDPFGGPGGQQAPFGSPAGRPEPFGEQD
FT                   RFGPSAGGRASVAVPGQGPAGGGNTFPPPPQQAPPAWSQDGPGTEPEQGRFDAFKPDAA
FT                   ESQTEAPPPKVRNGRVLAAVLIAAVLILAVPLGLLTLLGKVGDDKSAGFDPAVGSCVKQ
FT                   SGTSAVAADCGEPGAFSVVSKVDNKDKCADLAQPSVSVESGGTTRVLCLKPAGQ"
FT   gene            complement(129332..129469)
FT                   /locus_tag="ML5_0129"
FT   CDS_pept        complement(129332..129469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05683"
FT                   /inference="similar to AA sequence:KEGG:Sare_0106"
FT                   /protein_id="ADU05683.1"
FT                   /translation="MSMIERIRTRRDANRRARAIEHALRSANSPAVREELLAIAQRHMS
FT                   "
FT   gene            complement(129694..131163)
FT                   /locus_tag="ML5_0130"
FT   CDS_pept        complement(129694..131163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0130"
FT                   /product="catalytic domain-containing protein of components
FT                   of various dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain-containing protein of
FT                   components of various dehydrogenase complexes;
FT                   biotin/lipoyl attachment domain-containing protein; E3
FT                   binding domain protein; KEGG: saq:Sare_0107 dehydrogenase
FT                   catalytic domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05684"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ADU05684.1"
FT                   /translation="MSRIKEFNLPDLGEGLTEGEILAWLVKVGDDIELNQPIVEVETAK
FT                   AAVEIPAKWAGRVQAIFHPEGSTVEVGVPIIAIDTDPNAGPIEESTTATPASDLPAPSA
FT                   ASLAAVQVAPAEGMVEPGLIGGVAPGGRTAVLVGYGPRNAPAKRRPRKGDAPAAAPIQA
FT                   AAPVAPAPVAPAPVAPAPAPAVNGNGRVSGPVLAKPPVRKLAKDLGIDLATLTGSGPLG
FT                   SITREDVQRAASATPAAAEPLTVAAPAASAASFGADREQRIPVKGVRKLTAENMARSAF
FT                   TAPHVTEFLTVDVTRAMKALDRLRDRREWRDVRVSPLLLVAKAVLLAVKRHPMVNSTWA
FT                   GDEIVVKEYVNLGIAAATERGLIVPNIKDAGRLSLRELADAMTELVQTAKSGKTSPADM
FT                   SGGTLTITNVGVFGVDTGTPILPPGESAILAFGAVREQPWVHKGKVKPRLVTTLGLSFD
FT                   HRIIDGELGSKFLRDIGDFLADPEAALLAWT"
FT   gene            complement(131169..132158)
FT                   /locus_tag="ML5_0131"
FT   CDS_pept        complement(131169..132158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0131"
FT                   /product="Transketolase central region"
FT                   /note="KEGG: saq:Sare_0108 transketolase central region;
FT                   PFAM: Transketolase central region; Transketolase
FT                   domain-containing protein; SMART: Transketolase central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05685"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ADU05685.1"
FT                   /translation="MATETLTLGKALNTGLRRALENDPKVVIMGEDVGKLGGVFRITDG
FT                   LQKDFGDQRVIDTPLAESGIIGTAVGLAIRGFRPVCEIQFDGFVYPAYDQIVSQVAKMH
FT                   YRSQGKVRIPMVIRIPFGGGIGAVEHHSESPEAYFAHTAGLKVVSCANPQDAYVMIQQA
FT                   IASDDPIVFLEPKRRYWEKGPVDLDAPIADAYPLHSARVARPGADATVLAYGPMVRTAL
FT                   DAATAAAEDGRELEVIDLRTISPLDLTAAYESVRRTGRCVVVHEAPGNLGLGSEIAARI
FT                   TEECFYSLESPVLRVTGFDTPYPAARVEEEYLPDLDRVLDAVDRTFGW"
FT   gene            complement(132158..133336)
FT                   /locus_tag="ML5_0132"
FT   CDS_pept        complement(132158..133336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0132"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; KEGG:
FT                   saq:Sare_0109 pyruvate dehydrogenase (acetyl-transferring);
FT                   PFAM: dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05686"
FT                   /inference="protein motif:TFAM:TIGR03181"
FT                   /protein_id="ADU05686.1"
FT                   /translation="MAKGDPGAATRSKRAAPRTRRAAATGEPELVQLLTPEGERIESAL
FT                   GPDGTEYRVDFTDEEYRGLYRDLVLVRKLDAEATALQRQGELGLWASLLGQEAAQVGSG
FT                   RALRTQDMAFPTYREHGVLYCRGIDPIMPLGLFRGVDQGGWDPNEFKFNMYTIVIGAQT
FT                   LHATGYAMGVAMDGKTGGEDGEAVIAYFGDGATSQGDVNESFVWASVFNAPLVFFCQNN
FT                   QYAISEPLERQTRVPLYRRAGGFGFPGVRVDGNDVLASYAVTRHALDNARNGQGPSLIE
FT                   AYTYRMGAHTTSDDPTRYRIASEVEAWQAKDPIARMKAFLTKQKIADESFFTAVDEQAR
FT                   TESVHLRERVLAMPDPQPVTMFDHVYPNGSPELDEQRARFTQYMESFEGSAH"
FT   gene            complement(133947..134528)
FT                   /locus_tag="ML5_0133"
FT   CDS_pept        complement(133947..134528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05687"
FT                   /inference="similar to AA sequence:KEGG:Sare_0110"
FT                   /protein_id="ADU05687.1"
FT                   /translation="MWETDGLAGPDGSAGPDGSAGPDGSDGLDGSDEPAEGVGSAVVTD
FT                   GSGLGLGSGVGVAGSDGECDGDGEGTGDGRGGRTGVGRTGADGGGGAATGRDRCREPRS
FT                   LSSGRAGAAGSTGRAGGTDVTSTAGVGVDGAGAWVPWGIGMTTGPTEGVGRNGVLVSGR
FT                   ALLPTVADPVLIAARIGIDAVPASNATVSR"
FT   gene            135214..136079
FT                   /pseudo
FT                   /locus_tag="ML5_0134"
FT   gene            complement(136095..137321)
FT                   /locus_tag="ML5_0135"
FT   CDS_pept        complement(136095..137321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05688"
FT                   /inference="similar to AA sequence:KEGG:Sare_0111"
FT                   /protein_id="ADU05688.1"
FT                   /translation="MATPQTPYDAVLHAARDVTRLDSALDAEMLGAALLGSVYAVAEHD
FT                   RERAVREFVSGFLAATSRRRSAAATTLRAVFAALVPDAEGAARVRPGAYAPSWAGQLGR
FT                   VRVTGAWAYGDVYGDQTSYLATFAYDDEEEGGPEHALVALVDHNIGITKDVFVGGPAGR
FT                   IVEQAREICTEDEFTWFRTEDPARMHAEVSRHLAVTDDLTELPAQGSLATDRALVGARL
FT                   AVLPGPTPPAGPAVVPPPTDEERTRLIRAFLDSPEATRFGLPEVADGELASLHFCLGLL
FT                   LDHAASFPDADPMRWSPMVAELFLLDWVHRRAVLDMDDAAMLPRVLRAWAAYAARQRGL
FT                   SQSAAARTDEAITEMVPEFARLYSTGERRSPATAAVAQLMADGVDPDDPEALNAWIEAN
FT                   RHRLTDDPA"
FT   gene            complement(137374..139077)
FT                   /locus_tag="ML5_0136"
FT   CDS_pept        complement(137374..139077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0136"
FT                   /product="putative ABC transporter"
FT                   /note="KEGG: mkm:Mkms_1571 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05689"
FT                   /inference="similar to AA sequence:KEGG:Mkms_1571"
FT                   /protein_id="ADU05689.1"
FT                   /translation="MSASKDGTVGNIVGRMREAMRGEQRVDPDTLIERLTAIQRFLGAV
FT                   DGHVPDAQLVAAHTVVERAGDRLALSGRHTVVALAGATGSGKSSLFNSLARLDLSPVGV
FT                   RRPTTGVAHACVWGPLDGAVRLLDWVGVLPRHRFVRESPLDADDESNLHGLVLLDLPDF
FT                   DSVQHGHRLEVDRLLGLVDLVVWVVDPQKYADRVIHTSYLREFHRHKDVTVVVLNQADR
FT                   LHPTELPKVLDDLRRLLDADGLGGVPLLPTVAVDPNGLEGLRTELERTVAERQAALRRL
FT                   SGDVDAVVADLEPLVGPEPPRTRPGDASAQELTRALAGAAGVPTVAAAVEGAYRHRAVS
FT                   NTGWPLLRSWRKLRPDPLRRLHLPGRDPDAPAESLVAATSVPDPTAAQRSALTLAIRAV
FT                   AERSGSGLPAPWPTAVTAAARARQADLPGALDHAVAATDLGMDRRPGWWRVVGVIQWVV
FT                   TLAALAGLAWLVLGYALRLLGLPPLEHPTLGVVPWPTVLLLGGLLAGLLVATVTRPVVG
FT                   WAARRARRRAEERLLTSVGSVGEKYVLDPVWAVLARYGTARDALREAGRR"
FT   gene            complement(139133..140950)
FT                   /locus_tag="ML5_0137"
FT   CDS_pept        complement(139133..140950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0137"
FT                   /product="putative ABC transporter"
FT                   /note="KEGG: gob:Gobs_0079 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05690"
FT                   /inference="similar to AA sequence:KEGG:Gobs_0079"
FT                   /protein_id="ADU05690.1"
FT                   /translation="MTTHGDSATRAGAPAVAARTGATTGDDQPAHAADGLPAALTGLRA
FT                   AISAARFPLTLPSAEPARHAATSLTDQLDDYLLPRLARLDAPLLVVVGGSTGAGKSTLV
FT                   NSLVQARVSAAGVLRPTTRSPVLVCSPTDAAWFRQGELLPGLTRTTEPSEQPGTLHLVT
FT                   APALPPGLAFLDAPDIDSVVDANRALAGQLLAAADLWLFVTTAARYADAVPWELLRSAR
FT                   ARGTAVAMVLDRVPPEAADEVATHLSEMLAEQELGASPLFVLPETWVDGQGLLPDRITA
FT                   PLSDWFARLAADADARATVVRQTLDGALAALHPVVEALAEAADEQVTAADALDERVQAA
FT                   YRSAERSVDQGLKDGRLLRGEVLARWQEFIGTGDFFRGLEARIGRLRDRVVAAVTGRPA
FT                   PASELRTAIESQLVTLLRGVAAEAAENAYTGWKAHPAGAALLEPDLAHPSADLPQRAEQ
FT                   LVRDWQRGVLELVRVEGGDRRFVARTAAYAVNATGLAVMIGVFASTAFIPTGLEVAAGT
FT                   GTAVAGQTVLQAIFGDQAVRNLARKARVDLLDRVGKLLAEEAARYLSRTEAERPAANAG
FT                   AALRWAAVEVERARHRSGLFPGPEQDGRP"
FT   gene            141161..143023
FT                   /locus_tag="ML5_0138"
FT   CDS_pept        141161..143023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0138"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: saq:Sare_0112 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05691"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADU05691.1"
FT                   /translation="MARAVGIDLGTTNSCVSVLEGGEPTVIANAEGSRTTPSIVAFARN
FT                   GEVLVGEVAKRQAVTNPDRTIRSVKREIGTNWTVDIDGKKYTPQEISARTLMKLKRDAE
FT                   AYLGEQITDAVITVPAYFNDGQRQATKEAGEIAGFNVLRIVNEPTAAALAYGLDKGSKE
FT                   QTVLVFDLGGGTFDVSLLELAEGVVEVKSTSGDNQLGGDDWDQRIIDHLVKTFRGEHGI
FT                   DLSQDKMAMQRLKEAAEKAKIELSAATTSNINLPYITAGSAGPLHLDVTLSRAEFQRMT
FT                   QDLLDRCKGPFEQAVKDAGIKISDVDHVILVGGSTRMPAVTDLVKQLTGRDPNKGVNPD
FT                   EVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKLIERNTTIPTKRSEVFT
FT                   TADDNQPSVLIQVFQGERDIAAYNKKLGTFELTGLPPAPRGVPQIEVTFDIDANGIVNV
FT                   HAKDLGTGKEQKMTITGGSSLPKDDIERMRRDAEEHADEDKRRREEAETRNVAEALQWQ
FT                   TEKFLAESGDKLPGENRDQLNEALGELRSALGGQDIEKIKSAHEKLAQVSQQAGSLLYA
FT                   QQQEGEQTAPGAAGPGAGAGAAGGPKAGGDDDVVDAEIVDEDKK"
FT   gene            143072..143809
FT                   /locus_tag="ML5_0139"
FT   CDS_pept        143072..143809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0139"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: stp:Strop_0114 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05692"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADU05692.1"
FT                   /translation="MTDKPRAADPGATGSAPGAGKDTGDEPRVVIRDKRKLGKVTEQPA
FT                   NDASAADAAADAPAEGLVEEAEVVVDEIGGEAEVSGPTVVDSPAEPNGGTGTGAPLGAE
FT                   LESLRTDLEERTRDLQRVTAEYANYRKRVDRDRNLVQEQATGAVLTALLPILDDLDRAR
FT                   EHGDLVGPFGSVAEQLTGALAKFGLTAFGETGDPFDPTRHEAVAHQTSADVTEPTCVQV
FT                   MRRGYQLGERLLRPAMVAVADPE"
FT   gene            143889..145076
FT                   /locus_tag="ML5_0140"
FT   CDS_pept        143889..145076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0140"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: chaperone
FT                   DnaJ domain protein; heat shock protein DnaJ domain
FT                   protein; DnaJ central domain protein; KEGG: saq:Sare_0114
FT                   chaperone protein DnaJ; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05693"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADU05693.1"
FT                   /translation="MSSKDWIEKDYYAALGVDKSASSDEIKKAYRKLARESHPDHNPGD
FT                   TGAEERFKTVSEAYAVLGDEKKRREYDEMRSLFGSGAFRRNARGAGQPGGMPFDVSDLF
FT                   GGGAGGGDSRFSGGGFTDLFSSIFSGGAGGGGPARPRGPARGRDVETEVALDFEDAVRG
FT                   VTLPLTLRAPGVCDTCHGNGAKPGTQPVACPVCHGAGVTTRNQGSFSFSEPCRNCQGVG
FT                   TIVEEKCPECHGTGGVTKTRTLHVRFPAGVSDGQRIRLAGRGEPGERGGPAGDLFVQVK
FT                   VRPDELFGRTGDDLTLNVPITYAEAVLGTDLRVPTLDGTVTLRVPPGTPSGRVLRARGK
FT                   GVVRKDGRAGDLLVTLDVVVPAKVSDEARAALETFAAQTPPAAREHLDARVRRFS"
FT   gene            145101..145541
FT                   /locus_tag="ML5_0141"
FT   CDS_pept        145101..145541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0141"
FT                   /product="regulatory protein MerR"
FT                   /note="KEGG: saq:Sare_0115 MerR family transcriptional
FT                   regulator; PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05694"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADU05694.1"
FT                   /translation="MSEEYVGSGDQAYEAKVLMISVAARMAGMHPQTLRQYDRLGLVQA
FT                   GRASGGGRRYSVRDVVLLREVQRLSQDDGINLAGVKRIIGLERLLEEAQQRVARLEAEL
FT                   DAAYRRIAELESLGGFPRGDLVPTNRTSTALVVWRPRRAPDR"
FT   gene            145718..145924
FT                   /locus_tag="ML5_0142"
FT   CDS_pept        145718..145924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05695"
FT                   /inference="similar to AA sequence:KEGG:Strop_0117"
FT                   /protein_id="ADU05695.1"
FT                   /translation="MTEPAKKVAERAEERLEKVAENVRERFDRVTEGRFSDKVKEGRFA
FT                   DQTDHGVDRARDDERRKKQGGST"
FT   gene            complement(146154..146582)
FT                   /locus_tag="ML5_0143"
FT   CDS_pept        complement(146154..146582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05696"
FT                   /inference="similar to AA sequence:KEGG:Strop_0118"
FT                   /protein_id="ADU05696.1"
FT                   /translation="MSVQEETFRGFANPVDPSPAELRAWAYQPDSVPLTSMPPDWDLLV
FT                   AGDHLVQTLFDLAMDQGCPARRFTLHCLYIYAADGIRTNFRAHPKRRFRKLVEQAEKSG
FT                   DDLMRNWAHNSRVLLARPDLFVYRDWCEGGLVRENRRL"
FT   gene            complement(146747..147964)
FT                   /locus_tag="ML5_0144"
FT   CDS_pept        complement(146747..147964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0144"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   stp:Strop_0119 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05697"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADU05697.1"
FT                   /translation="MHETTILLIEVGALLLLLGLLGRLSRRFGVSPIPLYLLAGLAFGH
FT                   GGLLPLNASEEFFAVGAEIGVILLLVMLGLEYSANELVGNLRSAAPAGLIDAVFNALPG
FT                   FAFALLLGWGWVAAVVLAGVTWVSSSGVIAKVLGDLGRVGNRETPVILSVLVIEDLAMA
FT                   LYLPLVTALLAGVGLMKGGIALAVAVFTVVVVLAVAIRYGHLISAALSAKDPEALLLGV
FT                   LGLTLLVAGVAAKLQVSAAVGAFLVGIALSGPVAHHATELLSPLRDLFAAVFFVFFGLV
FT                   TNPLDMPPVLLPALLLAVVTMATKVATGYLAARRAGIAEPGRWRAGLALTPRGEFSIVI
FT                   AGLAVAAVYPVEPKLAALATAYVLITVVTGPLLARLPDSPWFKQWLRTRAAAARPPAPL
FT                   PLGTGD"
FT   gene            complement(147970..148470)
FT                   /locus_tag="ML5_0145"
FT   CDS_pept        complement(147970..148470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0145"
FT                   /product="TrkA-C domain protein"
FT                   /note="KEGG: saq:Sare_0119 TrkA domain-containing protein;
FT                   manually curated; PFAM: TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05698"
FT                   /inference="protein motif:PFAM:PF02080"
FT                   /protein_id="ADU05698.1"
FT                   /translation="MRVRVEQTALPGIGVRHDLMTESGRRLGVVSHRNGRRDLVLYDPD
FT                   DPDSCQHDIPLTDDEAEALADILGASLMLGQLSGLREQAAGLLTEQIAMPAGSKYVGRR
FT                   LADTKARTRTSASIVAVLRQGAVNVSPDPTFRFEAGDVVVVVGTRQGLDGVTAILAETD
FT                   PDG"
FT   gene            complement(148552..148770)
FT                   /locus_tag="ML5_0146"
FT   CDS_pept        complement(148552..148770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0146"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="KEGG: saq:Sare_4773 regulatory protein GntR HTH;
FT                   PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05699"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADU05699.1"
FT                   /translation="MPKQQYQVLADELKSKIDSGEWPPGTKLPSRAQLCKEYGVSDTVV
FT                   GKAMMILRATGLTETLEGVGVFVAERT"
FT   gene            148975..149292
FT                   /locus_tag="ML5_0147"
FT   CDS_pept        148975..149292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0147"
FT                   /product="DivIVA domain protein"
FT                   /note="TIGRFAM: DivIVA domain; KEGG: stp:Strop_1519
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05700"
FT                   /inference="protein motif:TFAM:TIGR03544"
FT                   /protein_id="ADU05700.1"
FT                   /translation="MRNLLRIRPKRRNVRPPGSAPGGAYRSASYLPLRPWQVRGHSFRT
FT                   CRRGLDPAEVAAFLDRVAGDLAAAYAEVARSRDETARIKGALREWQSRQAPSMGDLAGR
FT                   P"
FT   gene            149289..149555
FT                   /locus_tag="ML5_0148"
FT   CDS_pept        149289..149555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05701"
FT                   /inference="similar to AA sequence:KEGG:Sare_4346"
FT                   /protein_id="ADU05701.1"
FT                   /translation="MTGRYVIHLPVRAADLARAKMLGRTAGRSLAFLAVVELGGITVST
FT                   EDDQSVRHWVFCDRKLDGGRRCVLRADHETPCLARLPGRTGGR"
FT   gene            149641..152232
FT                   /locus_tag="ML5_0149"
FT   CDS_pept        149641..152232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0149"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="TIGRFAM: ATP-dependent chaperone ClpB; PFAM: ATPase
FT                   AAA-2 domain protein; AAA ATPase central domain protein;
FT                   Clp domain protein; Clp ATPase-like; KEGG: saq:Sare_0120
FT                   ATPase; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05702"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ADU05702.1"
FT                   /translation="MNTERLTTKSREAITGAVALANQRGHATVEPWHLLLSLLDTEGST
FT                   AAGLLRAVGADPAELRRVAQRSVDALPAARGSSIAEPTLAREFVNAIGAAEQIARPLGD
FT                   EYTSTEHLLAGLARVGGAVSVALKNSGATEENLVAAFPTVRGGDRRVTTADPEQTYQAL
FT                   AKYGVDLTASARDGKIDPVIGRDSEIRRVIQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   QRIVAGDVPESLRDKKLVSLDLGAMVAGASYRGQFEERLKSVLEEIKNSDGQVITFLDE
FT                   LHTVVGAGKGEGSMDAGNMLKPMLARGELRMVGATTLDEYREHIEKDPALERRFQPVLV
FT                   GEPTIEDTIGILRGLKERYEVHHGVRITDAALVAAASLSDRYITDRFLPDKAIDLVDES
FT                   ASRLRMEIDSRPVEVDEIERAVRRLEIEEMALAKEPDAASAERLERLRKELADKREQLT
FT                   ALSERWQTEKSHITKLSTAKEELERLGGEAERAERDGELERAAELRYGRIPALRTELKQ
FT                   AEEELARLQADGAMLKEEVGADDIAAVVASWTGIPAGRLLEGETAKLLRMEETLRGRVV
FT                   GQAEAVGAVSDAVRRARAGVADPDRPTGSFLFLGPTGVGKTELAKALAEFLFDDERAMV
FT                   RIDMSEYGEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYSVILLDEVEKAHPDVFDV
FT                   LLQVLDDGRLTDGQGRTVDFRNAILILTSNLGSSVISDLTLTENERREGVLAVVRSHFK
FT                   PEFLNRLDDIVVFAALQGEDLRSIVDIQLDRMRTRLADRRLALDISDSARNWLAEHGYD
FT                   PIYGARPLRRLVQSAIGDQLAKALLAGDIRDGDTVRVDLSDSKESLAVTAA"
FT   gene            152449..152826
FT                   /locus_tag="ML5_0150"
FT   CDS_pept        152449..152826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO7682 non-ribosomal peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05703"
FT                   /inference="similar to AA sequence:KEGG:SCO7682"
FT                   /protein_id="ADU05703.1"
FT                   /translation="MSGSWERELDLAVRELDGADTLAFGGVGLAGQVLPATEAYRRLEQ
FT                   GLREHPEAARKRVDRLLRKGSPAGRAYAATLLEAVDPAAGRAAWTRLRDDDGEFTTFSG
FT                   CLMGRATLGEYAADRLAGTGQ"
FT   gene            152911..153549
FT                   /locus_tag="ML5_0151"
FT   CDS_pept        152911..153549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05704"
FT                   /inference="similar to AA sequence:KEGG:Sare_0121"
FT                   /protein_id="ADU05704.1"
FT                   /translation="MNGSLAYVVTTLGCLVGVAGVVIAVIALRRSRSASGPKTKAAPGD
FT                   PFRDRDADALRGDPRALKPGDIVEIRSVPYTVRGSVHLVEGGWSWAEHLLDDAGGVKRW
FT                   LSVESDPDLELVLWTSEPGATVTPGAPTLEIAGRRYNWDESGQARYTATEGTGLDPHGT
FT                   MRYYDYQAPGGARLSFEAYGEAGWEVNLGEELRRAEVMIYPQGGSETVR"
FT   gene            153551..154045
FT                   /locus_tag="ML5_0152"
FT   CDS_pept        153551..154045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05705"
FT                   /inference="similar to AA sequence:KEGG:Sare_0122"
FT                   /protein_id="ADU05705.1"
FT                   /translation="MLVCLDTPYVDTSAADLSLALGGPELPALAVRDIDLPGLPRLRLR
FT                   LLGASHQVVLGGLTETVACLPGRPPHLPDALHDETTGYRFLATVLRPDGDGLRTRVAAL
FT                   RAELAGDPYALIGVFPGDEDAVTALSVRPRPPDGVLAWRTWHVYPQTNELVLTETVVEE
FT                   L"
FT   gene            154042..154467
FT                   /locus_tag="ML5_0153"
FT   CDS_pept        154042..154467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05706"
FT                   /inference="similar to AA sequence:KEGG:Sare_0123"
FT                   /protein_id="ADU05706.1"
FT                   /translation="MTYRRWFVVGVAVAVIGALIAAFTIFYGNFSPRGYVEDNFSRASG
FT                   RDIGSNAIAYTSRKTPSEVSKQITDAWRPADQYVDGSGVYLRYDDDSVVILPLAVGSVI
FT                   LLEKMTTAYPRYHTVVGNSWGWGRGSTVRGGGPGSGK"
FT   sig_peptide     154042..154107
FT                   /locus_tag="ML5_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.786) with cleavage site probability 0.649 at
FT                   residue 22"
FT   gene            154498..154920
FT                   /locus_tag="ML5_0154"
FT   CDS_pept        154498..154920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0154"
FT                   /product="protein of unknown function DUF350"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   saq:Sare_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05707"
FT                   /inference="protein motif:PFAM:PF03994"
FT                   /protein_id="ADU05707.1"
FT                   /translation="MQHLVTDLLVTLAYGVVGVVLMAIGYVLVDVATPGKLHELIWVER
FT                   NRNAALLLSSNLLGVGTIVVAAIVASDDDFTLGLIGAGAYGILGLVIMAAAFVLLDVAT
FT                   PGKLGELLVDPEPHPAVWVSATVHLATGAIIAAAII"
FT   gene            154920..155693
FT                   /locus_tag="ML5_0155"
FT   CDS_pept        154920..155693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05708"
FT                   /inference="similar to AA sequence:KEGG:Sare_0125"
FT                   /protein_id="ADU05708.1"
FT                   /translation="MSGKPAQHSAGKDKRTQTVIWSVVVGIVVVVCAIGVFSGDSDTSV
FT                   PAPAADERSGTVPILRAAADSQGICYGWELLDVYDEVSVGSNLGDGTTVVDAPGCTRWI
FT                   AVSANVRYTSSSSESEDSATIRIKGSDDIEFADLAAIETRLSRFGLDEEAFVDDPGWAV
FT                   TRAATILPLLAAERGLAEPAATPTAGPSTAAAPLPDAGNDFWRDRWIYVLSSLGLFLFA
FT                   ALFLVVGVRQRRNHRGRVPAQRAGAGAAGRTRSRR"
FT   gene            155690..157258
FT                   /locus_tag="ML5_0156"
FT   CDS_pept        155690..157258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0156"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: saq:Sare_0126
FT                   spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05709"
FT                   /inference="protein motif:PFAM:PF01564"
FT                   /protein_id="ADU05709.1"
FT                   /translation="MTVDVAARPRWRLARAAVLLAVFVCAACGLVYELALVALGSYLIG
FT                   DTVGQASIVLGVMVFAMGVGALVAKPLQSRAVVSFAVIELTLALLGGLSVLGLYAAFAW
FT                   LDLYGPALVGTAFVLGLLIGAEIPLLMVMLQRIREQSAGSAVADLFAADYVGALLGGLA
FT                   FPFLLIPVFGQLKGALVVGAVNAVAGVVLVFTVFRAELGRRARAALGVATVVVGLLLGY
FT                   AWVTAHDFEVTTRQQLYRDPVVHAERSRYQEIVLTRSVREPGHSDTDLRLFLNGDLQFS
FT                   SIDEYRYHEALVHPAMRGAHGDVLVLGAGDGLAAREILKYPDVRSVTLVDLDPAVVELA
FT                   RREPQLRELNRESLTDPRVRVLNLDAFAWLRTATDRFDVVIADLPDPDETATAKLYTIE
FT                   FYTLIRPVLAPGGRLVVQSGSPYFAPRSYWSIERSVREAGFATVPYHVDVPSFGDWGFV
FT                   LAAPGDVAPELALPDDPPPLRFLTPAVLAAAGTFPADRARIDVPASTLLRPRVLDYARE
FT                   EWRGY"
FT   gene            157269..158324
FT                   /locus_tag="ML5_0157"
FT   CDS_pept        157269..158324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05710"
FT                   /inference="similar to AA sequence:KEGG:Strop_1603"
FT                   /protein_id="ADU05710.1"
FT                   /translation="MPPESSSRHRPGIGWLVRRLPTRAVEAASYLQAFVLSGVVTVLAV
FT                   RAYLKATDYPQLGGGGLHIAHVLWGGLLLAVGLGIPLVFLGGGARSGGAVIGGIGFGLF
FT                   IDEVGKFVTTGTDYFYAPAAAIIYVAFALLVLLIQAVRGRTGRSRLTPAERTANALDMV
FT                   LSGLPGGLTDRRRIAVLRLVQGTGPATETAVAHLLEAVPHREPPPVPLWQRAADRARRL
FT                   AVWAAGRRWLVWPVVVYLVVEPVLTVVAVFLDGVTGKLDQEREWGAVLGVSATALITAV
FT                   LGLWAAWLLRRNRAEAFRLFKLALLVDLLFGQVFNFTVNQFGAVSAVALDLALLGVVTA
FT                   EHRRLRRAAER"
FT   gene            158394..159173
FT                   /locus_tag="ML5_0158"
FT   CDS_pept        158394..159173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05711"
FT                   /inference="similar to AA sequence:KEGG:Strop_0122"
FT                   /protein_id="ADU05711.1"
FT                   /translation="MVDAPGTPPRTRPGVVTLSSWLLILVAAIQVLNLIVALTVVGKIR
FT                   DVLTDAYAGTSAEGAGDIAYAFSIITAVVSLLIAAGLVVLALLNNRGKNGSRITTWVLG
FT                   GILFCCTGGGLLTGLTGGMTGGGNTTGDVPSSEEIQRRLEDALPSWYTPVNLLLGLVAL
FT                   LALLAALILLALPKANEFFRKPKAGWEPPVPGGAYPAYPSHPGQSGDPAYPSYPPAPGT
FT                   PPSTPGGQPPSAPGGQPPSAPGGQPGERRDPEPPSGS"
FT   gene            159246..159974
FT                   /locus_tag="ML5_0159"
FT   CDS_pept        159246..159974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05712"
FT                   /inference="similar to AA sequence:KEGG:Strop_0123"
FT                   /protein_id="ADU05712.1"
FT                   /translation="MSYPERAAPRRPGTVLAAAALLLVMAVGAVAYAVVNLAVGGGTVD
FT                   RFRDAAAERTGASGGDVDQVAGLLRGSTVLAAVLGVLAALLLVGLALGLLAGRSGARTA
FT                   TWVVAGTGLLCGCCGLAVLVGQRAAPLRLGADDRITADLLGLVGDAYPSWWIPVNATLS
FT                   VAQILGYLVVAALLTLPSSGAFLRRRTAPLRLSGYGSTVSGAAAPGPTPWGPPPGLNPP
FT                   PSVPPATPPGGFPPPPEDSR"
FT   sig_peptide     159246..159341
FT                   /locus_tag="ML5_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.575 at
FT                   residue 32"
FT   gene            159971..160780
FT                   /locus_tag="ML5_0160"
FT   CDS_pept        159971..160780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0160"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   stp:Strop_0124 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05713"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU05713.1"
FT                   /translation="MTGDTHPSRRRALVTGASLGIGEAFARRLAADGWDLVLVARDAAR
FT                   LDALAAELTGRHGGDAETIAADLSTEDGCAAVEQRLTAGTPIELLVNNAGISLSTSFVR
FT                   SSVADEARLVRLNVLAVLRLTHAALGPMIERGHGAVINVSSVAGFGVPMPGSTYSASKA
FT                   WVTNFSESIGQSVAPLGVRVMALCPGYTRTGVHERAGIDMSRLPAWAWLRADDVVAEGL
FT                   RDLCKGKSVSVPDWKYKVAVAGLRHAPKRLLRGFRRDTRGAVGRQRG"
FT   gene            160935..161474
FT                   /locus_tag="ML5_0161"
FT   CDS_pept        160935..161474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0161"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; KEGG:
FT                   saq:Sare_0130 orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05714"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADU05714.1"
FT                   /translation="MGDHDDLRKFITDLAVVHGRVVLSSGREADWYVDLRRVTLHHEAA
FT                   PLIGRVMRDLTADWAYDAVGGLTLGADPVAAAMLHASAGTGHAVDAFVVRKEGKAHGLQ
FT                   RRIEGPDVSGRRVLAVEDTSTTGGSVLTAVDALREAGAEVVGVAVIVDRGAGDTVRAAG
FT                   LPYRAAYTLADLGLVA"
FT   gene            161532..161909
FT                   /locus_tag="ML5_0162"
FT   CDS_pept        161532..161909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0162"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: stp:Strop_0126 regulatory protein, ArsR; PFAM:
FT                   regulatory protein ArsR; SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05715"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADU05715.1"
FT                   /translation="MEYVGTALAEMTMPQISPLAGEPIERADAERLAGVLKALADPARL
FT                   RLLSLIQSAPEGEACVCDLTAPLGLSQPTVSHHLRILTEAGLLEREKRGVWAYYRLVPS
FT                   AIATIADLLTPPRKRATKKAR"
FT   gene            complement(162082..162927)
FT                   /locus_tag="ML5_0163"
FT   CDS_pept        complement(162082..162927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0163"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   tcu:Tcur_0208 SNARE associated Golgi protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05716"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADU05716.1"
FT                   /translation="MPDRAGVPCVAVDTAEKTRMFSESVALNPLDPKDLIHTFGMIGVW
FT                   VILFAETGLLVGFFFPGDSLLFLAGVAASPVADAIFGDGTRLSLAGLMIGGPLCAIAGA
FT                   QLGHWLGARYGRRMFEKPNSRLFKREYVEKAEYYFQKFGPAKAVVLARFIPIVRTFLNP
FT                   VAGVLGMPARQFFVWNVVGAVLWVDGILLIGYLLARQIYDAIGDKIDRYILPVVALIIV
FT                   ISVLPIFFEFLRDRRARKRGEAVAVITAATVAGTVEAAREGIEEHRPGHGDGHGGQHRR
FT                   "
FT   gene            complement(162951..165467)
FT                   /locus_tag="ML5_0164"
FT   CDS_pept        complement(162951..165467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0164"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cai:Caci_5514
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05717"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU05717.1"
FT                   /translation="MTVLDIPELALVALVGVSGSGKSTFARRHFAPSQVLSSDTFRGLV
FT                   ADDENDQSASADAFDALHHVAAIRLRRGLLTVVDATNLQPHARAGLIRVAREHDVLPVA
FT                   IVLDVPEAVAWERTEARADRTHGRQVLNRMRRDLRQSYGRLAREGFRKVHVLRGVDEID
FT                   AAEIRYEKLFNDRRELTGPFDVVGDVHGCRTELEALLSRLGYVLRHDDAGRPVDAAHPS
FT                   GRTAVFVGDLVDRGPDSPGVLRLVMGMVAAGHAICVPGNHEQKLLRKLRGRDVRLTHGL
FT                   AETMEQLAAEPPEFVAGVETFIDGLVSHYVLDGGRLVVAHAGLKEAYHGRASGRVRSFA
FT                   LYGETTGETDEYGLPVRYPWARDYRGSAMVVYGHTPTPEPEWVNNTICLDTGCVFGGQL
FT                   TALRYPEKELVAVPAVKEWYAPARPLVPVTPSRPDTVLDLADVTGRRHLTHAYGSLTVP
FT                   AENAAAALEVMSRFAVDPGRLVWLPPTMAPCSTSAVDGFLEHPAEAFADYRAAGVERVV
FT                   CEEKHMGSRAVVLVEREPGRFGGGVVHTRTARPFFDPPLDGELLTRVRDAVTGAGLWAE
FT                   LDTDWLLLDAELLPWSAKASGLIREQYAGVGAAGRAALPAVLAALDTAAGRGMPVAGLR
FT                   DRMAGRAAEITAYSAAYRAYVRPTDGLRGVTLAPFAVLAGAGVSYADRDHGWHLALADR
FT                   LCAADPEFFTPTRRRVVDLADESAVADATEWWLALTAAGGEGMVVKPYAGLAARSPKGS
FT                   LLQPGIKCRGREYLRIIYGPGYTEAGQLAALRRRSLGRKRGLALREHGLGLAALDALAE
FT                   DAPLWRRHELVFAILACESEPVDPRL"
FT   gene            complement(165464..166954)
FT                   /locus_tag="ML5_0165"
FT   CDS_pept        complement(165464..166954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0165"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: sro:Sros_6753
FT                   ubiquinone/menaquinone biosynthesis methyltransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05718"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADU05718.1"
FT                   /translation="MLLTLTTTHRPATDLGHLLVKHPDRVQSFDLPAGAAHVFYPEADE
FT                   ARCTAALLVEVDPLKLGGGRRNRAPEGFALGQYVNDRPYAASSLLSSALSKVFRSALRG
FT                   ESRDRPELAASAIPLTVRVPVLRCRGGAELAVRIFAPLGWTVTATPIPLDETYPEWGDS
FT                   RYVDLTLTGTLRLADALNHLYVLLPVLDDAKHYWVAPDEVDKLLRAGAGWLAGHPERGL
FT                   ITRRYLAHRRALAGEAMARLTELRLADEPPADDSIEPSTGEPAESSGGGAGTAEDVRRA
FT                   SLAVRRREAVLAALRDSGASRVLDLGCGGGALLTALVADRRFTEVVGVDVSDRSLGLAA
FT                   RRLRLDRLPERQRDRIRLWQSALTYRDDRLRGYDAAVLMEVVEHLDPPRLPALEDAVFG
FT                   HARPGTVVVTTPNVEYNVRYEGLAPGRFRHADHRFEWTRAEFAAWVDRVAAAHGYTAVL
FT                   GGVGDEDPEVGTPTQIAVLTRDDRNENTSNDRKEATNR"
FT   gene            167073..167555
FT                   /locus_tag="ML5_0166"
FT   CDS_pept        167073..167555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0166"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: svi:Svir_09630 RNA polymerase sigma factor,
FT                   sigma-70 family/RNA polymerase sigma-70 factor, sigma-E
FT                   family; TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05719"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADU05719.1"
FT                   /translation="MTYEEFADARLGALLRYAVMLTGDPHQAQDLVQETMVRVQLNWRR
FT                   VARTDAPERYVRRMLTNQFIDWRRGSWARRVLLRGEADESVPAPTDHAQSAVDRDQVRS
FT                   WLSRLPRRQRAALVLRYYEDLPDGEIAEILGCAVGTVRSSISRALATLRAELVEVC"
FT   gene            167555..168607
FT                   /locus_tag="ML5_0167"
FT   CDS_pept        167555..168607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0167"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: saq:Sare_5021 cell envelope-related
FT                   transcriptional attenuator; TIGRFAM: cell envelope-related
FT                   function transcriptional attenuator, LytR/CpsA family;
FT                   PFAM: cell envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05720"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADU05720.1"
FT                   /translation="MIEDELRAAFARLEESTPPVGPVRAAVDRAVISRRRRRRRVRLAG
FT                   TALAVAAVALVGFTAMAPRPPAPTAAPAPPTPVPEPGGALNLLLLGVDQSVGSRRADSV
FT                   LLVHLPADRSRLHLVSFPRDLLVPVPPQGGTEKLNATFSRAAGSGTDLAAGYRATRQAV
FT                   ARLTGVRVDAGAVLTYPGARELTDAVGGVPVCLPAPVRSVHTERRFPAGCQRLDGAAAV
FT                   DLLRQRYGLRDGGLDRDRNAARYAAGLLRQLREQGTATDPAQLGRLLLRIGPAVTADTG
FT                   DLSLPALVAAAGRTSAAEPVALAFPVRDEWNGRGYEPDPELAPGFLEALRADRLAQWAA
FT                   EHPGQVTALR"
FT   gene            complement(168620..168829)
FT                   /locus_tag="ML5_0168"
FT   CDS_pept        complement(168620..168829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05721"
FT                   /inference="similar to AA sequence:KEGG:Strop_0129"
FT                   /protein_id="ADU05721.1"
FT                   /translation="MGQPDEDFAPSDHLAPEERDLEAEPADAVEQATTVTDETDGEPHR
FT                   GMEVDDWDAMEQARVVAADEDDYR"
FT   gene            168968..169351
FT                   /locus_tag="ML5_0169"
FT   CDS_pept        168968..169351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0169"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   nda:Ndas_0645 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05722"
FT                   /inference="protein motif:PFAM:PF04020"
FT                   /protein_id="ADU05722.1"
FT                   /translation="MGFLIRLAITAVALWIATLIVPGVEVSGRNTGSNVLTLIVVALVF
FT                   GVVNAVLKPLIKVFGCVFYLLTLGLFALVVNALLFLLTDWIAGVLKLPFHVDGFWAAFW
FT                   GAIVVAVVSWLISVIVPDRLENR"
FT   gene            169547..170569
FT                   /locus_tag="ML5_0170"
FT   CDS_pept        169547..170569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0170"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="KEGG: saq:Sare_0135 fructose-bisphosphate aldolase;
FT                   TIGRFAM: fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05723"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ADU05723.1"
FT                   /translation="MPIASPEAYAEMLDRAKAGRYAYPAINVTSSQTLNAALKGFADAE
FT                   SDGIIQVSTGGAEYLSGPSVKDMVTGAVAFAAYAHEVAKKYPVNIALHTDHCPKDKLDK
FT                   FVRPLMAISQERVKGGQEPLFQSHMWDGSAVPVAENLEIAEQLLAEAAKGKIVLEIEVG
FT                   VVGGEEDGVENAINDKLYTTVDDGLAMVDALGLGEKGRYMAALTFGNVHGVYKPGNVKL
FT                   RPEVLKQIQDAVGAKYGKDKPLSLVFHGGSGSLLSEIREALDYGVVKMNIDTDTQYTFT
FT                   RPVADHMFRNYDGVLKVDGEVGNKKMYDPRVWGKAAEAGMAARVVEACEHLRSTGTTMK
FT                   "
FT   gene            complement(170662..171942)
FT                   /locus_tag="ML5_0171"
FT   CDS_pept        complement(170662..171942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_4735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05724"
FT                   /inference="similar to AA sequence:KEGG:Kfla_4735"
FT                   /protein_id="ADU05724.1"
FT                   /translation="MPAGLLSFPPPVSALAARGQDGLVPTPPPADVIEPHAPHVNEIET
FT                   RTAFEQRLAGGTLAGLTVQGLRLDLDPVPDLRDVDVTGTLFVGCRFAGREVGADLVRRG
FT                   ANVVPPFSGLPYPTQPSHLYTADELAAGFAEGGFAGMYDTRVYAHFRAHGGALPDVREA
FT                   LGQRLHDHGVDNALADATRSWLAAHGPQSVVGVMGGHAVPRGSVAYRMAAVLGWELARA
FT                   DRLVVTGGGPGVMEAANLGAFLAAWPAEELSAAIDVLAVAPDFTDHDRYTAAALAVRKR
FT                   YADGPSLPSPRPSAPGTGWARSGGLAIPTWLYGHEPANLFAGRIAKYFSNAIREDTILR
FT                   LARGGIVFAPGKAGTVQEVFQAATKTFYGTDGASGAYVFLDRTYWTTELPVESLLRPLF
FT                   AASPFGDLSHTIHLTDDVRDAVRVLVQ"
FT   gene            172136..172564
FT                   /locus_tag="ML5_0172"
FT   CDS_pept        172136..172564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0172"
FT                   /product="protein of unknown function DUF3151"
FT                   /note="PFAM: protein of unknown function DUF3151; KEGG:
FT                   saq:Sare_0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05725"
FT                   /inference="protein motif:PFAM:PF11349"
FT                   /protein_id="ADU05725.1"
FT                   /translation="MQNLLPEPPATLLPVHEEADAALAAAAEQGTDEAYAEVAARFPTY
FT                   SAAWAALAGRALTAGQVVTAYAYARTGYHRGLDQLRRSGWKGHGPVPWSHKPNRGFLRC
FT                   LYVLSRAAGEIGEADEAARCAQFLRDCDPAAGDALSGD"
FT   gene            complement(172616..174568)
FT                   /locus_tag="ML5_0173"
FT   CDS_pept        complement(172616..174568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0173"
FT                   /product="chromosome partitioning ATPase"
FT                   /note="KEGG: saq:Sare_0137 chromosome partitioning ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05726"
FT                   /inference="similar to AA sequence:KEGG:Sare_0137"
FT                   /protein_id="ADU05726.1"
FT                   /translation="MVHENDDRAHVPGRPQVPQRDVEPLWPPEETDAAAATIPPWASVP
FT                   WPLPPADAPTPVAADVPAPQAPVAADVPAPQAPAVDLDLPFTLDRATSAPSPAQPEPAA
FT                   SGSPAASGSPAAPGTPAAPVPATTPATGTTGPGTTGEGAGNGRPGSPWAQPPQRAGSDS
FT                   ATTPDPADATAPPSEAAEADGIASGRATVAPPPPEALSTDGTASGRATVAPPPPPDALP
FT                   GDGTVSGRATVAGTQPSPESGTGPAGTGAPEQAPRLGPFPPSPGVPAQPSPYGNGYPSP
FT                   GYQPQPGQPGWYPPPGWTPQTGVPQPGGPLPPQAPVSGPVVPPPPQPGAPHPEQGWTPQ
FT                   QAVPPTAEDFARRRQARPVDPVATMGVRAVVNKIGLVRLAPGRHEQEMKRDIEMVRRNF
FT                   GGLRQVTVVNPKGGAGKTVAILLLAMTFGQKRGGYVLAWDNNETQGTLGMRAQQDFHAR
FT                   TVRDMLRDLAQFQGPHGRVGDLSQYVRSQGEGMFDVLASDESATGGEMLTAAAFAEIRE
FT                   VVSRFYKLIFVDTGNNVRAQNWQAAMDATDQLVVTMSARNDSAETAARMLDHLEQSGRQ
FT                   RLVRQAVTVVSMPPSRKEIDLPAIQAHFAARTRAVLLAPYERLIDTGEPLRYGQLSSAT
FT                   RDAWLKIAASVAEGL"
FT   gene            complement(174643..175641)
FT                   /locus_tag="ML5_0174"
FT   CDS_pept        complement(174643..175641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05727"
FT                   /inference="similar to AA sequence:KEGG:Sare_0138"
FT                   /protein_id="ADU05727.1"
FT                   /translation="MYDVVLLTLGSERDAPGGGCGSGGACCGGADDTAAETGEERCETP
FT                   RVPVLACADELTARGARVTTVTARSDSEIDEVLARLDGPPRADGLTWPDSDGKTRLIVA
FT                   TASDGQLRAVLRRLVRRYAPPPSRRPADLAANRTVPDLPPVGVLPLDPARSGTARDLAA
FT                   QLGLPRDPAGVAAAVLDGTARRLDLLRNDGGSVTLDGALLGAADDAGRPLHWRARVEVD
FT                   GTVLSDGSEPITACAIGNAGGYARLGEVDLLGGPDPADGRVTVGVAVPVVTRSALGRKK
FT                   VRLEVRRARGRAVAVVPRDEKVPFLDDGVEGELSRKRSWWTEPGAWAVWTG"
FT   gene            175763..177052
FT                   /locus_tag="ML5_0175"
FT   CDS_pept        175763..177052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0175"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: saq:Sare_0139
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05728"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADU05728.1"
FT                   /translation="MPAIVLLGAQWGDEGKGKVTDLLGERVDYVVRYSGGNNAGHTVIT
FT                   PDGQKYALHLMPSGALSPSAMIVIGNGVVVDPKVLLQEIDGLAERGVDVSRLRISGDAH
FT                   LIMPHHRALDRVVERYLGSSRIGTTGRGIGPAYGDKVARMGIRLQDLLDPGILRKKLEL
FT                   ALREKNQLLFKVYNRKAIDVEETVEEYLQYAERLRPYIAETRVMLWDALDRGETVLLEG
FT                   AQATMLDMDHGTYPFVTSSNPTAGGACVGAGIPPTAITKVIAVSKAYTTRVGSGPFPTE
FT                   LFDDNGQHLRKVGHEYGTTTGRERRCGWFDAVVARYACRLNGVTDLVVTKLDVLTGLAK
FT                   VPICVGYEINGERFDDMPMTQTDFHHATPIYEELDGWWEDITKARTEDELPENARRYIA
FT                   RIEELTGTRVSVVGVGPGREENVLRHPLLP"
FT   gene            177276..178199
FT                   /locus_tag="ML5_0176"
FT   CDS_pept        177276..178199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_0865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05729"
FT                   /inference="similar to AA sequence:KEGG:Bcav_0865"
FT                   /protein_id="ADU05729.1"
FT                   /translation="MGEFGELTRLAATQGGFVTAGQALRLGLGREQIRYLVRSGRWTRV
FT                   SRGCYLPSPAVLTPVALRRAMIRATVASLGRGAVAVLGTAAELHGIAGLPPTAAIHVSV
FT                   PPDRPHVQRRAEPGLTVHQLTLAEADVCRAGGVPVTTPARTVADVLLRARRYPAVCILD
FT                   SALNQRILAENDLSLVLTHLTGRRGAVAARGYLAEADGRAQSPLETRARLRCVDGGVPP
FT                   DVLQLPVRDEDGYLLGVGDLAWRGARLIAEADGRGPHLTPQAVYADRFRQNRLVNAGWR
FT                   ILRFTWSDTLRPDYIPQTVKRALKRR"
FT   gene            178290..179537
FT                   /locus_tag="ML5_0177"
FT   CDS_pept        178290..179537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0177"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="PFAM: Phosphoribosylglycinamide synthetase,
FT                   ATP-grasp (A) domain; Phosphoribosylglycinamide synthetase,
FT                   N-domain; Phosphoribosylglycinamide synthetase, C-domain;
FT                   manually curated; KEGG: saq:Sare_0140
FT                   phosphoribosylamine--glycine ligase; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05730"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADU05730.1"
FT                   /translation="MRVLLVGGGGREHALALGLAGDPAVEALVAAPGNPGIAAVAELRE
FT                   VTPTDPAAVAALAVEVAADLVVIGPEAPLVAGVADAVRAKGIAVFGPSAEAARLEGSKT
FT                   FAKDVMTAAAVPTARAYTCEDAAAVGRALDEFGAPYVVKDDGLAAGKGVVVTDDRAVAE
FT                   RHAAECGRVVIEEYLSGPEVSLFVVTDGEAAVPLLPAQDFKRVGDGDTGPNTGGMGAYA
FT                   PLPWAPPNLVDDVMRDVVRPTLAELRRRGTPFAGLLYVGLAITPSGPRVIEFNARFGDP
FT                   ETQVVLALLETPLAGLLHAAATGTLGAHPPLRWRDGAAVTVVVAADGYPAGPRTGDVIT
FT                   GADRAGIIHAGTRRDADGTLRSAGGRVLCGTATGPDLAAARDAAYALVRDVELAGSHHR
FT                   TDIAAAAVDGRFTIPG"
FT   gene            complement(179521..181023)
FT                   /locus_tag="ML5_0178"
FT   CDS_pept        complement(179521..181023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scb:SCAB_47721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05731"
FT                   /inference="similar to AA sequence:KEGG:SCAB_47721"
FT                   /protein_id="ADU05731.1"
FT                   /translation="MDRLRRRTALGLLVGGASAAALGPFDPVLGGRPDDSPTRWPVPPV
FT                   ERENRAAGEPWWPEHGGRAADDRRRQIQGYASTTSVAPGEEIDFHVAVNPGGRFRISVH
FT                   RLGWYDGAGARTMLTSPELRGVPQPVPVADPDTGVLDCRWPVSWRLSVPHGWTSGLYQA
FT                   VFTSADGWRACTPFVVRDDRRPAALCAVLPVTTWQAYNQWPRDRRTGKSLYNGYRADGR
FT                   RDPALRARAVTFDRPYSGAGLPTHFDRDEAAIRWLERNLYDVSYATSFDLHSGRLDPAR
FT                   YRGLVFCGHDEYWSAEMRRATEVGLDGGTSLAFLGANSVYWHARVRAAADGRPERLVEC
FT                   AKTLPDPGAGTGDPTVTWRNLDRPEQALLGVQYNGIVLTPQPLVVRAADNWVWAGTGVA
FT                   DGDRIPGVVAGEADGLHAALPRPAGTTLSSSPYPAQQGGRRLQSSYVHETARGAVVFAS
FT                   GTLGWTLALDRQGHRDPRIERATANVLNRMAGRRPGPVSPES"
FT   sig_peptide     complement(180964..181023)
FT                   /locus_tag="ML5_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.767) with cleavage site probability 0.266 at
FT                   residue 20"
FT   gene            complement(181101..182666)
FT                   /locus_tag="ML5_0179"
FT   CDS_pept        complement(181101..182666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0179"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   tcu:Tcur_4678 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05732"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADU05732.1"
FT                   /translation="MDLPFIAATLTRRGLLAPGGPIRVVSQLNALRRWGWSLAGELRQA
FT                   AARDPGRVAVVDEQGATMTYQELLDRSERLARSLRSHLGVQTGDRVGVLCRNHHGLIEA
FT                   IVAAMLLGADAVLVNTGLSAAQLVTVAEEQGLRVLVHDGEFTERVLGLPAELHRVDERR
FT                   QEELIAAAVPGEKLQPPERDGRTIVLTSGTTGAPKGARRPTPHGFGPLVSIIDRIPLHA
FT                   RDTVMIAAPIFHTWGYAALQVSFALRATVVLHRRFDPAATLAALAAQPCDAMFAVPVML
FT                   QRLMEVAPPQPRPPLKVVAVSGSALPGNLATAFMDRYGDVLYNLYGSTEVSWASIAGPA
FT                   ELRAAPTTAGRPPHGTRLAILDETGRPVRDGEVGRIFVGNEMLFEGYTSGAGRESRDGL
FT                   LDTGDLGRLNADGLLFVDGRADDMIVSGGENVFPSEVEDLIARLPQVREVAVIGVPDPD
FT                   YGQRLAAFLALRTGETLDPEAVREYVRRYLARFSVPRDVVFVKYLPRNATGKVLTRELR
FT                   RYFD"
FT   gene            complement(182834..184048)
FT                   /locus_tag="ML5_0180"
FT   CDS_pept        complement(182834..184048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0180"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: saq:Sare_0142 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05733"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADU05733.1"
FT                   /translation="MAEFSLDLNEEQRDLRDWVHGFAAEVVRPAAAEWDAREETPWPII
FT                   QEAAKVGLYGFEFLATCWADPTGLSLPIASEELFWGDAGIGLSIFGTSLAVAAIYGAGT
FT                   PEQLVEWVPQCFGDVDSPAVAAFCTSEPEAGSDVGSMRTRAVYDEATDEWVLNGQKAYA
FT                   TNGGIAGVHVVTASIEPELGSRGQAAFVVPPGTPGLTATRKLRKLGLRASHTADVFLDD
FT                   VRVPGRCLLGGKDALDERLARARSGQRASGQAAMRTFELSRPTVGAQALGVARAAYEYA
FT                   LDYAKERVQFGRPIISNQAVAFALADMKMEIDAARLLVWRASWMGRNNRPFTAGEGSMS
FT                   KLKAGEVAVSVTDKAVQLLGGAGFLRDHPVERWYRDAKIYTIFEGTSEIQRLVISRAIS
FT                   GMQIR"
FT   gene            complement(184050..184502)
FT                   /locus_tag="ML5_0181"
FT   CDS_pept        complement(184050..184502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0181"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   saq:Sare_0143 sterol-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05734"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADU05734.1"
FT                   /translation="MTDFDPANFANVGPKEFAQLVKSTPDAKINEIMSGEARGKILSEV
FT                   FNRMPTLFRADRAGATNAVIHWNITGRPDGGTDTYEIVIENGTCTVSETATRDPKLSLT
FT                   MGPVEFLKIVSGGANPVMMFMTGKLKAKGDLGLAANIANLFDIPKA"
FT   gene            184569..185222
FT                   /locus_tag="ML5_0182"
FT   CDS_pept        184569..185222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0182"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: saq:Sare_0144
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05735"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU05735.1"
FT                   /translation="MLARVSSTPTFKRLPRAVREQQMLDAAVKVFSRRGFHAASMDEIA
FT                   DDAGISKPMVYAYLGTKEELFIACLHRESTRMMEAIAGAAAPDLPADERLWRGLRAFFG
FT                   FVGAHRDGWAVLYRQARGSQPFAAELAAMRGRLVEVVAGMLDHALRASGREVGATDLEV
FT                   VAYGLVGASESLADWLADHPEADAGKTATRMMNVAWLGADQLLRGVTWHPPAAG"
FT   gene            complement(185268..185891)
FT                   /locus_tag="ML5_0183"
FT   CDS_pept        complement(185268..185891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0183"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   stp:Strop_0139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05736"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADU05736.1"
FT                   /translation="MGDVLDLLHHTVTSPWVYLVIIAVTAVDAFFPAVPGETVVITAGV
FT                   FAAGGEPNLVLVIVTAAFGALAGDHISYAIGRGGGAHRLARFPADSRRRASSEWARRAV
FT                   DRRGGMILTTARYVPGGRTAVTLTMGAVRYPARTFLLYDGLACTTWGVYCGLLGYFGGL
FT                   AFEHNPLSGLLAGVAISLAVTGLFEAVRWGRRRAHRRAAARRDC"
FT   gene            complement(185916..187163)
FT                   /locus_tag="ML5_0184"
FT   CDS_pept        complement(185916..187163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0184"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   sro:Sros_8967 adenylosuccinate synthase; SMART:
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05737"
FT                   /inference="protein motif:PRIAM:6.3.4.4"
FT                   /protein_id="ADU05737.1"
FT                   /translation="MVVDLGYGDAGKGTVVDLLCATRQVHTVVRFNGGAQAAHNVVLRD
FT                   GRHHTFAQFGAGTLRPGVRTHLARHVVVDPLALAAEADHLASVGVPDALDRLTVDGEAL
FT                   LATPYHRAANRAREIARGADRHGSCGLGVGEAVAYGLAHPDEAPRVADCRRPAVLRRRL
FT                   TALRDRLTAELGPLDAPPVDDCLPAYAAFAHRVAIVDRTWLAGALREGTCVFEGAQGVL
FT                   LDEWHGFHPYTTWSTTTFANAETLLAEAGMAGTAQRLGVLRTTTTRHGPGPLVTEDAAL
FT                   PFTDRHNGTNPWQGRFRFGHFDAVAHRYALEVAGGVDGLALTHLDLARPELRICRRYEG
FT                   LDRLVPGPAGDLDRQAALTERLMRARPVLDESPADWPAAVSEALGAPVVLTSRGPTAEE
FT                   KEGPLVNAFCMGRAPA"
FT   gene            complement(187172..188131)
FT                   /locus_tag="ML5_0185"
FT   CDS_pept        complement(187172..188131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_8966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05738"
FT                   /inference="similar to AA sequence:KEGG:Sros_8966"
FT                   /protein_id="ADU05738.1"
FT                   /translation="MGSGIWSTDVYDAADRYRRRTGKSAFSYSDSGARKVHPALDPRDA
FT                   LRESRDSAEHPQSTPIAVLFDVTGSMGHVPRVLQSKLPQLLGLLLRQGYAKDPQVMFGA
FT                   IGDATCDRVPLQVGQFESDNRMDDDLGRIVLEGGGGGQMMESYELALYFMARHTATDSW
FT                   DKRGRRGYLFIIGDELAYPAVKTAEVSRLIGDGLGEDMPVRQMVDEVTARWDTYYLLPA
FT                   GSHYAGNRKVLDFWRGLLGQNAVELDDLDAVCETIALTVGLGEQAIDLDAGLRDLDRAG
FT                   STATRTVSKALAQVGSGRRAVATLPFSPADGGSGVTRL"
FT   gene            complement(188142..189125)
FT                   /locus_tag="ML5_0186"
FT   CDS_pept        complement(188142..189125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0186"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nda:Ndas_0835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05739"
FT                   /inference="similar to AA sequence:KEGG:Ndas_0835"
FT                   /protein_id="ADU05739.1"
FT                   /translation="MRTEEAIRLVTAARTDADLFGTQEPARRYRELVGALHPDRLGAAD
FT                   PGVRAAAADALVTVTTRWRTPAPTYTGDVATLHERKEGPPVNASGRGGAPSYHLAKVCR
FT                   HPGDNDLMAREARALRRIAERGDAKHLAYVPRLVDSYPARDPSTGVQRQVNELMTVPGL
FT                   RSLDDVRRAYPDGLDPRDAAWMWRRLLVALGLAHRAGVVHGAVLPRHVLIEPDAHGLVL
FT                   VDWCFSAEPGGLVPALVPGHEDWYPPEVAAKRQCGPGTDIALAARCMTWLMGDRAPREL
FT                   RAFADGCQGTALATRPDDAWRLLRELDEVLHRLYGPRTFRPFTLNP"
FT   gene            complement(189122..189880)
FT                   /locus_tag="ML5_0187"
FT   CDS_pept        complement(189122..189880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0187"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: tcu:Tcur_3138 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05740"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADU05740.1"
FT                   /translation="MAVNEQEFLAGYDPRDYPAVAVTVDVVALTIREGALHLLLIRRGA
FT                   PPYEGHWALPGGFVQPDEDLAAGARRELAEETGLGGERLRRVHLEQLGSYGAPDRDPRM
FT                   RVVSVAHLAFAPDLPDPVADTDADEAIWLPVTALTSRQLAFDHGRIIDDGLERARSKLE
FT                   YTPLATRFLAPEFTVTELREVYETVWGHPLHAGNFHRKVLSVPGFVESTGASTERGGAR
FT                   GGPRAKLYRAGDARLLHPALLRPAREETVR"
FT   gene            complement(189961..191055)
FT                   /locus_tag="ML5_0188"
FT   CDS_pept        complement(189961..191055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0188"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   stp:Strop_0140 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05741"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADU05741.1"
FT                   /translation="MAKDHEDDLSLHDLIEGPTRDLTAARAAAQAQSHPQSHPTQARPS
FT                   SDDHEVDGTSGDPQGSQLHDRRGEGEGEEAGPEGRRRVALSRLPASGALYRRALLGVVP
FT                   GVGGRRGADVPGLELGVSGVAVDQRHLADYDRVCGFRLTDRLPATYLHVLGFPLSLRLM
FT                   TGPGFPIPLTGVVHVANRITVHRPVEVGESVDFHTYAENLRPHERGRQLDVVLVGSIGG
FT                   EEVWRGVSTYLGKERAAGGGPRRDRGDRPAPPAASARWRVTPRVGTDYARVSGDHNPIH
FT                   TSKLGARLFGFPRPIAHGMWSKARCLAALEPRLPEAYTVDVSFKLPVPLPSTVAFSASA
FT                   TGEGWDFALHSARDGRPHLVGSVR"
FT   gene            complement(191055..192413)
FT                   /locus_tag="ML5_0189"
FT   CDS_pept        complement(191055..192413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0189"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   saq:Sare_0147 3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05742"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU05742.1"
FT                   /translation="MTDRYASFVQTGAGRALVKRLGLPDPPRLRRHTPGDPLVPGPVLL
FT                   GSSAGGRIAEPAGKILTAAGVELADPVAAHDADRRFAALVYDASGITDSAGLRQLYDFF
FT                   HPQARSLLPSGRVIVLGTPPAECGSPREATAQRALEGLTRSIGKEFGRGVTAQLVYVTR
FT                   EGDAGTPVSLESTLRFLLSGRSAYVSGQVVRVGTGTAVAPADWDRPLSGQVVLVTGAAR
FT                   GIGAALAKVLARDGAQVVALDIPAAGDELAAVANDIGGSAVQLDLTAPDAPTRLAEHLA
FT                   SRHGRVDVVVHNAGITRDKTLGRMDADRWDSVIDVNLSSQERINDVLLERDLMPAGGRI
FT                   VSVSSIAGIAGNRGQTNYATSKAGVIGLVDSLSPVLRGRGISLNAVAPGFIETRLTARI
FT                   PLTIREAGRRMNSMAQGGLPVDVAETIGWLSWPATGAVSGNVVRVCGQSLLGA"
FT   gene            192469..193761
FT                   /locus_tag="ML5_0190"
FT   CDS_pept        192469..193761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0190"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   stp:Strop_0142 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05743"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADU05743.1"
FT                   /translation="MQSVRRVAVIGGNRIPFARSNSRYAHASNADMLGAALDGLIARFG
FT                   LAGERVGEMVAGAVLKHSRDFNLTREVVLGSRLDPHTPAYDIQQACGTGLEAAILVANK
FT                   IALGQIEVGIAGGVDTTSDAPLAVNEDMRRTLIQLNSARTLGERLKIAAKLRPHQPFKP
FT                   EIPRNAEPRTGLSMGEHAARTALRWNVDRTAQDELALRSHQRLAAAYDKGFFDDLMTPY
FT                   LGLTRDQNLRPDTSLEKLGSLKPVFGASGADAERATMTAGNSSPLTDGASTVLLASEEW
FT                   AKAHNLPVLAWFSWSEAAAVDFVHGDEGLLMAPAYAVPRMLARAGLSLQDFDFYEIHEA
FT                   FASQVLATLAAWESPEFCKERLGLDAPLGSIDRDKLNVNGSSLAAGHPFAATGGRIVAT
FT                   LAKLLDEKGSGRGLISICAAGGQGVTAILER"
FT   gene            complement(193812..196109)
FT                   /locus_tag="ML5_0191"
FT   CDS_pept        complement(193812..196109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0191"
FT                   /product="PKD domain containing protein"
FT                   /note="KEGG: cai:Caci_1999 protease-like protein; PFAM: PKD
FT                   domain containing protein; SMART: PKD domain containing
FT                   protein; Parallel beta-helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05744"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADU05744.1"
FT                   /translation="MHRPLLAGLTTTVLTGGSLLVLAAPSQAADTTTIYVRQTAAACSD
FT                   TGPGTLGAPFCSINPAVARVEPGQTVDIGQGTYPERVTVGRSGTPEQPITIVADGSATI
FT                   NGPTAGVVVHGQHDIVLQNIRVAKTADGPALDLANASGLTVQGGSFLPADTATAPIVRL
FT                   TAVSRTTLAQIIVKGVMPASGISMDTATTGVVVRSATVGGTYKVAEPNVGIRIDGPGNT
FT                   ILNSTVGAFTGAGVAIGPAAADTVVANTQVQSGAGLGIHVRGAARTAITNNYVRDHCSD
FT                   GIRVDGDATGVSVQNNIMNSNGITTRSYCDPADPPGVEIGLFDAAAGSTVVDYNNTYHY
FT                   SSPSDTAYSWNGTRMGVQAFRLASGQAAHDLDTSYTTEAEDSANSAAPGFQATDRAGNA
FT                   RADNPNRPNTGAGPVPWADRGVTEYLGAPRAWVETKLDLGTRTVTADASLSLPGYRPIS
FT                   RYVFDFGDGTVVTSDKPVASHAYTTTGDYTVSVTVSGSDNRTGTATQGISVLRRTGTVG
FT                   LLALVNLRYASATAGRVLTADKATLAGDGQFDLADAGNGRVAVLSRSVGRYLVNSGAIL
FT                   PNSPAVTDEQTFDLVTNADGTISLRWSGRAYVGVDGNAQLVATATAIGTREKFYRVNLA
FT                   DANRTLKAGVNGRFVSAESAGTKPLIANRTSAGPWERFDLLDLGSGKVALLAQANGKVV
FT                   CADGTGTKPLIANRTSAGAWETFVLVRNADGTVSLKATINNRYVSAESAGAKPLIANRT
FT                   TVGPWEKFTVGG"
FT   sig_peptide     complement(196023..196109)
FT                   /locus_tag="ML5_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.891 at
FT                   residue 29"
FT   gene            196284..197843
FT                   /locus_tag="ML5_0192"
FT   CDS_pept        196284..197843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0192"
FT                   /product="adenylosuccinate lyase"
FT                   /note="KEGG: saq:Sare_0154 adenylosuccinate lyase; TIGRFAM:
FT                   adenylosuccinate lyase; PFAM: fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05745"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ADU05745.1"
FT                   /translation="MATVALEPAASAGLTTFSVRPAHGPDRTGYRRRRGRPGRRERLRY
FT                   VTTIPNVLANRYASPELVALWSPEEKVRMERRLWLAVLKAQRDLGVPVPDGVVEAYERV
FT                   VDQVDLASIAARERVTRHDVKARIEEFSALAGHEHVHKGMTSRDLTENVEQLQIRASLE
FT                   LIRDRVVATLARLGRHAGEYSALVMTGRSHNVAAQATTLGKRFASAAEELLIAYERLED
FT                   LIAWFPLRGIKGPVGTAADQLDLFDGDAAKVAELERRVAEHLGFSRVLDSVGQVYPRSI
FT                   DMAVVAALAQVAAAPSSLATTIRLMVGQELVTEGFKPGQVGSSAMPHKMNTRSSERVNG
FT                   FAVIIRGYLSMVGELAGDQWNEGDVSCSVVRRVALPDAFFAADGLFQTFLTVLDEFGPY
FT                   PAVINRELERFLPFLATTKILVAAVRRGVGREVAHEVIKEHAVAVALAMREKGAAENDL
FT                   FDRLAADGRLGLTRAEVDTLVADRNAFVGAATDQVSRVTARITKVVESHPEAAAYSPPP
FT                   IL"
FT   gene            complement(197956..198405)
FT                   /locus_tag="ML5_0193"
FT   CDS_pept        complement(197956..198405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0193"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   stp:Strop_0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05746"
FT                   /inference="protein motif:PFAM:PF01906"
FT                   /protein_id="ADU05746.1"
FT                   /translation="MTTDQLPGYEIRQILGEVVSSMARTRNPYREGVKNLRGGAYDPMA
FT                   PDNLTRWRTDSVARLGEEARRLGANAVIGMRFDSRDCGEMWMEICAYGTAVIVAPKMPD
FT                   VMPPDQPAIAAETAHEPEIASAPGGIAEPASAPNLSSAAETPTGP"
FT   gene            complement(198544..199227)
FT                   /locus_tag="ML5_0194"
FT   CDS_pept        complement(198544..199227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0194"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="KEGG: saq:Sare_0156 peptidase S1 and S6
FT                   chymotrypsin/Hap; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; SMART: peptidase S1 and S6
FT                   chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05747"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ADU05747.1"
FT                   /translation="MRLRPLLAVLTTALAGVLATASGATAAPAGPQPIIGGGTVSSAPW
FT                   AAAVFSNGSFTCSGSVIAPQWVLTARHCVSGTMSVRVGSVYYASGGVTRTVSASYTRYD
FT                   LALLRLSSTVSTSAVSLASSNPPVGSTNTIYGWGMTCYSGCGASPQLKTASVRVTSTSV
FT                   TDAYGGQAIRSTRVNGNAWRGDSGGPQFYNGRQVGVASTADGQSIQNYGSVAYNRAWIT
FT                   STAGV"
FT   sig_peptide     complement(199147..199227)
FT                   /locus_tag="ML5_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 27"
FT   gene            199698..199961
FT                   /locus_tag="ML5_0195"
FT   CDS_pept        199698..199961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0195"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="KEGG: saq:Sare_0157
FT                   phosphoribosylformylglycinamidine synthase, PurS; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase, purS; PFAM:
FT                   phosphoribosylformylglycinamidine synthetase PurS"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05748"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ADU05748.1"
FT                   /translation="MPRVVVDVMLKPEILDPQGQAVANALPRLGVSDVASVRIGRRIEI
FT                   EFTGEPDLDRAREIADKLLANPVIEDFTVRVVTADETAGAQS"
FT   gene            199958..200641
FT                   /locus_tag="ML5_0196"
FT   CDS_pept        199958..200641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0196"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: saq:Sare_0158 phosphoribosylformylglycinamidine
FT                   synthase I; PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05749"
FT                   /inference="protein motif:TFAM:TIGR01737"
FT                   /protein_id="ADU05749.1"
FT                   /translation="MTARVGVVTFPGSLDDGDAARAVRIAGAEAVRLWHGDPDLHGVDA
FT                   VVLPGGFSYGDYLRCGAIARFAPVMETIVQAARGGLPVLGICNGFQILCEAHLLPGALT
FT                   RNQHLHFRNRDQVLRIESTGTAWTNAFQPGQEVLVPVKNGEGCYVADPATLDRLEGEGR
FT                   VVARYVGGNPNGSQRDIAAITNEAGNVVGIMPHPEHAVEALTGPSLDGLGFFTSVLKHL
FT                   VGAPA"
FT   gene            200706..203417
FT                   /locus_tag="ML5_0197"
FT   CDS_pept        200706..203417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0197"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; KEGG: saq:Sare_0159 phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05750"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ADU05750.1"
FT                   /translation="MTTHPDPALREPQGVVPQAGPTDDWALGVDTVPRAADSPEELQPY
FT                   AELGLRDDEYDRIRHILGRRPTQAELAMYSIMWSEHCSYKSSKVHLRQFGEKAPPSDRL
FT                   LAGIGENAGVVRVSDELAVTFKVESHNHPSFVEPYQGAATGVGGIVRDILAMGARPVAV
FT                   MDPLRFGAADHPDTARVLPGVVAGVGGYGNCLGLPNIGGEVVFDPCYQGNPLVNALCLG
FT                   VLPVDRLQKKDATGPGNIVVLMGAKTGRDGIGGVSVLASATFDEGSEQRRPSVQVGDPF
FT                   MEKLLIEACLELYDAELVVGIQDLGGAGLTCALTETAASAGTGMRVWLERVPLREPSME
FT                   PHEILASESQERMLLVVSPDKLDAVLKTAEKWGVWATAIGEVTAPSADGQPGRLVVTWR
FT                   DQLVVDVPPGSLVDDGPVYARPMREPADLILLQADRAETLPRPSTPEALRETVLRMIAS
FT                   PNLADKTWVTEQYDRYVLGNTVLAQPEDSGVIRIDERSGLGVALSVDGNGRYARLDPYH
FT                   GTKLALAEAYRNVAVTGAKPIAVTNCLNFGSPEDPGVMWQFAEAVRGLADGCLELGIPV
FT                   TGGNVSFYNQTGAAAIHPTPVVGVLGVLDDVANRVPMGFVPRPAGDHDQLFLLGETHVE
FT                   LSGSEWAWVTHEHLGGIPPQVDLARERQLAELLAEAARVGHLSSAHDLSDGGLAQSLVE
FT                   SALRRGVGARVVVPEHFAGGSMPFVFLFSESAGRVLVSVPRGHEKAFTALCAERGVPWE
FT                   FIGVTDPASGGLEVHGQFRIGLDELREAHTGTLPRLFGAAEAARVEVEATRTGTTTVLP
FT                   ATAEQPVGVDPAAVDAEPIAKAGRDTPAADAEASAPAAEAEPEASAAASDEAEPAEGTA
FT                   TPAVDGTPAQDESAPADGSDGPAPGEPAPGQR"
FT   gene            203428..204177
FT                   /locus_tag="ML5_0198"
FT   CDS_pept        203428..204177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0198"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: saq:Sare_0160 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05751"
FT                   /inference="similar to AA sequence:KEGG:Sare_0160"
FT                   /protein_id="ADU05751.1"
FT                   /translation="MAVFAQPGAGVRFDWGLTGAAELGRVCAALVVVDVLSFTTAVEVA
FT                   VSRGMRVHPFPWGEQAADYARRVGAVAAVGRRKTTTEHPWSLSPAALRAAPLVADLVLP
FT                   SPNGSAISAAASATGVPVVAACLRNAPAVGRWLRAEGYGSKDAPVGVVAAGERWPDGSL
FT                   RPCVEDQLGAACVLDALADVPGGLSVEAAMALAALASTPDVPAAVRGCVSGRELAEGGF
FT                   AEDVTVATEVGVSDVVPVLRQGYFAPA"
FT   gene            complement(204269..206581)
FT                   /locus_tag="ML5_0199"
FT   CDS_pept        complement(204269..206581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05752"
FT                   /inference="similar to AA sequence:KEGG:Strop_0153"
FT                   /protein_id="ADU05752.1"
FT                   /translation="MSTHRRAWKQRAGVVVALVFGALLTVPAAPALAANVSVSPGSVTV
FT                   NAGSDATVTVTVNPEGGDTNGDISLSGLPSGVSCTSGCGGIEFNPPGTAKVQILTLRAN
FT                   DNAGDANSSVTVRIQGVGRPDTANFNLTVKGKAAPPSPQQPQTVKTVSGKVVNADGDPI
FT                   EGALVMLRDSAGKERRTNTSGNGNFSFSGSESNPIAPGRIDLGASTDGASPVARSINAN
FT                   AGQSVTGVRLSIQVKASASPSATPSASESAPPSEEPLDEEATDTPSAEAPAAQQPAANE
FT                   DSGGFGSWLLILLGGLFVAVGVGTIVLLYMRRKNEGDDGDGDGPGGPAGPGGPGAAGAI
FT                   PAARGAYHGTDDQTRVVNGMGAPAATMVGGPSISDAPTMLQRPVVDDVPPDPYGAPPGP
FT                   AYGAGGGQGGYGYGDDAAGQGGYGGAGGYGNAPSSGGGYGNGPSSGAGYGNPDYAAGAA
FT                   AGAAGYAAQGGGYGNERFDEPTGRYTGDSTQYAPAADPYPTSTYQPEQDRGYDQSGSAP
FT                   YGRGPEQGDAYGAAGGYGAASGGYDNGATGGYDSTRQQGGYGEPTGAYGNAAGGGYGDN
FT                   PTGGYGDAPAYGGGRAAGGGYGDAPAGGYDNAPAGGYGDAPAGGYDSTRQQGGYGDAPA
FT                   GGYDNPAGGYDSRSQAGYDKGAGGYDSGATGGYDSTRQQGGYGDAPAGGYGNAGGGYDG
FT                   GHQAGGYGQQGGGYGEGYGQNPQGGYGQQGGYGQEPPQQRGGGYDNGYSNDPAQAGRAR
FT                   PDGQADRSGRRLDWLDD"
FT   sig_peptide     complement(206480..206581)
FT                   /locus_tag="ML5_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.986 at
FT                   residue 34"
FT   gene            206667..207095
FT                   /locus_tag="ML5_0200"
FT   CDS_pept        206667..207095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0200"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: saq:Sare_0162 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05753"
FT                   /inference="similar to AA sequence:KEGG:Sare_0162"
FT                   /protein_id="ADU05753.1"
FT                   /translation="MPCLTGSSLPRAAVGRPSAGSYRPVVSSPHAYSEAVRAALVALDE
FT                   GRTPERPVLREAVRTLLAALADRAPGRSVEVRVPPYGAVQCVSGPRHTRGTPPNVVEMD
FT                   PPTWLAVATGRQGWAETVTEGRIRVSGNRADLSPYLPI"
FT   gene            207264..208781
FT                   /locus_tag="ML5_0201"
FT   CDS_pept        207264..208781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0201"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="KEGG: saq:Sare_0163 amidophosphoribosyltransferase;
FT                   TIGRFAM: amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05754"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ADU05754.1"
FT                   /translation="MPRGDGRLSHDLDPQRPGPQDACGVFGVWAPGEEVANLTYFGLYA
FT                   LQHRGQEAAGIAVSDGSGVVVYKDLGLVAQVFDEPTLASLRGHVAIGHARYSTTGGSTW
FT                   ENAQPTIRATTAGTTIALAHNGNLVNTAELQREAAVRGLDSDGSTNDTSLVTMLLASRP
FT                   DLSVEAAALEVLPQLRGAFSFVFMDESTLYAARDAHGVRPLVLGRLERGWVVASETAAL
FT                   DIVGASVVREVEPGELIAIDENGLRSSRFASPEPKGCLFEYVYIARPDATIAGRNVHAA
FT                   RVQIGRQLAKEHPVEADLVIPVPESGTPAAIGYAEESGITYGQGLMKNPYVGRTFIQPS
FT                   QTLRALGVRLKLNPLRQNVRGKRLVVVDDSIVRGTTQRAIVRLLREAGALEVHVRISSP
FT                   PVSWPCFYGIDFATRAELLANGLDNDGIRRSIGADSLGYVSLPGLIAATEQPKSRLCRA
FT                   CFDGEYPIELPAGNLIGKHVLEGVGRRVAAEAAGPTGPLVATPTHHP"
FT   gene            208839..209993
FT                   /locus_tag="ML5_0202"
FT   CDS_pept        208839..209993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0202"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; KEGG: stp:Strop_0155
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05755"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ADU05755.1"
FT                   /translation="MTHVSERSGAGSSPTGAGGDRQPWSAGSGRTQRKRSVSYADAGVS
FT                   IEAGDRAVELLKSKVKETRRPEVMGDLGGFAGLFRLDTKKYKNPILASSTDGVGTKLVI
FT                   AQQLDIHDTVGIDLVAMVVDDLVACGAEPLFLLDYIATGEVVPDKVAEIGAGIADGCRY
FT                   AGCALLGGETAEHPGVLRPDEYDISATGVGVVEESEILSPERVEVGDVVIAMRSSGLHS
FT                   NGYSLVRHVLLGAGRMRLDVVIDDFGRQRTLGEELLTPTKIYAQDCLKLIAEAEVRALA
FT                   HVTGGGIPGNLVRVLPEHVDAVVNRSTWKPQPIFDLIQSKGRIEDPEMEATFNMGVGMF
FT                   AIVSAEDADRALATLTGRGVDAWQAGEIIEGSGNVQMVGQHTRG"
FT   gene            210097..211212
FT                   /locus_tag="ML5_0203"
FT   CDS_pept        210097..211212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0203"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   saq:Sare_0165 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05756"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU05756.1"
FT                   /translation="MAARTPGGMRGISAVPSYVVMQPTTLCNLDCAYCYLPFRAVDRRM
FT                   PVAVAEAVAASVNPWAAGGRFSVVWHGGEPLAAGREHLAALLAPFGPDVEHHVQTNATL
FT                   IDDAWCAFFAEHRVRVSISVDGPRARNGERVTRGGRPAYDRIVAGVAALRRHGLPFSAL
FT                   AVVSRPEPGLATELYDYFLDLGCDVLGVNIEETEGVNTRTNARDAGAVTGFWAELVAAW
FT                   RRDPRIHLREVEWSLRYAGAVLAGTADDLLPRSLDPIPTVGHDGSVVVLSPELAGFTDP
FT                   RYGDFASGNVLTTPLGDILAGAAGTPWVGEFLTGVEACRASCAYFGFCGGGHAANRYFE
FT                   LGRFDGTETEHCRNSKIRLLEGVLEHARDHQ"
FT   gene            211193..211405
FT                   /locus_tag="ML5_0204"
FT   CDS_pept        211193..211405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05757"
FT                   /inference="similar to AA sequence:KEGG:Sare_0166"
FT                   /protein_id="ADU05757.1"
FT                   /translation="MPETISDTDREAVADRVRDAAAGLTALLREAEAARLLRAEVSGGD
FT                   GADAVCAWNHFENIPTFYNWNNRPR"
FT   gene            complement(211556..211771)
FT                   /locus_tag="ML5_0205"
FT   CDS_pept        complement(211556..211771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0205"
FT                   /product="Protein of unknown function DUF3073"
FT                   /note="PFAM: Protein of unknown function DUF3073; KEGG:
FT                   stp:Strop_0158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05758"
FT                   /inference="protein motif:PFAM:PF11273"
FT                   /protein_id="ADU05758.1"
FT                   /translation="MGRGRAKAKQTKVARELKYHSPNTDLTALQRELAGSGKSEHNFDD
FT                   DYKEYVDDDDEDHADDDPDTWARPTR"
FT   gene            complement(212063..213145)
FT                   /locus_tag="ML5_0206"
FT   CDS_pept        complement(212063..213145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0206"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase dimerization
FT                   region"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region; Glu/Leu/Phe/Val dehydrogenase; KEGG: saq:Sare_0168
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05759"
FT                   /inference="protein motif:PFAM:PF02812"
FT                   /protein_id="ADU05759.1"
FT                   /translation="MGVFASTDDPVSTGHEQVVFCQDKQSGLKAIIGIYSTALGPALGG
FT                   TRFYPYASEAEALADVLDLSRGMAYKNALANLDLGGGKAVIWGDPEQIKSEALLRAYGR
FT                   FVESLNGRYYTACDVGTYVADMDVIARETRYVTGRSVEHGGAGDSSILTAWGVFQGMRA
FT                   AAEHVWGSPTLAGRRVGVAGLGKVGKYLTAHLLDDGAEVVATDVSPRAREWARTTHPQV
FT                   TLVDDTEALVTSDIDVYAPCALGGALNDDTVPVLRAKVVTGAANNQLAHPGIEKVLADR
FT                   GILYTPDYVVNAGGVIQVADEIEGFNFDRAKLRATRIFDTTRQILQLADDEGVPPAVAA
FT                   DRLAERRMAEVGRLRTIHLR"
FT   gene            213321..214160
FT                   /locus_tag="ML5_0207"
FT   CDS_pept        213321..214160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05760"
FT                   /inference="similar to AA sequence:KEGG:Sare_0169"
FT                   /protein_id="ADU05760.1"
FT                   /translation="MPSLFASYLRVYEPLTAFDRDRQSYWRRYVSEGRAIAPLEGPVRQ
FT                   RTAVIEALGAGWTRLPDLPDEAYVLESDDALLVCPWNLRIRVAEAALSARDGVPSVLAD
FT                   AFVPPVLAGQAKAVVEDWRSGARVLEHGVPRVHEQIATWGVPLRWFVLFEAGERHLVTE
FT                   PERRALRYRTEISKARRRASRALSVLRKSIGEAPITEAVEEAARWLEEFHPRSVVELDY
FT                   GGLVQLLPDETLEADDSTELVATGLSGLGRGEAEEASAAYDKLVARWRAVQLLERCN"
FT   gene            214417..214626
FT                   /locus_tag="ML5_0208"
FT   CDS_pept        214417..214626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0208"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="KEGG: saq:Sare_0170 DNA binding domain-containing
FT                   protein; TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05761"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADU05761.1"
FT                   /translation="MASRTHEPEPLLTPAEVASMFRVDPKTVTRWAKAGKLSAIRTLGG
FT                   HRRYRESEVRALLQGQIPQQRQGD"
FT   gene            complement(214698..215090)
FT                   /locus_tag="ML5_0209"
FT   CDS_pept        complement(214698..215090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0209"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: stp:Strop_0162 hypothetical protein; TIGRFAM:
FT                   putative F420-dependent enzyme; PFAM: pyridoxamine
FT                   5'-phosphate oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05762"
FT                   /inference="protein motif:TFAM:TIGR03666"
FT                   /protein_id="ADU05762.1"
FT                   /translation="MTDLDRLAAEKYVLLTTFRKDGRAVPTPVWAVRDGDGLAVWTVAD
FT                   SGKVKRIRRDGRVTVAPCDVRGRPHGEAVPGHATIADPESTNRVRGLLKRKYRLIGRLS
FT                   LLGSRLRRGERGTVGLRIVLDGPGRD"
FT   gene            215146..215925
FT                   /locus_tag="ML5_0210"
FT   CDS_pept        215146..215925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0210"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: ami:Amir_3934
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05763"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADU05763.1"
FT                   /translation="MTGEPEIGDVFGEMIRDAYAVATGIGPRPMAGGRLPRPVIEIIER
FT                   DDGLVNGAPAEHYLDPPQRWQPHDHRAVDRVRGHVLDVGVGAGRIALHLQDRGVPVTGL
FT                   DTSLGALRVSRHRGVRDLVHGTVDEHAADGRRYDTFLLLGNNLGLFEGRERAPAMLAAL
FT                   AALARPGARVIAHGTDPYGTTDPVHTAYHERNRRRGRIGGQLRLRLRYRLLGTDWFDYL
FT                   VCSPEEFAELVHGSQWRLTDVDDTDHPYYLATLELRR"
FT   gene            complement(215979..216266)
FT                   /locus_tag="ML5_0211"
FT   CDS_pept        complement(215979..216266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0211"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05764"
FT                   /inference="similar to AA sequence:KEGG:SGR_5033"
FT                   /protein_id="ADU05764.1"
FT                   /translation="MSQAPESAESTETVETRGDERVDLLRADTNNDGKTDVWVVDTDGD
FT                   GKADLFQFDTDGDGKVDITMVDIDEDGTPDEVVDGDGGLPPEQTTPTVQV"
FT   gene            216429..217286
FT                   /locus_tag="ML5_0212"
FT   CDS_pept        216429..217286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0212"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain-containing protein;
FT                   KEGG: stp:Strop_0163 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05765"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADU05765.1"
FT                   /translation="MSGRFVVVGAGTMGLGIAYVAAGAGYAVELVEVDPARGAEALRRL
FT                   GELWDRGVQRGKLTEEAATANRERVTLRAGLAEVAEGADVIVEAVPERLDLKRAVLREA
FT                   ESRRPALLGSNTSSIPIAELAAGLDRPADFVGLHFFNPVWAMALLEVVVGPATAPETTE
FT                   AAVALAARLGKDPVVVRDMPGFATSRLGVTLGLEAIRMVADEVASPADIDKAMVLGYRH
FT                   PIGPLELTDLVGLDVRLDIARTLQAAYGDRFAPPPLLVEMVAAGKLGKKSGQGFYTWKD
FT                   GVKQ"
FT   sig_peptide     216429..216512
FT                   /locus_tag="ML5_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.630) with cleavage site probability 0.272 at
FT                   residue 28"
FT   gene            217283..218026
FT                   /locus_tag="ML5_0213"
FT   CDS_pept        217283..218026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0213"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   saq:Sare_0173 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05766"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU05766.1"
FT                   /translation="MSGLRIEELPDRLVVTLDRPEKRNAIDADLVGELHAVCADLEARP
FT                   RLLLLTGGTAGIFAGGADIAQLRERGRLDALAAINQGVFARIRALPMPTVAAVDGPALG
FT                   GGAELAYACDLRVCTDRAVFGQPEVRLGILAGAGATYRLPALIGEARAKELLFTGRRVD
FT                   AEEALRIGLVNRVVADPAELLPTAHGLLDEMAKGSALALRLTKMAVDAPAAAHPQLDLL
FT                   SQAVLFEDEEKHRRMTEFLDRRRPR"
FT   gene            complement(218090..219427)
FT                   /locus_tag="ML5_0214"
FT   CDS_pept        complement(218090..219427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0214"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   saq:Sare_0174 ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05767"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU05767.1"
FT                   /translation="MLRTRTSRAALSMACAALLLATSACGSDEPEETPATQVRLYGTDG
FT                   NMLNSYAAELKDRADLVNGMKGTTPLTPLAESFKERLLAVDPKLGDFLYSAESYDAVVI
FT                   SALAAQLAGTTAPAEIAKQIVGVTTGGERCDDVTACLQLARAGRDIEYRGVSLTRAGFT
FT                   DTGEPATASYGTMHFDNQKIDDSKTEFVGAGEESGASTKAPPRGRKPRDGKAKDAPLVL
FT                   GGLLPKTGDLALANPPLAAGAALAIREVNAAGGVLGEPVKWIEGDDGTNPEVAKATVAS
FT                   HVSKGVQVIIGAGGSGISRAVLPDVVAAGRILFSPSNTDAGLSAVDDKGLYFRTAPPDS
FT                   LQGRALADVMLRDGPRKIAILARKDSYGEGLQENVRSELEKAGIGADRIKLLTYEPPAD
FT                   PKTPVDFSGTAKEIKAFGPEALLLIGFAESAPAITALDDAGVDIKH"
FT   sig_peptide     complement(219347..219427)
FT                   /locus_tag="ML5_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 27"
FT   gene            219594..219983
FT                   /locus_tag="ML5_0215"
FT   CDS_pept        219594..219983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_0804 hemolysin-type calcium-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05768"
FT                   /inference="similar to AA sequence:KEGG:RPB_0804"
FT                   /protein_id="ADU05768.1"
FT                   /translation="MNDEAQQTLDDATAVLRSALAGDGAGVVGTFDAVVDRSGLAGAYG
FT                   VAWCLAATMLGDDTPGGGAALDFPGIDQADYDTRWVARFVSACANDDADTGEALFGAAA
FT                   ADGLLPDCLLTLAGSTIATLRSRSD"
FT   gene            220029..220733
FT                   /locus_tag="ML5_0216"
FT   CDS_pept        220029..220733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_1141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05769"
FT                   /inference="similar to AA sequence:KEGG:Franean1_1141"
FT                   /protein_id="ADU05769.1"
FT                   /translation="MSEAMLSKVRKLLAQAEDPACTPAESAAFMAKATELIARYGVDRA
FT                   LLAARDPAADPVGDRTVDVIAPYARDKAGLLAAVAEPLRCRCVRRRQGNGFVMHLFGFA
FT                   SDLERVELLFTSLLVQAAHGLAGAAVPAGEHPAAFRRTWLAGFAYVVAERLRAAESKAV
FT                   AESGGTSTALVLADRSDRVQRRVAEAYPRLRTAPRRRLAGGGFGSGADAGRRADLGGTG
FT                   VAGTGAAPGIAG"
FT   gene            complement(220759..221262)
FT                   /locus_tag="ML5_0217"
FT   CDS_pept        complement(220759..221262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0217"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: saq:Sare_0175 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05770"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADU05770.1"
FT                   /translation="MADPDEVRQESDRFSLRSSLLVPASAERAYAVFTGALADWWVREY
FT                   TWSGPEALAAIGIEPRAGGMLYEIGPYGFRNDWGRVLTWDPPRRLVFTWQIGPDRVPVP
FT                   DPARASEVEVLFHAGGPERTRVDVEHRYFDRHGTAAEGYREALTAGWHELLCRYLATVA
FT                   RTSA"
FT   gene            221533..222291
FT                   /locus_tag="ML5_0218"
FT   CDS_pept        221533..222291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_7270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05771"
FT                   /inference="similar to AA sequence:KEGG:SACE_7270"
FT                   /protein_id="ADU05771.1"
FT                   /translation="MTDSRATEPVPDPGDELTGSPAGPESEPDVLLDVPELTVDEIRLA
FT                   VDGLDADLSLRARLANLLQLDAGVRVHLEGVELDITGVSAEALLKVRLEKLVQILDRAL
FT                   TTIDRNPQLIDALARSAGVTLDDVHRLAAPVVDQTGRTVAAAGEVVERTAPAVSGPIEA
FT                   PEPPRRPARTESERAAGSGQGAGAGPSAERPTEKKRGSERPGGAGQPASAAAEAAQLAG
FT                   QAGQALRQAGRSVWEAIQGSPTQNRRPPKT"
FT   gene            complement(222349..222729)
FT                   /locus_tag="ML5_0219"
FT   CDS_pept        complement(222349..222729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cfl:Cfla_0611 transcriptional regulator,
FT                   MarR/EmrR family"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05772"
FT                   /inference="similar to AA sequence:KEGG:Cfla_0611"
FT                   /protein_id="ADU05772.1"
FT                   /translation="MSTVDDPRAGGPFPTNGLDDTVHQRHRLGILTIAAEGERVEVAYL
FT                   REALELTAGNLSRHLTVLEEARLIQVEKGYHGRRPRTWIRITREGRQALQSEIAALQEL
FT                   LRRHQQAAQPSTSAGPDDFPPA"
FT   gene            complement(222726..223478)
FT                   /locus_tag="ML5_0220"
FT   CDS_pept        complement(222726..223478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyh:Cyan8802_0083 carbohydrate kinase, YjeF
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05773"
FT                   /inference="similar to AA sequence:KEGG:Cyan8802_0083"
FT                   /protein_id="ADU05773.1"
FT                   /translation="MPSESPREDNAQELLASMTTLRRQARAARQAYWLPLLLFGVLIAA
FT                   AAPLYVESAEPPALRAGSDGPVLTGLGGGFLEKSTALGWYWLAALVGGYLAGLAWYRWH
FT                   GRRAGVQTPTRAYVIAGIAGTLVGLALPVVLEFLLFNTSAPVSGGTSWLTGPLLGLANR
FT                   GMLPHLVIAVGLAVLAHLERSRSLWVVVGLYTVVLVAVNAWFQVSDLQPGDLTRFSFML
FT                   AAMLPAPVLLIGGGLTLAAAKKQHNGYA"
FT   gene            223660..224097
FT                   /locus_tag="ML5_0221"
FT   CDS_pept        223660..224097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0221"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: stp:Strop_4433
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05774"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADU05774.1"
FT                   /translation="MSRVQLALRVSDLEGSVAFYSKLFGVEPAKRRPGYANFAVENPPL
FT                   KLVLLEGEPGLPTVMDHLGVEVSTTEEVNAATNRLTESGLITLEENDTECCYALQDKVW
FT                   VRGPGDEPWEVYTVKADSPQLAKATESACCASDTAAQPAAV"
FT   gene            complement(224162..225127)
FT                   /locus_tag="ML5_0222"
FT   CDS_pept        complement(224162..225127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0222"
FT                   /product="WD40-like beta Propeller containing protein"
FT                   /note="PFAM: WD40-like beta Propeller containing protein;
FT                   KEGG: sal:Sala_2007 peptidase S9, prolyl oligopeptidase
FT                   active site region"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05775"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ADU05775.1"
FT                   /translation="MRALRTALTPVLVLAVILLSGCGRVSGLLDRVSLFHPVWAADGWV
FT                   YYLREVTSTSGSGVAEVWRQRPDGSAEEPVLKRAPAVSTCEAGLFSFLFAGPGGDLGVA
FT                   LECGWDETELLSYSPADKTFEPLASTRFLAEAALVNRGGGGYVEAPRECGPGGVQLLAD
FT                   GKAYEFGSPVTVGGVTFNLSGGDTDCESTVLARSPAALGERLFFITAPDSLGRLPLPPE
FT                   VSPDDLTWHLTEWAVGSATARFITELPGLADLAVSPDGRSVIAAVASDHVGGVWSVDVR
FT                   TGKKTRIAGGARAYHPSFSPDGKRFVYVEKLERLKFAEAR"
FT   gene            225285..225812
FT                   /locus_tag="ML5_0223"
FT   CDS_pept        225285..225812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0223"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_3881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05776"
FT                   /inference="similar to AA sequence:KEGG:Sare_3881"
FT                   /protein_id="ADU05776.1"
FT                   /translation="MKLRAAILLALTALSLGLVVVASPAEPAWACSCARTGADERADLI
FT                   VVGTITEVTDTGVQLAVESVEKGSLRAGATLRLRVGRQEESCGYDFRTGTRYRVNSRDG
FT                   VTGLCAGITAAPAQVPTTPSAPAAAPTLVTALPAPAQVPGRLWLVGGAVLTVLAAGLVA
FT                   VSMRRRRIEAKR"
FT   sig_peptide     225285..225353
FT                   /locus_tag="ML5_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.655 at
FT                   residue 23"
FT   gene            complement(225909..225982)
FT                   /locus_tag="ML5_R0005"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(225909..225982)
FT                   /locus_tag="ML5_R0005"
FT                   /product="tRNA-Phe"
FT   gene            complement(226056..226132)
FT                   /locus_tag="ML5_R0006"
FT                   /note="tRNA-Asp1"
FT   tRNA            complement(226056..226132)
FT                   /locus_tag="ML5_R0006"
FT                   /product="tRNA-Asp"
FT   gene            complement(226166..226238)
FT                   /locus_tag="ML5_R0007"
FT                   /note="tRNA-Glu4"
FT   tRNA            complement(226166..226238)
FT                   /locus_tag="ML5_R0007"
FT                   /product="tRNA-Glu"
FT   gene            complement(226382..227170)
FT                   /locus_tag="ML5_0224"
FT   CDS_pept        complement(226382..227170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0224"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   stp:Strop_0292 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05777"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADU05777.1"
FT                   /translation="MRPRALSALALGLVLLVTGCGEAGKSPEKAAAPPSASASPSPTPV
FT                   TKPSPTPTTPAKPKLRPLPKKLPTGLHRASGSNGVALTFDDGPDPRYTPQILAQLRAAH
FT                   VKATFCVVGKQAKRYPELVARIVREGHQLCNHSWHHDVNLGRRSAAEIRSDLERTNEAI
FT                   HAAAPKAPITWFRQPGGRWTAEEVTIAKQMGLRPLHWSVDPQDWDHPPAKTIIKRVKGA
FT                   TRHGSVVLMHDAGGDRAQTMAACRHLIPDLKRRYGIALPR"
FT   sig_peptide     complement(227099..227170)
FT                   /locus_tag="ML5_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.734 at
FT                   residue 24"
FT   gene            complement(227247..228191)
FT                   /locus_tag="ML5_0225"
FT   CDS_pept        complement(227247..228191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0225"
FT                   /product="regulatory protein MerR"
FT                   /note="KEGG: saq:Sare_4927 MerR family transcriptional
FT                   regulator; PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05778"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADU05778.1"
FT                   /translation="MADEALSAGAVARRLGVAVTTLRTWHQRYGLGPSEHVPGHHRRYT
FT                   PADLARLEIMRRLTTEGVAPAEAARWARQAPAVLPPERLGLKARASTVRDGGGTIPVGR
FT                   AGPAARGLARAAMRLDSVTIGRTIADALAADGVVATWEGLLRPVLAGIGERHAATSALI
FT                   EVEHLMSRCVSEAFATVARTYPMTGPPRILLSCADEEQHSLPLEALAAALAEVGVSYRM
FT                   LGARVPVPALVEAVNRTGPAAVVLWSHIRATADPCQLTALLAVPRRPLLVLAAGPGWRA
FT                   DSLPAGVVRPVDLAEALSLAVAVRDSLDQSTTS"
FT   gene            complement(228181..228774)
FT                   /locus_tag="ML5_0226"
FT   CDS_pept        complement(228181..228774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0226"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 1"
FT                   /EC_number="5.3.3.2"
FT                   /note="TIGRFAM: isopentenyl-diphosphate delta-isomerase,
FT                   type 1; KEGG: stp:Strop_4438 isopentenyl-diphosphate
FT                   delta-isomerase; PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05779"
FT                   /inference="protein motif:TFAM:TIGR02150"
FT                   /protein_id="ADU05779.1"
FT                   /translation="MSERETHLVELVDDDGLVIGETTVATAHQPPGRLHRAFSVLLVDP
FT                   EGRVLLQQRAAVKTRFPLRWANSCCGHPLPGQSLTEAANRRLAEELGVDPVDLTEVGVY
FT                   LYYAEDPATGRVEFEYDHVLRADVPADLVTRPDPDEVADLRWVDPGAVVADLDAHPREY
FT                   APWLGGVVNRLLHPTDASRPGVPATEAPERSGGR"
FT   gene            complement(228771..230285)
FT                   /locus_tag="ML5_0227"
FT   CDS_pept        complement(228771..230285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0227"
FT                   /product="phytoene desaturase"
FT                   /note="KEGG: stp:Strop_4439 phytoene dehydrogenase-related
FT                   protein; TIGRFAM: phytoene desaturase; PFAM: amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05780"
FT                   /inference="protein motif:TFAM:TIGR02734"
FT                   /protein_id="ADU05780.1"
FT                   /translation="MMSNFVSKGAGMRTVKGRTDRVVVVGAGLGGLACALHLAGSGRQV
FT                   TVLEREPVPGGRAGRLSVDGYEFDTGPTVLTMPDLIAEALGAVGEELTDWLDLTPLDPA
FT                   YRAYYPDGSTLDVITDTTRMAAEIARVCGPREADGYLRFVEYARNLWQWERADFIERNL
FT                   DAPTDLLTGNLLKLFAGGAFRRLQTKINQFFRDPRTQRIFSFQAMYAGLSPHDALAIYA
FT                   VIAYLDSVAGVCFPRGGIHAVSRGMAGAAEKHGVQIRYGTTVTRVETANGRATGVVTAD
FT                   GDFIPADTVVLNPDLPVAYQDLLPPSRQRKLTYSPSCVVLHIGSTQGYGKIAHHNIHFG
FT                   RSWKGTFDEVIRRGELMTDPSLLVTNPSRTDPSVAPAGRHTYYVLAPVPNLERAPFDWT
FT                   GDLTQRYADQLVTTLEERGYVGFGDGIEVMRAVTPADWAAQGMAAGTPFAASHSLFQTG
FT                   PFRPSNLHRTLENVVFVGSGTQPGVGVPMVLISGKIAAARITGAMS"
FT   gene            complement(230282..231436)
FT                   /locus_tag="ML5_0228"
FT   CDS_pept        complement(230282..231436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0228"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: saq:Sare_4930
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05781"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADU05781.1"
FT                   /translation="MANDAVAGNALRVAPAQPGATDDPVRGVLAAFTKDLIKGVDETLA
FT                   AFLAAEVESLTEIDAAMGGFAATARDSVLAGGKRVRPTFAYWGWRGVVGGEEPLCSVLP
FT                   ALSALELLHTFALVHDDVMDASDTRRGLPTAHRAAAARHRAAGHTGDPDRYGEAVAVLI
FT                   GDLCMVWADRLMAHAAVPAERLLDVRRCYDQMRVETVAGQFLDVLGENDSASWTVDRAL
FT                   RVARYKTASYTVQRPLLFGACLAGADADDPLIAAYTRYGLAVGEAFQLRDDLLGVYGDP
FT                   ETTGKPAGDDLRTGKPTALLMLARQLADPAQRRVLERAGSVTSATEVDRLADVVRDTGA
FT                   TARVERMISDRVTEALAALGTAPIDETARTALTGLATAATARRA"
FT   gene            231501..232427
FT                   /locus_tag="ML5_0229"
FT   CDS_pept        231501..232427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0229"
FT                   /product="Phytoene synthase"
FT                   /EC_number="2.5.1.32"
FT                   /note="KEGG: saq:Sare_4931 squalene/phytoene synthase;
FT                   PFAM: Squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05782"
FT                   /inference="protein motif:PRIAM:2.5.1.32"
FT                   /protein_id="ADU05782.1"
FT                   /translation="MDTDLTAAYDRCRELHRRHGRTYYLATRLLPAWKRRHVHALYGFT
FT                   RYADEIVDRTEDLPPAERAARLREWSDRFVAGLHGASVDDPLLPAVLHTIAVFDLDRDD
FT                   FASFLRSMAMDLTVMSYPTYDDLLDYMEGSAAVIGTMMLPILGSSDPAAAREPARQLGF
FT                   AFQLTNFIRDVAEDLDRGRTYLPDEDMAKFDLTRDDLLAAKAAGRTTPRIRELIEYEVT
FT                   RAQAHYVAAAPGIPLLDPASQACMRTAYALYGGILDEVAAQDYDVFVRRALVPQRRRMA
FT                   VAARALLTPPGTPVRVPGPALEPALAG"
FT   gene            232424..233746
FT                   /locus_tag="ML5_0230"
FT   CDS_pept        232424..233746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0230"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="KEGG: sro:Sros_1613 deoxyribodipyrimidine
FT                   photo-lyase; PFAM: DNA photolyase FAD-binding; DNA
FT                   photolyase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05783"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ADU05783.1"
FT                   /translation="MTGRTAVVLFTRDLRVHDHPALAAACSAFDRVVPLYVLDPALQKL
FT                   SPNRTRFLHQSLADLREALRKRGGDLVIRRGDPVAETVKLARKVGAEGVGLSADVSRYA
FT                   HRRERRLRAECDRHRMFLRLFPGLTIVEPGALRPGGGDHYRVFSPYFRAWQGVRWRDEL
FT                   AAPKRVRLPDGVDPGRLPDPPKGDSPDAAVGGEAVARRRLTAWLPTLDRYDDIHDDMAG
FT                   DETSRLSPYLRFGCVSPLAVATRAGGWDGPFVRQLCWRDFYHQVVAGFPDLSTVAYRRG
FT                   AREDWRDDPHAFDAWAEGRTGMPIVDAGMRQLRAEGWMHNRARLITAGYLTKHLGLDWR
FT                   PGLEIFFRWLLDGDRVNNSGNWQWVAGTGNDTRPYRGFNPVRQAERYDPDGAYVRRWVP
FT                   ELASVAGKAVHQPWRLPDEVRHTLDYPPPLEVPGADPVWLR"
FT   gene            complement(234117..235217)
FT                   /locus_tag="ML5_0231"
FT   CDS_pept        complement(234117..235217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0231"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: sen:SACE_3662
FT                   carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05784"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADU05784.1"
FT                   /translation="MHARFTPVRDCFHDLFTTGRETGASLSVWHDGVPVVKLVGGTTAA
FT                   VPPGTVVPAAGADRPWRPDTLVDVYSVGKPVVALCLLLLVDRGRVDLDAPVSAYWPGFR
FT                   APATVRQVLTHTAGLPAFPVPRPAAAIADWDLLCADLAAAEPEWTPGAVAAEHAWTYGH
FT                   LVGELVRRVDGRPVGRFLAEEIAGPWRLDLAFGLGEADRRRCADLSYADPAWPDAMRGE
FT                   PGSLRARALDNPPGGRDVAMVNSDLWRAAEIPAVNLHATAAGLARLYAGLLARGTLDGV
FT                   RLFSPELVTEATRVQYSGPDLLLDRPVDWTLGMQWEPDGSWGMGGIGGSSAWADPERGY
FT                   TFAYATARLADHDRVEELVEALHSCL"
FT   gene            235310..236794
FT                   /locus_tag="ML5_0232"
FT   CDS_pept        235310..236794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0232"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: saq:Sare_4957
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05785"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ADU05785.1"
FT                   /translation="MAEPELVDVVVVGLGVGGEEVAGRLAEAGLTVVGIERDLVGGECP
FT                   YWGCVPSKMMIRAANALAEAHRVNELAGSAQVRPDWAPVAKRIRAEATDTWDDKVAVDR
FT                   FTGKGGRFVRGSGRLDGPNRVRVGDQVFQARYGVVLGTGTRPSVPPIDGLADTPYWTNH
FT                   QAIEVEELPASLLVLGGGAIGLELAQVFARFGVRVTVIEAADRVLAVEEPEASALAADA
FT                   LRADGVEIHTGVKAGRVSHDGTTFTVHADGAEFTGEKLLVVTGRKAHLEELGLDTVGVD
FT                   AGQRYLPVNDRMHVTDGIWAVGDLTGEGAFTHIAMYQAGIVVPDVLDHMRRTKGGPDAS
FT                   GTASVVGGAAGVVSAVGGAMSAGGSTAAPGSVPVADYRALPRVTFTDPEVGAVGLTEQQ
FT                   ARERGVNVQVGYADLTSSARGWIHKTGNAGFIKLIADADQGVLVGATSAGPAGGEVLSA
FT                   LVVAVHAAVPISQLRHMIYAYPTFHRAIEDALRALK"
FT   gene            complement(236799..237563)
FT                   /locus_tag="ML5_0233"
FT   CDS_pept        complement(236799..237563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0233"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   saq:Sare_4961 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05786"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU05786.1"
FT                   /translation="MGVRVEHAGAVTTVILDRPEARNAVDGPTARALADAFRAFDADPD
FT                   AAVAVLWGAGGTFCAGADLKAVGTPRGNRVEPGGDAPMGPTRMRLSKPVIAAISGYAVA
FT                   GGLELALWCDLRVAESDATLGVFCRRWGVPLIDGGTVRLPRLIGESRAMDLILTGRAVG
FT                   ADEAYAMGLVNRLVAPGEARTAAEELAAAIARSPQTCLRNDRAAVRDGAGQPEPEAMAT
FT                   ELAYGLESLAVDGVRGAGRFADGAGRHGAPAG"
FT   gene            237647..238498
FT                   /locus_tag="ML5_0234"
FT   CDS_pept        237647..238498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0234"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   gob:Gobs_4736 Rieske (2Fe-2S) iron-sulphur domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05787"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADU05787.1"
FT                   /translation="MRELLTKLEQATGLDRVGDRLQRAVQGTLRSQRVRDALHGVWLGH
FT                   PLHPAMVQVPVGAWISAAVVDLLPGQRRAATALVGLGTVSAVPAAVAGLNDWATLTRDQ
FT                   RRVGLVHAAANTVGLALFAGSLAARLNGRHGLGRTLSYLGLSAASGGAYLGGHLAYKQG
FT                   AQASQSVSELHLISDGWHRVGDLSSLPRHELVTKKIDDVPVILYRDGDDVSVMLERCPH
FT                   QSGPLGEGTVEQIDGHACVVCPWHGSAFRLDGGEVVHGPAANDQVVLPSRVVSGRVEAR
FT                   LP"
FT   gene            complement(238500..239516)
FT                   /locus_tag="ML5_0235"
FT   CDS_pept        complement(238500..239516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0235"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="KEGG: stp:Strop_4449 peptidoglycan-binding LysM;
FT                   PFAM: Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05788"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ADU05788.1"
FT                   /translation="MGAPRRSPVRRAGQVLTGLGALVVLVGVLAGGPVALLAFAGNPLP
FT                   DHLPTLAEVGTALTSRDDGRLFLRALAVVGWFGWATFAFSVVVELLAAAVRRPAPKLPG
FT                   MHRQQKAAAALVGSVALILVASPAAASAAALTAPQPAVAAVTSPAVAASQVTPPAPIAS
FT                   KADDPAVYRVAKGDYLGEVADRYLDDFDRYKELARLNRLADPDRIRPGQLITLPEGATD
FT                   SGARRHATGRIVVTKPAETAPVKPGGGGASSTTPKAKPKPTPRDATPTVEAPVGQPPAM
FT                   SAGASRATAEEGINRPLAISAVLAVASIVGAQIGALLGLRKRPVPARALSSGRHRRD"
FT   gene            complement(239532..239963)
FT                   /locus_tag="ML5_0236"
FT   CDS_pept        complement(239532..239963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05789"
FT                   /inference="similar to AA sequence:KEGG:Strop_4450"
FT                   /protein_id="ADU05789.1"
FT                   /translation="MTGRREAENGRVSLFLAVAMTGVLAIIGLAYDGAGQLRTLQRADN
FT                   LAAEAARAGGQMIDRARAIEGGPKRIDQVAARAAVAAYLDAAGGVQDHDVDFPVVGTET
FT                   QIRVRVQITYSRDLLSLFGVQENATVTGEATARALTGPP"
FT   gene            complement(239960..240433)
FT                   /locus_tag="ML5_0237"
FT   CDS_pept        complement(239960..240433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0237"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: stp:Strop_4452 TadE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05790"
FT                   /inference="protein motif:PFAM:PF07811"
FT                   /protein_id="ADU05790.1"
FT                   /translation="MNAGPRRDRGSVSIEVAVLAPAFIGLMVLAGVAGRTAIADEAVES
FT                   AAHDAARAASLARTADDGAEAAEVAAQDQLGWAGLNCTGPPQIDLAGSVAGTTTSFAAA
FT                   YQSAAGVPATVTVTVTCTVSFDDLSAPGLPGVPGGKTVSASFTSPLDTYRSRG"
FT   gene            complement(240430..240912)
FT                   /locus_tag="ML5_0238"
FT   CDS_pept        complement(240430..240912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0238"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: stp:Strop_4453 TadE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05791"
FT                   /inference="protein motif:PFAM:PF07811"
FT                   /protein_id="ADU05791.1"
FT                   /translation="MPRPARTVRSRPASAGRPAGPPGPGRFAAALRARLAEGERGANPV
FT                   ELAVVMPVILVMLFGSIQVAVWFVARSTALNAAQTGVNAQRTIDAGPDAGRQRAISFLQ
FT                   QSGDWLVGWEQTGPTCVETATAVTCTVQGRSLSVIPGVSFEVTQTAHGPAEHWTTG"
FT   gene            complement(240912..241121)
FT                   /locus_tag="ML5_0239"
FT   CDS_pept        complement(240912..241121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05792"
FT                   /inference="similar to AA sequence:KEGG:Sare_4967"
FT                   /protein_id="ADU05792.1"
FT                   /translation="MHLYAYLYVAVSTRLAELRRDSERGDSPVPTAVIIFGLVAVAMAV
FT                   TGLALAKANNWMNAIPNNTAPQAP"
FT   gene            complement(241147..242010)
FT                   /locus_tag="ML5_0240"
FT   CDS_pept        complement(241147..242010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0240"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   saq:Sare_4968 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05793"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADU05793.1"
FT                   /translation="MILNWQLAIAVLGGCAVGLGLFLVVREALPATPALGPALRRLHQP
FT                   PGQAPAAGAGPDWLGGFARWLRPPHRQLALLDRTPEQYALSVLLSALVGFATPAVASAV
FT                   LFVGGVALPVAVPVVASLGLALGAGLLAHRTVLAKADAARDEFRQAVCTYLDLVALQLS
FT                   AAHGPVQSLERAAAVCDGWVFDRIREALRLAQLQMHSPWDELQELAERIGIPELGDVGA
FT                   IMRSSGSEGAQVHETLRSRADSLRDQIRTDNLARAEGVTSKLDIPGSLLVFVLLGFAVY
FT                   PFLARL"
FT   gene            complement(242007..242906)
FT                   /locus_tag="ML5_0241"
FT   CDS_pept        complement(242007..242906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0241"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   stp:Strop_4456 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05794"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADU05794.1"
FT                   /translation="MTQIELIALVSGAACVAGLVLTVVALVGTRRPPGPAPGAGPGLSR
FT                   LWTGSGASRADQRRYQLLLGAAVVAGAAAFLLTGLPVVGLLVALAVPGVPWLFAVGRAE
FT                   QRAIARVEAVGEWTRRLKDISATGQGLQQAIIGTIATAPEEIQEEVRTLAARLQAGWLA
FT                   RSALLAFADEIADPVADQVVAALILHLTDRGERLGDVLGSIATAASAEVATRREVEAKR
FT                   TQPRFAVRFLTGMTLATLAYGLVNSDYIRPYGTLTGQLVMAVLGAAFVGLLVWVRSMSQ
FT                   PPRPARFLPAPDLDEAIA"
FT   sig_peptide     complement(242829..242906)
FT                   /locus_tag="ML5_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.575 at
FT                   residue 26"
FT   gene            complement(242903..244444)
FT                   /locus_tag="ML5_0242"
FT   CDS_pept        complement(242903..244444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0242"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   stp:Strop_4457 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05795"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADU05795.1"
FT                   /translation="MRFEPVSHDPRAQQPGVVSTVPPLAPPNGRHHVPGPAPAAPPAPP
FT                   PRPRVDFAVVRELRRELSERLTHWQRGREFDADAEEVERARLAVAVVSAYADSVRRAGT
FT                   PMAADSERLLLDQVTAELVGLGRLQTLLVDDSIEEVHILGCDQVRITRHGGGVDWAEPI
FT                   AETDDELVEILQAAARRAGATERSLSTSKPTLDLQLPDGSRLAAVFLVSHRPYAVIRKH
FT                   NTLEVSLEDIAGGRPDLDEMIDPLLRDFLRASMRAGLNIMVAGLAGAGKTTVIRALMDE
FT                   IPADEPYVLLEESRELLPARRGHKHRAVMSFESREGHGERGADGRPAGEVSIADLIPVS
FT                   LRMGVLRIIVGEVRSREIVPMLQAMTTSRGSMCTIHARTPSGVSERIIELALSHGREMT
FT                   VDQARRMAGNALDLIVYVTVEDETAIGGRKHRFVSHVEEVIGVGEGNRITTTTVFGPGP
FT                   DGRAVPRHLPERIRDQLLRVGYDARLLTRFVEAGVGAWRRPRHTRLGARPSGGPA"
FT   gene            complement(244434..245267)
FT                   /locus_tag="ML5_0243"
FT   CDS_pept        complement(244434..245267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05796"
FT                   /inference="similar to AA sequence:KEGG:Strop_4458"
FT                   /protein_id="ADU05796.1"
FT                   /translation="MAIIALVSAKGSPGVTTAALAAALSWHRRLVLAECDPAGGSILAG
FT                   YLGGALDGPRGIGELAVGELRDGSLEHAFWSQLVDLDAPRRERLLLPGVVDPAQAGSVI
FT                   PLWQRFADYFTGLERGEPPYDVLVDCGRLAVGGPPWPLLRAAAVVLLVTRAHLPDLSAT
FT                   RATARAIERDLTEHRVPPGTLRLLVVGDGHGTSEISKALRLPVIARLPHDPRTAEVLAH
FT                   GGTVRANRPLMRAAGALEVPVRALLDRRRARLAWPGATTPRAVTAPSVPGVSGAV"
FT   gene            complement(245267..245935)
FT                   /locus_tag="ML5_0244"
FT   CDS_pept        complement(245267..245935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0244"
FT                   /product="SAF domain protein"
FT                   /note="PFAM: SAF domain protein; KEGG: saq:Sare_4972 SAF
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05797"
FT                   /inference="protein motif:PFAM:PF08666"
FT                   /protein_id="ADU05797.1"
FT                   /translation="MSVVAARNGTPVEAPVAPPKVVRQRRVRPGLLGLAVLLIALGGLG
FT                   AAFAVTSVRSTGTYLAVARPVDVGHQLTADDLVPVRVSGGRELQPVPADRMDEVLGLRA
FT                   AVRLTPGTLLTPAQLTEAPLLGPGQQQIALGLEPEQVPARKLHPGDKVLLVSTPSNATG
FT                   GGSEASRGGGTRFEGTVIDTAAPQNGDVVVYLALAVRDVPAVVALAADDRIALVLTEAA
FT                   "
FT   gene            complement(245932..246885)
FT                   /locus_tag="ML5_0245"
FT   CDS_pept        complement(245932..246885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05798"
FT                   /inference="similar to AA sequence:KEGG:Sare_4973"
FT                   /protein_id="ADU05798.1"
FT                   /translation="MLTWGGRGVPARPARAGTLRRLLLAAGLAALLTLTGAPARAADPG
FT                   GSCPPEQTDCDVWDDDPGTPGGPGGPGGPGGGGDNGGGGGSTPKCQWNGRAIPCYHPIL
FT                   GWFNNADGCYYKLEEPQDEAPPGKQWYQLTCNGGDLGSLRRALLDAPPPGYGAPPDPEE
FT                   LARRALASISLLPPRAAVAPRRSQGPGLVGLPVWMWASPGAAYFGPLSASASDRGLTVE
FT                   ITAKVDRIVWHMSDDIDVTCDGPGTPYRADGPRAGSTSPDCGLDQGYPKAGTYQVSATT
FT                   FWTVEWSGGGESGVIAQSRSSGVVLVQINELQVVTR"
FT   sig_peptide     complement(246760..246885)
FT                   /locus_tag="ML5_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.993 at
FT                   residue 42"
FT   gene            complement(246879..247445)
FT                   /locus_tag="ML5_0246"
FT   CDS_pept        complement(246879..247445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05799"
FT                   /inference="similar to AA sequence:KEGG:Sare_4974"
FT                   /protein_id="ADU05799.1"
FT                   /translation="MRTRQSRRWEIFLLSIVLVVGSAGCGTEPEAVTRPLTGRAAAPAA
FT                   HSSAEENAAGKAALAAYSGYLDASRAASARSDPSHPALTRFLADPLLTRVRMAILDAKE
FT                   HGAMRTGKLVSDPEVVSVDLAARPPTVEIQDCLDASGYRLVYAKDRKAVPGTRGGRYLA
FT                   TATAVRYPDGRWLINGGAAHQDQPC"
FT   sig_peptide     complement(247362..247445)
FT                   /locus_tag="ML5_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.674) with cleavage site probability 0.403 at
FT                   residue 28"
FT   gene            248005..248781
FT                   /locus_tag="ML5_0247"
FT   CDS_pept        248005..248781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0247"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   stp:Strop_4462 peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05800"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ADU05800.1"
FT                   /translation="MTAERVRRTGPVADARRPSTRLTAALTVVPLLRLAVARYAVPPGC
FT                   PDRTACDGCGAPIGLDRPLPALGPVARCPACRARVGAPPAVVEVALLLAVAVPVFAGGA
FT                   PAARLALAWWLVWAVPMTIVDAMAHRLPDRLTWPAAAGVWALLGVAALTGPGVDPLVRA
FT                   VLAALALGGGFAATTLLFGRRGFGLGDAKLALGAGALLGWYGWPVLVAGLVLALLLAGS
FT                   AGVALLAARRVRWSGHLPFGPFLVLGTAATLVLVTV"
FT   gene            248890..251259
FT                   /locus_tag="ML5_0248"
FT   CDS_pept        248890..251259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0248"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: tcu:Tcur_2817 glycoside hydrolase family 65 central
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05801"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADU05801.1"
FT                   /translation="MPHGDDGWRIRRTSADLDRLGETESVFALANGWVGWRGTLDEGEP
FT                   CGMPGSYLNGFHEQHELTYPESGYAFPERSDTVISAPNAALIRLWVDDEPLDLSTGTIR
FT                   RHHQELDLRAGVVRRETEWVSPGGRGVRIRSTRLVSLTRRPVAAVDWAVEPLDEPVRLR
FT                   VGADLLANQRVPERADDPRAASVIHDPLTGEIRRDDGPDGVLVHRTGRSGQRVAVAVAH
FT                   RVEAPDEIATDTELTADRFRLALSGPVRPGERIRVTRFAAYECTDVDGTPAGELADLVV
FT                   AEAATARDDGFDALLTEQRAALDAAWDTADVELEGDPELQLAVRFSVFHLLQSGRADGD
FT                   RTIPAKGLTGNGYDGHVLWDTEGYVLPVLTYLAPELARSALRWRHAHLPEARDRAAELR
FT                   LTGATYPWRTLSGRECSGYWPAGSAGLHVNADIADAVLRYVAATGDTAFLAECGAEVLI
FT                   ETARLWHGYGHFDDGGAFHLTGVTGPDEYSALVDDNVFTNLMARRNLRGAADAAEDCPE
FT                   VAARLGVDAAEVAGWRAAADAMFVPYDGKRGVHEQSAGFTAQPEWDFAGTGEDDYPLLL
FT                   HFPYQELYRKQVVKQADLVLAMLRCPGEFTAEEKTRNVAYYEARTVRDSSLSASAQAIL
FT                   AAEVGHLDLAYDLFAETAFQDLADLGDKTADGLHLASLAGAWLVVAQGFGGLRDDRGVL
FT                   AFEPRLPRPITRLAFHLRRHGHRLRVTLTEREARYELPDAGPGDAVELWHHGEQLRVTG
FT                   DGPVTRPMPPVPDPGPEPEAPPGRRPERRAQEAGGD"
FT   gene            complement(251238..251714)
FT                   /locus_tag="ML5_0249"
FT   CDS_pept        complement(251238..251714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_33090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05802"
FT                   /inference="similar to AA sequence:KEGG:ROP_33090"
FT                   /protein_id="ADU05802.1"
FT                   /translation="MTGGRETVEVEPVVFRAVYDSPASLPGRHRWTTPEADVRRLEKLL
FT                   NMPARSIGAPLWVSGDEPDCPKCGRRVTWYDIVASALHGVHDHTMIARVILGERKYVNT
FT                   EVPDAIPGVHCADCRTPITGLRSFKCHNWAYAFEALEEVVARMSGLPAQSPPAS"
FT   gene            251830..252603
FT                   /locus_tag="ML5_0250"
FT   CDS_pept        251830..252603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0250"
FT                   /product="protein of unknown function DUF574"
FT                   /note="KEGG: sma:SAV_7303 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function DUF574"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05803"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADU05803.1"
FT                   /translation="MTEAENRPNVARMYDYYLGGCHNFAADRAAAEEVLKIFPDTGVAA
FT                   QSNRAFLRRVVRWAAGQGVRQFLDIGAGLPTQGNVHEVVRAVRPDARVVYVDHDEVAVA
FT                   YARRLLPTDGRTVVLQGDLRRPGDLLADPTLRDTIDLSEPVAVLLLAVLHFVPDADDPY
FT                   AAVATLRDATVPGSVLALSHLTLDGLPTLPTEQGTAIYRRSSSPLVPRTRDEVARFLDG
FT                   YELVEPGLVKVADWRPDGEPQAAVSHGYGGVGVRR"
FT   gene            complement(252610..252963)
FT                   /locus_tag="ML5_0251"
FT   CDS_pept        complement(252610..252963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbi:Tbis_0399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05804"
FT                   /inference="similar to AA sequence:KEGG:Tbis_0399"
FT                   /protein_id="ADU05804.1"
FT                   /translation="MTGGKARREGTAGGACDDRRMSSAASPDVSALAINVTVPEELRWT
FT                   DTRRGEEFTLTTLNIRLLPDGRLAAKAYGRPTAGGRGAYVSFRVPDRPELAALVAAAAD
FT                   RAAALWAAHGGLD"
FT   gene            complement(252960..253841)
FT                   /locus_tag="ML5_0252"
FT   CDS_pept        complement(252960..253841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0252"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: sen:SACE_4776 sigma factor, sigma 70 type,
FT                   group 4; TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05805"
FT                   /inference="protein motif:TFAM:TIGR02957"
FT                   /protein_id="ADU05805.1"
FT                   /translation="MADRATEDFLAHRNLLFTVAYEMLGSAADAEDVVQETWLRWAGVD
FT                   LEAVRDRRAYLVRIATRQALSRLRTLGRRKESYVGSWLPEPLLTAPDVADDVTLAESVS
FT                   MAMLLVLETLTPTERAVFVLREVFDVGYDEIAETVERTPVAVRQIAHRARAHVAARRPR
FT                   RTVPAAEARDALDAFRRAVETGDLDGLLRVLAADAVLVGDGGGIKQAIARPVTGGDKVA
FT                   RLLAGGWRRIAAVASMEPVQVNGYPALLVRLDGELDTVVAVRLDDGRISGLYAVRNPEK
FT                   LSHMTRETTLRR"
FT   gene            254009..254494
FT                   /locus_tag="ML5_0253"
FT   CDS_pept        254009..254494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0253"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="KEGG: sen:SACE_4777 alkylhydroperoxidase; TIGRFAM:
FT                   alkylhydroperoxidase like protein, AhpD family; PFAM:
FT                   Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05806"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ADU05806.1"
FT                   /translation="MQTRFNLFENPVSATFMKRFAGAGLMIHQSSLPRTVQELVSLRAS
FT                   QINGCGWCIDMHTKEAVAGGESAVRLNLVAAWRESTVFTEAECAALAFAEEGTRLADAH
FT                   QGVSDETWEQVRKHYDDDQIAALVCLLGLINAANRFAVLVHQRGGSYEPGMFAAAMG"
FT   gene            complement(254504..255595)
FT                   /locus_tag="ML5_0254"
FT   CDS_pept        complement(254504..255595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0254"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: Epoxide hydrolase domain protein; alpha/beta
FT                   hydrolase fold; KEGG: sro:Sros_5100 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05807"
FT                   /inference="protein motif:PFAM:PF06441"
FT                   /protein_id="ADU05807.1"
FT                   /translation="MIEPFRVHVPQADLDDLADRLARTRWPDELPDAGWDYGIPLSRVR
FT                   ELAEHWRTAYDWREAEAELNRYPQFTTTIDGQNIHFLHVRSADPDALPLILTHGWPGSV
FT                   VEFLDVIGPLSEQFHLVVPSIPGFGFSGPTRERGWDVDRVARAWAELMRRLGYRRYGAQ
FT                   GGDWGSVISTRLGGIDPEHVVGVHLNYLPTPPPPGWTGEAGLSGEDRDRLARIRRLKTQ
FT                   RHPHQVLYASRPQTVSYALNDSPVGQLAWIAEKFTEWTDPGSAVSVDRVLTDVSVYWFT
FT                   GTAASSARLVRESAFGGPPAPCPPPLGVAVFAHDITRSVRPIAELTYTIRQWSEFDRGG
FT                   HFAALEVPELFVDDVRSFFWNLR"
FT   gene            255690..256151
FT                   /locus_tag="ML5_0255"
FT   CDS_pept        255690..256151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0255"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: ami:Amir_2538 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05808"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU05808.1"
FT                   /translation="MDNPEPDLVPTRLAGLPSWLITRTAVRAGRLVSDGLAAVDARGYH
FT                   FRLLATLDEFGPASQAALGRRSGIHVSDVVAALNELAEREFVTRSPDPADRRRNVVTIT
FT                   AAGRRQLRRLEKRLAAVQDELLTPLSPDERAELTRLLARVLAHHTRPPA"
FT   gene            256229..256825
FT                   /locus_tag="ML5_0256"
FT   CDS_pept        256229..256825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0256"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: sro:Sros_5282 hypothetical protein; PFAM:
FT                   regulatory protein ArsR; SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05809"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADU05809.1"
FT                   /translation="MSMERWAEIALHPVRIRILRAVAGARVTTHDLVELLPDVPQATLY
FT                   RHLATLVKTGMLDVVQERKVRGAVERVYALPAHGAALDPAALATATPEDHARYFTAFVS
FT                   SLLSEFSRYLARESVDFVADGVGYQQLVLHLTDAELHDFAAGLNALVGPLLARGPGGGR
FT                   TPRLLATVLMPADRPATPGDTHTSAHDSDTTKGDD"
FT   gene            256825..257196
FT                   /locus_tag="ML5_0257"
FT   CDS_pept        256825..257196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_5283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05810"
FT                   /inference="similar to AA sequence:KEGG:Sros_5283"
FT                   /protein_id="ADU05810.1"
FT                   /translation="MASVTLDRDVIDIRFTGWERMWVGRERFTLRLAAVRHAAPVDEPI
FT                   RLARGARRGYAVSGFAKVGVWGIFGGPRQLVAARRGKPGLHLVLDRAAAGGEFDEVVVS
FT                   DPAASRLAETIGRATRSRP"
FT   gene            257193..258098
FT                   /locus_tag="ML5_0258"
FT   CDS_pept        257193..258098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0258"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cfl:Cfla_0921 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05811"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU05811.1"
FT                   /translation="MTGDRLAIEASGLTKRYGDVTAVRDLTFTVRPGAVTGFLGPNGAG
FT                   KTTTMRMLTGLVTPTGGAATIGGQPYGRLAQPSRTVGAVFDGNAFHPGHTARDHLGVYA
FT                   AMAGCPDGRVAELLDLLGLAQAADRRTREFSTGMRQRLSLATALLGDPRVLLLDEPSNG
FT                   LDPEGMSWLRGLLRRLADEGRTVLVSSHVLHEAQQVVDDVVVIRRGELVAAGPWSRLTG
FT                   PPTVLVTSPDAIDLAAALTADAGSVEPAGPGRLRVRGLDAPRVADLAADHRLRIHELVT
FT                   ETTSLEQLFLELTTDTAEAR"
FT   gene            258095..258889
FT                   /locus_tag="ML5_0259"
FT   CDS_pept        258095..258889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_5480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05812"
FT                   /inference="similar to AA sequence:KEGG:Sros_5480"
FT                   /protein_id="ADU05812.1"
FT                   /translation="MNLIRAELRRVLATRMCTGLLLAALALGGGLVGLMALVGPENFDP
FT                   PMPGLHTEEGLRSILGILGFTAFVPAAAGALAATSEYRHGTAAVTFMFAPRRGRVLAAK
FT                   LATHAIVGLGYGIALAGSAAAALFTVAAARGVSLGLPAPTVLALLARIGVAMAVYLLVG
FT                   TGVGALLRNQVAAVCVVVGYLYLAEPVLMMIPGVNALYPLLPGGATAALTDFTYVADAM
FT                   SAQLGSDAVALLPPAAGALLLTGYAIAAAAIAVVVPMRRDIT"
FT   sig_peptide     258095..258205
FT                   /locus_tag="ML5_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.450 at
FT                   residue 37"
FT   gene            259001..259993
FT                   /locus_tag="ML5_0260"
FT   CDS_pept        259001..259993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbi:Tbis_2629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05813"
FT                   /inference="similar to AA sequence:KEGG:Tbis_2629"
FT                   /protein_id="ADU05813.1"
FT                   /translation="MDPVLAGLPTDRVVALLGADADAVAMMIARDHAELAAVVHRPVSA
FT                   CTMPVDFVHAVLDRLERVAVELLPAWLPEAAHDVRPDTSGLAAVRAAAAARSRRDRYPG
FT                   SFLSDLAVFAVTGRRSGATTLPLRAQAAALARLVAGAFGRRKVVLLAEPAHGDGAVMAA
FT                   GAAWLVQHGGPAVWLAGAGAVGLDGLPAFRVAPPAAPVGQAPVAGRPHPGSDAEKRLEA
FT                   ALAAQSWAAGRRWNQSYQSHRLAAPVRLDLLWPDERCVVEIDGPEHCRPVRFEADRQRD
FT                   VQLQLDGYAVLRFTNARVVHDVGTVVQQIGTYLRARRRDLAEGRHHGRR"
FT   gene            259980..260633
FT                   /locus_tag="ML5_0261"
FT   CDS_pept        259980..260633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_1182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05814"
FT                   /inference="similar to AA sequence:KEGG:Mvan_1182"
FT                   /protein_id="ADU05814.1"
FT                   /translation="MAGDDLTASESAILVVLMAEAREVLNTELRDRYGLDVRKPQRDKL
FT                   TRLHYVASRKSGSTYALQLDDKGWVRMQSDLDFTLRGASALGAALTAMQAHLRDRVLAR
FT                   SGCATLAELFALTDVRGPAPAPAPEASGALEARVVAAYRALADEPGAWVSLRRLRPFFA
FT                   DLPRDDLDAALRQLSRSEGVTIAPESNQKTLTEADTAAALRLGGQENHLLAIGV"
FT   gene            260633..263794
FT                   /locus_tag="ML5_0262"
FT   CDS_pept        260633..263794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0262"
FT                   /product="AAA ATPase"
FT                   /note="KEGG: mva:Mvan_1183 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05815"
FT                   /inference="similar to AA sequence:KEGG:Mvan_1183"
FT                   /protein_id="ADU05815.1"
FT                   /translation="MNEAERNALAALRFDWAPVPDDVWRPLPFHVEGLHVPVLRDVLAG
FT                   VDEAASNPHGSPLGLVVQGQRGSGKTHLLGVIRQQVQERDGYFFLVGLLDAGSFWDGVL
FT                   AAMLDGLSRPVPGRRETQLKLLLRRLSALVGAPRTARRAVMGDTELTRAALDAFLEGLG
FT                   AFDRHAARTCQETARALALSASEDISHRDIAENYFLSGEEVAAGERAAWGMRRVPRPAQ
FT                   QIVQDLSWLLALTGPSVVAIDQIDTLIAQLAIQSDPALAGAVAMSPEQALMLARMADGL
FT                   MALRQTTRRTLTVLACIPNSWTIIKSTAADTVADRFRETPPLRRIDDADVARAIIEKRF
FT                   TLRYQEAGFVPPYPSWPVSPRAFAGAGAFTPRQLLIEIDKHIRECLADDEVREMTSLGE
FT                   PPIAEPRAPRPAPVTATGEEMDRYDARFAELREAADVTGPLRRTSEDAAMPPLLAAGLT
FT                   AWILERGDAGEAFSVDPPPSTDPPLHARLRLTLDERTEDQVHWCFRAIGDDHHGNAALA
FT                   RLRKASVAAALDTGSGRRKLFLLRNRAWSTSAATSKAVGAFTAAGGQTLGVDEEDLRVL
FT                   SALRVMLAEATMDLQGWLAERRPTRELKFLQHALADVDRWGPDAGPLPEPAEPPPAAAV
FT                   TGPADPSFVVGHGYDDGTPVPLALEALRKHTTIFAGSGSGKTVLIRRIVEECALAGISA
FT                   IVLDPNNDLARLGEGWPEPPAQWRPGDADRARDYLTHTDVVVWTPRRNSGRPLSFQPLP
FT                   DFTGVRDDPDEFGEAVEAAVASLAPRAMLTGRATRAHLGLAVLRKAVEHYGRRGGSRLQ
FT                   GLIDTLADLPDGIIDLDDADKIGLSLAQTLTAAMVNDPLFGGEGTPMDPGVLLTPAPGK
FT                   RARVSVVSLVGLPSDDVRQSFVNQLQMALFAWIKKNPAGDRPLLGLLIMDEAQTFAPSG
FT                   AMTACTQSTLALAAQARKYGLGLIFATQAPKGLHNRIPGNAATQLYGLMNSPIQIEAAR
FT                   EMARAKGGDVPDISRLTVGEFYLAAEGAAPRKIRTPLSLTHHPRSPLTVEEVLDRARGG
FT                   QGRST"
FT   gene            complement(263776..264690)
FT                   /locus_tag="ML5_0263"
FT   CDS_pept        complement(263776..264690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0263"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: fre:Franean1_4770 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05816"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADU05816.1"
FT                   /translation="MGTRTFRAAVVRTPGGPDTIEIIDVPEREPGPGEVRVDVAAAPVN
FT                   PADLGVVGGFFHSLGLIHQPHHTGLGWDFAGVVAAAGPGVDLAVGTRVAGLVGGFDRDF
FT                   GTYAEQLVVAAADVAVVPDDLDLVAAATVPLNGQTAAQIVDLLGDPPADGRLLVTGAAG
FT                   AVGGYVVPLARDRGWRVTGLARAGDEKFVRGLGADFTTAAEPGWDAVADAAGWQDQGLA
FT                   LVGDGGVFVGVRPNAHPAAERGVTVRAVDVRPDGARLADLLARTAAGELPARVHAVLPL
FT                   DRVADAHRAVAEGGVRGRYVLRP"
FT   gene            264809..265237
FT                   /locus_tag="ML5_0264"
FT   CDS_pept        264809..265237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0264"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   fre:Franean1_4769 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05817"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADU05817.1"
FT                   /translation="MPTQTAAEKRAQAREEYDAFLAGCPSRQLLDRISDKWVALILAAL
FT                   GRDGPDRNAEPQVMRYSELSRRLAGVSQKMLTQTLRSLERDGLVTRTVTPSVPVTVTYE
FT                   LTDLGQSLHRLMYGMKLWAEAHMDEVHANRERYDAADR"
FT   gene            265528..267000
FT                   /locus_tag="ML5_0265"
FT   CDS_pept        265528..267000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0265"
FT                   /product="glycoside hydrolase family 10"
FT                   /note="KEGG: sco:SCO5931 xylanase A; PFAM: glycoside
FT                   hydrolase family 10; Ricin B lectin; SMART: glycoside
FT                   hydrolase family 10; Ricin B lectin"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05818"
FT                   /inference="protein motif:PFAM:PF00331"
FT                   /protein_id="ADU05818.1"
FT                   /translation="MKHLPRRSHRVVLAAVTSALALAGAALVVPSLAQAAASTLGAAAA
FT                   QSGRYFGTAIAASRLGDSTYSTIAAREFNMITAENEMKPDALQPNQGQFNFSSGDQIYN
FT                   WATQRGLQVRGHTLAWHAQQPAWMQRLSGSSLRTAMINHINGVMAHYRGKLAAWDVVNE
FT                   AFNEDGSRRQSNLQGTGNDWIEVAFRTARAADPSVKLCYNDYNIENWSYGKTQGVYNMI
FT                   RDFKSRGVPIDCVGLQTHFTGGSSLPGNFQTTLSNFAALGVDVALTEVDVTNSSTSQYA
FT                   GLTQACLNVPRCIGITVWGVRDSDSWRSNENPLLFDGGGNKKAAYTSVLNVLNAATPNP
FT                   TPTGTASPTAGPTGGPTTPPPTNGASRIVGNQSGRCIDVPNSSQSNGTRVQLYDCHGLT
FT                   NQRWTYTSSRQLTVYGSMCLDAAGSGNGSAVQIYSCNGQTNQQWNVNSNGTITGVQSGR
FT                   CLDVWGTGNGQQVQIYDCNGQANQRFQLVATS"
FT   sig_peptide     265528..265635
FT                   /locus_tag="ML5_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 36"
FT   gene            267162..267461
FT                   /locus_tag="ML5_0266"
FT   CDS_pept        267162..267461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05819"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1449"
FT                   /protein_id="ADU05819.1"
FT                   /translation="MMIVIFDADREWYIQGRVYADIVRAVPAGMLQDDDLDMYLWPARS
FT                   MSLLRLPRLEPDRAERIAAALTEGVARCLRTIDPSDTELVEFYEGLLDVAARHG"
FT   gene            complement(267587..268324)
FT                   /locus_tag="ML5_0267"
FT   CDS_pept        complement(267587..268324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0267"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: kfl:Kfla_2724
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05820"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADU05820.1"
FT                   /translation="MANTSRNLGLGHGSAFGERGVAKRLGTLSRHTSLTGRRLLEIGCG
FT                   DGTYTMRLVGAFEQIEAVDIQQDRLELFRERLAGDPAAAQKINVRELSATELDYPDESF
FT                   DLVTAIEVVEHIDDLDAALRQVRRVLVPGGCFALTTPNRWFPFETHGFLIRGKRYRPAR
FT                   GPFLPWIVPLHRRLADARCFTARGLSAQLRRAGLERVAVDYIMPPFDRSHFGRRIRPVT
FT                   DTVERSPLRFFGMALAVVARRPA"
FT   gene            complement(268460..268963)
FT                   /locus_tag="ML5_0268"
FT   CDS_pept        complement(268460..268963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0268"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   kfl:Kfla_1153 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05821"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADU05821.1"
FT                   /translation="MQRTQFGAMACSIARTLDVIGEPWSPLILRDVYAGTHRFEQLQRG
FT                   LGVSRKVLAERLNWLVTQGVLTRREYSTRPVRHEYLLTDKGMELCDLLLVMVRWGDRWT
FT                   AGEAGPPVLYRHHACGRTSQVELRCSACGQPMHATDIDLLPGPGADSRDEDGLPDRDER
FT                   RQPG"
FT   gene            269083..269751
FT                   /locus_tag="ML5_0269"
FT   CDS_pept        269083..269751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0269"
FT                   /product="protein of unknown function DUF899 thioredoxin
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF899 thioredoxin
FT                   family protein; KEGG: stp:Strop_2736 protein of unknown
FT                   function DUF899, thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05822"
FT                   /inference="protein motif:PFAM:PF05988"
FT                   /protein_id="ADU05822.1"
FT                   /translation="MNHPPIVPTEDWQTALDTLRSREKMLTRQLDALAAARRRLPMTLV
FT                   EQEYVFEGPDGPVGLADLFQGRRQLIVYTFMWHGADDICSGCSMFTDNVGHPAHLNARD
FT                   VTLALISGGPLADLMALRHRMGWTLPWYSSLHNSFNADMGAGDGFALNVFLRADDRIFR
FT                   TYSTTARGVERLGSNWTFLDLTPYGRQETWEDSPEGWPQTQPYQWWRLHDEYDDSTDPS
FT                   "
FT   gene            269748..270272
FT                   /locus_tag="ML5_0270"
FT   CDS_pept        269748..270272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0270"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: sti:Sthe_2962 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05823"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADU05823.1"
FT                   /translation="MTVSTPIAELLFQPKDATPFDTDVATIKPWSQALSCLRSAHRGWL
FT                   STVRPDGRPHAAPVMLVLVDGAPCVATRPASRKGRNLARNPHTVLTVGGEDLDLVVEGK
FT                   AHQVAGDAALRGVAAAFATKYGWAFDIRDGRAHDESLPGSPRYAFYEISLVRAFGYGSD
FT                   GLTATRWRFHH"
FT   gene            270418..270771
FT                   /pseudo
FT                   /locus_tag="ML5_0271"
FT   gene            complement(270787..271158)
FT                   /locus_tag="ML5_0272"
FT   CDS_pept        complement(270787..271158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0331 putative amidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05824"
FT                   /inference="similar to AA sequence:KEGG:FRAAL0331"
FT                   /protein_id="ADU05824.1"
FT                   /translation="MADESLVRNSRLLGLFTEIVQGPEGTLRAVEAAGRGIAAEARCTL
FT                   AVLADKLTIRSGSRDELIESALASADRLMELGAIEDDLSELWSRRRERGLGDEAFEASL
FT                   QQIVLRLEAWPLSWSRQPE"
FT   gene            complement(271286..271357)
FT                   /locus_tag="ML5_R0008"
FT                   /note="tRNA-Lys3"
FT   tRNA            complement(271286..271357)
FT                   /locus_tag="ML5_R0008"
FT                   /product="tRNA-Lys"
FT   gene            271523..272644
FT                   /locus_tag="ML5_0273"
FT   CDS_pept        271523..272644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0273"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: tcu:Tcur_0111 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05825"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADU05825.1"
FT                   /translation="MPAVALVALLGLVVQSEGIDTTAELVALLVVLASSAALYLRRRHP
FT                   VALGLVALAAVAAYGALLHRPGPIMLVFVVALYTVVDEGYLAVAVGLGLASVVSFAVAD
FT                   SYTRTGVSGNGATLLHAGWLVAVIVGVTRNRRAYLAEVQARVLAAEQRKEEEARHRATE
FT                   ERLRIARELHDLLGHHLSLISVQASAALHRPDPERSAEALTVIKQTSRETLRELRAALG
FT                   VLRQEGTTPNRPAPGLDRLDELITAAGRRGMTVRTEVTEAGPLPPEVDLSAYRIVQEAL
FT                   TNVSRHAGATTAVVRVVPDGDEVLVEVADDGAGPAGPPGNGILGMGERARALGGSLTTG
FT                   PGPDGGFLVRARLPLRPAPLPVPAPRTAQGETT"
FT   gene            272641..273303
FT                   /locus_tag="ML5_0274"
FT   CDS_pept        272641..273303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0274"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: sro:Sros_8793 response regulator receiver
FT                   protein; PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05826"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU05826.1"
FT                   /translation="MIRLLLADDQTLVRAGFRSILDGEDGIEVVGEAADGTTAVRLTRE
FT                   RRPDVVLMDIRMPLLDGLAATREIVAGTDARVIILTTFDLDDYVYGALRAGASGFLVKD
FT                   TEPAELIHGVRVVARGDALIAPAVTRRLIAEFAARTRHPEPGPRLNALTEREREVLALV
FT                   AAGLSNDEIAARLVLSPATAKTHVSRIMTKTRVRDRAQLVVLAYESGLTVPGWLTAS"
FT   gene            complement(273370..273753)
FT                   /locus_tag="ML5_0275"
FT   CDS_pept        complement(273370..273753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gym:GYMC10_3335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05827"
FT                   /inference="similar to AA sequence:KEGG:GYMC10_3335"
FT                   /protein_id="ADU05827.1"
FT                   /translation="MSIRHLLATTVVGEFAPAAHTSLAAGGIGGSGRAGATVIALVGLA
FT                   SVVVGGLALSRSRRGPGEGRVQALVAAAAGLVSLVLSAWHLALTTEGLGSGQGRAGAVA
FT                   GVALGLIGAVLGGLALARSRRTA"
FT   gene            273937..274236
FT                   /locus_tag="ML5_0276"
FT   CDS_pept        273937..274236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa35350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05828"
FT                   /inference="similar to AA sequence:KEGG:nfa35350"
FT                   /protein_id="ADU05828.1"
FT                   /translation="MRVTSTAAVAASREVPGDDGVRRPGGEVHAWLPGRNQTLCGLPLS
FT                   RTRLRRFPHVPFDYSGTDVLTDADPEGWLCPRCLAATSGRRDREKGWARTNPRP"
FT   gene            274274..275356
FT                   /locus_tag="ML5_0277"
FT   CDS_pept        274274..275356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0277"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   sro:Sros_5491 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05829"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADU05829.1"
FT                   /translation="MRIVIVGATGNVGTAVLRRLRREAGTELVGVARRLPGPDAGEPYD
FT                   DVEWHSCDIGAPGAADQLVRIFAGARAVVHLAWQIQPSHDRRTLYRTNVGGSRAVIEAA
FT                   VRVGVPALVYASSVGTYAPGPKNQPVSENWPATGVETSSYSRDKAEVEALLDGVQREHP
FT                   KLRVVRLRPGLIFQREAGTEISRYFLGPLVPVRLLRYGRIPLVPSNRRLRMQAVHADDV
FT                   ADAYARAVVGDASGAFNVAADPVLTPELVARHFHGWTLPVATPVLRAAAALTWRARLQP
FT                   VDTGWVDLALNVPLMSSHRAETELGWSPSIDTVTALKELFAGMATRAGTGSPPLSPDPA
FT                   LPGRPAALTRGQLPGHPNPY"
FT   gene            complement(275752..276897)
FT                   /locus_tag="ML5_0278"
FT   CDS_pept        complement(275752..276897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0278"
FT                   /product="Polymorphic membrane protein Chlamydia"
FT                   /note="PFAM: Polymorphic membrane protein Chlamydia; KEGG:
FT                   kfl:Kfla_4105 polymorphic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05830"
FT                   /inference="protein motif:PFAM:PF02415"
FT                   /protein_id="ADU05830.1"
FT                   /translation="MKSAVTLLALALTTATLPACGDDPAVAPAADVGSSAGPAAAPAAS
FT                   PSGRAGLGSARPSPSPATVTFRAGNPNGRAAVPAEARPVDTSRPTRTVGSGTPASCTSE
FT                   AVVKAVAAGGVITFDCGPAPVTITMKATAKVVNSHGPRVVLDGGGTVTLSGGGKRRILY
FT                   MNTCDEAQGWTTSHCQNQDHPRLTVQNLTFADGDATGDRTEGGGGGAIFVRGGRFTVIN
FT                   SRFVGNRCDRTGPDLGGAALRVLSQFENKPVYVVSSTFTGGVCANGGALSSIGVSWTVL
FT                   NSVFRDNRAVGTGANPARGGTPGGGSGGAIYCDGNEFAVRIAGTVIEDNSANEGGGAIF
FT                   FVSNNRTGTLKIDSSTLRRNPSRGFETKGHPGIFFLGAQIS"
FT   sig_peptide     complement(276832..276897)
FT                   /locus_tag="ML5_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(277109..277858)
FT                   /locus_tag="ML5_0279"
FT   CDS_pept        complement(277109..277858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0279"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: kfl:Kfla_1154
FT                   zinc/iron permease"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05831"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ADU05831.1"
FT                   /translation="MPEWLEAGFWGLLAGSALLIGAAVGFFARVPRRVTASVMAFGAGV
FT                   LLSAVSFELIDEAHKQGGLLPVAIGAAAGALLYTAANVLLARHGARHRKRSGDEQPSER
FT                   EQPGSGTAIAVGALLDGVPESVVIGASLLAGGPVSLVTVIAVFLSNVPEGLSSAAGMRQ
FT                   AGRTRRYVFGLWTAIALISGAAALAGYTLLGGAPPEVLATITALAAGAILAMITDTMVP
FT                   EAFADAHLLVGLITVLGFLVAFALSHA"
FT   gene            complement(277898..279097)
FT                   /locus_tag="ML5_0280"
FT   CDS_pept        complement(277898..279097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0280"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bse:Bsel_2780 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05832"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU05832.1"
FT                   /translation="MHIRRLAADERLTTSFPLQAYAFEASPMGATRTDQFRAYLPYNAG
FT                   NTTLVAEEDGVTAAAVSAIPMRQNLRGAVLPMAGVAGVATHPLARRRGHVRTLMQQLLD
FT                   GVRDEGHQLTALHPFRASFYERFGYIGLPRRRTAIFNPADLAPLLRADLPDELVWERIG
FT                   AGYARWRAYTERCLRERHGFAVFPDFRAVGLRDRDDRWLVSVVRGGETVGAVTYRIDDH
FT                   AGTLLADDLLVDDAYARASVLQFFARHVDQVARISVQVTPDELPELWLTDLDVQVEARV
FT                   ARPDPTAPMARLLSLDALAEQPVGVGRVLIEVVGDRWLAGRHLLDGTTGKLAVLPAQTA
FT                   AEGSVPAARLTAAGLSALAYGVLDPAEVVVRGLGEVPVDAAGELRRLFPRELPHLFADF
FT                   "
FT   gene            complement(279150..279869)
FT                   /locus_tag="ML5_0281"
FT   CDS_pept        complement(279150..279869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0281"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: saq:Sare_4532 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05833"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ADU05833.1"
FT                   /translation="MTLILRSAILNDVGLVRTNNEDSALAGDRLVAVADGMGGLPAGEV
FT                   ASEIVIRILDELTPPTGADEAADALRAVVSTANQRIRAAITVDPARDGMGTTLTAALLA
FT                   GDTLVLAQVGDSRCYLLRDHELTQLTRDDTFVQALVDQGALSRDQARHHPQRSLVTRAV
FT                   QGSDAPPAVGALTVFPGDRLLLCSDGLSDYVEDAAIAAALATYGDRQQCGEQLVKLAHQ
FT                   AGAPDNVTVVISDVTEA"
FT   gene            complement(279963..280526)
FT                   /locus_tag="ML5_0282"
FT   CDS_pept        complement(279963..280526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0282"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: sro:Sros_0410 putative transcriptional
FT                   regulator, XRE family; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05834"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU05834.1"
FT                   /translation="MTAAAPADDRGAREVGRRIRSLRTERGISLSELARLAGVGKATLS
FT                   GLENGVRNPRLETLYAITAQLGVPLTAVLATPDQAPTLRGAAVGGTLLEVFSDREATYE
FT                   LYRMWVTPGPAQLSPAHSSGVTEHVTVFSGVLRAGPADAPLTAGPGGYLRWTSDVPHTY
FT                   AAVGEEEVHASLLLRYPRPSTPDS"
FT   gene            280585..281799
FT                   /locus_tag="ML5_0283"
FT   CDS_pept        280585..281799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0283"
FT                   /product="benzoate transporter"
FT                   /note="KEGG: sro:Sros_0411 putative benzoate transporter
FT                   protein; TIGRFAM: benzoate transporter; PFAM: Benzoate
FT                   membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05835"
FT                   /inference="protein motif:TFAM:TIGR00843"
FT                   /protein_id="ADU05835.1"
FT                   /translation="MGGRLQPVLAGVVTALVGFASSFTVVLAGLRAVGADPDQAASGLL
FT                   ALCVASGACAVWLGLRHRLPLSIAWSTPGAALLVATGPVAGGWPAAVGAFLLAGLLIVA
FT                   AGLIPALGRAVAAIPAPIASAMLAGVLLPLCTAPVRALVEVPRLAGPVVLVWLLLHRFA
FT                   RRWAVPGALAVAVVAIALTTSGPARLDVAPVVAFTAPSWTLPAVVGLALPLFLVTMAAQ
FT                   NVPGTAVLAGYGYRAPLGSALRVTGLATALGAPAGGHAVNLAAITAALAAGPDAHPDPE
FT                   RRWIASVTAGIGLALLGLGAGVATALVLLSPPVLVEAVAGLALLGALAGAVAAAVAQPD
FT                   AREAAVVTFVVTASGVSLLGVGGAFWGLVAGWLMLLLFRRRAVASPPVEPPRTESAPTL
FT                   SGRTG"
FT   gene            complement(281807..282592)
FT                   /locus_tag="ML5_0284"
FT   CDS_pept        complement(281807..282592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: srt:Srot_0358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05836"
FT                   /inference="similar to AA sequence:KEGG:Srot_0358"
FT                   /protein_id="ADU05836.1"
FT                   /translation="MLLTYVDESYTDRWYWIGALLVPEAVAIPLSTALDEVMTDAAKAY
FT                   GIDRAAELHGYDLFQGRTAWARVPPRARIAVYNAALKAIGTYDVTVILRGVDRHGLTRR
FT                   YGLTRPAHEVVLSHLLERVDGYAAMRDELALVIADEVDNPASHRSGLTRYRVDGTGGYR
FT                   SRRLSRIVDTLHFAPSHASRLGAGRRPGHLPVPQDGERGGRGSSGGDDEHAAVVLGRAA
FT                   PIPLVVLASDRAADARRARLKAGPKAVAGTLTGLLRTPG"
FT   gene            complement(282672..283037)
FT                   /locus_tag="ML5_0285"
FT   CDS_pept        complement(282672..283037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05837"
FT                   /inference="similar to AA sequence:KEGG:Strop_4110"
FT                   /protein_id="ADU05837.1"
FT                   /translation="MSQQQDTVSRVTTGMRVVDSAGVEVGTVDLVQRGDPAAVTVQAPA
FT                   PVDPGSSLDELIESAAAEEPDVPADLAARLLRDGYLKVSTELVRTGAVYVLADRIAAVG
FT                   DGAVRLTVPAAELPAEE"
FT   gene            complement(283067..283315)
FT                   /locus_tag="ML5_0286"
FT   CDS_pept        complement(283067..283315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05838"
FT                   /inference="similar to AA sequence:KEGG:Strop_4109"
FT                   /protein_id="ADU05838.1"
FT                   /translation="MEQRRHWWNGKWGRLARRDVFLRVDGDRWHVEQRAGGAEGISRFY
FT                   EHASVEEAEETIRALLDGTDTWRELSPRPPGGWAPSV"
FT   gene            complement(283393..283863)
FT                   /locus_tag="ML5_0287"
FT   CDS_pept        complement(283393..283863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0287"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="KEGG: dra:DR_2422 large conductance mechanosensitive
FT                   channel; TIGRFAM: large conductance mechanosensitive
FT                   channel protein; PFAM: large-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05839"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ADU05839.1"
FT                   /translation="MLKGFKDFIMRGNVVDLAVGVVIGAAFTGVVTQLTKSFLEPLVRV
FT                   FIALITGSEDGLSGSTPKFRGIPFDWVAFVNAAITFVLTAAALYFLVVYPMNRLAERRK
FT                   RGEEPPPSAPSEEVKLLTEIRDALLAGNHGTPGQRSALDDVLGRRQEPPAPR"
FT   gene            complement(283904..284587)
FT                   /locus_tag="ML5_0288"
FT   CDS_pept        complement(283904..284587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0288"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: saq:Sare_4529 GntR domain-containing protein;
FT                   PFAM: GntR domain protein; regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05840"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADU05840.1"
FT                   /translation="MTPAVDSVAVPPRGHRVRQTIEQLRERILGGEWAVGGRIPTEPQL
FT                   VAALGVGRNTVREAVRALVHAGVLECRQGSGTYVVSTDELAPVVARRLTDDRMTEVIEV
FT                   RRAFEVEAARLAALRRTPEDLAALDGALAAREAAWRGGRVDEFVEADAALHTVVVAAAH
FT                   NAMLAELYASVGAALRSTVAQAMGEALTPERYVDHSRLVEAIRAGDPQRAAIEAGAFLE
FT                   GPAGA"
FT   gene            284637..285905
FT                   /locus_tag="ML5_0289"
FT   CDS_pept        284637..285905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0289"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   saq:Sare_4528 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05841"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU05841.1"
FT                   /translation="MTPPPAPAATVPAPGVTPAAGPAPAAGPVRGGLLVLAGMLLVALN
FT                   LRAAVTSLGALLDEIRVGLGLSGAMAGLVTTLPTIAFAGLGALTPWLVRRWAAPRVLVV
FT                   AMVALTVGQVLRAVTGSAAVFVLTSALALAGIAVANILLPMLVKQHFPHRTGLVTGAYT
FT                   MALTVGTTVAAASAVPVAHAFGSWRAGLGIWAGLAALAVLPWVPLALRARAARRAAPPA
FT                   VAVAAPARVQPGRTRLGWAMAVYFGAQSLSGYAIMGWLAQLFRDAGYRPETAGLLLAGV
FT                   TALGVPVALMMPALAGRLATLRPLVLSLTVFSAAAYAGLALAPHGLAPLWVLLLALGQG
FT                   AFPLILTTIGLRARTAEGTVALSAFAQSTGYVIAALGPLLVGILYEATGGWTAPIGFLL
FT                   VALAVQTAAGMVIARPRYIEDER"
FT   gene            complement(285916..286272)
FT                   /locus_tag="ML5_0290"
FT   CDS_pept        complement(285916..286272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0290"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: nda:Ndas_5267 anti-sigma-factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05842"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADU05842.1"
FT                   /translation="MSLTVHTEQRGDVVVVSVAGELDMATAPQLQDQITDLLDKGRSRL
FT                   VFDLAEVSFCDSTGLSVFVRAKNNCDEAGGVVRLAAPQRGVLRILEVSGLVEVLHTYPT
FT                   VEQAVAGDPNPASS"
FT   gene            286432..287292
FT                   /locus_tag="ML5_0291"
FT   CDS_pept        286432..287292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0291"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: sro:Sros_2269 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05843"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADU05843.1"
FT                   /translation="MALSAEQGGRLAHLLSQHADRLTNRWTEIVGSSLRGRLSRAELAR
FT                   QVQELHRALVDAGRQGVSDLADEHGGELRAVLSELSTNRARQGFSATETAISVFALKDA
FT                   LLELMEEEKGDDTLRDFVAFSALVDQMGLFTFETFVRARESLIADQAEQLLELSTPVVK
FT                   LWEGVVAVPLVGTLDSARAQVVMERLLQTLVDTGSPYAIIDITGVPAVDTQVAQHILKT
FT                   VVAARLMGADCIISGIRPQIAQTIVALGIEFGDIATKASLADALRHVLRLTGVETTARR
FT                   PRRES"
FT   gene            287292..287702
FT                   /locus_tag="ML5_0292"
FT   CDS_pept        287292..287702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0292"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: sro:Sros_2268 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05844"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADU05844.1"
FT                   /translation="MERVPILKIGDILLVSIQVDMSDQTAVQLQEDLAERIVATGCHGV
FT                   IIDITALDIVDSFVGRMLSTIASISKVLDAETVVVGMRPAVAITLVELGLSLNGIRTAL
FT                   NVERGMELIAASRADEWDAAADDEDTETTATA"
FT   gene            287699..288118
FT                   /locus_tag="ML5_0293"
FT   CDS_pept        287699..288118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0293"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: ami:Amir_3742 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05845"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU05845.1"
FT                   /translation="MTTGVDLGVPATQAIRSDEDVVRVRQLARTTAVAVRLSLVDQTKL
FT                   VTAASELARNTLIYGGGGSAEVSTVSDGRRRGVRIVFADEGPGIPDLDLALTDGYTTGG
FT                   GLGLGLSGARRLVDDFDIRTAVGEGTRITVTKWSR"
FT   gene            288115..289128
FT                   /locus_tag="ML5_0294"
FT   CDS_pept        288115..289128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0294"
FT                   /product="Stage II sporulation protein E"
FT                   /note="KEGG: fal:FRAAL1278 putative two-component system
FT                   regulatory protein; PFAM: Stage II sporulation protein E;
FT                   SMART: protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05846"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADU05846.1"
FT                   /translation="MIADVVPDHGIWFRVDTGATAGSVRRAAERLGRQLELSAARVADL
FT                   AIVTAEITSNLVKHAREGTLLMRPARRGGRAGVELVAIDSGPGMADLTLSSADGHSTAG
FT                   TLGIGLGAITRQSSRFDGYSSPGRGTVLVVQVWDAAPPEPDWAGGLARPITGEQTSGDG
FT                   YAVRQVDGRRQVLVSDGLGHGPLAAAATGAAVSAFRSAPDGPPDVVVRHLHAAISHTRG
FT                   AALAVAEPDPAAGVLRYAGLGNIAAMIVAPGERRRGLVSLPGIAGHQRPAIRGYDYPFS
FT                   RDATLVMHSDGVVDRWDLDDYPGLAGRNPLLAAATLLRDAGVRRDDACVLVARGAA"
FT   gene            289125..290471
FT                   /locus_tag="ML5_0295"
FT   CDS_pept        289125..290471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0295"
FT                   /product="histidine kinase"
FT                   /note="KEGG: ami:Amir_3740 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05847"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU05847.1"
FT                   /translation="MTEPLLHLALRVEQDIFLVRQRGREVAAAVGLEHQDQVRIATALS
FT                   EVARELLHGADGADVTFALDRDAVGRRVLQVDLSPLRPLPGGRYEPQSGAVARLVDTLR
FT                   VVAVEGDTVVRMSRRVPDHAEELTAERAAELRAELAERAPGSALDELAAQNAQLIAALD
FT                   EVRSQRDELAVLNSELQETNHGVMALYNQLTEELEETNRGVVALYAELDEKSAQLRAAS
FT                   ESKSRFLANVSHELRAPVTAIIGLARLLADSASDPLTGEQARQVGLIRSSAGDLLGLVN
FT                   ELLDLAKAESGRIEPDWSDVDLRAVFGQLRGTLRALAARPEVELVVEEPPAPATVRSDE
FT                   VLLAQVLRNLLHNGLKFTERGEVRLRAERRGGQWTLSVTDTGVGIPPELHERVFEEFYQ
FT                   VPGTTRVGGTGLGLPYARRLITLLGGTLELTSEPGRGSTFTVVLPAGGA"
FT   gene            290474..292012
FT                   /locus_tag="ML5_0296"
FT   CDS_pept        290474..292012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0296"
FT                   /product="response regulator receiver modulated serine
FT                   phosphatase"
FT                   /note="KEGG: sro:Sros_2264 serine phosphatase RsbU
FT                   regulator of sigma subunit-like protein; PFAM: Stage II
FT                   sporulation protein E; response regulator receiver; SMART:
FT                   response regulator receiver; protein phosphatase 2C domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05848"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADU05848.1"
FT                   /translation="MDGGPVTVLVVDDSGPKRYLLVNWLTRAGFVTVEAENGTAALERV
FT                   DREHIDLVVLDVRLPDMSGFEVCERIKEAHPSIPVIHVSAHAVDVVDRAQGLTRGADAY
FT                   LAEPIEPEELVATAHAVLRYYQARRRAEQLAERLAALADATVEMHATPNFVRLLEAAAS
FT                   GAARIFNAPAAVVAETFDGDCLAGVAADPHTPATIVPWVVDDTGVPIGTRVRVDEPANW
FT                   ALAGWPDGDTVTVAASRLREDRAPLYVVVPTATQTVRTPVLVQLAQAVASAVEAQRSFD
FT                   EEHRIAVTLQRSLLPQRLPDVVGLDLAVRYEPASAQTEVGGDFYELVMLDGHLLVAIGD
FT                   VAGHSLHAATVMAELRHAVRAYAVEGHQPGVILDRVNELMRNLLPTELATICVLLLHPP
FT                   TGLVRLASAGHLPALLSRDGRVEFVTQSAPLLGVRAPRPPDLEFVLPAGATLVLYTDGL
FT                   IERRDATIDDGMAALGVAATRVDDDLDDFCRRLLVELAPPEIHDDVAVVAVRRR"
FT   gene            292067..292633
FT                   /locus_tag="ML5_0297"
FT   CDS_pept        292067..292633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0297"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_4189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05849"
FT                   /inference="similar to AA sequence:KEGG:SGR_4189"
FT                   /protein_id="ADU05849.1"
FT                   /translation="MNTKTSELLAVAAPRTAAVVRGISDDQLVLPTPCPDYTVRDLLGH
FT                   LFDVVVNFQALARREEVDWSGKTDHLTDGWRDRFATEAARLTEAWSDPATQEGVSPGMG
FT                   LPQETVGMMALIDLTVHGWDLARATGQELTVDPAVVAAGHEFMDRMGDTGQKMGAFGPP
FT                   VPTGAAPDSMDALLGRAGRDPAWTR"
FT   gene            292706..293242
FT                   /locus_tag="ML5_0298"
FT   CDS_pept        292706..293242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0298"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: sma:SAV_5389 PadR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05850"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADU05850.1"
FT                   /translation="MSTSHVLLGLLAAGPRHGYELKRAHDERLPRARPLAFGQVYATLA
FT                   RLCRDGLVATAGQTRESGPDRTSYALTEDGRAALDHWLATVEPPMPYVASTLFAKVVVA
FT                   LLVADVDQARVYLIAQRQAHTQRLRELTALKTAPGARLDEVVAADFAIAHLDADLRWLH
FT                   TTLDRVADWHREVRT"
FT   gene            293239..293940
FT                   /locus_tag="ML5_0299"
FT   CDS_pept        293239..293940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0299"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sma:SAV_5388 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05851"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU05851.1"
FT                   /translation="MTFLQARGVVRAYGHNPALRGVTLDVAEGEIVAVTGPSGCGKSTL
FT                   LHCLAGILRPDAGQVTWRGERIDTWSEAARSRLRRTEFGVLFQFGQLVAELTAAENVAL
FT                   PLLLAGTGRRAARTAALSWLDRLGVADVADARPGEMSGGQQQRCALSRALVTEPRVIFA
FT                   DEPTGALDTLAGEQVLTQLVRLAREQRTTVVLVTHEPRIAAYADREVSLRDGMVDHTGL
FT                   GLDPALPGGSR"
FT   gene            293937..295448
FT                   /locus_tag="ML5_0300"
FT   CDS_pept        293937..295448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0300"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   sma:SAV_5387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05852"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU05852.1"
FT                   /translation="MRPGTLLRLVLAGTRTDIARVVLTAVSAALATLAGLAALTVLSVV
FT                   KPSGDEGLNSDQYTNALLREPGLRPGVAFALLLLCVPVLGLAGQCARLGAPGRDRRLAA
FT                   FRLAGATPGQVTRVAVAETGVASLLGTLVGLAVFLAGCRLLHRPDADGRLPLPTDVHPA
FT                   PVAVAAVVLGLPLVAALVSALLLRRVATTPFGVVRKVRTRAPWPWPGVLILAALAMFAA
FT                   IRPLLLWYERRGAVAPDWLVPTLLVVGGLTAMIGVVSGTGWISYRTGRLLHRHGRGPAA
FT                   LLAARRLAADPWAGSRTFAALLAALIFGAGAAGLRADFQAEAEVTRRTGSGMADPGFYL
FT                   GAMDLVDLAVLVAMAIAGGGLLVAVVEGITSRRRAYAAQVATGVPRATIGRSLLWAALA
FT                   PAVPAIGLALTVGYLLVRGVMPAPSNGGFTRTICDAGSELCGDPATAARYTRTEWVPKT
FT                   TVPPDVPWDQLAWLAAGGLAAVLCTVVAGLLFLRTATSVEELRAG"
FT   gene            complement(295533..297626)
FT                   /locus_tag="ML5_0301"
FT   CDS_pept        complement(295533..297626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0301"
FT                   /product="Oligopeptidase B"
FT                   /EC_number="3.4.21.83"
FT                   /note="KEGG: saq:Sare_4526 oligopeptidase B; PFAM:
FT                   peptidase S9A prolyl oligopeptidase domain protein
FT                   beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05853"
FT                   /inference="protein motif:PRIAM:3.4.21.83"
FT                   /protein_id="ADU05853.1"
FT                   /translation="MTETPPPVAKRVPTERLHHGDTVLDEYAWLAAKDDPDTIAYLDAE
FT                   NAYTEARTAHLAGLRAELFEETRRRTQETDLSVPTRKDGYWYYTRTVEGQQYGVHCRRA
FT                   VRPGETAPPVSADGAPLDGEEVLLDGNQIAEGHDFFSLGAFDVSPDGRWLAYSTDFSGD
FT                   ERFTLRIKDLTTGESLPDEVPDTFYGTAWSSDASTLFYVTVDEAWRPNRVWRHAVGTAS
FT                   TEDVVVYQEDDERFWVGVELTRSERFVVIDIHSKITSEVWVIPASNPTGEPAVVAPRRQ
FT                   GIEYAVEHHGHRFLILHNDGAEDFALAYTSADSPGEWEPLIPHTPGTRLEAVDAFENHL
FT                   VVSLRTNGLTGLRVLPVGTDDSWDIDFPEPIYSVGLDANPEYRTSEVRLRYTSLVTPDS
FT                   VYDYDLVTRELTLRRQKPVRPGPDGRAYDPADYEQHRDWALADDGTRVPISLVCRRDTP
FT                   RDGSAPAVIYGYGSYEASMDPWFSIARLSLLDRGVIFAVAHIRGGGELGRRWYDEGKLL
FT                   AKKNTFTDFVACARHLVKAGWTASDRLVARGASAGGLLMGAVANLAPDAFTGIVAQVPF
FT                   VDALTSILDPSLPLTVTEWEEWGNPLDDPEVYAYMKSYTPYENVATVEYPAILAVTSLN
FT                   DTRVLYHEPAKWIARLRSLAPAGDYLLKTEMGAGHGGPSGRYDSWREEAFVNAWILDRV
FT                   GRA"
FT   gene            297709..299202
FT                   /locus_tag="ML5_0302"
FT   CDS_pept        297709..299202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0302"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   tcu:Tcur_3272 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05854"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADU05854.1"
FT                   /translation="MCTITAMADAARSTDRLEALDITRKLAAICGTPFARFAGPADEVA
FT                   GRTARWVAVPGGPHAAAEVLRLAAAHDLTVVPRGAGTKIDWGAAPAQVDIMLDTGRLAG
FT                   VWHEPRDAAVAEIGAGTPLRAVQATLARTNRRLPVDAPSPGATLGGVLAADESGPLRHR
FT                   HGSPCAQLVGVRYLDADGELVSVGESGTEALGRATPGSGGGRASGRGPAGGAGGDPGRG
FT                   GGDAILGRGEVPGLDVARLLCGSQGGLGVLVSATMRVHAVPAGRLWVSRPVWTPLEVHD
FT                   LVRAVLAAGVDPAAVELDLPVPVPLPRRRIPPTHPSVVNRPDHPAVTGRPAAGSLVVLL
FT                   EGGPADVTERAERLTAVLGAEAIVSHHAPEWWGRYPFAPGDTALRIEVPINDLHAAVYA
FT                   LRDATGGPVPVRGSAGAGTVHAALSGALPPERVASILTAVRSVLIARRGRCVVVAAPAA
FT                   VRRAVDLWGELPTLPRLRSAKAHLDPHHRLAPGRLPGGL"
FT   gene            complement(299654..301714)
FT                   /locus_tag="ML5_0303"
FT   CDS_pept        complement(299654..301714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0303"
FT                   /product="protein serine phosphatase with GAF(s) sensor(s)"
FT                   /note="KEGG: stp:Strop_4104 stage II sporulation E family
FT                   protein; PFAM: Stage II sporulation protein E; GAF domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   protein phosphatase 2C domain protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05855"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADU05855.1"
FT                   /translation="MSAEAGPASGGADERVRRVRLPADRRTPAAARALVRTMLLEARLP
FT                   ELLNEALLLTTELTTNAVEHARTELDIEVDTDRNGLTVTVTDFASGPVDELIVGVRNTT
FT                   SDITEVAARGRGLLLVDHFSSRWGTTYLPTGKGVWFRLDRPGPGGSARPSAGPLRVAEP
FT                   DRNGDGTPSAAAMSELMQLTPDSYADEPLPEFATGLLTRVAEMVGAAGGTVRLDRGDGL
FT                   GTQVFARYGRPPREGNELLRVPLAVHRPYSGELELDAAPSAYARPLAVLAAERLSLHLE
FT                   NDRLRRADVRRSTWLTFLAEASELLAQSLDVELTMALVPQLVVPRLGQWCAVHTTDEWG
FT                   RLRLAASSHADEAMLPQLHRILQETGPDSIQSRLREASRNAAQVPLGGPMEGFAVPLIA
FT                   RGQRLGTLAVGRHQRQRHDPDEVSVLEDVARRAALAIENARIHAERRRVAQTLQQSLLP
FT                   PVLPVVEGIGFAAEYVPTGDDAEVGGDFYDVLPLPDGRWLVVVGDVSGKGVQAAAVTGL
FT                   VRDVIRVLVGDGKPLPEVLGRLNETLVERGGGRYCTLALAAVAPGDGDQLDVSLHLAGH
FT                   DRPVLLHGGGGATFVGAGGTALGLLDTITTPTAELTLKPGDALIFYTDGVTERRRGREL
FT                   FGTDRLRESAAPLAGYSADVVAARLRAATIAFSVEPPRDDIAILVLRNDTP"
FT   gene            301885..306249
FT                   /locus_tag="ML5_0304"
FT   CDS_pept        301885..306249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0304"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /note="KEGG: sna:Snas_1053 GAF sensor hybrid histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; GAF domain protein;
FT                   histidine kinase HAMP region domain protein; response
FT                   regulator receiver; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; GAF domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05856"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU05856.1"
FT                   /translation="MATVNQSLTADPSASDHEVLLGELVEALRRVGRGDLRVRLPRRAG
FT                   LPGEVADAFNDVVSLQERQHLDLRRISRIVGRDGRLTERLDDEGLDGSWAEGQRAVNSL
FT                   IDDLGRPTTEIARVIVAVADGDLSQHMALEIDGRPLRGEYLRIGRTVNTMVDQLSSFAD
FT                   EVTRVAREVGTEGKLGGQADVRGVAGTWKDLTDSVNTMASNLTGQVRSISQVATAVAKG
FT                   DLSQKITVGARGEVAELADTMNSLTDTLRLFAEQVTRVAREVGTEGKLGGQAEVPGVAG
FT                   TWKDLTDNVNSMASNLTAQVRNIAQVSTAVAKGDLSQKITVAAQGEILELKDTVNTMVD
FT                   QLSSFADEVTRVAREVGIEGKLGGQAQVRGVSGTWRDLTENVNQLAGNLTSQVRNISQV
FT                   STAVAKGDLGQKITVDAQGEILELKNTVNTMVDQLSSFADEVTRVAREVGTEGKLGGQA
FT                   QVKGVSGTWRDLTDNVNSMASNLTSQVRNIASVTTAVAKGDLSQKITVDARGEILELKS
FT                   TVNTMVDQLSSFADEVTRVAREVGTEGKLGGQAQVRGVAGTWRDLTDNVNSMASNLTAQ
FT                   VRNIAQVSTAVAKGDLSQKITVDARGEILELKSTVNTMVDQLSSFADEVTRVAREVGTE
FT                   GKLGGQAQVKGVSGTWRDLTDNVNSMASNLTSQVRNIASVTTAVANGDLGQKITVDAQG
FT                   EILELKNTVNTMVDQLSSFADEVTRVAREVGTEGKLGGQAQVKGVSGTWRDLTENVNQL
FT                   ASTLTTQLRAIAQVSTSVTRGDLTQRINVKAQGEVAELKDNINQMIVTLRETTKKNAEQ
FT                   GWLDSNLARIGGLLQGQRDLGEVCRMIMQEVTPLVDAQLGAFFLADSSEGSMRLRLTAS
FT                   YGYVARGHDVTFGPGEGLVGQAALSRRTIRVKAQPDGRLVVRSGLADTPPADLVVLPVQ
FT                   FEGELLGVIEFAGVATFSELHLAFLERLVLTIGVAVNTIQANRRTEELLAQSQRLAHEM
FT                   QDQSAELQRTNAELEDKAKLLSEQKANIETQNREIELARLGLEEKAQQLTRASAYKSEF
FT                   LANMSHELRTPLNSLLLLARLLAENPERNLSAKQIEFARTIHGAGSDLLSLIDDILDLS
FT                   KIEAGRMDVEPTEIQFAEIRGYVEQAFAPQAEEKGLDFQVRVSQDLPPALVTDAQRLQQ
FT                   ILRNLLSNAVKFTDNGAVTLRIGPAAENAVFDVPALTNAQRVIAFTVIDTGIGISDDKL
FT                   SLIFEAFQQADGTTSRRYGGTGLGLSISRDLARLLGGTITVSSAPGQGSTFTLFVPDVL
FT                   APDAVVAPAPPSPSRAGLPSSLLMPMELPQPQETPATRRLDGVTVLIIDDDVRNVFALT
FT                   SALELHGMTVLYSDNGADGVRQLAEHPEVDIVLMDAMMPDQDGYETTAQIRRNHRFADL
FT                   PIVFLTAKAMPGDRESALGAGGSDYITKPVDLDELIELMASWIGRSRGEENA"
FT   gene            306246..306803
FT                   /locus_tag="ML5_0305"
FT   CDS_pept        306246..306803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0305"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: saq:Sare_4522 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05857"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU05857.1"
FT                   /translation="MTQTAKALLVDDRRENLMALEAILQGLPVQSVAVESGEAALKQLL
FT                   VDDFAVILLDAQMPDMDGFETATHIKRRERTRHVPIIFLTAADKDAQLALRGYAAGAVD
FT                   YLTKPFDPWVLRAKVTVFVDLWVKTRQLAAQSDLVRERDLQWRHLTDAVDEATALLRAD
FT                   DDPSARDRAVELLEQARWGNTR"
FT   gene            complement(306808..307311)
FT                   /locus_tag="ML5_0306"
FT   CDS_pept        complement(306808..307311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0306"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_1000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05858"
FT                   /inference="similar to AA sequence:KEGG:Snas_1000"
FT                   /protein_id="ADU05858.1"
FT                   /translation="MNVPPHHDEEEVHLFVERMAMAFADVGFPRMAARVLFTVMSADDP
FT                   LTAGEIAERLGVSAAAVSGAVRYLTQFAMLVREPVKGSRRDRYRMPDNPWYEATITKTT
FT                   IYKNFIDIAAGGVDALHGRSTPAGERVTEMRDFFLFVQEELESLGDRWRARRAATGHGG
FT                   PAGG"
FT   gene            307386..308348
FT                   /locus_tag="ML5_0307"
FT   CDS_pept        307386..308348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0307"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: amd:AMED_0299 ATPase component of ABC-type
FT                   multidrug transport system; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05859"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU05859.1"
FT                   /translation="METAIDVSGLVKTFGRTRALDGLDLTVRTGEVHGFLGPNGSGKST
FT                   TIRVLLGLLRADAGAVRLLGGDPWRDAVALHRRLAYVPGDVTLWPNLSGGEVIDLLGRL
FT                   RGGLDPRRRAELLESFELDPRKKGRTYSKGNRQKVGLVAALASDVELLILDEPTSGLDP
FT                   LMEEVFQHWVRRARQDGRTVLLSSHILAEVEALCDRVTIIRAGRTVESGTLGDLRHLHR
FT                   TAIDAEVAAPLDGLADLPGVHDLRVDGQRVRFDVDTASLDAALRRLTELGVRSLVSTPP
FT                   TLEELFLRHYETAPASGAAPASGVARSSDVARSETADRS"
FT   gene            308345..309937
FT                   /locus_tag="ML5_0308"
FT   CDS_pept        308345..309937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0308"
FT                   /product="putative exporter of polyketide antibiotics"
FT                   /note="KEGG: amd:AMED_6771 putative exporter of polyketide
FT                   antibiotics"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05860"
FT                   /inference="similar to AA sequence:KEGG:AMED_6771"
FT                   /protein_id="ADU05860.1"
FT                   /translation="MSALTGTRHLVRLILRRDRLLLPLWVLILAVLPMTYAASYFELFP
FT                   TAAERAAYLEGTARNPSIVALLGPAYGDSVGGLTAQRSGFLLLIVALASLLTVIRHTRT
FT                   EEEAGRRELLGGSVLGRHAGLTAALLVTYGADLVLGLLTAAGLVSTGLPVGGSVAYGLV
FT                   TVLTGAVFATLGGLAAQLTETAGGARGIGLAGLGAAFGLRLAGDTAGDDWPSWLSPLGW
FT                   AARVRPYEGERWWVVLLPLAATVLLAALAYPISVRRDLGAGVLPPRLGPAGAGGALSGP
FT                   FGLAWRLHRGQILWWSVGFGLLGLILGGAAEAAGRSVEGSPRMEEIVARLGGASGMADA
FT                   YLGVTLSLAGLAAAGYGIQAALRMRAEEAAGHAEPVLATGTRRSTWLLSHVAFALLGPV
FT                   VVLGVTGLATGLTYGLSTGDVPRQLGRMLAAGLAQVPAAWVLAGLAVLLYGLLPRLASA
FT                   AWVVLAVCVLLGQLGAVLELDQWLLDVSPFTHTPQVLRDAWTPTPLYVLTALAVTLATA
FT                   GLLTFRRRDLPVL"
FT   gene            complement(309964..311043)
FT                   /locus_tag="ML5_0309"
FT   CDS_pept        complement(309964..311043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0309"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: sco:SCO6392 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05861"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADU05861.1"
FT                   /translation="MRRIVERVADRYDVVVGVDTHTDTHTAAVVDRLGGVLAQVTVSTD
FT                   PDGLSRLLAFAVAHTPPQGRRLWAVEGTRSHGQGLCRLLTAADEPVCEAPKPPAAARRR
FT                   GGKSDQLDAVAAAHTVLALPAERIAVPRSDGPREALRLLLICRRHHTDARTAAVNLVKA
FT                   LILTADDTLREALRGLSTTIQIARLAALELPETTALPCEEHTRRRELVTLARHIHILDA
FT                   TLADNHQRLRALVTELCPPLLDQPGVGPVTAAIALTAWSHPGRVRSEAAYATLAGAAPI
FT                   PVASGRTDRHRLNRGGDRTLNSALHTIALTRRRIHPETRDYITRRHAEGRTTREITRCL
FT                   KRYIARQLYRTITTHHQTP"
FT   gene            complement(311420..311752)
FT                   /locus_tag="ML5_0310"
FT   CDS_pept        complement(311420..311752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0310"
FT                   /product="anti-anti-sigma factor"
FT                   /note="manually curated; TIGRFAM: anti-anti-sigma factor;
FT                   KEGG: saq:Sare_4521 anti-sigma-factor antagonist; PFAM:
FT                   Sulfate transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05862"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADU05862.1"
FT                   /translation="MDRAELSITVHRTGDEAVLRLAGEIDMLTAAQLSTVVNEVLADPP
FT                   PRIVLDLAGVTFCDSQGLGTLVVLSRKASHTQCLLMLTNVGDFLIRVLDITGLRSALMI
FT                   RNEATP"
FT   gene            311910..313247
FT                   /locus_tag="ML5_0311"
FT   CDS_pept        311910..313247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0311"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="KEGG: stp:Strop_4100 glutamate-1-semialdehyde
FT                   aminotransferase; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase; PFAM:
FT                   aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05863"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ADU05863.1"
FT                   /translation="MTETFSAGSGRYPADAPASEALFDRAKAVVPGGVNSPVRAFRAVG
FT                   GTPRFMVRGEGPWLFDADGRRYVDLVCSWGPLILGHAHPAVVEALREAAPLGTSFGTPT
FT                   PGEVDLAEEIIARTPVEQVRLVNSGTEATMSAIRLARGFTGRAKIIKFSGCYHGHSDAL
FT                   LAAAGSGVATFGLPDSPGVTGAAAGDTIVLPYNDLRAVEEAFAAEGQHIAAIITEAAAG
FT                   NMGVIAPRDGFNSELARIAHANGALLIVDEVMTGFRVSRAGWHGLDPSDADLWTYGKVM
FT                   GGGLPAAAFGGRAEIMAKLAPAGPVYQAGTLSGNPLACAAGLATLRLADDALYRRLDET
FT                   AAALGKLTTEALSAAGVPHRLSTAGNMFSVFFTDADVHDYDSARTQVVPAFKAFFHAML
FT                   AGGVYLPPSAFESWFVSTAIDDAAWEQIAAALPVAARAAAAAGHGG"
FT   gene            313266..313898
FT                   /locus_tag="ML5_0312"
FT   CDS_pept        313266..313898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0312"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: saq:Sare_4519
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05864"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADU05864.1"
FT                   /translation="MHVLRHGEVHNPDGILYGRLPGFRLSELGVQMAKAAAQALADRTV
FT                   VHVVASPLERAQQTAEPIAAQFGLSVGVDERLIESANWFEGKKVSPGDGSFRDPRNWWV
FT                   LRDPVTPSWGEAYRAIAERMFAALHAARVAAEGREAVLVSHQLPIWTLRRHVERKRLWH
FT                   DPRRRQCGLASLTSFHFDGAKIVGIGYSEPAAHLVSISPTARTAKGA"
FT   gene            313898..314473
FT                   /locus_tag="ML5_0313"
FT   CDS_pept        313898..314473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0313"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: saq:Sare_4518 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05865"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADU05865.1"
FT                   /translation="MLTRRLAAALLAAVTAGTALVGCSSGSQESRCAADGSTVTCAPDQ
FT                   RSKTPKVSGELLTGGSYDISRDRGQVVVVNFWGSWCAPCRAEADDLEATYQATKGSGVT
FT                   FLGINVQDSKDKAIAFEEGRVTYPSIFDPASRQALNFDIPPNTTPATVVLDREGRIAVV
FT                   IRRAVTRDELRPIVEDIAAEAPPPNGAR"
FT   sig_peptide     313898..313981
FT                   /locus_tag="ML5_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.261 at
FT                   residue 28"
FT   gene            314473..315384
FT                   /locus_tag="ML5_0314"
FT   CDS_pept        314473..315384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0314"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: stp:Strop_4097 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05866"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ADU05866.1"
FT                   /translation="MGETFRQLAESGPLLLAVGAAALAGLVSFLSPCVLPLMPGYLSYV
FT                   TGLAGSDLEGARKGPLLTPPVEEGPLLNTGAAAGSSAGGSGGSGGSGGSGGVSVAERAA
FT                   PQRTTAAVKGRVLAGTLLFIAGFTVVFVATAILFSGVGKLFFRYERTLEIVIGALVVVL
FT                   GLGYLGVIPGMQREFRIRWLPSAGLLGAPVLGAVFALSWLPCTGPTLGAVLGMAATEGG
FT                   TDRAVVLAVAYCLGLGIPFVVFGLGFQRLLGVFRAVRRNSRWVTRIGGALLIAIGLALI
FT                   TGGWVNVVIWLQTNVGVGEVSI"
FT   gene            315384..317003
FT                   /locus_tag="ML5_0315"
FT   CDS_pept        315384..317003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0315"
FT                   /product="ResB family protein"
FT                   /note="KEGG: stp:Strop_4096 ResB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05867"
FT                   /inference="similar to AA sequence:KEGG:Strop_4096"
FT                   /protein_id="ADU05867.1"
FT                   /translation="MTTVDDRPSTPPAQAPRRRVNPVLALLRNSWRQLTSMRTALILLF
FT                   LLAVAAIPGSVLPQRGVNPERVNQWFVDHPDLAPRLNQIGAFEVFGSVWFSAIYLLLFT
FT                   SLIGCILPRARDHVRALRMKPPAAPKRFDRLPQHAVLEAPAAADPEAIAAVLRRRRWRV
FT                   TVRGDEVSAEKGYLKETGNLLFHVSLVAVLLGVALGSWYGWHGNRILVAGEDNAFCNTR
FT                   QQYAEASLGPRVDSSDLPPFCLTLEKFEADYLPSGLASRYWATVTVDEPGGAERTAGFS
FT                   VNSPLRLGSANVYLLGNGYAPLLKYTDKYGRSQTSEAPFLRTGDSNATEEGVAIFPDAN
FT                   VDPKTGARAPDQQIAFDGLYLPTAPESAPYVSSQYPAERNPAVNLTAYRGNLGLDAGIP
FT                   GSVYALDRRQIDDGKLKEIGTKLLRPGEKWTLDDGSTLEFVGTKPYITLAVRHAPGQTL
FT                   LLVASGTLLLGLMGSLFARRRRVWFRVSPPEGGSPTSGSSLVEAGGLPRTEHPGFADEF
FT                   AQLVAAVSGDAPDARRAREGDD"
FT   gene            317003..317977
FT                   /locus_tag="ML5_0316"
FT   CDS_pept        317003..317977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0316"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="KEGG: saq:Sare_4515 cytochrome c assembly protein;
FT                   TIGRFAM: cytochrome c-type biogenesis protein CcsB; PFAM:
FT                   cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05868"
FT                   /inference="protein motif:TFAM:TIGR03144"
FT                   /protein_id="ADU05868.1"
FT                   /translation="MSALSDQLVAFAILAYLIAMISHAVEFALGNARKVPAAAPARELV
FT                   GAGVGGAGGTIDEPAVAATPPRPDRTGARAVLAGRIAAWLTVLAAAVHLGAVVTRGLAA
FT                   DRMPWGNMYEFVLTGTWIGVAAWLVVLWKQPWLRRLGLFLTLVMVLLLAFAELKLYVPI
FT                   EPLMPALQSWWFIIHVSTIIFASGIFLLGVVPAAAYLMRSGWEQGRRSFPYTLARRLPE
FT                   AAGLERLTFMLHAFSFPIFTFAVIAGAIWAEAAWGRAWGWDPKETWAFISWVVYAGYLH
FT                   ARATPSVKRNVATWISIVGFLTVMMNLFGVNFFFTGLHSYAGV"
FT   sig_peptide     317003..317077
FT                   /locus_tag="ML5_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.828 at
FT                   residue 25"
FT   gene            complement(317946..318170)
FT                   /locus_tag="ML5_0317"
FT   CDS_pept        complement(317946..318170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05869"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU05869.1"
FT                   /translation="MDDAYVVGDPDGLSPLQAEIRDAVARELHAQFALRADRLELADLP
FT                   EVAYQVTRRVDEVLSARPVTTPRRTSADR"
FT   gene            318267..319748
FT                   /locus_tag="ML5_0318"
FT   CDS_pept        318267..319748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0318"
FT                   /product="putative ATP/GTP binding protein"
FT                   /note="KEGG: scb:SCAB_51721 putative ATP/GTP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05870"
FT                   /inference="similar to AA sequence:KEGG:SCAB_51721"
FT                   /protein_id="ADU05870.1"
FT                   /translation="MPLFGKPAEIFDRDVEWAELARFVADDRPGATLGVVSGRRRQGKT
FT                   LLLYQLAQASEGFYFGATEATSTESLRRLGEALGAYSGSPGPVHLPDWGAAVDALLALG
FT                   RERPVTVVLDEFPYLVRAARDLPSIIQHALTPGRPERTGSRARLLLCGSALSFMGRLLA
FT                   GSAPLRGRAGLELPVQPLDFRAAAAFWQIDDPLLAVRVFSVVGGTPAYRREYVQDDTPA
FT                   GSDDFDAWIVRTVLNPARPLFREARYLLAEDPDLRDTALYHSVLAAVAEGNASRGGIAG
FT                   YIGRKATDLQHPLTVLEDAGLLLREPDPLRSGRSSYRITEPLITFYQAVMRPAWTALEQ
FT                   RRGADVWRRSQRRYASAVLGPRFEEIVRQWSLRFAEPELLGGHVAEVSAATLTDPDTRT
FT                   RHELDLVAVGEPPPGDGPRPLLAIGEVKWGRRLGRADLQRLERIRTVLVRRPGFDAAGA
FT                   RLLLAGGHGFEDDLVDAAAGRADVVLVDPALLYGR"
FT   gene            complement(319758..320228)
FT                   /locus_tag="ML5_0319"
FT   CDS_pept        complement(319758..320228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0319"
FT                   /product="regulatory protein MarR"
FT                   /note="KEGG: sen:SACE_1607 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05871"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU05871.1"
FT                   /translation="MATPDRPGFALPLLLLAGFRTLVDDLHAELARQGHPELRPAHGFV
FT                   LQAVGPAGTTASDLGQRLGVSKQAAGKTVDRLVALGYLERVDDPADARRKLVRMTAKGR
FT                   DGLHRSAVVFDELRDRWAATLGADRVAAIEDDLRRMVPADVFRLDIPGWFGG"
FT   gene            320292..320846
FT                   /locus_tag="ML5_0320"
FT   CDS_pept        320292..320846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0320"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="KEGG: amd:AMED_2140 hypothetical protein; TIGRFAM:
FT                   alkylhydroperoxidase like protein, AhpD family; PFAM:
FT                   Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05872"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ADU05872.1"
FT                   /translation="MSRFTAYEPDTAPAAARPVMAGVRRSLGHLPAAVSLMAGSPELLK
FT                   GFLAANAAFEATDLDPVAREVVVLTVATRNGCHLCVAMHTATLVRHGAAPELIGALRTG
FT                   ATLPDPRLEALRRFTAAVLDHRGAVPDADLDALLAAGWQARHALDVVLGVGTYTISTFA
FT                   NRLTEAPLDEPLAAYAWQPAA"
FT   gene            320932..322398
FT                   /locus_tag="ML5_0321"
FT   CDS_pept        320932..322398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0321"
FT                   /product="UbiD family decarboxylase"
FT                   /note="KEGG: saq:Sare_4514 UbiD family decarboxylase;
FT                   TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05873"
FT                   /inference="protein motif:TFAM:TIGR00148"
FT                   /protein_id="ADU05873.1"
FT                   /translation="MGGMAARFPYTDLKDFLAALERAGELRRVSAPVDPTLEISEIVTR
FT                   TVRAGGPALLFERPTRGEMPVAINLFGTEKRMAMALGVEHLDEIGERIGDMLKPELPQG
FT                   FSGMMGGLGKVMQLKSMPPKKVKTAPCQQVVYRGDDVDLNRLPGLQVWPGDGGIFHNFG
FT                   LTHTKHPETGKRNLGLYRLQQHSHNTIGMHWQIHKNSTAHHAVAERLGQRLPVAIAIGA
FT                   DPVVAYSASAPLPADIDEYLFAGFLAGERVEMVDCLTVPLQVPAHAQIVLEGYIEPGER
FT                   LPEGPFGDHTGFYTPVEPFPVMHIECMTMQRDPVYHSIVTSQPPQEDHGLGKATERIFA
FT                   PLLRFLIPDIVDYDLPAAGVFHNCAIVSIRKRYPKHAQKVMNAIWGAHMMSLTKLIVIV
FT                   DEDCDVHDYNEVAFRAFGNVDYARDLMVTEGPVDHLDHASYQQFWGGKAGIDATRKLPE
FT                   EGYSRGWPEEMRMSPEVVSLVDKRWKEYGI"
FT   gene            322398..323303
FT                   /locus_tag="ML5_0322"
FT   CDS_pept        322398..323303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0322"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /note="KEGG: stp:Strop_4093 prenyltransferase; TIGRFAM:
FT                   4-hydroxybenzoate polyprenyltransferase; PFAM: UbiA
FT                   prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05874"
FT                   /inference="protein motif:TFAM:TIGR01475"
FT                   /protein_id="ADU05874.1"
FT                   /translation="MTAAVQERPGRVSSFLKLVAIEHSVFALPFAYLSALTAMQLNGGR
FT                   VRWGDLLLITVAMVGARTFAMAANRILDRRIDARNPRTANRELVTGAVSVRTAWTGAAV
FT                   ALVVFLAAAALLNPLCLVLAPLAVVPLVVYPYAKRFTNWPHAILGVAQAVGPVGAWLAV
FT                   TGTLDGSGPAWLLGAAVGLWIGGFDLIYACQDSEIDREIGVHSVPARYGRRFALHASTV
FT                   AHVVTFALFIWFGAWVGFGWLWWIGLALTAVAFAYQHMVVSPTDLSKVNRAFFTANGFV
FT                   GIALFVLALLDLVIRLGLRP"
FT   gene            complement(323323..324288)
FT                   /locus_tag="ML5_0323"
FT   CDS_pept        complement(323323..324288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0323"
FT                   /product="Terpene synthase metal-binding domain-containing
FT                   protein"
FT                   /note="PFAM: Terpene synthase metal-binding
FT                   domain-containing protein; KEGG: rxy:Rxyl_0493 terpene
FT                   synthase, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05875"
FT                   /inference="protein motif:PFAM:PF03936"
FT                   /protein_id="ADU05875.1"
FT                   /translation="MTAAVLRALRSDCPIPPRLSPYADDVQAWLVAQVDRLGLPADPAT
FT                   RQRLARAGFARYAGRLYPDATEPDLRVLTTLFTWFFLVDDACDGRDGLTPAQIRALRDG
FT                   ALALLREGPRARHPGFSGPLRRLLVQAWREPRRRMPARWRLRFADAVADHLDGVHREAT
FT                   ATTSGRPPGVAEYVRLRRATSAAYVSYPLIEFASGRPLPDAVYHHPALRRLAGLANDLL
FT                   SWFNDIASLERDRATGGGHNLVLATAAERGVPVPAAVDLVAGHWRAEMDRFAALLAAAP
FT                   SFGPTLDDAVATHLDGLAAAVRGTVDWTLESARYPVGAAP"
FT   gene            324431..325075
FT                   /locus_tag="ML5_0324"
FT   CDS_pept        324431..325075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0324"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="KEGG: saq:Sare_4512 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05876"
FT                   /inference="protein motif:TFAM:TIGR00421"
FT                   /protein_id="ADU05876.1"
FT                   /translation="MREPWVVGVSGASGTPYAAAVVRGLLDAGQAVDLIVSRAARLTVL
FT                   DETGRPFRDAHWTEDLAAWLDRDLTGADLRHWPAGDLAAGPSSGSYPVRGMAVVPASTA
FT                   ACAGIAIGLSKDLLQRAAEVNLKERRPVVVVPRETPVTRSHLEHLIALHDAGAVVLPAS
FT                   PGFYGAGAAASAGQLVDFVAGKVLDALGVEHTLFRRWSGELAAGRREADPD"
FT   gene            complement(325133..325399)
FT                   /locus_tag="ML5_0325"
FT   CDS_pept        complement(325133..325399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0325"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="KEGG: saq:Sare_4511 DNA binding domain-containing
FT                   protein; TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05877"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADU05877.1"
FT                   /translation="MDTGDRLLTPGEVAALFRVDPKTVTRWAAAGRIGSIRTPGGHRRF
FT                   RESEVRALLEGEGMLDEAEDMGKARNMGPTASTGPGPANAGMY"
FT   gene            325657..326115
FT                   /locus_tag="ML5_0326"
FT   CDS_pept        325657..326115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0326"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: saq:Sare_4510 AsnC family transcriptional
FT                   regulator; PFAM: Transcription regulator AsnC-type-like;
FT                   SMART: Transcription regulator AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05878"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADU05878.1"
FT                   /translation="MDTIDLSLVELLRGNARLSYAELARQVGLSAPAVHERVGKLESSG
FT                   VIRAYRAEVEPESIGLGVTALIGIIEDSDADTDEVLEAFRRIPEIESCYFMAGVESFLL
FT                   KARVGTIAELEQLIVRLNRTAGVASTRTSIALSTKWENRPQPLEPPTA"
FT   gene            326158..327000
FT                   /locus_tag="ML5_0327"
FT   CDS_pept        326158..327000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0327"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ami:Amir_2536 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05879"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU05879.1"
FT                   /translation="MTSSVRGAAVVTGAAGGLGRALAAALHADGWNVLLTDTDATAVAA
FT                   AAAPLGGWSRPLDVRDESACADVAAEAAAAPGGLGLWVNNAGILATGPSWAHDAPTRRA
FT                   VVEVNALGAINGTLAAVEVMREQGRGHVLNVVSLAGLIAAPGETVYAASKHALLAFSLG
FT                   TLSDLRMAGVRGVHVSCLCPDGIWTPMLHDKLDDPGALASFTGSLLTPERVAARAVRLA
FT                   RRPRPVVSLPRWRGAQVRLLDAFPRLALALTPVIRATGRAGQRRQARRVRENPSPPRL"
FT   sig_peptide     326158..326229
FT                   /locus_tag="ML5_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.832 at
FT                   residue 24"
FT   gene            327011..328105
FT                   /locus_tag="ML5_0328"
FT   CDS_pept        327011..328105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0328"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: stp:Strop_4089
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05880"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ADU05880.1"
FT                   /translation="MTHLDRCDEASRRWVTEAIATVEADANRSADTHLLPFPLPREWGI
FT                   DLYLKDESVHPTGSLKHRLARSLFLYGLCNGWIGPDTTIVEASSGSTAVSEAYFARMLG
FT                   LPFIAVMPASTSPEKIAQIEFQGGRCHLVDDPSKVVVEARWLAEDSGGRFMDQFTYAER
FT                   ATDWRGNNNIAESIYAQLALERHPVPAWIVVGAGTGGTSATIGRYARYRRLPTKLCVVD
FT                   PENSAFYPAWQAGDWSVRTDRGSRIEGIGRPTVEASFLPSVVDRMVQVPDAASLAAMRA
FT                   GSAVLGRRVGGSTGTNLWGAFGLIAQMRAAGRTGSVVTLICDPGDRYVDTYYSDEWVAA
FT                   QGLDLAPHLATIDRFLTDATWPAA"
FT   gene            complement(328122..328742)
FT                   /locus_tag="ML5_0329"
FT   CDS_pept        complement(328122..328742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0329"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   sro:Sros_3333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05881"
FT                   /inference="protein motif:PFAM:PF06475"
FT                   /protein_id="ADU05881.1"
FT                   /translation="MPKSLFWARTDTAGSEHVVLDDGQGLTAQGVALAVDPIPYTCRYR
FT                   LTVGPDWSTNRLEVESEGAGWSRSVRLERGRDGWRVRTGEEGDLDAALSAAGHPPAGLP
FT                   GTDDPGRLAEALDVDLGGSPLTNTLPIRRIGLGRLPADLATAVNVAWVLLPGLAVVPAE
FT                   QVYTSLGPGRVRYASGTFTADLEVDPDGFVVRYPGLAERVDPR"
FT   gene            complement(328838..330727)
FT                   /locus_tag="ML5_0330"
FT   CDS_pept        complement(328838..330727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0330"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: saq:Sare_4508 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05882"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADU05882.1"
FT                   /translation="MTTFAESSTSPSVDPTPDTVDFASLGLPRQVVEVLARQGITTPFE
FT                   IQRATLPDSLAGRDVLGRGQTGSGKTLAFGLPVIARLADRNRARPLHPRALVLVPTREL
FT                   AMQVNDALMPLGKAVGVFLKTAVGGVPYDRQIDALRRGVEIVVATPGRLGDLIERGVCR
FT                   LDDVEITVLDEADQMADMGFLPEVTQLLAKTPADAQRLLFSATLDNDVDTLVKRFMTDP
FT                   VTHSTAPATAAVSTMDHHLLLIPPHDKFAVAASIAAREGRTMLFARTQLGVDRLVEQLA
FT                   AVGVRAGGLHGGKTQRMRTKTLAEFREGRTPVLVATDVAARGIHVDGVSLVLHVDPPKD
FT                   PKDYLHRAGRTARAGESGAVATLVLPKQRRTTLAMMEKAGVEPAETRVRAGDEALAELT
FT                   GAREPSGVPVRDEPEPRRGGGSRRFGDRDGRGFDRGGRGGFSDRGERRFGDRDGRGERR
FT                   FGDRPAGERSGDRFADRGGDRRFGDRPAGERYSGERSGGERRFGRPERRDDRSFGDRRS
FT                   DGRSFGEQRSDDRGQRGDDRRFGERSEQPYGDRQRPATGRGYDRDERRYDDRPSGSRGF
FT                   GDRRQDDRPHAERRFGDRGDARPAERRAGGFRAEGRGRDDRRGFGGRPPARTH"
FT   gene            complement(330917..332554)
FT                   /locus_tag="ML5_0331"
FT   CDS_pept        complement(330917..332554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05883"
FT                   /inference="similar to AA sequence:KEGG:Sare_4507"
FT                   /protein_id="ADU05883.1"
FT                   /translation="MGEQDVPAEKVHPGPTPDPADPAGDDDHGSAPPGPVAVARARVSV
FT                   AGSAVPPPAGDEQPLPQAGPTTYRAATPADTPPPLDRRLPGATVPPSSWSAFAVGERQA
FT                   TSQPAAAEADGDASPGTPGSAPAAIPAPRVSGSARVPTPPVATADAAAPADAAPDRDTA
FT                   PAEQADGTAVGPQDDSPSSAAGSAESPPNAAPASAAGRPAPLTGSSTPAEQAGSAPARA
FT                   SASVPGLRRVSAEEVAASVVAAPPAAATVYRAGPVNPEPPEPVQPPEPAQPPAPNGPEP
FT                   EPAPTPVPGPTPPSPAPPVPEPEPPLRPTPPLPTPPAPAPPTPTPGPVPPIPGPPVPPP
FT                   GPPVPPPPPPPGPMPAPPFPPPPAMTGGPGPLPAPLFPAPAPGPSFPPARAAVPGPPAT
FT                   PGTPDGALPSWAAAPVSAPPPPVVPAPALPTWPPPATPARDADTTRPVRPQPAGPDLAG
FT                   TAYGGTDGPGFATVSFPQGNPLENSGSLTGHILAQGWSEESPAARGGNTKVIIVLAVAL
FT                   TMLIAISLLVVFLANDALSSLTGTMLIE"
FT   gene            complement(332664..334259)
FT                   /locus_tag="ML5_0332"
FT   CDS_pept        complement(332664..334259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0332"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: saq:Sare_4506 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05884"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADU05884.1"
FT                   /translation="MISPILRPALWSVLLGAVAAAALATPAWADPLPDVVPDTGSRPQV
FT                   TGPLQLPGSSGTVRGVPGTVPGVPGAVPGLPGTVPGLPGVTTPGGTAGLPGTTGVTNPA
FT                   DGPLIAQINQLDARVTLLGEELLRIKTERDAAQTELTQSAARLKEAQDALTRAQDNAKS
FT                   AAADAVKADAALPPGEFGASLRDFANLQRITRGDKAEGATTSVTGELLRATSAEEAARK
FT                   AHESAQRRATEQTTAFTRAEADLRKQETALVALRKENAAKLLEIERLADAAEQRLGTSY
FT                   VVDQSIDGLVADPRALAAVRYALAQLGDPYLWAAEGPDRFDCSGLMLASYQAAGYRGLP
FT                   RVAKDQYFATRSRTVSPNALLPGDLLFFASSSSWTSVHHVAMYIGNGKMVEAPRTGDVV
FT                   KISVVRWSRLYAATRVIGAVPAPATPVPPPTVPATPKPSTTPKPTPTTPKPSTTPKPTP
FT                   TTPKPTTPTPKPTTSSPAPSTPPPSPTDSPDPTPSQSASAEPETSSAAPSSSSAAPSSS
FT                   TSGSGSASPSSSTD"
FT   sig_peptide     complement(334170..334259)
FT                   /locus_tag="ML5_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 30"
FT   gene            334527..335696
FT                   /locus_tag="ML5_0333"
FT   CDS_pept        334527..335696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0333"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: saq:Sare_4505 radical SAM domain-containing
FT                   protein; PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05885"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU05885.1"
FT                   /translation="MDAGLKRELEAKVYAGERLTREDGIALYASDDLTWLGRLAHHRRT
FT                   ELNGDRVMFNVNRHLNLTNVCSASCAYCSFQRKPGEKDAYTMRIDEAVRKAKEMEDEQL
FT                   TELHIVNGLHPTLPWRYYPKVLRELKAALPKVNLKAFTATEVQWFEKISGLTADAILDE
FT                   LMDAGLESLTGGGAEIFDWEVRQHIVDHNCHWEDWSRIHRLAHSKGMKTPSTMLYGHIE
FT                   EPRHRVDHVLRLRELQDETGGFQVFIPLRYQHDFVDSADGKIRNRIQARTTMASPAESL
FT                   KTFAVSRLLFDNVPHVKCFWVMHGLSVAQLSLNFGVDDLDGSVVEYKITHDADSYGTPN
FT                   TMHRDDLLHMIWDAGFRPVERNTRYEIVREYDGPPSLAERRSEPQQVWA"
FT   gene            335704..336132
FT                   /locus_tag="ML5_0334"
FT   CDS_pept        335704..336132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05886"
FT                   /inference="similar to AA sequence:KEGG:Sare_4504"
FT                   /protein_id="ADU05886.1"
FT                   /translation="MSDEEQQRGFPRRDAEGRILTLGDLLGVSLAGLVIGVLALLVFEF
FT                   AFATVGDSGFGGTNGWLAVILPLWLFWDEFRAWEFGAARVVAALAGLGLGVLAGLLAAG
FT                   LASGLPALFTGALAAAVFTVVYAVIWFHGVHWLARRTG"
FT   gene            336159..336443
FT                   /locus_tag="ML5_0335"
FT   CDS_pept        336159..336443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05887"
FT                   /inference="similar to AA sequence:KEGG:Sare_4503"
FT                   /protein_id="ADU05887.1"
FT                   /translation="MSAAVKYTLGRVGLFVAVLAALWFVEMNMFLRLMVALISSAALSF
FT                   FLLRNWRDEMAGEMAEASERRRAEKDRLRSALAGEDEPGAEPDAERRDG"
FT   gene            complement(336528..337868)
FT                   /locus_tag="ML5_0336"
FT   CDS_pept        complement(336528..337868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_6915 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05888"
FT                   /inference="similar to AA sequence:KEGG:SAV_6915"
FT                   /protein_id="ADU05888.1"
FT                   /translation="MFGRPMRAAALAGLTALTLLATSAPVQAQAPRPGVTHDEQITFQE
FT                   FSRFPDWRSGSHQGTRAVPGRHPALTIGRPAGTTEFTDEHTGTTRTWEYATWTSPERRI
FT                   GFDATEMVASWNAATPAGTWIQVELHGTYNTGAQTPWYVMGRWASGDQDIKRSTLDGQG
FT                   DPWSSIWTDTFSVDDADAGVLLRSYQLRLTLYRAPGQAAAPQVRMVGAMASNVPDRFTV
FT                   TPSRGGIAWGTELAVPRYSQNIHIGEYPEYDGGGEAWCSPTSTEMVVEYWGRKPSAEDT
FT                   SWVDPSYPDPTVDHAARMTYDYEYEGAGNWPFNTAYASSFPGLEARVTRLHSLDEAERF
FT                   IKAGIPVVTSQSFLASELDGANYGTSGHLFVIVGFTADGDVIVNDPASSSNDAVRNVYK
FT                   REQFEQIWLRTKRYRANGTVASGSGGIAYLIKPADRPWPVVPGSTNW"
FT   sig_peptide     complement(337782..337868)
FT                   /locus_tag="ML5_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            338074..339396
FT                   /locus_tag="ML5_0337"
FT   CDS_pept        338074..339396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0337"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="KEGG: stp:Strop_4082 peptidase M14, carboxypeptidase
FT                   A; PFAM: peptidase M14 carboxypeptidase A; SMART: peptidase
FT                   M14 carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05889"
FT                   /inference="protein motif:PFAM:PF00246"
FT                   /protein_id="ADU05889.1"
FT                   /translation="MAFRSSPLRRRLALAAVIGLTIVTAAAAPAVARPAPEGSGEPATV
FT                   AYRVLGPRTAADRTAVASTGAAIDYSEHGVLHVTATKAEANAITRLGFRLEKDVVPEHN
FT                   HADGGMTANAFPPADSNYHDYAELTAVVNKVVADHPTIARKLSIGTSYQGRDLMAVKIS
FT                   DNVATDEAEPEILFNAQQHAREHLTVEMAIYLLNLFTDNYGSDSRISSIVNSREIWIVP
FT                   TVNPDGSEYDIATGSYRSWRKNRQPNSGSTAIGTDLNRNWAYQWGCCGGSSGTKSSDTY
FT                   RGPSAFSAPETAALRNFVNSRVVGGVQQIKANIDFHTYSQLVLWPYGYTYSNTATGMNT
FT                   DQYNTFATIGRQMAATNNYTPEQSSDLYIADGTSIDWMWGAHKIWAYTFEMYPGSASGG
FT                   GFYPPDEVIPAQTSRNREAVLILSEYADCPYRAIGKQSQYC"
FT   sig_peptide     338074..338172
FT                   /locus_tag="ML5_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.642 at
FT                   residue 33"
FT   gene            339715..340647
FT                   /locus_tag="ML5_0338"
FT   CDS_pept        339715..340647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0338"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   saq:Sare_4501 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05890"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADU05890.1"
FT                   /translation="MSRRTPRLFATALAAGVLLLGGCAEKTSTDTPAAGGSGGAFPATV
FT                   GKLTLEKRPEKIVSLSPTSTEMLFAIGAGKQVTAVDDQSNYPAEAPRTDLSGYQPNAEA
FT                   VASRNPDLVVISDNLNKIADQLVALKIPVLQIPAAATLDDTYRQLTDLGTLTGHRSEAD
FT                   AVVQKMKDDITALTKDLPKRTEKPTYYHELGPELYSATSKTFIGTIYALAGLENIADAS
FT                   DADGKNGGYPQLSQEVIVKANPDFVFLSDTKCCKQSADTVKARSGWSGITAVKNNQIVE
FT                   LDDDIASRWGPRVVELLKVIVDATAKVPA"
FT   sig_peptide     339715..339795
FT                   /locus_tag="ML5_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.350 at
FT                   residue 27"
FT   gene            340650..341819
FT                   /locus_tag="ML5_0339"
FT   CDS_pept        340650..341819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0339"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   stp:Strop_4080 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05891"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADU05891.1"
FT                   /translation="MALRQAESAPNPAGTPDAPRPGARLLSRPGRRGARGAAGAPIRPA
FT                   GLRKRWLFAGVVAVLVALVAGVSLGPVSLPPGSVAAELLNLLPGVHLDSGLTEREVAII
FT                   TELRLPRVVLGLLVGALLALAGGCYQGVFRNPLADPYLLGVAAGAGFAVTAAIVLGAGA
FT                   GGALTGLPITIPLAAFVGSLGAVVLTYLLGAAGGRDRSPATLILAGVAVSAFFAAGQTY
FT                   LLQQHSDNIQQVYSWLLGRLATAGWHDVWLVLPYFVLTSVVVLLHRRELDVLSVGDDEA
FT                   AGLGLHPQRSRYLLIAAASLGTAAAVSASGLIGFVGIIVPHTMRLLAGSSHRVILPLSM
FT                   LFGGAFLALTDVVARTAAAPAEIPIGVVTALLGGPFFVLVLRTARRVAM"
FT   gene            341816..342595
FT                   /locus_tag="ML5_0340"
FT   CDS_pept        341816..342595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0340"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: saq:Sare_4499 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05892"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU05892.1"
FT                   /translation="MNAPAVRVHDLRVALGGIPVLAGVDLTVTAGEWVTVIGPNGAGKS
FT                   TLLRAVGGLLTGPGEVALFGTPIGALRRRDRARIVATVAQSPVVPIGMSVFDYALLGRT
FT                   PYIPPLGRESAADLAAVHEVLDRLDLGPFAHRELATLSGGERQRVFLARALAQGATLLL
FT                   LDEPTSALDIGHQQEVLELVDQLRRAHGLTVLATMHDLSIAGEYADRLVLLADGRVAAA
FT                   GPPEEVLTEELLARHYRAHIRVIPGDHGPLVVPVRPT"
FT   gene            complement(342640..343719)
FT                   /locus_tag="ML5_0341"
FT   CDS_pept        complement(342640..343719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0341"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: sco:SCO6392 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05893"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADU05893.1"
FT                   /translation="MRRIVERVADRYDVVVGVDTHTDTHTAAVVDRLGGVLAQVTVSTD
FT                   PDGLSRLLAFAVAHTPPQGRRLWAVEGTRSHGQGLCRLLTAADEPVCEAPKPPAAARRR
FT                   GGKSDQLDAVAAAHTVLALPAERIAVPRSDGPREALRLLLICRRHHTDARTAAVNLVKA
FT                   LILTADDTLREALRGLSTTIQIARLAALELPETTALPCEEHTRRRELVTLARHIHILDA
FT                   TLADNHQRLRALVTELCPPLLDQPGVGPVTAAIALTAWSHPGRVRSEAAYATLAGAAPI
FT                   PVASGRTDRHRLNRGGDRTLNSALHTIALTRRRIHPETRDYITRRHAEGRTTREITRCL
FT                   KRYIARQLYRTITTHHQTP"
FT   gene            complement(344130..344888)
FT                   /locus_tag="ML5_0342"
FT   CDS_pept        complement(344130..344888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0342"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: saq:Sare_4498
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05894"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADU05894.1"
FT                   /translation="MNGVEPGTPCWTDLATPGLDDARRFYPELFGWTGEISPEPEADGY
FT                   TVFRKDGKAVAGAGPPGTPDQVPVWSTYVATDDADLVATRVEAAGGQVVVSPFDVAQQG
FT                   RMAVLADPAGAVFSVWQPMAMRGAELYNAPGAMCWNELVTPDPEGAKEFYALVFGWHPE
FT                   ERPAGPVAYTGWRCGARIVAGMLPRAEPMPTDLPAYWAVYFAVEDADATAARAAELGGT
FT                   ILVPPRDNPAGRSAALRDPDGALFSVSTLR"
FT   gene            complement(344982..345719)
FT                   /locus_tag="ML5_0343"
FT   CDS_pept        complement(344982..345719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0343"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   fra:Francci3_4202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05895"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADU05895.1"
FT                   /translation="MPLALIHARYHLLEIIRVPVAVVGSAFFPAASMLFFVVPFAGDDP
FT                   VGATYATAAMVTFAVMTANIFQYGVGVSEDRDQPWNPYTRTLPTGPAPRLAGRILAGVV
FT                   LTYVSMIPVVVIAAVATDARVSAVQFLLGLGAVAVVSVPFTLLGLAIGYSLPSKAAIVV
FT                   AQVIFFPLAFGGGLLSGPDDAPGFIKAIAPYLPTRGAVELIWAAVTDFRPDTRALVMLV
FT                   VWVLVLAALAGWAYRRDEGRRFS"
FT   gene            complement(345729..346616)
FT                   /locus_tag="ML5_0344"
FT   CDS_pept        complement(345729..346616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0344"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sro:Sros_2548 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05896"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU05896.1"
FT                   /translation="MILAQAEQVSRRYGDVLALDRVDLTVRAGELVGLLGPNGAGKSTL
FT                   INLLVGLRRPTAGRVELCGGDPRDPASRRQLGVTPQETGLPGTLRVGEVVDFVSAHFPD
FT                   PVPRGELLDRFGLADQVRRQTGGLSGGQRRRLAVALAFVGRPRLVVLDEPTTGLDVEAR
FT                   HALWDAIRGFHADGGTVLLSSHYLEEVEALAQRVVVIGHGRVLADDSVAAIRGIVGVRR
FT                   VSLVADDLPALPGVVTTERADGRVHLLTTDADQLVRDLVTSGVPFHDLEVRPTSLEEAF
FT                   LAITADDRPAPTPA"
FT   gene            346766..347086
FT                   /locus_tag="ML5_0345"
FT   CDS_pept        346766..347086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_0715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05897"
FT                   /inference="similar to AA sequence:KEGG:AMED_0715"
FT                   /protein_id="ADU05897.1"
FT                   /translation="MTSPSRNLDVQPEALRSFAAASRDRAGRFRELERAFRDGHVARHS
FT                   FGVMPASFSLAAAYEQQFEACLEGLADGAEVMADIAEGLDDTAEAYTGTDVANTDMFKP
FT                   GV"
FT   gene            347096..348022
FT                   /locus_tag="ML5_0346"
FT   CDS_pept        347096..348022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0346"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_1295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05898"
FT                   /inference="similar to AA sequence:KEGG:Caci_1295"
FT                   /protein_id="ADU05898.1"
FT                   /translation="MSTEALQRNKTYFEQIVSGTPDPFKPLSNAVLWPFEQLLELVAGE
FT                   PDDLMRAAQLALTTGEAVRRIAGDQVADRARLRGAWDGDAADKFHASMESVEEAIEELA
FT                   KGLDGTKEVLVDAANAAVDAFNLLVELILEFLLWFLTEVIIAAVAAVLSAGVTLAATVV
FT                   RVLARLATTVGRMVKIVARFAEILTKLVTKLEKVAELLMRYRRVVLELRQAKKAYRAWN
FT                   KSGYTREAFAFKIKRAAILFPGKFAINQASPVNIPGIGGALLDTGMGLHDVSDGRKDRN
FT                   YLVDGTYREDLGPYTNGVQNVFDSIVN"
FT   gene            348032..348385
FT                   /locus_tag="ML5_0347"
FT   CDS_pept        348032..348385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0347"
FT                   /product="Uncharacterized protein family UPF0133"
FT                   /note="PFAM: Uncharacterised protein family UPF0133; KEGG:
FT                   sro:Sros_7887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05899"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADU05899.1"
FT                   /translation="MTFPALDRIEALARNLDGWQRELGARMAELEQSSAEGVSDSGLVT
FT                   VVAAADGKILSTDINARAMRFDSYTLAEEITSAANRAQEAAAARVREIVGEVMGNAPGA
FT                   ERPADDGYGHDRY"
FT   gene            348390..348989
FT                   /locus_tag="ML5_0348"
FT   CDS_pept        348390..348989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cre:CHLREDRAFT_166262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05900"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_166262"
FT                   /protein_id="ADU05900.1"
FT                   /translation="MDETRYRDRIGMLVEPGERVLAHAKADVGQGLAPAPPLEPESTAE
FT                   PSRRTIGSVLLNVLLPLATWDRGDRLVDAIGWGIAGRGAPGTAASRLHRALRPPRPDLQ
FT                   VRETLLAVTERRLLACRTGGVKLLAGREAEERALTETAVAWSAARGEIASARVGWHRLN
FT                   PKRLRIDFTDGSWLSFTVPIAESGRPLREVAAALSA"
FT   gene            complement(349094..351139)
FT                   /locus_tag="ML5_0349"
FT   CDS_pept        complement(349094..351139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05901"
FT                   /inference="similar to AA sequence:KEGG:Sare_4482"
FT                   /protein_id="ADU05901.1"
FT                   /translation="MPATDLDATPSLDAELAAERAHLDASRAALTRMRERAEALFSTGD
FT                   KVAGDSYTAEQLGRHMARRVKELADDPTTPLFFGRLDFGGDDPDHAGREYHVGRRHVTD
FT                   ELGEPLVLDWRAPVSRSFYRASARDPQGVAVRRRFGFSAGTLTSFEDEHLDRGEELGTA
FT                   SRILTAEIERPRVGPMRDIVATIQPEQDELVRADLTDSICVQGAPGTGKTAVGLHRAAY
FT                   LLYLHRERLRRSGVLIVGPNRAFLSYIAAVLPALGEVEVEQATVEDLVARVPVRAVDDP
FT                   AAAALKHDVRMAEVLRRAVEAHIGTPTEPIMVSDGSYRWRIGLDPLHRLVTETRGEGLP
FT                   YATGRERVRARVVGLLQRQAEARRAESPSDAWLRRMSRIKPVTDLLDAVWPALTPDGLV
FT                   HRLRTDADALAAAADGLLTPEEQELFRSGKISRTAKATRWTAADAVLIDEVAGLLERPA
FT                   GFGHVVVDEAQDLSPMQCRAIARRSEHGSITLLGDLAQGTAPWAATDWRDSLAHLGKPD
FT                   AAVVPLSVGFRVPAAVVAFANRLLPALAVDVPPARSLRNDGALDVRTAEDLTAATVAEV
FT                   RAALAHDGSVGVIAADDAVDRLRAALADAGVETATADDVEAAARVTVVPATLVKGLEYD
FT                   HVVVVEPAAIVAAEPRGLHRLYVVLTRAVSRLAVLHREPLPAPLTA"
FT   gene            351362..351733
FT                   /locus_tag="ML5_0350"
FT   CDS_pept        351362..351733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scb:SCAB_62611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05902"
FT                   /inference="similar to AA sequence:KEGG:SCAB_62611"
FT                   /protein_id="ADU05902.1"
FT                   /translation="MEWEILMTGQVEEFLDQLYVLDRDSHRLVNQAILVLERNGPAEGR
FT                   PLVDSITASRLSNLKELRPPSAGRTEIRILFVFDPWRSAVLLVAGDKSGQWTRWYREAI
FT                   PEAEQLYDTYLKERQEENR"
FT   gene            351730..352050
FT                   /locus_tag="ML5_0351"
FT   CDS_pept        351730..352050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0351"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: sro:Sros_8556 putative transcriptional
FT                   regulator, XRE family; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05903"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU05903.1"
FT                   /translation="MSGVKRWRDTTHLDWAIDTAGGPRAFEAEVGEMLDQARGWRLAEL
FT                   RKRREMTQEQVASRMGVSVARVSQIEAGNVATQEVLARYIGALGGTLKLIADFGDEQLK
FT                   VA"
FT   gene            352106..352687
FT                   /locus_tag="ML5_0352"
FT   CDS_pept        352106..352687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0352"
FT                   /product="regulatory protein IclR"
FT                   /note="KEGG: sna:Snas_1225 transcriptional regulator, ArsR
FT                   family; PFAM: regulatory protein IclR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05904"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADU05904.1"
FT                   /translation="MTEALPGRSRVTISDPQVMRALAHPARMAIMEHLGTLEGGATATE
FT                   CAEIAGLSPSATSYHLRELAKFGLVQQAPGRGDARERLWQAVNPSYHVEVGPDADPEAR
FT                   AAEAALVEAHMVRDAQRVRDWLRRAPDESPEWYAATWFSDSMLLMTAEELTELNQAIQA
FT                   LMEPYRRRTRTDPPAGVRPVATQYRAMPVD"
FT   gene            352729..353985
FT                   /locus_tag="ML5_0353"
FT   CDS_pept        352729..353985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0353"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sna:Snas_1226 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05905"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU05905.1"
FT                   /translation="MSFTTDESRWPDVWLAATARGISSCGDFLAAATLTLALQSAGAGG
FT                   LAVSGLLLAATLPLVVLAPLTGRLADRVDSRLLLVAAGLAQAAVCLALAYARDPVLVIA
FT                   LVALLATGLAVTQPAIAALVPVMVRPEDLPRAGALNQTAGTLGALAGPALAGLLVGQFG
FT                   TRVPLLVDAFSYLALVAAGLLIRTRRGGRRTPAAVAAAVAPAWRLRRDPLLTVMVGSVA
FT                   AVIGAVGAVNVIEVFFIRETLGSSTTVYGLVTGSWTLGIVLGAWLFARVARRLADDGAL
FT                   LGAGLVLLGGCCLAVLVSAAVPSAWLLVPIWLAGGVANGGNNVFDQLLLARRVPEASRG
FT                   RAFAVFGAAAQGAAMGGYLVGGLLLEVAGPRVLIAGCGVAGLLVVVALLGPVRRAVRAE
FT                   RAAARTATPAAVSVVAKSV"
FT   gene            354122..354973
FT                   /locus_tag="ML5_0354"
FT   CDS_pept        354122..354973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0354"
FT                   /product="protein of unknown function DUF178"
FT                   /note="PFAM: protein of unknown function DUF178; KEGG:
FT                   stp:Strop_4076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05906"
FT                   /inference="protein motif:PFAM:PF02621"
FT                   /protein_id="ADU05906.1"
FT                   /translation="MADRIARPRVGHIQFLNCLPIYWGLMRSGALIDVDLHKDSPDRLS
FT                   ADLVAGDLDIGPITLVEFLKHADDLLLLPDLAVGSDGPVLSVNVVSTRPLGELDGARVA
FT                   LGSTSRTGVLLAQLLLAERHGVRPEYFRCPPDLTQMLLEADAGVLIGDVALRALYEAPA
FT                   KGLEVTDLGQAWHDWTGLPMVFAVWAVRREFAAAHPGLVKEVHEAFLRSRDLCLAELDQ
FT                   VAEAAARWETFDAATLATYFRALDFSLGERQVAGLREFARRAAAHGEVPALPAGGPEFF
FT                   QG"
FT   gene            complement(355041..355976)
FT                   /locus_tag="ML5_0355"
FT   CDS_pept        complement(355041..355976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05907"
FT                   /inference="similar to AA sequence:KEGG:Sare_4474"
FT                   /protein_id="ADU05907.1"
FT                   /translation="MAGARRRPGSYRRPLAFSALAAALVGLLGLSLRVIPGSPLEATAN
FT                   SHPEPTSERSTQQSVDRNAPRVAPSPSIAPLPFQAKNLDSLKIKGWYAWSVLDKRTGKI
FT                   IGSANMGETSTTASLIKSWVVADYLRLSAAEGRTPSDAKLADATKIIRDSDNTRAQEFY
FT                   ENVGGSDSIERLISICRLTDSEVASDGGWSRTELSPRDTARLGLCIDDGRAAGPKWTKW
FT                   LLNEMRQVRAPGDFGIRKAFPAAQQKKIAIKNGWIDRDKEEEYHVNCLAIGDTWTMGVM
FT                   LRTPFGVEGGWEYGMDACERITKALLRPAT"
FT   gene            complement(355976..356956)
FT                   /locus_tag="ML5_0356"
FT   CDS_pept        complement(355976..356956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05908"
FT                   /inference="similar to AA sequence:KEGG:Strop_4074"
FT                   /protein_id="ADU05908.1"
FT                   /translation="MRPRVTLVLAIVAVLIGGVMLVPAAYAKLSGGDGAGGLGGGEQVP
FT                   APAPTAPAPPTLADAPVSVNFKGEFFSWALMDRETGTVTGAKNMNQTSSTESMLKAWII
FT                   ADYLRQLGDKQPSAGLKKAAILAIRDSDDDGANAVYRAAGGSYKPQPGGRPDPVIARAI
FT                   QICGLTDTRPGSVPDYKGWWSFTEMSPRDAARLGDCIADGRAAGPKWTKWLLSEMTKVA
FT                   GSVSKQGARSGGGRWGIIDGLPATIKSQGPVHMKNGWTQLAYDGNWHVSCLAFTDKWSL
FT                   SVMMRYPGSSGLPYGAKMCAAVATQLVAPQPGAALKVPQQPVGKL"
FT   sig_peptide     complement(356873..356956)
FT                   /locus_tag="ML5_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.975 at
FT                   residue 28"
FT   gene            357316..358380
FT                   /locus_tag="ML5_0357"
FT   CDS_pept        357316..358380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0357"
FT                   /product="phenylacetate-CoA oxygenase, PaaG subunit"
FT                   /note="KEGG: saq:Sare_4472 phenylacetate-CoA oxygenase
FT                   subunit PaaA; TIGRFAM: phenylacetate-CoA oxygenase, PaaG
FT                   subunit; PFAM: phenylacetic acid catabolic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05909"
FT                   /inference="protein motif:TFAM:TIGR02156"
FT                   /protein_id="ADU05909.1"
FT                   /translation="MYGNDFAPPEDAPGGGLLGEVEAAEAALREAAARARRGGPAPDED
FT                   VEAYFADVINADQKIEPRDWMPEAYRRTLIRQIAQHAHSEIIGMQPEGNWISRAPSLKR
FT                   KAILLAKVQDEAGHGLYLYAAAETLGISRDELVDLLLDGRQKYSSIFNYPTLTWADVGA
FT                   IGWLVDGAAIVNQVPLCRCSYGPYARAMIRVCKEESFHQRQGYEILHTLAHGTPAQKAM
FT                   AQDAVDRWWYPSLAMFGPPDGDSTHSAQSMAWKIKRFSNDELRQRFVDMCVGQAEVLGL
FT                   TLPDPDLRWNDERQAYDYTQPDYDELMRVIKGNGPCNRERMAHRRKAHADGAWVREAAA
FT                   AYAAKRAERKAVAA"
FT   gene            358377..358664
FT                   /locus_tag="ML5_0358"
FT   CDS_pept        358377..358664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0358"
FT                   /product="phenylacetate-CoA oxygenase, PaaH subunit"
FT                   /note="KEGG: saq:Sare_4471 phenylacetate-CoA oxygenase
FT                   subunit PaaB; TIGRFAM: phenylacetate-CoA oxygenase, PaaH
FT                   subunit; PFAM: phenylacetic acid degradation B"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05910"
FT                   /inference="protein motif:TFAM:TIGR02157"
FT                   /protein_id="ADU05910.1"
FT                   /translation="MNSASSPLWEVFVRARRGLSHTHVGSLHAPDAELALRNARDLYTR
FT                   RQEGVSIWVVPASAITASSPDEKDAFFDPAADKVYRHPTFYEVPEGAAHL"
FT   gene            358661..359383
FT                   /locus_tag="ML5_0359"
FT   CDS_pept        358661..359383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0359"
FT                   /product="phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /note="KEGG: stp:Strop_4071 phenylacetate-CoA oxygenase,
FT                   PaaI subunit; TIGRFAM: phenylacetate-CoA oxygenase, PaaI
FT                   subunit; PFAM: phenylacetic acid catabolic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05911"
FT                   /inference="protein motif:TFAM:TIGR02158"
FT                   /protein_id="ADU05911.1"
FT                   /translation="MSLFDFTLAVGDDALIAAQRLGEWTSRAPEMEEDIALANIALDQL
FT                   GAARLLLTYAGELEGAGRDEDDLAYLRDDREFRNCLLVELPNGDFGVTMAKLFFLAAYQ
FT                   SPLYTALAGCADERLAAVGAKARKESAYHLDHASLWVKRLGDGTEESHRRMQDAVDQVW
FT                   PYVHELFAPDPAAPVDPSTLRADFDAAVSAVLDEATLIRPETGWAPGGGRDGLHTEHLS
FT                   YLLAEMQVLHRAHPGASW"
FT   gene            359439..359915
FT                   /locus_tag="ML5_0360"
FT   CDS_pept        359439..359915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0360"
FT                   /product="phenylacetate-CoA oxygenase, PaaJ subunit"
FT                   /note="KEGG: stp:Strop_4070 phenylacetate-CoA oxygenase,
FT                   PaaJ subunit; TIGRFAM: phenylacetate-CoA oxygenase, PaaJ
FT                   subunit; PFAM: protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05912"
FT                   /inference="protein motif:TFAM:TIGR02159"
FT                   /protein_id="ADU05912.1"
FT                   /translation="MTDARAAAAAVVDPEIRVITIDELGILRAVDEEPDTGRVVVTITP
FT                   TYTGCPAMDVIREDIRRALAAAGHPDAEVRTVYHPAWSTDWISEAGRAKLAAAGIAPPA
FT                   PRGDDTVVPLTLAVRCPRCGSPETTQISRFGSTACKALWRCRSCSEPFDHLKAL"
FT   gene            359912..361024
FT                   /locus_tag="ML5_0361"
FT   CDS_pept        359912..361024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0361"
FT                   /product="phenylacetate-CoA oxygenase/reductase, PaaK
FT                   subunit"
FT                   /note="KEGG: saq:Sare_4468 phenylacetate-CoA
FT                   oxygenase/reductase, PaaK subunit; TIGRFAM:
FT                   phenylacetate-CoA oxygenase/reductase, PaaK subunit; PFAM:
FT                   Oxidoreductase FAD-binding domain protein; oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05913"
FT                   /inference="protein motif:TFAM:TIGR02160"
FT                   /protein_id="ADU05913.1"
FT                   /translation="MTVTITRPVRRRPVFHPLPVASVDRLTDDSVSITFAVPEELRETF
FT                   AFSAGQHLTVRRPADGDGEEVRRSYSICSTPDELARHGRLRVGVREVPGGAFSAYACGA
FT                   LRGGDTVEVLPPLGHFTSAFTPDRARRYGAVVAGSGITPVLGLAATALATEPRSTFTLV
FT                   YGNRTANSVMFAEELADLKDRYPTRLHLVHVLSREMGESALLSGRIDADRLTRLLDTVV
FT                   PGDEIEEWFLCGPYGMVVDAKAVLAGRGVPDAAVHTELFHVDAPPEPVRRETDRPGAGT
FT                   EVTILLDGRSSSFTMGRDERVLDAALRVRGELPYACKGGVCSTCRAKVTSGEVTMARNY
FT                   ALEPDEVAAGYVLTCQSSPVTDELTVDYDA"
FT   gene            complement(361037..361651)
FT                   /locus_tag="ML5_0362"
FT   CDS_pept        complement(361037..361651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr0496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05914"
FT                   /inference="similar to AA sequence:KEGG:mlr0496"
FT                   /protein_id="ADU05914.1"
FT                   /translation="MAGARSALWSLTMTAVLVGFGLAVIVVSAVVAHLTVGLPIAVPIS
FT                   VALVGCLAFAVGLRLLHRGWWLTLLSVLPALFVLVGTVQLAPESVLRERGVAQQVTITD
FT                   VQTVGKRHEFVLQGGTGRLDEPLVYRGSSPGYRVGQRLTVLVDPRGEVELADAQDVDPA
FT                   GKRGMLVLGAAGWTLLALVGGWRGHVSRARGRAATAPPVVF"
FT   sig_peptide     complement(361553..361651)
FT                   /locus_tag="ML5_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.690 at
FT                   residue 33"
FT   gene            361792..362070
FT                   /locus_tag="ML5_0363"
FT   CDS_pept        361792..362070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0363"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   mbt:JTY_1986 hypothetical protein, antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05915"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADU05915.1"
FT                   /translation="MEQIAVRELNQHTSRVLARVRAGETVEVTDRGEPIARLVPVLAGD
FT                   ALLGRLVAEGRATAPTTTGPVPMPPVLGDPTVDAAAALVEARDEERW"
FT   gene            362067..362477
FT                   /locus_tag="ML5_0364"
FT   CDS_pept        362067..362477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_9123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05916"
FT                   /inference="similar to AA sequence:KEGG:AMED_9123"
FT                   /protein_id="ADU05916.1"
FT                   /translation="MIYLDSAAVIKMLRREAETADLLGWLNERAGTALVSSALVEVEVP
FT                   RALRRAAPQALVGVPSVLGRLYRVEIDATVRATAGAYPEPMLRSLDAVHLATAEILARQ
FT                   AAAEFVAFVTYDERLLEAAKAIGLPVASPGMP"
FT   gene            362551..363741
FT                   /locus_tag="ML5_0365"
FT   CDS_pept        362551..363741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0365"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   saq:Sare_4467 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05917"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU05917.1"
FT                   /translation="MTANREIDDILQRGADGGRITPEEALLLYTDAPFHALGEAADAVR
FT                   RRRYPDNIVTYLIDRNINYTNVCVTACKFCAFYRAPKHKEGWTHPTEEILRRCGEAVEL
FT                   GATQVMLQGGHHPDYGVEYYEELFSSVKKAYPQLAIHSIGPSEILHMAKVSGVSLDEAI
FT                   ARIKTAGLDSIAGAGAEMLPDRPRKAIAPLKESGARWLEVMELAHRQGLESTATMMMGT
FT                   GETNAERIEHLRMIRDVQDRTGGFRAFIPWTYQPENNHLKGRTQATTLEYLRLVAVARL
FT                   FFETVPHLQASWLTTGKDVGQLALHMGVDDLGSIMLEENVISSAGARHRSNLHELIGMI
FT                   RSADRIPAQRDTLYNRLAVHHTPADDPSDDRVVSHFSSIALPGGGAGKSLPLVEVN"
FT   gene            364184..365440
FT                   /locus_tag="ML5_0366"
FT   CDS_pept        364184..365440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0366"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; KEGG: saq:Sare_4466 cell wall anchor
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05918"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ADU05918.1"
FT                   /translation="MTFRYRSTLARAGVVALLSTAGLGAAAGPAQAADKADLQLIPLSY
FT                   QLAKGVSEAKAKPFKFQVNNTLGTVDAKDVRVTVETKGLKTAKVGVLVPAGCDIRGTTF
FT                   SCLLGDLPAGTTEDFGLPLFSTGGKGAAGTLTVSISAANGAGVLDTIDHDITVTEPGYD
FT                   LTTWVQDVYADVRVDGDDADESGLRPVRPGGTAPLDWAVFNDGSKRATGIKYGIALPAG
FT                   VTFAKLPDGCVEQNLGGFLNAYCEDLGAVLKPGQYYTADVRVTVGADVTEKLLRPGILW
FT                   AEGLDAASGAPEEEPRVASSAQRRAFAETDDGDNSAVFDVFVDQSPSTPSPTPTTQPTS
FT                   TPTAQPTPTGDATAVPTPTAGGGAGGGSGDGGLPVTGMQVGLIGGVGAAVLAAGAALMM
FT                   LSRRRKVVLVAPGEERTGD"
FT   sig_peptide     364184..364282
FT                   /locus_tag="ML5_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            365540..366250
FT                   /locus_tag="ML5_0367"
FT   CDS_pept        365540..366250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0367"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="KEGG: saq:Sare_4465 ubiquinone/menaquinone
FT                   biosynthesis methyltransferase; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferase;
FT                   PFAM: UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05919"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ADU05919.1"
FT                   /translation="MSRTPQGQRASLDKQPHEVAAMFDGVAARYDLTNTVLSFGQDRSW
FT                   RRATRAALGLRPGERVLDVGAGTGVSTEELAHSGAYAVGADLSLGMLHAGKRTRPSVPL
FT                   LAGDALRLPFADASFDAVTISFALRNVNDTDAALAELARVTRPGGRLVVCEFSTPVNPA
FT                   FRTVYLSYLMRSLPAVARAVSSNPDAYVYLAESIRAWPDQAALAARIGAAGWGRVAWRN
FT                   LTGGVVALHRAVRN"
FT   gene            366325..366543
FT                   /locus_tag="ML5_0368"
FT   CDS_pept        366325..366543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0368"
FT                   /product="mycobacteriophage protein"
FT                   /note="KEGG: fal:FRAAL2683 mycobacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05920"
FT                   /inference="similar to AA sequence:KEGG:FRAAL2683"
FT                   /protein_id="ADU05920.1"
FT                   /translation="MTGPDQAATDDDAAELIAQLRELAGADPADVRQVVAEVLAALDRA
FT                   AGGALRDHLPEAIRLDAGLGPAAQVRP"
FT   gene            366678..367952
FT                   /locus_tag="ML5_0369"
FT   CDS_pept        366678..367952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0369"
FT                   /product="geranylgeranyl reductase"
FT                   /note="KEGG: saq:Sare_4464 geranylgeranyl reductase;
FT                   TIGRFAM: geranylgeranyl reductase; PFAM: FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05921"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ADU05921.1"
FT                   /translation="MTAVENDADVIVVGAGPGGSATAYHLARHGVRVLLLEKTEFPREK
FT                   VCGDGLTPRAVRQLIRMGVDTSPEAGWLHNKGLRVIGGGIRLELDWPDLASFPNYGLVR
FT                   TRLDFDDLLAQRAVAAGAKLQTSVSVLGPVLGADDRVIGVQAEVGPDKEPATFHAPLVV
FT                   AADGVSGRFPLALGLAKREDRPIGVAVRRYYRSPAKHDDDYLESWLELRAKGSDALLPG
FT                   YGWIFGLGDGRVNVGLGVLNSSSAFGKTNYRKLLTDWLANTPEDWGMTDESNAEGPILG
FT                   AALPMGFNRVPHYTRGVLLVGDSGGMVNPFNGEGIAYAMESGEMAAEVVVQALARPAGA
FT                   ERERALMAYPQELKARFGGYYRLGGVFVKLIGRPEIMRMATKHGMPHPMLMRFVLKLLA
FT                   NLTDPRGGDAMDRVINAMTKVAPAV"
FT   gene            368087..368452
FT                   /locus_tag="ML5_0370"
FT   CDS_pept        368087..368452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0370"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3; KEGG: saq:Sare_4463 NADH dehydrogenase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05922"
FT                   /inference="protein motif:PFAM:PF00507"
FT                   /protein_id="ADU05922.1"
FT                   /translation="MTLSPYAPIIGLFALAAAFALFSVAAARLAGPRRLNKAKLEAYEC
FT                   GIEPSPQPVGGGRFPIKFYLTAMLFIVFDIEIIFLYPWAVSFDALPIFGFVEMVLFIVA
FT                   VFVAYAYVWRRGGLDWD"
FT   sig_peptide     368087..368164
FT                   /locus_tag="ML5_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.739 at
FT                   residue 26"
FT   gene            368464..369144
FT                   /locus_tag="ML5_0371"
FT   CDS_pept        368464..369144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0371"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   KEGG: saq:Sare_4462 NADH dehydrogenase subunit B; PFAM:
FT                   NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05923"
FT                   /inference="protein motif:TFAM:TIGR01957"
FT                   /protein_id="ADU05923.1"
FT                   /translation="MGIEEKLPSGVLLTSVEKLVNWTRKTSVWGATFGLACCAIEMMAA
FT                   GGPHYDMGRWGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPRWVISMGVCA
FT                   SSGGMFNNYAIVQGVDHVVPVDMYLPGCPPRPEMLIDAVLKLREKIMHEPLGPNGRKML
FT                   EARQARGDVPVVPYGSMPSSYRSDKARRAEWTKAVREGREEQLRIENWMKAQNHLQASH
FT                   RGPK"
FT   gene            369141..369872
FT                   /locus_tag="ML5_0372"
FT   CDS_pept        369141..369872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0372"
FT                   /product="NADH (or F420H2) dehydrogenase, subunit C"
FT                   /note="KEGG: saq:Sare_4461 NADH dehydrogenase subunit C;
FT                   TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C; PFAM:
FT                   NADH dehydrogenase (ubiquinone) 30 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05924"
FT                   /inference="protein motif:TFAM:TIGR01961"
FT                   /protein_id="ADU05924.1"
FT                   /translation="MSNDKNNDGGVPVPTTPVGASSTAPAEYPPASPAGRGMFGNQGTG
FT                   DVSGYGGLVRPRKPIEEAARPYGSYFDEVRDALEEAYPDFGDAIEKVVVDRGELTLHVR
FT                   PERIAEVCQVMRDDLALRFELLSSVSGVDYLGAQERRLHVVYHLTSMTYRRSVRLEVAV
FT                   SVEEPHVPSVTAVYPTADWQERETYDMFGVVFDGHPALTRILMPDDWEGHPQRKDYPLG
FT                   GVPVEYKGAEIPPPDRRRSYQ"
FT   gene            369869..371194
FT                   /locus_tag="ML5_0373"
FT   CDS_pept        369869..371194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0373"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: NADH dehydrogenase I, D subunit; KEGG:
FT                   saq:Sare_4460 NADH dehydrogenase subunit D; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05925"
FT                   /inference="protein motif:TFAM:TIGR01962"
FT                   /protein_id="ADU05925.1"
FT                   /translation="MTTSNYATERETTEGKVFTVTGGDWDEVVSGTDPINDERIVVNMG
FT                   PQHPSTHGVLRLVLELEGETVREARSVIGYLHTGIEKNLEYRNWVQGSTFVTRMDYLSP
FT                   LFNETAYALAVEKLLGITDDVTERATTIRVLMMELNRVSSHLVWLATTAMELGAINMML
FT                   YGFREREYVLDIFETITGLRMNHAYVRPGGVAQDVPDDAIRKIRDFLQLMPKRLKEYEN
FT                   LLSGQPIWLERTQHVAVLDVTACMALGVTGPVLRSAGLAWDLRKTMPYCGYETYEFDVP
FT                   THTDGDVWGRYLVRVAEIRESLKLIEQALDRLKPGPVMVSDKKIAWPAQLAIGVDGMGN
FT                   SLEHVAKIMGQSMESLIHHFKLVTEGFRVPPGQVYVGIESPRGELGVHAVSDGGTRPYR
FT                   VHYREPSFVNLQALPAMAEGGLIADVIAGGASLDPVMGGCDR"
FT   gene            371191..372285
FT                   /locus_tag="ML5_0374"
FT   CDS_pept        371191..372285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0374"
FT                   /product="NADH-quinone oxidoreductase, E subunit"
FT                   /note="KEGG: saq:Sare_4459 NADH dehydrogenase subunit E;
FT                   TIGRFAM: NADH-quinone oxidoreductase, E subunit; PFAM: NADH
FT                   dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05926"
FT                   /inference="protein motif:TFAM:TIGR01958"
FT                   /protein_id="ADU05926.1"
FT                   /translation="MSFSETTRTRAREIIARYPADRSRSALLPLLHLVQSEEGYVSPAG
FT                   VEFCAEVLGLNKAQVGAVATFYTMYKRKPTGDYLVSVCTNTMCDVLGGQKVYDTLAEHL
FT                   GVGHEETTADGKITLEHAECLAACDYGPVMTVNYDFFDNVEPQAALDVVEELRAGGRPM
FT                   PTRGARLCTLKEMAVQLAGFADERDGAVADGGPGEPSLRGLRLAEQHGVSVPGFDPKTP
FT                   IRSKAEADRAAAEAKAKAEAAKPAPAPEPAEPEAATGSTAPDVKAPDDKSPQVRTAETR
FT                   QPDASTPVPDAPGTKVPVDGPAPAPRDARAAEAAGVAANPPAGDGKPAGDAAGAQERNL
FT                   KEAESGTGADGADPADASGTGVRK"
FT   gene            372282..373598
FT                   /locus_tag="ML5_0375"
FT   CDS_pept        372282..373598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0375"
FT                   /product="NADH-quinone oxidoreductase, F subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, F subunit;
FT                   KEGG: saq:Sare_4458 NADH-quinone oxidoreductase, F subunit;
FT                   PFAM: Respiratory-chain NADH dehydrogenase domain 51 kDa
FT                   subunit; Soluble ligand binding domain; NADH ubiquinone
FT                   oxidoreductase, F subunit, iron sulphur binding"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05927"
FT                   /inference="protein motif:TFAM:TIGR01959"
FT                   /protein_id="ADU05927.1"
FT                   /translation="MTTPRPETLAKLTPVLTKRWLSPDAWRLGTYEKLDGYAALRKALK
FT                   AHPDDLIQLIKDSGLRGRGGAGFPTGLKWGFIPQGDGKPHYLVVNADEGEPGTCKDLPL
FT                   MTHDPHSLVEGVIIASYAIRANRAYIYIRGEAVHAARRLRSAVDEAYAKGYLGRNVLGS
FT                   GFDLDLVVHSGAGAYICGEETALLDSLEGFRGQPRLRPPFPATHGLYASPTVVNNVGTI
FT                   ASVPYIVLGGADWWKTMGTEKSSGPMIYSLSGRIADPGQYECSMGITLRELIELAGGMK
FT                   PGHNLKFWTPGGSSTPLLTAEHLDVPLDFEGVAAAGSILGTTATQIFSDQDCPVYATYR
FT                   WLEFYHHESCGKCTPCREGNYWMVRVYRRILAGQGTHEDLDTLLDTCDNILGRSFCGLG
FT                   DGATSSVTSSLKYFKQDYLDYIEGRTAPKLSEKTLVGAH"
FT   gene            373598..376039
FT                   /locus_tag="ML5_0376"
FT   CDS_pept        373598..376039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0376"
FT                   /product="NADH-quinone oxidoreductase, chain G"
FT                   /note="KEGG: saq:Sare_4457 NADH dehydrogenase subunit G;
FT                   TIGRFAM: NADH-quinone oxidoreductase, chain G; PFAM:
FT                   NADH:ubiquinone oxidoreductase, subunit G, iron-sulphur
FT                   binding; ferredoxin; molybdopterin oxidoreductase Fe4S4
FT                   region; molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05928"
FT                   /inference="protein motif:TFAM:TIGR01973"
FT                   /protein_id="ADU05928.1"
FT                   /translation="MTDVAKQTETVTLTIDGVEVTAPKGALLIRVAEQLGTEIPRFCDH
FT                   PLLAPAGACRQCLVEVEGQRKPVASCTQTVADGMVVRTQLTSPVAKKAQEGVMELLLLN
FT                   HPLDCPMCDKGGECPLQNQAMSTGRTDSRFHEHKREYPKPLPISTQVLLDRERCVLCQR
FT                   CTRFSEEIAGDKFIDLMGRSSHEEINIYRDDAYGEEGDEGDVPFNSYFSGNTVQICPVG
FT                   ALTGTQYRFRARPFDLVSTPSVCEHCSAGCAQRTDWRRGKVLRRLAGDDPAVNEEWNCD
FT                   KGRWGFQYTRAFDRISTPMVRDEKTGELREASWSEALTRAAEGLRAARDGATGTAVLTG
FT                   GRLTVEDAYAYAKFARIALHTNDIDFRARPVSREEADFLASSVAGVTDVTYTDVENAPA
FT                   VVLVGLEPEEECPILFLRLRKAYLKKKLTVYALAPFATRGLEKLGAKLARVVPGEEAGV
FT                   LAEHATVAEALGQPGAILIVGERLAEVPGGLSAAADVARRTGARLVWVPRRAGDRGAVD
FT                   AGCLPNLLPGGRVVTEPAARAELGEAWDIPAGVIPSQAGRDTDGILTAAANGQIGALVV
FT                   AGVDPADLADPRLAESALDAVPFLVSLELRMSAVSRRADVVLPVAPVVEKAGSFLDWEG
FT                   RLRTFEKVLDTGAMTDARILDAIAAQLDVRLGTGDVPSIRRELGALPRTRVERPSAPSV
FT                   EPAAVRQPGPGEAVLATWHQLIDLGSLTDGDEHLAGTARPPVVRLGKGTAEALGVADGD
FT                   PVTVGTDRGAITLPAAITEMPDGVVWLPTNSPGSTVRRGLGATSGDVVSVSAVGNERWV
FT                   Q"
FT   gene            376036..377391
FT                   /locus_tag="ML5_0377"
FT   CDS_pept        376036..377391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0377"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: saq:Sare_4456 NADH dehydrogenase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05929"
FT                   /inference="protein motif:PFAM:PF00146"
FT                   /protein_id="ADU05929.1"
FT                   /translation="MNPVILAAQDPTLADFGKDPWWLVLGKILFAFVVAVAATLLGVWF
FT                   ERRVVGRMAVRPGPNQAGPFGLLQTLADGVKLAFKEDILPRKADKVVYFFAPVISVVCA
FT                   VTALSVIPFGPMVSIFGHRTPLQVTDVSVAVLVVLAFSSLAVYGIVLGGWASGSTYPLL
FT                   GGLRSAAQLVSYEVTMGLSVVAVFMTAGTMSTSGIVAAQGDGTRLSIGGFDLAAPGWYA
FT                   ILLLPSFIMFFIAIVGETNRAPFDLPEAESELVAGFQTEYSSLKFALFMLSEYVAMVTM
FT                   SAFTVTLFLGGWHAPWPITIWSGANEGWWPMLWFFGKVIMLVFVFVWLRGTLPRLRYDQ
FT                   FMRFGWKVLLPLNLVWIMVLAGLRSIEDWQTRDRLLVTAVGAGVLLLATLFWPSRKKEP
FT                   KPSLQEQADTRPYGSFPLPPMDLQVPPSPRTKRVLAEREPANVVAGPDSREV"
FT   gene            377393..378040
FT                   /locus_tag="ML5_0378"
FT   CDS_pept        377393..378040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0378"
FT                   /product="NADH-quinone oxidoreductase, chain I"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain I; KEGG:
FT                   saq:Sare_4455 NADH dehydrogenase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05930"
FT                   /inference="protein motif:TFAM:TIGR01971"
FT                   /protein_id="ADU05930.1"
FT                   /translation="MGAITGTFKGFGVTFSHMFKKVVTTDYPFKPPVSAPRYHGRHILN
FT                   RHPDGLEKCIGCELCAWACPADAIYVEGGDNTEEQRFSPGERYASTYQINYARCIFCGL
FT                   CIEACPTRSLTMSNEYELARDNRQDLIFTKEQLLAPLLEGMEQPPHPMRLGDSEKDYYV
FT                   GALTNPGTSAGAERSPMGPGRYQVEEHPGVTFPGAEQAEQRSAAAAGKGGKA"
FT   gene            378037..378807
FT                   /locus_tag="ML5_0379"
FT   CDS_pept        378037..378807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0379"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: saq:Sare_4454 NADH dehydrogenase subunit J"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05931"
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /protein_id="ADU05931.1"
FT                   /translation="MTSATVLAAAGQVSGGEEVTFWILAPLALLGAIGMVWARNAVHSA
FT                   LWLVLTMLCLGVFYVLQAGPFIGMVQIIVYTGAIMMLFLFVLMLVGRDASDSLIETLRG
FT                   QRVAAVVLGLGFAGLVGTGLYRALDGVQPVGLDEANGEGNVQGIARLLFTKYVFAFELT
FT                   SALLITAAVGAMVLAHVERRKADRMDQIATMKARFRPGNYPGPKPGPGVYATSSSVATP
FT                   ARLPDGRLTDRSIPEIMPVRELTAEETAPKGTDR"
FT   gene            378863..379162
FT                   /locus_tag="ML5_0380"
FT   CDS_pept        378863..379162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0380"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   stp:Strop_4055 NADH dehydrogenase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05932"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADU05932.1"
FT                   /translation="MTPDYYLILAAVLFTIGAVGVLVRRNAIVLFMCIELMLNAANLTL
FT                   VTFSRINGDLNGQIMAFFVMVVAAAEVVVGLAIIMAIFRTRRSASVDDANLLKY"
FT   gene            379170..381131
FT                   /locus_tag="ML5_0381"
FT   CDS_pept        379170..381131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0381"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /note="KEGG: stp:Strop_4054 NADH dehydrogenase subunit L;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05933"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ADU05933.1"
FT                   /translation="MVEQILTIAQSEPAEAVTFATADGMLGSVWLLVAIPLVSAAILLL
FT                   LGKRADRWGHWLGVGAIGAAFVLGLTYFFQLRGLENKQVELSLWDFMAVGNLKVDFGLL
FT                   FDPLAAVFVLLITGVGFLIHLYAVEYMAHDAGRRLFFAYFNLFVAAMLLLVLGNNYVML
FT                   YFGWEGVGLASYLLISFWYGRPSAATAGKKAFLMNRVGDAGLAIGIFIMFAVLGTTQYD
FT                   EVFNGVGSMTSTTVLVLGLLLLLGAAGKSGQFPLQAWLPDAMEGPTPVSALIHAATMVT
FT                   AGVYLIARSNAIFSANETLQLVVVSVGALTLLMGCIIGAAKDDIKRVLAWSTVSQIGYM
FT                   FLGVGLGGGAYALAIVHLLAHGFFKANMFLGAGSVMHGMNDQVDIRRFGGLSKYMKVTW
FT                   LTFMMGWLAIIGMFPFSGYFSKEPIIVAAFEREGWTAWLFGMAALLGAGLTAFYMTRLF
FT                   VLTFHGPKRWTEDIEHPHESPKLMTVPLILLAVGSVGAGFLLATSVPDWLTATNGLAAE
FT                   SGEHAPVLAHWLLTALSLLLTVLGAGLAWFLFRSGTATEPQPAGVVVTAARRNLYTDAF
FT                   NEAVFEKPGIFLTRALVFLDNRGVDGLVNGLAAAVGGGSGRLRRLQTGFVRSYATSILT
FT                   GALLVVAAFLAVQAGWLA"
FT   gene            381196..382728
FT                   /locus_tag="ML5_0382"
FT   CDS_pept        381196..382728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0382"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /note="KEGG: stp:Strop_4053 proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain M;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05934"
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /protein_id="ADU05934.1"
FT                   /translation="MSNFPFLSVLTVAPLVGALVVALLPRSRPDLAKLVAFGWSLLVLV
FT                   LSVVMWFAFSAGGDRFQFRESYPWIPNWGVNFTFEVDGIALVMLMLIAILVPLVILASW
FT                   HDAEASKRSVPAYFALLLVLECTMIGVFAAADVFLFYVFFEVMLVPMYFLIGSYGGHQR
FT                   QYAAVKFFLYSLVGGLFMLAAVIGLWVVGGKTFDWQALSQAEFATDTARWLFLGFFVAF
FT                   AIKAPFFPFHTWLPDAGGAAPAGAAALLVGVLDKVGTFGILRYCLPLFPEASRWFAPWA
FT                   LALGVIGIIYAALLAVGQNDLKRLVSYTSIAHFGFIGVGIFAFTTQAGTGAVLYMLNHG
FT                   LATGLLFLVVGMLIARRGSALISDFGGAGKLVPVLAGVLFFAGLASLALPGTAPFVSEF
FT                   LVLIGTFTVNKPVAVIATLGIILAAAYVLWMVQRTTQGTLNPALTEVEGMRRDLTLREK
FT                   VVVAPLIALIVLLGFYPKPVTDVINPAVQATMQDVGKSDPAPEVGSVQEAAK"
FT   gene            382725..384278
FT                   /locus_tag="ML5_0383"
FT   CDS_pept        382725..384278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0383"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /note="KEGG: stp:Strop_4052 NADH dehydrogenase subunit N;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain N; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05935"
FT                   /inference="protein motif:TFAM:TIGR01770"
FT                   /protein_id="ADU05935.1"
FT                   /translation="MSELRLPSIDYAALAPILIMLGAALLGVLVEAFVPRRLRNAVQLG
FT                   LALVAMLAAIVMVILNADDRLITIGGAIAIDGPTLFLQGAILVLAVMALLLVGERTVER
FT                   GGAFVAHAAVTAESAEDRRQAEGVGGATEVYPLMSFAIGGMLIFVAANDLLTMFVALEV
FT                   FSLPLYLLCALARRRRLLSQEAALKYFMLGAYASAFFLFGVALIYGFTSGIPGRTAGVD
FT                   FATVHAAVTDSPSSPVLLFAGMALLAIGLLFKAAAAPFHVWTPDVYQGAPTPVTGFMAA
FT                   CTKVAAFGALLRVFHVAFAGASWDFTPVLGAIAVLTMLVGAVLAVTQTDIKRLLAYSSI
FT                   ANAGYLLVGVLAPSREGLSGTMFYLAAYGFSVLAAFAVVTLVRDADGEATHLSRWAGLG
FT                   RRSPFFAAIFTFILLAFAGIPLTSGFTSKFAVFGPALEANQAWLVIAGVLTSMVLAFPY
FT                   LRVVVMMWLSEPGESTPTVTVPGALTSAALVIGVLATLVLGVVPGPLLDLTTGAAEFVR
FT                   "
FT   gene            384366..385406
FT                   /locus_tag="ML5_0384"
FT   CDS_pept        384366..385406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0384"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: stp:Strop_4051
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05936"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADU05936.1"
FT                   /translation="MVEDVANPAGERSGQFGALGLHLADPRVEASVLGVLDRVETSLRA
FT                   SVASADPLVTEASRHLVEAGGKRFRPLLVALGAQFGDPDTDQVVPAAVVMELTHLATLY
FT                   HDDVMDEAAVRRGAPSANSRWTNSVAILVGDYLFARAADIAADLGPEAVRLQARTFARL
FT                   VHGQIAETVGPRDTDPVAHYLHVIAEKTGSLIATSARFGGMFGGAAPEHVEALAEYGEI
FT                   IGVAFQLSDDLLDIASESVQSGKTPGTDLREGVPTLPVLYAMASDDADAASVRLREILA
FT                   TGPLVDDALHAEALGLLRESPALKRARETVRSYAEDARARLAPLPEGPARRALESLCDY
FT                   IADRTS"
FT   gene            complement(385548..386750)
FT                   /locus_tag="ML5_0385"
FT   CDS_pept        complement(385548..386750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0385"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sna:Snas_5945 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05937"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU05937.1"
FT                   /translation="MTETVSRVASPASRHAVTVGAGATLTTIVCVLPVFLVGGLAVQLA
FT                   DELRFSPAGLGLAVSIYFGVSALASVPSGALVERFGSAPVARAAILLSAASLLAVAGLA
FT                   RSYPILVALLALSAAANALGQLASNAALAEHVPAHRQGLSFGVKQAAVPAATLLAGLAV
FT                   PTVALTAGWRWAFVAAAVAALAVLPAVPRAGRDRRARTASGRGPGGTGPLVVIGLAATL
FT                   AAAAANALGTFLVDSAAARGLSPGLAGLTLTLGSVVCVLARVGVGWLADRRTSGHVGLI
FT                   AGMLLTGSVGLILLAVAGSAPLVAGVVLGFGLGWAWPGLMNFAVVRLHPQAPAAATSIT
FT                   QTGVYAGGCLGPLGLGALAGAAGYPAMWLTAAAAMLLAAFLMLLGARLLRPTPTPTPTL
FT                   P"
FT   gene            386904..387686
FT                   /locus_tag="ML5_0386"
FT   CDS_pept        386904..387686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0386"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: saq:Sare_4448 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05938"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADU05938.1"
FT                   /translation="MRDPLAEPSDLIRSVSRALRVLESVGRAPRGLTVKQIARRCELTV
FT                   ATTYHLVRTLAYEGYVIRREDGTYIVGLEVADRYRELVTAFRGPPAVGEALRRAASDTG
FT                   WSHYLGRFVGGQVAVTASAEGPRSPYMEDLVPGFDEGAHATALGKSLLATLTTEQRFRY
FT                   LREYGMRPFTTATLTTVEAFEADLAAGDRRGMQLELGQFRQGVACAAVLVSPDKDIERR
FT                   VVLACALPAGEMMTSARVVRAKLLTAARAIADGIASEN"
FT   gene            complement(387804..389930)
FT                   /locus_tag="ML5_0387"
FT   CDS_pept        complement(387804..389930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0387"
FT                   /product="protein of unknown function DUF839"
FT                   /note="PFAM: protein of unknown function DUF839;
FT                   Twin-arginine translocation pathway, signal sequence,
FT                   subgroup; KEGG: stp:Strop_4049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05939"
FT                   /inference="protein motif:PFAM:PF05787"
FT                   /protein_id="ADU05939.1"
FT                   /translation="MSDRPRLLPLLGGTRHGSRDAMTCLYRCGNACDHPVPNPTDNPYF
FT                   GDVVDTEISRRGVVRAGAVGALVLGFGGAAAGALAGAAPAAAAPAAPPVPGGGEVSPAG
FT                   AGRPGSGALTFKPIPPNKLDTLVVPNGYDHSVVIRWGDEVVPGAPAFSLGRQTAAAQSK
FT                   QFGYNNDFVGVLPIDRRRALLVVNHEYTNEDLMFPGFTSQDALTVEQLRVAMAAHGMSV
FT                   VELERVENTGQWQPVRRGRREYNRRVTALATKFELTGPAAGSSWLRTAADPKGRTVIGT
FT                   LNNCAGGVTPWGTVLSGEENFNQYFVGGDGAPEEQKPKLARYGIPTDVRHPSGSRKWER
FT                   ADERFDLAKHPNEANRFGWIVEIDPFDPQAKPRKHTALGRFKHEGANVIVARNGRVVAY
FT                   MGDDERFDYLYKFVSDKKFMPGKSSVARRHNLTLLESGTLYVAKIEGDSPAAEIDGSGK
FT                   LPADGGFGGRGRWIKLVSGNRSYVDGMTAADVLTFTRLAGDKVGATKMDRPEDVEPSLL
FT                   TGKVYVALTNNSDRGKAGKAPADEANPRNSNKHGQILELVEDRGDNTAETFAWSLPIVC
FT                   GDPADASTYFAGYDKTKVSPISCPDNVAFDATGNLWISTDGNALGSNDGLFATAVEGPE
FT                   RGHLKQFLTVPLGAETCGPFITGDNRSVFVAVQHPGEVSGASVENPASTWPDGDFAKPG
FT                   VVVTWRLDGGPVGS"
FT   gene            390101..390670
FT                   /locus_tag="ML5_0388"
FT   CDS_pept        390101..390670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0388"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: saq:Sare_4446 LuxR family transcriptional
FT                   regulator; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05940"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADU05940.1"
FT                   /translation="MEGRTHRRFPRRRKRGTAISDHDAQLLRALHDEHADALYAHALRL
FT                   VNGDRPRAEDLVQETLLRAWRHPESLDPRRGSVRAWLFTTARNLAIDAWRRRSARVGEV
FT                   YTDELPETAETVDETERAVEAWTVAEALNRLSPTHREVLVECFYQGRSVAEAAARLGVP
FT                   PGTVKSRTHYALRSLRLALAEMGVTG"
FT   gene            390667..391356
FT                   /locus_tag="ML5_0389"
FT   CDS_pept        390667..391356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0389"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: saq:Sare_4445 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05941"
FT                   /inference="similar to AA sequence:KEGG:Sare_4445"
FT                   /protein_id="ADU05941.1"
FT                   /translation="MTRCEFAHDDGAYVLGALAPADRVAYERHLAGCAQCREAVAEIAV
FT                   LPGLLGRLDPAGLEQFLEVGPETSRVPALLDAARERKRRERSRSRRRYALTALAAAALA
FT                   VLAGVGVGLVQSPAEPSKPPVALASMRPVAGTVPVHAEVGLTETPWGTEVTMHCGYDRR
FT                   AGHREAYTFRLVAHGPDGATEQIGSWLAAPGDDLRFSGVTRFTKGELVRLELLRGTNAP
FT                   VLAYDLR"
FT   gene            complement(391448..392374)
FT                   /locus_tag="ML5_0390"
FT   CDS_pept        complement(391448..392374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0390"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="KEGG: saq:Sare_0466 transporter DMT superfamily
FT                   protein; TIGRFAM: RarD protein, DMT superfamily
FT                   transporter; PFAM: protein of unknown function DUF6
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05942"
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /protein_id="ADU05942.1"
FT                   /translation="MNQLRLGYLYGVGAYLIWGFFPIYLKLLRPAGPVEILAHRILWSV
FT                   AFVALLLAATRHAGFLRKLARRPRALAGIGLAAALIAVNWGTYIYGVNSDRVVETALGY
FT                   FINPLVSVLFGVLVLRERLRRAQWAALGVGALAVAVLTVDYGRLPWLALTLAFSFAGYG
FT                   LVKKQLALPATEGLFVESAVLALPALAYLGWLSARGDSTFGHVSAGHTALLVLAGAATA
FT                   IPLLLFAGAANRLPLSTVGMLQYLAPILQLGCGVLIFHEPMPPARLAGFALVWLALVVF
FT                   TADALRHSHRTRQAARTPTAPTPTPSR"
FT   gene            complement(392371..392859)
FT                   /locus_tag="ML5_0391"
FT   CDS_pept        complement(392371..392859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0391"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   saq:Sare_0465 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05943"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU05943.1"
FT                   /translation="MFTLTRADGYEISTDPDRIDLDRVHVWLSTDAYWALGRERETVAR
FT                   AFTGSIGFGVYRPGDGRQVAVARVVTDGATFAWLCDVYVDPAERGSGLGTWLAGAVRDH
FT                   LNELGVRRILLATLDAHGVYAKIGFKPVAADRWMELDQRVTPVTDKDQDKDPPLTVER"
FT   gene            complement(392964..393350)
FT                   /locus_tag="ML5_0392"
FT   CDS_pept        complement(392964..393350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0392"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   saq:Sare_4444 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05944"
FT                   /inference="protein motif:PFAM:PF04020"
FT                   /protein_id="ADU05944.1"
FT                   /translation="MDFLKGLLIRVGSTAVAFWLATLLIPGISLDSDSATETVITLVLV
FT                   AVIFGVVNAVLQPIIKTVGCGFYLLTLGLIALVVNGLLFLLTSWIAGEAGLPFHVDGFW
FT                   PEAVLGALFVGIVTWILGAVLDRD"
FT   gene            complement(393418..395220)
FT                   /locus_tag="ML5_0393"
FT   CDS_pept        complement(393418..395220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05945"
FT                   /inference="similar to AA sequence:KEGG:Sare_4443"
FT                   /protein_id="ADU05945.1"
FT                   /translation="MTASTSERPASVPVRTSQWTSRPTARLRAGQIVATQVAAAVLVAA
FT                   AGRGVVPTAVALLSAALLLPAAWVRVRGRWLHEWLVTAAAYVTRRRALPPAADPAALLG
FT                   LLRPGSVVGATEASGGAAVLHDAAGLTALLELGDPDDLLGDHAHELPTPFDLLPPAGPD
FT                   APAIRLQLVFSSSPAPVPAVAGGPAGTSYRQLTDGRVAARARVVLVVQVLRADGWPDED
FT                   LLRALSGTLRRLVRRLGPLTARPLGGDAALRVIAELAHHEPGAPVRETWPLLTVGGLTQ
FT                   ATWRLRRWPDPRGEAARGLVGRLLALPATATTVALTAGPRTGTAPVPAELAVRVAAGSA
FT                   AGLSTAERTLRRIAGDVGGELRRLDGEHLAGLAATLPLAVTGGAASPAGSPPPALDLPS
FT                   ATAGLMVGANRHGAALTVRLFRPATTRVLLVGGVPAAQLLVLRALALGARVVVQTGRPR
FT                   FWEPFVRGVGTVGGGVPLLPPGRPAGGAPGSPLHPLLVVVDAGPVPPEAGPAAAWQSVL
FT                   VVRDELTSADTPALARADLAILQPLDPDEAALAGAALGLGGSAEWLTRIRDDMVAVVNR
FT                   RALRWALLSPTPVESQLVGRPARH"
FT   gene            395454..395783
FT                   /locus_tag="ML5_0394"
FT   CDS_pept        395454..395783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05946"
FT                   /inference="similar to AA sequence:KEGG:Sare_4442"
FT                   /protein_id="ADU05946.1"
FT                   /translation="MTSGMSQTQAEAAVMQQTAAKFEQVDQSLQTMLSGLMAELEVLQQ
FT                   AWRGAGGRSFAQVKQQWAQDQAALQRALRETATAIRSAGRHYDVADTEAAGRVAGTNRG
FT                   IQLPL"
FT   gene            395804..396097
FT                   /locus_tag="ML5_0395"
FT   CDS_pept        395804..396097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05947"
FT                   /inference="similar to AA sequence:KEGG:Sare_4441"
FT                   /protein_id="ADU05947.1"
FT                   /translation="MEHGVLVVNFAALQQAGADIQRALSTLESQLGQLERDAAPLVASW
FT                   NGEAREAYEVRQSRWRAASQDLQAMLRDIKLAVEDSATDYLDTEKRNANLFQ"
FT   gene            complement(396159..397373)
FT                   /locus_tag="ML5_0396"
FT   CDS_pept        complement(396159..397373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0396"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: saq:Sare_4440 peptidase S8/S53 subtilisin
FT                   kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05948"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADU05948.1"
FT                   /translation="MSRPVAYPVVAALATLLVAGVPAAPATARAPAGCASPPAPARPVA
FT                   DQPWPQQRYAPERLTPLATGAGVVVAVVDSGVDRSHPQLAGRVLDGADFLDRSGDGTQD
FT                   CAGHGTGVASIIAAAPQPGVAFRGLAPDARILPVRVSEQQVVDGRESGRTVDAAGFARA
FT                   IRWAVDHDADVLNLSVVLYADDPAVRAAVAYAVRRDVVVVAAAGNLHDNGDPRPYPAAY
FT                   DGVLGVGAIGRDGTRSAFSQTGSYVDVVAPGSEVLMAAPRSGHQRAEGTSYATPFVAGT
FT                   AALLRQYRPRLSAAEVAGLIVAAADPAPGRDAGYGAGVLNPYRAVTESAGATDSRTRPG
FT                   AALPAERPDPAALARQSRRDTARDRALLAAAVAGGAVALVAALALVLPRGARRRWRAAD
FT                   PAVPS"
FT   sig_peptide     complement(397287..397373)
FT                   /locus_tag="ML5_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.915 at
FT                   residue 29"
FT   gene            397526..400750
FT                   /locus_tag="ML5_0397"
FT   CDS_pept        397526..400750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0397"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05949"
FT                   /inference="similar to AA sequence:KEGG:Sare_4439"
FT                   /protein_id="ADU05949.1"
FT                   /translation="MTGWEPATEAEVAMRDALRAQDQQQYFRALTRVDLLLPVANGPTA
FT                   GWGTWTSGGRTHVLAFTSVAALRASLGENAGPTRRVPYPDLAAGWPNPEWWLAVNPGLP
FT                   IEGYLPAWYVAQLSRGDVRLPGRTMGARARLERVENATRGARNAVPEAAPRPAAVPVPP
FT                   AAVTPAPVPSAAVPPAAVPPPLVPPPAVPPPAVPPPVVPTVAGAPGRDERLMKTDEPPT
FT                   VPMRAASVLGRRMPTVPPRRRAPDGDVPSRTAPGTESDADALDGWLTDLRRRPDEPDPF
FT                   TTAPAAPVDEPPDASAPPPSRSFFEPSSGGRSARRPSPLDPSRRAGDRATPPTRFAGGQ
FT                   PFPRRRPLNEPVREGPTHAFPARTDEPSRVPRSEEATQAFRPTRPSEDATEALPRRHAG
FT                   PATAADAGPATAAAADGWETAPGGTEGETTRWETIDEPVEELPPSIAEPVSAPPASRRD
FT                   FTPIVIEGTVIEARDLTEPAPPWSAQPTGPVRAEPAERAATPWAGTTDPTVPLPVDPPV
FT                   ADDTVNLTEPTPAHAGATGATDRSAPRDEPAVSLASESEPTRSLFEPPSPAGEATAPLF
FT                   TPSAPAEPTVSLFDRVPTGPTAPPAGPGEAEPTVSLTTESEPTASLFEPPAPAADATAP
FT                   SPSAEPTVSLFDPAPAEPTVSLFDPVPSESTTSLSDPAPDDPTAPLTSPPAEPTASLSD
FT                   PVPAEQPTVSLFEPATGDEQVTTSLFAPGEPTVALSTQAPDTAGPAASETTDDQPSGDE
FT                   SAAEFVPANDVEEDLLAAAGSGSTDGFLTTLLLARVLLPVAPDSATGSRPGDPGFVWHA
FT                   DQVDGGRCVSVYTSPERLAEHTEGRIETVRVKFVQLIRRWPDVAWSFRVNPGSPVGATY
FT                   PGEQVLALANWAAEVGLGDDPEPAAAPQSAERQRPEAPTTTADRPVTMQKAIAASQLAY
FT                   YLERGYDRVSGFVHRAGELAHLRTPAELYRALGLGHPGSPFSPDDDEIYLLRWPAYRPS
FT                   LYRIPYGGPNEAAMRAMEGWVIERSPFRGNGFAPGESSDVIAEFKVDSARLPHGAELWR
FT                   VGADGDSRLVAVLDTDELLWRKAGEA"
FT   gene            400747..401112
FT                   /locus_tag="ML5_0398"
FT   CDS_pept        400747..401112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0398"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05950"
FT                   /inference="similar to AA sequence:KEGG:Sare_4438"
FT                   /protein_id="ADU05950.1"
FT                   /translation="MSRDGYVARWRGREYQASPDGDDIRLYQPGPDEGFTEVRPGRYVR
FT                   VVPAAEVDDLAYVRTTCTWQGQPFIVLAEHEGWLRLEYTGGRWPVAEAMGLEAFDFGVY
FT                   QGWAPAAEVADLGEQRV"
FT   gene            complement(401114..402046)
FT                   /locus_tag="ML5_0399"
FT   CDS_pept        complement(401114..402046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0399"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: saq:Sare_4437
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05951"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADU05951.1"
FT                   /translation="MTDQRGGPVDESCVLPEGPWTHRFVGANGSRFHVVEAGTGPMVLF
FT                   LHGFPEYWYAWREMLPAVADAGFRAVAVDLRGYGASDKPPRGYDGYTLAADVAGLIRAL
FT                   GERSATVVGTGAGGLIGWTAASFHPTLVRRLVVLGAPHPLRLRAAIFADPRGQFTSATA
FT                   TLKFQLPRYEHVLARDGAAEVEEILRRWGGPRWVSGPDFADYAHCCRVAMQIPQAAFCA
FT                   MEGYRWAFRSVLRLHGYRFVKLMQKPLVTPTLQLHGALDRASLPRTAQGSGRYVTAPYE
FT                   WRLLDDVGHFPHVEARDVVLGEILRWAKS"
FT   gene            complement(402178..402516)
FT                   /locus_tag="ML5_0400"
FT   CDS_pept        complement(402178..402516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05952"
FT                   /inference="similar to AA sequence:KEGG:Sare_4436"
FT                   /protein_id="ADU05952.1"
FT                   /translation="MSDDHQPAASGPASPSGRPTPLSATDLPTLRRPAGPPKRPTDNRP
FT                   TGVVAGWITRGGPGPCYGLMDENGTEYAVYGPNAGELRKGDLVTLRLTARDRSVDCGPG
FT                   IPMRIIEE"
FT   gene            complement(402687..405104)
FT                   /locus_tag="ML5_0401"
FT   CDS_pept        complement(402687..405104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0401"
FT                   /product="M6 family metalloprotease domain protein"
FT                   /note="KEGG: saq:Sare_4435 peptidase M6 immune inhibitor A;
FT                   TIGRFAM: M6 family metalloprotease domain protein; PFAM:
FT                   peptidase M6 immune inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05953"
FT                   /inference="protein motif:TFAM:TIGR03296"
FT                   /protein_id="ADU05953.1"
FT                   /translation="MRKVAVGLLGLSLTATGLVAGTSASAAPTPKLPAAAPSVAEPAQA
FT                   EHDLPNPLEEKRRALRQEGLSEVLSGRAKAQKINGSTVVKVGERAAEGAAAGRSAKSTK
FT                   AGKGPTKDQYVELSRERTDKIFVILAEFGDERHPNYPDQDTDPDTPGPSRFDGPRVNQI
FT                   PEPNRAVDNSTVWQADYSADHFRKLYFGTAPGDESVKQYYEAQSSGRYSVDGEVTNWVR
FT                   VRYNEARYGRSDGYPCASNVCTNTWALVRDAANQWVADQKAQGRSDAEIAADVKAMDEW
FT                   DRYDFDGDGNFNEPDGYIDHFQIVHAGGDQADGDPYQGEDAIWSHRWYAFASDQGNTGP
FT                   ENFPAGGTQIGNTGVWIGDYTIQPENGGRSVFYHEYGHDLGLPDDYNVVSGGDNNNEHW
FT                   TLMAQSRLGAKNDGGIGERGGDLGAWNKLQLGWLDYEVVVAGQKRTLELGPQEYNSNKA
FT                   QAAVVVLPQREYTFQNGKPFEGTKQFFSGNDDDLNNTMTRTVDLTGKTSAALSMKGRYS
FT                   IEADYDYLFFEASTDGGQTWTSLAGTANGTPLKEISPGRYALDGSSNDQWVDVNIPMDA
FT                   VAGNVVQFRLRYQTDGGVSEGGFYGDAITVTADGQTVLTDGAEAGANGWTLSGFSIVEE
FT                   TYTRKFDNYYIAGNRSYVSYDKYLKTGPYFFGYANTRPDYVDHYAYQEGLLISYWNLRF
FT                   ADNDTFAHPGEGRNMIIDAHPRPIYNLTGQPWRARVQVYDAPFSLKKADSFTLHLNSQP
FT                   QYIRGQAAQPLFDDTKQYWYPELPNHGVKLPATGTKIKVLEQNGTSVKVRFS"
FT   sig_peptide     complement(405024..405104)
FT                   /locus_tag="ML5_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.977 at
FT                   residue 27"
FT   gene            complement(405446..408238)
FT                   /locus_tag="ML5_0402"
FT   CDS_pept        complement(405446..408238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0402"
FT                   /product="M6 family metalloprotease domain protein"
FT                   /note="KEGG: tbi:Tbis_2142 M6 family metalloprotease
FT                   domain-containing protein; TIGRFAM: M6 family
FT                   metalloprotease domain protein; PFAM: peptidase M6 immune
FT                   inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05954"
FT                   /inference="protein motif:TFAM:TIGR03296"
FT                   /protein_id="ADU05954.1"
FT                   /translation="MLPMSQHRARRRLLVALPAIALAATSLTVTGSAAAQPARSAPVTI
FT                   GADEHYINYAEPEVQPDTGGKEVKGRDGVFSSPADEARAYDRKYAGGNPIAARELAKLE
FT                   AKSIRTGHSPRKIKKAKSTQTAKLLTLLVEFNDKANDDFTDVMVPKTVFEDRTCVPGTV
FT                   QNGPRHNTIPNPATLPHKDNNSMWVPDFSPAHYDKMLYSKKGITERVRKDLKGPDGKPG
FT                   ISLAGRTMHNMYLEMSKGAYTVDGQASPWITVPHSEGWYAASRCFQDENGNWVAGREQS
FT                   MNGHPDNPQGAGRLATDAIDALAAADPNFPWADYDIEDQSDRDGDGNYHEPDGVIDHLV
FT                   LVHANQGKSRGGGDVGIYSVWAHSSTVTGGYTIPGTNLKVSNYIVQPEDAGVGVFAHEF
FT                   GHDLGLPDLYDTSGNADSDVDFWDLMASGSHSGEIFQALPTHMGLWDKWVLGWAEPKTF
FT                   GPGDRSKLVKLGQTSRTPVGTEDGIKIDLPDKVISLATPHSGSNMWYSGADQNWADVKL
FT                   SRTVTVPNAADAKFWMWNNYVIEADWDFGFVEVSTDGGATWSEQKVYAEGGALVSTNDG
FT                   YADPNGRMVDFGNKKYGLTGSTNGWRHDYVDLSSYAGQTVQVRLRYATDEAFVERGWFA
FT                   DDFSVTGGGATTWSDDVESGAAGWTQTGGTFTDTSGAGWYIDSGTQVKSHYYLAEWRNF
FT                   DGFDKGLKYTYDTVYSHEAWKVDRIAYNAPGMLVWYRDTQLGDVNHVTAQMTALPSYGA
FT                   KGGLLIVDSHNDPLRRKGVAAEKDPSVLKNLPSRPQSSNAAFGLKPTYPFKECLEAADE
FT                   PYSEYCTKFGPQAPVRGFTDAKGWYPGIEIRDGAAYARDNDASVVVPSRGNQQYTTRVV
FT                   NPDGTPATDYYGSTLGGGAIVLGTGNPGDAGVQYGVSIIIKRAAKDNSYATVYVVPPRS
FT                   "
FT   sig_peptide     complement(408131..408238)
FT                   /locus_tag="ML5_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.676 at
FT                   residue 36"
FT   gene            complement(408462..410450)
FT                   /locus_tag="ML5_0403"
FT   CDS_pept        complement(408462..410450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0403"
FT                   /product="acetate/CoA ligase"
FT                   /note="KEGG: saq:Sare_4434 acetyl-CoA synthetase; TIGRFAM:
FT                   acetate/CoA ligase; PFAM: AMP-dependent synthetase and
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05955"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ADU05955.1"
FT                   /translation="MSEALANLLNETRQFPPPAELAANANVTAEAYEEAAGDRLAFWER
FT                   QAGRLAWAQPWEQVLDWSNAPFAKWFTGGRLNVAYNCLDRHVEAGLGDKVAIHWEGEPG
FT                   DTRTVTYADLHKLTCQAANALTELGVTAGDRVAIYLPMIPEAAVAMLACARIGATHSVV
FT                   FGGFSADALTNRIQDASAKVVITADGGFRRGKPSALKPTVDEAVANCPSVEHVLVVRRT
FT                   GEEVAWSAKDHWWHETVETASPEHEAQAFDAEHPLFILYTSGTTARPKGILHTTGGYLT
FT                   QTSYTTHAVFDLKPETDVYWCTADIGWVTGHSYIVYGPLSNGATQVMYEGTPDTPHKGR
FT                   FWEVVDKYKVTILYTAPTLIRTMMKWGEDIPAGYDLSSLRLLGSVGEPINPEAWIWYRQ
FT                   HVGRGELPVVDTWWQTETGAIMISPLPGVTEAKPGSAMSPLPGIVADVVDDQGQSVPNG
FT                   GGGYLVLKEPWPSMLRTIWGDDNRFLETYWSRFGAGANTGDEWVYFAGDGAKKDDDGHI
FT                   WLLGRVDDVMLVSGHNISTTEVESALVSHPSVAEAAVVGATDPTTGQAIVAFAIPRGSA
FT                   EISGDAGEQLIAELRNHVAKTLGPIAKPRQIMLVPELPKTRSGKIMRRLLRDVAENRSL
FT                   GDVTTLQDSSVMELISSGMSGGKSDED"
FT   gene            410673..411419
FT                   /locus_tag="ML5_0404"
FT   CDS_pept        410673..411419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05956"
FT                   /inference="similar to AA sequence:KEGG:Sare_4433"
FT                   /protein_id="ADU05956.1"
FT                   /translation="MTTDPLAPLLALADVATAVEQARERVDLAHRHRALRRQGGQVAAE
FT                   VSLRSAVASAALEGRVHDREEVRAGTVTDPVLQGALRVAGALPGLSDLWPKAPRQVMAR
FT                   LHVLAARDVVTEEELGRPVADPVVAARLDGLAALVAGGTKVPPLVLAAVVHGELLNLRP
FT                   FPGPSGVVARAAARLVLISTGFDPRGLVAVDVGHREREPEYVGAAGAFATGTPDGLRSW
FT                   LRHYMKAVEVGADQITLIGDEILAAS"
FT   gene            complement(411433..412239)
FT                   /locus_tag="ML5_0405"
FT   CDS_pept        complement(411433..412239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0405"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); KEGG: saq:Sare_4432 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05957"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ADU05957.1"
FT                   /translation="MGRSAAFFDLDKTVIAKSSALAFGRPFYRDGLITRRDVVKSAYAQ
FT                   LMFRLGGTDEQTMARTRDYLATLCKGWPVEQVRQIVAETLHELINPYVYAEAAALIEEH
FT                   QAAGRDVVLVSASGDEMVRPIGELLGITDVIATRMGVVDGRYSGEVEFYAAGPSKVEAV
FT                   SELALERDYDLADSYAYSDSYSDRPLLECVGHPTVVNPDRALRKLAVENAWPVLEFRHP
FT                   IPLGRRLRERPAVPVAAAALGVGVGVAIGIAWYGRHRRTRAAAPTA"
FT   gene            complement(412573..413541)
FT                   /locus_tag="ML5_0406"
FT   CDS_pept        complement(412573..413541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0406"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   sti:Sthe_3261 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05958"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADU05958.1"
FT                   /translation="MIDKPDIDERLLAAEVAAAWSVDVVDLAFMPVGLDGHAWAYRVET
FT                   SDGGRCFLKVRRGDFTPAAVLLPGFLRTQGLRQVVAPLDLRLDGGVARRFGDYRLLLYP
FT                   FQDGDSLWGRGLTDRQWTEYGDFLGRLHRVTPSAEVAAVLPVETYRSSAGDRLRTLGGQ
FT                   AATSEVLGAFWKRYGAALRRLAETVDDLASRVTPGQHVICHADIHPGNLIADGDGPLHV
FT                   VDWDAPILAPRERDLMFVHSADFGDHPINAHRAELFREGYGALEPDPVLLSYYRGERHL
FT                   DDVAAFLGSILGPEASAESRANDLHWLIRIAEAVADPGYAP"
FT   gene            complement(413584..414279)
FT                   /locus_tag="ML5_0407"
FT   CDS_pept        complement(413584..414279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_1398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05959"
FT                   /inference="similar to AA sequence:KEGG:Sare_1398"
FT                   /protein_id="ADU05959.1"
FT                   /translation="MTDSPHPLTPPSVRPHSRSAPTAGGEIWLRDPSPTLLAAIAIGLV
FT                   VVVLASIVSVFATPRRPDLPPPLEGQAILASPTRAGSVTETPAESYAPPSVSFSSRAVA
FT                   PSRTAAPTRRPTPSSRPTSPKPSIPRSKPPVVGPGELAPLPASRESRLRSHGGGPSTFI
FT                   DFVNSHGSTVVVHWINYDGRRQQYAVLRPGQSYRQQTYVGHPWVVADERGRGLVCFEPD
FT                   RQTLRAVIR"
FT   gene            414527..415630
FT                   /locus_tag="ML5_0408"
FT   CDS_pept        414527..415630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05960"
FT                   /inference="similar to AA sequence:KEGG:Sare_4422"
FT                   /protein_id="ADU05960.1"
FT                   /translation="MPPRTPLPPYRRLPLLVTSDGDLLDELLRLAAAGGTEVELAADPA
FT                   AARARWAPAPLVLIGADQAAACLRARLPRRARTVLVGRSGELDPGTELAELIGAEHVAT
FT                   LPAAEPWLVDRFAECVAGPAGPDQGRVVAVLGGRGGAGASVLAGGLAVSAARSRLRTLL
FT                   VDADPLGGGLDLVLGWEQLDGLRWPELAGTDGRVDPPSLIRALPSRGDLVVLSWDRGDL
FT                   RHLPAEAMAATVDAGRRGRDLVVLDLPRHLDDAAVVALQAADRALLVVPAELRAAAAAA
FT                   RVAAVAAPHCVDLSVIVRGPAPGRLRAAEVSRALGLPLAGTLRPEPGLCRGLERGEAPG
FT                   ASGKGPLAALCQRIVDELVGSPAAGAA"
FT   gene            415627..416838
FT                   /locus_tag="ML5_0409"
FT   CDS_pept        415627..416838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0409"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   saq:Sare_4421 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05961"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADU05961.1"
FT                   /translation="MTAPADPGELAARVRHRFAAEATPVTPAAIVSAVRAEPATAVLGD
FT                   TTLLRIADRVHDDLVGAGPLAPLLADPQVTDVLVNGVRVWVDRGRGLRQVAVPLGTLDD
FT                   VRRLAQRLTSAAGRRLDDASPYADARLPDGTRLHAVLPPVATDGPYLSLRTFRQRPFTL
FT                   DELVERGTVPRPIAPLLAALVEARLAYLVSGGTGSGKTTLLNTLLGLVPGTERIVLVED
FT                   AAELRPVHPHVIGLQARTANVEGAGAVGLGDLVRQALRMRPDRLVVGECRGAEVVDLLA
FT                   ALNTGHDGGAGTLHANAPADVPARLEALGMLGGLPRLALHAQVAAALQVVLQLRRTGEG
FT                   RVLDSIGLLLPDGPDRVVTVVPAWARGRGLAPAALLLAGLLRERGAPVPPILQAAWPGP
FT                   AEPS"
FT   gene            417180..417743
FT                   /locus_tag="ML5_0410"
FT   CDS_pept        417180..417743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05962"
FT                   /inference="similar to AA sequence:KEGG:Sare_4420"
FT                   /protein_id="ADU05962.1"
FT                   /translation="MAALCGAVTGALLGGPVAALVLATYGVLAARAVLRRRTHRTATLA
FT                   HRRDLDRLAAVAADLRAGLPVDGGVDDGPGRVARLARAAGRLADQTGAPLADLLERIEA
FT                   DARAADRGLAAAAAQAAGARATAWLLAALPLGGIGLGYGIGVDPVAVLLHTPVGAGSAV
FT                   AAVVLQVGGLLWAERLGVTPGRAA"
FT   sig_peptide     417180..417239
FT                   /locus_tag="ML5_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.651 at
FT                   residue 20"
FT   gene            417743..418471
FT                   /locus_tag="ML5_0411"
FT   CDS_pept        417743..418471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0411"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   stp:Strop_4037 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05963"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADU05963.1"
FT                   /translation="MSRQVLAAVCLGGAASLLVVAGPVVRPARRLRRLAPTPPPTRPAW
FT                   WPDRVRLGAALAGIAVAVVVGGVTGVFLGLLAGAAADRLLRRIEPRAARERRLRETADL
FT                   PLAADLLAAALRAGAPVDRSVLAVAEALGGPLADRLGRVGRTLRLGGSPGEAWAHLEGV
FT                   TGAEPVVAAAVRSSNSGAALARALTRLADDLRAERSTSAEAAARRAGVLIVLPLGLCFL
FT                   PAFILAGLVPVIVAVLGDVL"
FT   sig_peptide     417743..417808
FT                   /locus_tag="ML5_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.987 at
FT                   residue 22"
FT   gene            418495..418662
FT                   /locus_tag="ML5_0412"
FT   CDS_pept        418495..418662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05964"
FT                   /inference="similar to AA sequence:KEGG:Strop_4036"
FT                   /protein_id="ADU05964.1"
FT                   /translation="MRKLLTRLRGDAGMNTAEYAVGTLAAVAFAGILLKVLTSGNVQSA
FT                   LTAVIDRALK"
FT   gene            418725..419153
FT                   /locus_tag="ML5_0413"
FT   CDS_pept        418725..419153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05965"
FT                   /inference="similar to AA sequence:KEGG:Strop_4035"
FT                   /protein_id="ADU05965.1"
FT                   /translation="MSTEPGSTRDAVGTRAGEVRRRWRSWVACERGSFTAELAAGLPAL
FT                   MLLLVAGLTAVNAVGTRVACVDAAREAALAAARGEPGTVAATRYAPDGAEVSVTVTGDR
FT                   VTATVRAPVRTFGTRLPRLVVSAEAVAAVEPGAPGPVP"
FT   gene            419324..419644
FT                   /locus_tag="ML5_0414"
FT   CDS_pept        419324..419644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0414"
FT                   /product="Helicase/secretion neighbourhood TadE-like
FT                   protein"
FT                   /note="TIGRFAM: Helicase/secretion neighbourhood TadE-like
FT                   protein; KEGG: saq:Sare_4416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05966"
FT                   /inference="protein motif:TFAM:TIGR03816"
FT                   /protein_id="ADU05966.1"
FT                   /translation="MCLLAIGMVFVLVGVFGAAVGAARCARHQARNAADFGALAGAVQV
FT                   LDGAGVACARAADLVSANGGRMTGCRADGLDLIVTARVRVAPLPGLARDAVATSRAGPA
FT                   RS"
FT   sig_peptide     419324..419392
FT                   /locus_tag="ML5_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.347 at
FT                   residue 23"
FT   gene            complement(419699..420277)
FT                   /locus_tag="ML5_0415"
FT   CDS_pept        complement(419699..420277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05967"
FT                   /inference="similar to AA sequence:KEGG:Sare_4415"
FT                   /protein_id="ADU05967.1"
FT                   /translation="MSPDNLQAQHRFIIRQRLRMMVNQYEVHSVAPDGSEGGLLAFAQQ
FT                   KRLAFKEQVTIYTDDSKQYPLLGFKARQRLDLGATYDVTDHAGNPIGLFRKDFAQSLLR
FT                   STWHVEQPGLPPATGQERSLPVALLRRFVDSLSWLPYHFDFMAGGQPVFSVDRKWGLRD
FT                   RYNVEIQHPQIDRRLVIAMAVGLDALQSR"
FT   gene            complement(420479..420685)
FT                   /locus_tag="ML5_0416"
FT   CDS_pept        complement(420479..420685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0416"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: maq:Maqu_1039 23S rRNA m(2)G2445
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05968"
FT                   /inference="similar to AA sequence:KEGG:Maqu_1039"
FT                   /protein_id="ADU05968.1"
FT                   /translation="MADTIAETVELLYTIDQENLTPDQQIALGTAMATLAQAERLEQIN
FT                   ERLRGIHQVLNSWAMKATVDGGR"
FT   gene            complement(420942..423419)
FT                   /locus_tag="ML5_0417"
FT   CDS_pept        complement(420942..423419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0417"
FT                   /product="Protein of unknown function DUF1998"
FT                   /note="KEGG: saq:Sare_4414 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: Protein of unknown
FT                   function DUF1998; DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05969"
FT                   /inference="protein motif:PFAM:PF09369"
FT                   /protein_id="ADU05969.1"
FT                   /translation="MTDHSPGPRRAPGELLRRLRLRHPTDPVTHVERVPARAGEPVGWP
FT                   GWAPEELRAAFARRGVTAPWRHQAEAAELAYAGRHVVVATGTASGKSLAYQLPALSTLL
FT                   ADPRATVLYLAPTKALAADQLRAVAGLELDGVRPATYDGDTPRAEREWIRRHSRFVLTN
FT                   PDMLHHGILPGHAHWSGFLRRLAYVVVDECHTYRGVFGSHVAHVLRRLRRQCARFGRTP
FT                   VFLLASATSGDPATAAGRLTGLPVTAVTEDTSPRGGVTFALWEPPLLPPTESSVDADLV
FT                   QVRRSALRETADLLADSVVEGVRTLAFVRSRRGAEVVAANARRSLDEAVPGLGDRVAAY
FT                   RAGYLREERRELERALLHGDLLGLASTNALELGVDLVGLDAVLICGWPGTRASLWQQAG
FT                   RAGRSGDEALAVLVARDDPLDTYLVHHPEALFGRPVEATVLDPANPYVLAPQLACAAHE
FT                   SPLTPADLDLFGEGAKEAVDSLVEAGALRQRPTGWYWRHRERPEVDLRGEGGAPVCVVE
FT                   ESTGRLLGTVDGGSAHFLLHTGAVYLHQGVSYVVDSLDLTDGCALVHAEEPDWSTHARD
FT                   VTSLSVVSVRSYVDAGPVGLFLGEVDVTSQVVSYQRRRIATGEVIDTRPLDLPARELRT
FT                   VAVWFTLSPESLTAAGVEAADVPGALHAAEHAAIGLLPLMATCDRWDIGGLSTALHPDT
FT                   EAPTVFVYDGHPGGAGFAERAYGTAAAWLRATRDAIAECGCETGCPSCVQSPKCGNGNN
FT                   PLAKAEAVKVLDVVLTNLATAGGEAAVAGPEAVTGPEAVTGPGSGGPERGEVLPRQDDR
FT                   AARPAQAAGAPPA"
FT   gene            423553..423903
FT                   /locus_tag="ML5_0418"
FT   CDS_pept        423553..423903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0418"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: saq:Sare_4413 anti-sigma-factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05970"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADU05970.1"
FT                   /translation="MELSLATRAVGEHTVLEVGGEVDVYTAPRLRERLLELIDGGARHV
FT                   VVDLGRVDFLDSTGLGVLVGALKRLRSAGGSFALVCDKEPLLKIFRITALDQVFPLHPT
FT                   VDAAIAADSTGA"
FT   gene            423903..424340
FT                   /locus_tag="ML5_0419"
FT   CDS_pept        423903..424340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0419"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: saq:Sare_4412 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05971"
FT                   /inference="similar to AA sequence:KEGG:Sare_4412"
FT                   /protein_id="ADU05971.1"
FT                   /translation="MATVKLSFSPAPVHVRTARLVGVAVARRAGVREDLLDEVRLAIGE
FT                   ACTRAVALHRQYGLADPVYVEMSDGGGYTVRVVDRAPIEAGLGLAALGPDELAKESLSE
FT                   DALTTGVGFALLAGFVEDLQVRPVDDGVGTEVRMSWPAGRA"
FT   gene            424662..427010
FT                   /locus_tag="ML5_0420"
FT   CDS_pept        424662..427010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0420"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="TIGRFAM: V-type H(+)-translocating pyrophosphatase;
FT                   KEGG: saq:Sare_4411 membrane-bound proton-translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05972"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ADU05972.1"
FT                   /translation="MSGTLAADGGALSLTGANVTYVVIAAVIALVALVFAAALTRAVLA
FT                   AGKGTTNMQEISGAVQEGASAYLLRQFRTLAIFVVIAVVLLFLLPVHDTDGNETLVKAG
FT                   RSAFFVVGALFSAFIGGAGMWLATRANLRVAAAAREREGGREAAMKIAFRTGGVVGFLT
FT                   VGLGLFGAALVVLIFRGDAPTVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVE
FT                   QGIPEDDPRNAATIADNVGDNVGDCAGMAADLFESYAVTLVAALILGRAAFGETGLVFP
FT                   LIISTIGVLVAIVGVFITRLRASDRNGLTAINRAFYLSALIAAVLVAIAAFAYLPATFA
FT                   ELEGGLTDVDRNPRLVAIGAVVIGIVLAAAIQALTGYFTETNRRPVQDIGKSSQTGPAT
FT                   VILAGISVGLESAVYSALLIGAGVFGAFLLGGSSITLSLFAVALAGTGLLTTVGVIVAM
FT                   DTFGPISDNAQGVAEMSGDIDEHGARTLTELDAVGNTTKAITKGIAIATAVLAATALFG
FT                   SYTDTLRSAYEDAGVGDVGTEILNSLNVSNPRNLVGLIIGAAVVFLFSGLAINAVSRSA
FT                   GAVVMEVRRQFRELPGIMDRTQRPEYGKVVDICTRDAQRELMTPGLLAILAPIAVGFGL
FT                   GPGALAAYLAGAIGAGTLMAVFLANSGGAWDNAKKLVEDGAYGGKGSDAHSATVIGDTV
FT                   GDPFKDTAGPAINPLIKVMNLVSLLIAPAVVAWSVGDDKNPALRITIAVVAALIIAAAV
FT                   VFSKRKGVAMTDEDSGAGTPDQRPETVNA"
FT   gene            427112..427654
FT                   /locus_tag="ML5_0421"
FT   CDS_pept        427112..427654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05973"
FT                   /inference="similar to AA sequence:KEGG:Sare_4410"
FT                   /protein_id="ADU05973.1"
FT                   /translation="MRTRRAATAGKLTVVLATLVLVVAGCGGGPNPRVWAASVCQALTP
FT                   WRAEISKLTSSTQQQMTAQTTPAQAKENLVRLFAGAEQASETARRKVEEAGVPEAERGA
FT                   EVSAGFLGSLSKMRDAYGRARSAIDRLDTAQAGPFYDGVRAAVGTLNKEYDASALDTSK
FT                   LNSTELKEAFDEVPECR"
FT   sig_peptide     427112..427222
FT                   /locus_tag="ML5_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.758 at
FT                   residue 37"
FT   gene            427645..428253
FT                   /locus_tag="ML5_0422"
FT   CDS_pept        427645..428253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05974"
FT                   /inference="similar to AA sequence:KEGG:Sare_4409"
FT                   /protein_id="ADU05974.1"
FT                   /translation="MSLTPPTPKPARQPSLFSTEAADPALADLAGLLAGPGEVGRMGGT
FT                   ARISVVVDAAWRVHVLVAELGARGVPASWEPTEDGRHRVRTAYTSMLAPLARAWLRGAV
FT                   KRPPARFHLDGRRLRLWAAAAGTAEPAGFRLRLGPADEQSWPVVRAALAAVGLPAAFVE
FT                   PDEGGPAFRIGGRRMSRLAELVGERPATAPVADWPGSRG"
FT   gene            428522..431338
FT                   /locus_tag="ML5_0423"
FT   CDS_pept        428522..431338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0423"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain-containing
FT                   protein; TIGRFAM: DNA topoisomerase I; KEGG: stp:Strop_4027
FT                   DNA topoisomerase I; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05975"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ADU05975.1"
FT                   /translation="MPSNAGTTRLVIVESPAKAKTISGYLGPGYVVEASFGHVRDLPRN
FT                   AADVPAKYKGEPWARLGVDVDNGFHALYVVSPDRKQQISKLVKLAKEVDEIFLATDEDR
FT                   EGEAIAWHLVETLKPKVPVKRMVFHEITKPAIQAAVANPREIDRDLVDAQEARRILDRL
FT                   YGYEVSPVLWKKVMPKLSAGRVQSVATRIVVERERQRMAFRTAEYWDILATLAVAKPGE
FT                   GPRTFNATLVALNGDRIATGKDFEPTTGRVRAGAGVVHLDEGGARGLAARLADQPFTVT
FT                   RVEEKPYRRRPYAPFITSTLQQEAARKMRFSSQQTMRTAQRLYENGYITYMRTDSVNLS
FT                   ETAIAAARRQIVELYGERSVPPEPRRYTGKVKNAQEAHEAIRPAGDNFRTPGEVAKELS
FT                   AEEFKLYELIWRRTIASQMTDAVGSSVSVRIRAVSSAQEEADFGATGKTITDPGFLRAY
FT                   VESSDDENAEAEDAERRLPTLVKDQPLTADELAAQGHHTQPPSRYTEASLVKALEELGI
FT                   GRPSTYASIMQTIQDRGYVVKRGQAMIPSFLAFAVIGLMERHYPRLIDYDFTASMENEL
FT                   DEIAGGDHAAVDFLTSFYFGSTNGTGDQAIAHAGGLKKLVTENLSEIDARSVNSIPLFT
FT                   DDEGREVVVRVGRYGPYLQRALPGEQQAPTPAPAAPGEGEESGSQGDRAPIPEGLAPDE
FT                   LTPEKVHELFLGGGGERKLGDDPSTGEPIVLKSGRFGPYVASGERKSSLLRSQTPDSLT
FT                   LEQALQLLRLPRLIGVAPDGVEVFANNGRYGPYVKRGDEFRSLDSEDKMFTVTLDEALA
FT                   LLAAPKTRQRRAAAPPLREMGNDPLTEKPLVIKDGRFGPYVTDGEFNASLRRGQTPEEL
FT                   TLEQASEMLAEKRAKGPAPKKKAAKKAAPAKKTTAAKKTTAAKKTTAAKKAPAKKAAPK
FT                   KATSTPNE"
FT   gene            431460..432392
FT                   /locus_tag="ML5_0424"
FT   CDS_pept        431460..432392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_2602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05976"
FT                   /inference="similar to AA sequence:KEGG:Xcel_2602"
FT                   /protein_id="ADU05976.1"
FT                   /translation="MRRALPSDDADELTWLLFRQEDVLSLQQARAHLTRRAIRHRVTTG
FT                   RWRQAHRAVLVAHNGPVGPAQLRWIAVLAAGPTALLGGMTAAQAGGLRGFSERVVHLLL
FT                   PATTRRSPLPAGVLAHRTTHLPDSDVVPVAAPPRTAAARSIVDAAQWAPTDTRARAIVA
FT                   AAFQQRLVGGDDVHEVVERMPRVRRRRLILSTATDAAGGAHSLGELDLLGLVRRAGLPE
FT                   PSRQVVRRDSAGRRRYLDAYFEQWRVHVEVDGGQHLDPAHAWADMRRQNDLWVEGDRVL
FT                   RFPAWVLRARPEEVIAQLRAALRAAGWPG"
FT   gene            complement(432453..433760)
FT                   /locus_tag="ML5_0425"
FT   CDS_pept        complement(432453..433760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0425"
FT                   /product="FAD-linked oxidoreductase"
FT                   /note="KEGG: saq:Sare_4407 FAD-linked oxidoreductase;
FT                   TIGRFAM: FAD-linked oxidoreductase; PFAM:
FT                   D-arabinono-14-lactone oxidase; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05977"
FT                   /inference="protein motif:TFAM:TIGR01679"
FT                   /protein_id="ADU05977.1"
FT                   /translation="MTGTTATWSNWAGNQHSTALLTVRPRSVSDVVEAVRQAAAAGRTV
FT                   RATGSGHSFTATAVADGHRIDLAELETDVTVDVARRLVTVPAGMTLHTLNDLLAGHGLA
FT                   MPNLGDIDAQTIAGALSTGTHGTGAKLGCLSTFVAGLTLVTGTGEVLRCSAEENRDVFD
FT                   AARVGLGAVGVLVEVTLRCVDAFVLRAHERPAPLAEVLDDLPGLYDAHDHAEFYWFPYT
FT                   DRVQVKTNDRVPADDRPLPRWRGWLDDEFLSNTVFAGACRLGRAVPALAPRISAVSARA
FT                   LTERTYTGRSDRVFCTPRRVRFVEMEYGLPREALPTALAELRRIVDRLPFKVLFPVEVR
FT                   FTAADDIWLSHSYGRDSAYIAVHQYVGMPYEPYFRAFEQVATELGGRPHWGKLHWRTAE
FT                   SLASAYPRFADFQSVRARLDPHNLFQNPYLTQVLGA"
FT   gene            433989..434564
FT                   /locus_tag="ML5_0426"
FT   CDS_pept        433989..434564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0426"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: stp:Strop_4025
FT                   regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05978"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU05978.1"
FT                   /translation="MLDACAELVDEVGYEGLTTTLLAERAEVAIGSVYQFFPDKRAIVQ
FT                   ALTLRTMESYLQRLDERFSSDDLTHWWDGVDAAIDEYISMHRTVPGFRTLHFGDVVDLH
FT                   LLDDQRDNNGVIAEQLARVLTERFGLAGVPDLRFHLEVAVEAADALIKLAFRRRTDGDE
FT                   RVLVEAKALIREYLHRQVNAPTEVAHQG"
FT   gene            complement(434644..435852)
FT                   /locus_tag="ML5_0427"
FT   CDS_pept        complement(434644..435852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0427"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   saq:Sare_4405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05979"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADU05979.1"
FT                   /translation="MAIDRDKLRDRLDRATAHLDPPYAVVDLTAFDANAEALVGRSGGK
FT                   PLRVASKSVRVRELLTRALKRPGWHGVMAFTLPEALWLVRSGVSDDVLVAYPTAHRGGL
FT                   ADLAADPALADAVTLMVDDTAQLDLIDRVCPPAGRPALRVCLDLDASWRPLGGRVHVGV
FT                   RRSPVHSATAAGALAAAVAGRPGFRLVGLMSYEAQIAGLGDAPPGQAMLGSAIRVAQRG
FT                   SYRELLARRSAAVGAVREHADLEFVNGGGTGSVAATSADPAVTEVTAGSGLYGPTLFDA
FT                   YRAWRPTPAAFFACAVVRRPAPGLATVLGGGWIASGQAATSRLPRPWLPDGLKLLGAEG
FT                   AGEVQTPLAGKAADGLRVGDRVWFRHAKAGELCEHVNEVHLVEGDAVVATVPTYRGEGH
FT                   AFL"
FT   gene            436070..438223
FT                   /locus_tag="ML5_0428"
FT   CDS_pept        436070..438223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0428"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: saq:Sare_4404
FT                   dTMP kinase; PFAM: thymidylate kinase; major facilitator
FT                   superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05980"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADU05980.1"
FT                   /translation="MSSGTAADHSGVAAIRSVLRIRPFRRLWIVLSAASFGDWLGLLAT
FT                   ALFAASQVSGSTAQGAAFGGVTAIRLLPALVLGPVAGVLADRFDRRWTMVICDLLRFVL
FT                   FASIPLYALTGAAGGLVVGWALIATFLIESITLLWIPAKEAAVPNLIPRTRLEAANQLT
FT                   LITTYGLTPVAAAVALAVLTRGLPGAFGGDLPNWAEPAQLALWFNAFSRLATALVVAFG
FT                   IKEISEAQRGEAERTEQSMFRQFSEGWKYIGQTPLVRGLVLGIFGAFAGGGIVVGTGKF
FT                   FANSLGAGDAAFSLLFGAIFVGLALGIGLGPMIVRDMSRRRWFGMSIVLASASVLVLAF
FT                   AIHLSMAILGAILVGAGAGMAFLAGTTLLGGEVADEVRGRVFAVVQIGTRLVLILAIAL
FT                   SSLLVGVGSSRQLTIADLGISISSTRLLLLAAGAAGIIAGISAFGQMDDKKGVPVLADL
FT                   WGSIRGRPLMPAEPFVSSGLFVVFEGGEGAGKSTQLAELAERLRAQGRDVVVTREPGAT
FT                   PVGKRIRSLVLGTNPGEAPSPRAEALLYAADRAHHVATVVRPALVRGAVVISDRYVDSS
FT                   LAYQGAGRTLPVDEVSWLSSWATGGLKPDLVVLLDVEPRTGLSRVEDRNEGTDRLEAES
FT                   LTFHERVRYAFLDLAAGDPKRYLVLDASRPIDETADAVARRVGELLTDPAGIVHPRPAQ
FT                   GPDTSVQPELSDAELVTMEQPRR"
FT   gene            438220..439491
FT                   /locus_tag="ML5_0429"
FT   CDS_pept        438220..439491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0429"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /note="KEGG: saq:Sare_4403 DNA polymerase III, delta prime
FT                   subunit; TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05981"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADU05981.1"
FT                   /translation="MTDVFGDLVGQDEAVAMLRRAAASAAALLRAPVTSPAGGHDDLDA
FT                   LAEEHDGDPGPAAPADPGGGMTHAWIFTGPPGSGRSVAARAFAAALECVHGTGCGTCPG
FT                   CHTTLAGTHADVRLVVPEGLSIGVGEMRALVLRAASAPSGGRWQIVIIEDADRLTEAAG
FT                   NALLKAIEEPPPRTVFLLCAPSTHPDDISVTIRSRCRVVPLRQPPPAAVAEVLVRRDGV
FT                   APDVAEWAAAAAQGHVGRARRLARDPEARQRRDAVLAVPRRLTGVGAAFDAASALIEAA
FT                   EAEAAASVAEIDEAERTALQTALGAGGTGRGAAGAMRGAAGQLKDLEKRQKSRATRAQR
FT                   DALDRALVDLAGFYRDALTMAWRAPVAPVHTDTASLAGAGAQKWDAEGSLRRLEAVLEC
FT                   RAAIEANVKPRIAVEAMMLALWRG"
FT   gene            439625..439954
FT                   /locus_tag="ML5_0430"
FT   CDS_pept        439625..439954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05982"
FT                   /inference="similar to AA sequence:KEGG:Strop_4021"
FT                   /protein_id="ADU05982.1"
FT                   /translation="MPRGEIDEAWIEEAVRRYRRIENLQAEFDQAVATVEVTVRSPDGL
FT                   VEVVVTAGGRITDVRFLGPLHHRSPRDVAGSVQAAVTAAADAAQWAREKLHNETFAAYR
FT                   PLAGA"
FT   gene            439956..440261
FT                   /locus_tag="ML5_0431"
FT   CDS_pept        439956..440261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05983"
FT                   /inference="similar to AA sequence:KEGG:Sare_4401"
FT                   /protein_id="ADU05983.1"
FT                   /translation="METLRALAARLDEAGATLATLSRTVTATDPPHPAFGAHAAGRPGE
FT                   VGRALHRQWTVATADRAREAQAAAVRLAAAAAALRSAADRYAAADDAVARRLAREA"
FT   gene            440261..440929
FT                   /locus_tag="ML5_0432"
FT   CDS_pept        440261..440929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05984"
FT                   /inference="similar to AA sequence:KEGG:Sare_4400"
FT                   /protein_id="ADU05984.1"
FT                   /translation="MDALDRLAEPGLDLLGRVDTLLAAGAPEGHRLWPLLRRMQVLPGA
FT                   AVREFLDLHPAPLTGAGHAVRRLVRGYDDTCALLADQVAWSGAAASAYDEARAALMRHL
FT                   DEGPDSLVGRLESTAGYADALAGWVEGSRAALARALAEVLGSAEAVAVHAATRPGAEAG
FT                   RAGASAAAEIATRVLGVLGVAYDGAETLLRQWGPSLAETPWRDRATTAPRYGGTTRIGY
FT                   "
FT   gene            441190..442032
FT                   /locus_tag="ML5_0433"
FT   CDS_pept        441190..442032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0433"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: saq:Sare_4399 PSP1
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05985"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADU05985.1"
FT                   /translation="MGMLCAVSFNRYGRLYYLDPGELRPQVGDRVLVPTDEGPEVAECV
FT                   WAAQWVSEDTDSFPKLAGIAGDDDLRRDEMLRRRKAEAKVAAKRLIREHGLPMKVVAVD
FT                   HVLATPENGSDRTTIYFTAPHRVDFRSLVRDLGATLHCRVELRQLSARDSARVQGGIGS
FT                   CGRDLCCATFLTDFEPVTIRMAKDQDLPLNPLRISGACGRLMCCLKYEHPLYQKFQESA
FT                   PAVGSRVSTPQGEGKVVGHSVPRDAVTVRLDADGSRSMCSRASVCGPRQAHDQHYPQP"
FT   gene            complement(442135..443865)
FT                   /locus_tag="ML5_0434"
FT   CDS_pept        complement(442135..443865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0434"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: saq:Sare_4398
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05986"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU05986.1"
FT                   /translation="MTDEPPRPPAPEARPGERATRRPRSIDPRELGFTPRRPVPWLAPL
FT                   LLISTGLRTLLAMLFGAYLDKRELQNAFSDGTFRQVGPDGGLWLDYVADLGDGFDATYS
FT                   VAYLLAQPELTVDGHTLPRAQTLVMGGDQVYPAAGYEAYEDRCKGPYQAALPVAPPEQP
FT                   KLFAVPGNHDWYDGLTAFLRLFVRTRDRHFAGWGTGQSRSYFAVELPAGWWLLGLDDQS
FT                   GSYLDDPQLTYFDEVARKLTPESKVILAVPAPTWVKAVDHPNAYDSIDYFIRTLVAPTG
FT                   AQVRVLVSGDLHHYARYAGTDRQLITCGGGGAYLYPTHRLPEKLEVPPRDTLTRRASNT
FT                   REYDLAARYPDKARSRRYGWGIFARLPFRNPGFTTLLGTLHTLLMLAMAGVAVQQVGTT
FT                   EQRLFSVPLAIMLVVAMMGAVFFAKPPTAGGKRHARHWILGVAHGLAQVALAAGGTWVW
FT                   LQLPFYDWPWPLPAVAAVVLYGPLSGLVASQLVALYLLVAGAFGVNLNELFAAQGIEDS
FT                   KAFLRFRIDPNGTLTIYPIAVDKVSHDWQLNPDQSPTASWLTPKTPLTPRLAEPPIVIR
FT                   "
FT   gene            443998..444071
FT                   /locus_tag="ML5_R0009"
FT                   /note="tRNA-Thr1"
FT   tRNA            443998..444071
FT                   /locus_tag="ML5_R0009"
FT                   /product="tRNA-Thr"
FT   gene            complement(444220..444810)
FT                   /pseudo
FT                   /locus_tag="ML5_0435"
FT   gene            complement(444893..445840)
FT                   /locus_tag="ML5_0436"
FT   CDS_pept        complement(444893..445840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0436"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: amd:AMED_5881 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05987"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU05987.1"
FT                   /translation="MRSTAGRNHGASHPGWASWRPTARGYVGVVDGSNPLGEFLRARRE
FT                   TTSPAEAGIVSSGRRRTPGLRREEVAQLSGVSADYYARLEQGREQHPSEQMLNALARTL
FT                   GLDAEEAAHLHLLARSGRKPARRGTRETVRPSLLRLMDGWLHTPALIVDRRMDVLAANR
FT                   LGRALFAKLFEADEPNLVRFVFLDSAARSFHPHWDRVAQSSLGALRAAAADMLDDARLT
FT                   ELVGELSLKSPEFRRLWARHDVRGKTHEAKLFHHHDVGELTLTYDSLTVAGATGQQLVV
FT                   YQAEPGSRSAQALALLGTVAADLPAPGRRTRAAS"
FT   gene            445865..446287
FT                   /locus_tag="ML5_0437"
FT   CDS_pept        445865..446287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hne:HNE_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05988"
FT                   /inference="similar to AA sequence:KEGG:HNE_0020"
FT                   /protein_id="ADU05988.1"
FT                   /translation="MSGTSHRKAATVLLTAALTACGTETPPVPQAAPSATPARPSVSEA
FT                   LHPYVGMWVTADGHIRQELLPDGRYDEARGDRASAYTGRYEVTGEHIDYWDDSGFTADG
FT                   RFDGDVLHHGGYLFYREGSAAHRQAVAGRASTRPSG"
FT   sig_peptide     445865..445960
FT                   /locus_tag="ML5_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.522 at
FT                   residue 32"
FT   gene            complement(446341..447168)
FT                   /locus_tag="ML5_0438"
FT   CDS_pept        complement(446341..447168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0438"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   stp:Strop_2137 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05989"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ADU05989.1"
FT                   /translation="MAKTLTITTRNASFQQWQALLTNRTKRQRSGEFLVQGVRPITVAL
FT                   EQGWEIRALLHPDRQPLSRWCRDLLDRADARRVALAPELMRELSGKEEESPELLAVVAQ
FT                   PADDLARIPVGPAMLVVVFDRPKTPGNIGTLIRSADAFGASGVIITGHAADPYDPKAVR
FT                   ATTGSLFALPVVRVPSHRDVLDWVAAVRADGLPQVQIIGTDEHGDVDVAEHDLTGPTLL
FT                   LIGNETHGLSKGWQEASDRMVRIPIVGAASSLNAAAAGTVALYEAARQRAERR"
FT   gene            447298..449472
FT                   /locus_tag="ML5_0439"
FT   CDS_pept        447298..449472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0439"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: ske:Sked_08830
FT                   predicted acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05990"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADU05990.1"
FT                   /translation="MTSPPLTKVADREGSPAEEPAGTATGREPGREATPSRFRADVAGL
FT                   RAVAVGLVLLYHAGLPFIPGGFVGVDVFFVISGFLITGQLISEIERSGRVSLTGFYARR
FT                   AKRILPAATVVLAATAVAVRLFVPRGEWQVIGGDIAAAATYVVNWRFADRAVDYLAEDV
FT                   APSPVQHFWSLAVEEQFYLLWPLLIVLAILAARRLRRANVRPVLWVGLAVLAVPSFVWS
FT                   IVETANSPERAFFVSTTRLWELAVGAAVALLAVRAARMPRSVAVVLGWLGLAAIVAAAL
FT                   LVSGKTAWPGYAAALPTLGAAAVIAAGAAAGSRGPVLVLGMRPFQWIGDLSYSLYLWHW
FT                   PMLVVAAAHFGDLSVTEGLVVALASVIPAWLTFRLVENPLRYSRKISTSPRLALSLGGN
FT                   FTLAGICAGLVLVLMGAWAAAATTTKGRYAPGAALLSTAPGTAPIGPVPERFDAITPDP
FT                   LQIRQGFMDVPDTNRDKCFQQVEGAEVLSCTYGVPNGSTTVALVGDSKMDQWLPAFQVL
FT                   AAQNDWKLLIMAKAGCAFTSAQVLKGDGSGKPYTDCIEWNRALLDRLVQERPDYVVTSQ
FT                   SASTALDSGGERATVAAMVSGVRASWKKLDSVGTKVVVLANNPHPGAAVACADKNRKRL
FT                   SACAFDREKHDQDPAYRMQRQAVAGAPKVKMIDLFDAVCPTDRCPVVFGNVLIYRGGSH
FT                   IGAAYVKTTAPHLARALSDVGVPARFTPAG"
FT   gene            449515..450099
FT                   /locus_tag="ML5_0440"
FT   CDS_pept        449515..450099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lhk:LHK_02883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05991"
FT                   /inference="similar to AA sequence:KEGG:LHK_02883"
FT                   /protein_id="ADU05991.1"
FT                   /translation="MRRPLWLSLAYVLLAVAGGALLWLPFHTQMALDDWGVTLRERGTP
FT                   TQATVVDQVTKSGGNRSSSSRTMYFSYAVDGRTHSQEVPCFEVCRAAGTEVPIWVNPAD
FT                   PNDFVTDFGQLSGHRGRVQGVLGVVGLFALGAGVVLTLSRIRRAARPGDRAGRASHDAA
FT                   RRDRPRRVAPTPVGDGRGYTGRGKRKRNARR"
FT   sig_peptide     449515..449610
FT                   /locus_tag="ML5_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.739 at
FT                   residue 32"
FT   gene            complement(450139..450759)
FT                   /locus_tag="ML5_0441"
FT   CDS_pept        complement(450139..450759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0441"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: stp:Strop_3980 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05992"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADU05992.1"
FT                   /translation="MTTREITSEAELRELIGTPMPRAAAKDRRTLHERDREWLAASPFC
FT                   LIATAGADGTCDVSPKGDPPGFALVLDDTTIAIPERPGNRRADGYRNVLANPHVGLIFL
FT                   IPGRTDTLRINGRARLISDAPWFADMEVKGHRPLLAVEVAIEQIFYHCAKAFLRSELWQ
FT                   PETWQPDVLPTRARLIKEVEAPAESLADLERHYGPAYLETLYR"
FT   gene            450927..451433
FT                   /locus_tag="ML5_0442"
FT   CDS_pept        450927..451433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05993"
FT                   /inference="similar to AA sequence:KEGG:Sare_4364"
FT                   /protein_id="ADU05993.1"
FT                   /translation="MESRLKVLGHPVHPMLVMFPVALFVTAVIFDVVDTVGGPGFLAEV
FT                   AYWNITVGLIGGLLAAAAGAFDLLALPAGTRAKRVGVTHAAANVAVILLFAAVWAVRLN
FT                   ADSRAAGGALVAIEVVALAILGVSAWLGGELVDRLGVGVDPEHDLNAPSSLRPSSATQR
FT                   IGDAR"
FT   gene            451430..451966
FT                   /locus_tag="ML5_0443"
FT   CDS_pept        451430..451966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0443"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: saq:Sare_4363
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05994"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADU05994.1"
FT                   /translation="MTEQGSGRGWRGRQQGWDPMGELQSLRSELSRLVGGRSGSQDVDL
FT                   AETADGWEVVVRLPGVAPEEVTVELDDRELCVRARSEAEVNADHGIPGGFTTRGFEYRV
FT                   DLPSRVDPDRIDAVMDHGLLRVHLPRATRPAPRTITVGRTGPRPGADRTPMPADPAADR
FT                   ELHHPDTALDEIDRP"
FT   gene            451974..453131
FT                   /locus_tag="ML5_0444"
FT   CDS_pept        451974..453131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0444"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   stp:Strop_3977 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05995"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADU05995.1"
FT                   /translation="MTSPPDSRSPRRDLEPSALGPVGERVPDVERIAVLRANALGDFIF
FT                   VLPALDALRSAYPSAEIVLLGAPWHAALWRDRPGPVDRVLVVPAAPGIRDPGPGESPGD
FT                   VPAFLAAARAERFDLALQVHGGGGNSNPFVAGLGARVTAGLRAEGAPPLDRWLRYVYYQ
FT                   HEVIRYLEVVALVGAPATTITPSLAVTAADRAEAAAVLGEPTRPRVALHPGATDTRRRW
FT                   PPERFAEVARELTGDGYEVLVTGTPAEQETVDAVVAAAGVPVRPQVGTLSLGALAAAYA
FT                   DCALVVSNDTGPLHLAAAVGAPTVGVFWVGNLINGASPLRGRHRPIAAWTTHCPVCGVD
FT                   CTPGIYPHRPGDGECPHRVSFVADVPVAEVVEAARELLTPPRATR"
FT   gene            complement(453106..453978)
FT                   /locus_tag="ML5_0445"
FT   CDS_pept        complement(453106..453978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0445"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   saq:Sare_4361 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05996"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADU05996.1"
FT                   /translation="MTRPLDPGTPGRFRHHRRLDVLIPTRNRPAELAVTLSGLAAQEGV
FT                   PGFGVVVSDQSDGDPAYAHPAAATMVRALRHRGHPVLLTRRLPRRGLAEHRSYLLAQSA
FT                   ADAVLCLDDDVWLEPGALSRLVTALDELGCGFVGNAVHGLSYADDVRPETHQHYEEWTG
FT                   PPVPERIQPGTPEWHRASIHPAANLLHVTEKLDLAADEWRAYKISWIGGCVLYDRAKLV
FT                   EAGGFDFWERLPERHQGEDVAAQLAVLERHGGAGVLPSGAYHLESPTTVTERDVEAWEV
FT                   VLSESPAEV"
FT   gene            complement(453975..455813)
FT                   /locus_tag="ML5_0446"
FT   CDS_pept        complement(453975..455813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0446"
FT                   /product="rfaE bifunctional protein"
FT                   /note="KEGG: saq:Sare_4360 RfaE bifunctional protein;
FT                   TIGRFAM: rfaE bifunctional protein;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase; PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05997"
FT                   /inference="protein motif:TFAM:TIGR02199"
FT                   /protein_id="ADU05997.1"
FT                   /translation="MAGAAAEERRLATVVASWQQRPVLVVGDAMLDEWRFAESERLCRE
FT                   APAPVLTLRRRISAAGGAANTAVNVAALGGRAALVAPVGADVAGDELHDCLDRAAVWDR
FT                   TVSQPGRPTPVKRRMLAGNQILLREDSGGPEDGLDADGVARLLTALHCATEELRAVAAG
FT                   QPLTLVVCDYGLGALPSAVRAWLVANRDRYGTVALDAHDLADWRGLNPTVVTPSFAEAT
FT                   RLLARAAAGFAHAERGAVPSGDVHLNHPAEADGPSELMVGAAPGGSGERVPGSPHPTSG
FT                   TPAAEVPAGPTGEPVPGEERVALTGDGLSVTGTGVTVSAAAGAGVDRAVLAESRLPELR
FT                   EHTGADVVAVTLDTEGAVVGGAEGEPRRSHSTPVPASHAVGAGDAYLAAMTLALAADAG
FT                   LPTAAQLAQLAATITVADTGTCVCRRQDLLAALGTGADEGGHPALVGADELAALVDEHR
FT                   QAGRSVVFTNGCFDVLHPGHVRYLTQARALGDLLIVAVNSDGSVRRLKGPDRPVNPVED
FT                   RIALLAALACVDHVVVFEEDSPARLIEAVRPDVYVKGGDYPPEMVPEAPLVRRLGGQVR
FT                   TLGYVPDRSTSAIIDRIRAHPVGDPVGDTVGEGRPA"
FT   gene            455940..456497
FT                   /locus_tag="ML5_0447"
FT   CDS_pept        455940..456497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0447"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="KEGG: rxy:Rxyl_2045 peptidase C56, PfpI; TIGRFAM:
FT                   intracellular protease, PfpI family; PFAM: ThiJ/PfpI
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05998"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ADU05998.1"
FT                   /translation="MAATLQGKRIAFLAADGVEEVEYTKPREAVENAGAQVELVSIESG
FT                   TIQAFNHLDHGKQYQVDVTTEEADAGAYDGLVLPGGVANPDFLRTDPEAVRFVRAFFDA
FT                   GKPVGVICHGPWTLVEADVVRGRTITSWPSLRTDLTNAGAKWVDQEVVTDNGLVSSRKP
FT                   DDLPAFCAKIVEEFAEGRHAAR"
FT   gene            456551..458218
FT                   /locus_tag="ML5_0448"
FT   CDS_pept        456551..458218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0448"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: sna:Snas_6232 drug resistance transporter,
FT                   EmrB/QacA subfamily; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05999"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADU05999.1"
FT                   /translation="MTAQAARPALPARQIRLLMFGLMTGMLLAALDQTIVGTALPTIVG
FT                   ELGGINHYSWVVTAYLLASTASTPLYGKMADLYGRRPVFLFSIGMFLLGSLLAGLSQDM
FT                   TQLIVTRGVQGLGAGGLMTLAFTIISDVVSPRERGRYQGLFGAVFGVSSVAGPLVGGYF
FT                   AENNWRWIFYINVPLAILAIVVCWHVMRLVPFERREHTVDWIGAALLVAGVSCLLLALS
FT                   WGGAEYAWGSGVIVGLFAAGAVLGVLFVAQEARTKEPILPLRLFRSATFALANGAGFVL
FT                   GLVMFGSIIFIPLYLQIVKGASPTRSGLLMLPMMAGVIVTSVLTGRAMSRIGRYKWFPV
FT                   AGAAVLVVGMLLFQQLQVATSLWLAFGYMVVIGVGLGLCMQSLILAVQNAVSVRDLGAG
FT                   TSSATFFRSLGGSFGVAILGAVLSSRLTAEMSARLPGALAQLPPEQRAAVTAGGDFSIN
FT                   DPAAILALPAPVRAAVQAAFVESLHLVFLTTGLIAVIAVLVTLAMPNLQLRGTGPQGAT
FT                   GGADPLGGKAPAPGGKPLTKESKDEAAADMEAKSQTML"
FT   gene            complement(458226..458717)
FT                   /locus_tag="ML5_0449"
FT   CDS_pept        complement(458226..458717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0449"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: saq:Sare_4359 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06000"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADU06000.1"
FT                   /translation="MSISWADSYVGQLRALAGDRTLMFVGARAVVRDNAARVLLIQRSD
FT                   NGQWALPAGAMELGESIADCAVREVREETGLRALRVSAFALYTGPDRTHTNMYGHTYQV
FT                   FTTAFRVDEWDGELARFTDETTDSGFFRPADFPHPLSSSVHETLADLDVFEQTNRLILK
FT                   "
FT   gene            458803..460452
FT                   /locus_tag="ML5_0450"
FT   CDS_pept        458803..460452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0450"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   saq:Sare_4358 long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06001"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADU06001.1"
FT                   /translation="MRSTMMDAPLQVARILEHGSTVHGAAEVVTWTGAEPRRMTYAEVG
FT                   RAAARLAHALRDECGVTGDERVGTFMWNNNEHLVAYFAVPSMGAVLHTLNIRLFPDQVS
FT                   YIANHAQDRVVLVDTTLIPLLARVIGEMTTVAHVVVVGGGDPAPLLTAAGDRITVHHWD
FT                   ALLADRPDHFDWPEVDERDAAALCYTSGTTGNPKGVAYSHRSIYLHSLQVCMPEGFGLG
FT                   PNDRELAIVPMFHAMSWGLPYAAFLSGASLIMPDRFLQAEPIAAMIAAERPTLAGAVPT
FT                   IWTDLLAYLDAHEVDLSSLKEVIVGGSACPPALMHAFHDRYGIDVIHAWGMTEMSPLGS
FT                   VSRAPAGATGDDAWRYRYTQGRVPAGVTARIVGPAGEPLPADGTSVGELEVRGPWVTAR
FT                   YIGDDAPEEEKFRDGWLRTGDVGTLSPDGYITLTDRAKDVIKSGGEWISSVELENALMA
FT                   HPAVLEACVVGVPDERWDERPLATVVIREGASVTAEELRDFLAGSVARWQLPERWAFID
FT                   AVPKTSVGKFDKKVVRSRYADGGLDVRELTAS"
FT   gene            complement(460633..461646)
FT                   /locus_tag="ML5_0451"
FT   CDS_pept        complement(460633..461646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0451"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   saq:Sare_4357 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06002"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADU06002.1"
FT                   /translation="MKAIVYERSGDASVLQVVERPVPEPGPGEVLVRMAVSGVNPTDWK
FT                   ARQAWPLPAGWQIPHQDGAGVVEAVGEGVDRTLIGERVWVWEAAWQRPWGTAAEYTLVP
FT                   VRHAVPLGPASFDLGAALGIPFMTAHRCLTAGEFMPDKLHAGALSDHVVLVQGGAGAVG
FT                   NAAIQLARWADACVITTVSSPEKAQLAAAAGASFVINYREQDVVEEVRKVAPDGVHTIV
FT                   EVSAARNAAADVRMLRTGGAVCVYADDGGGEVTLPIRPLMGPNARWQFVLIYTAPKVAK
FT                   AQAVTDIAAAVAQGAIRVGEEAGLPLHRYPLAEAAAAQQAVQDSVVGKVLVSTADE"
FT   gene            complement(461737..462861)
FT                   /locus_tag="ML5_0452"
FT   CDS_pept        complement(461737..462861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0452"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   svi:Svir_26960 theronine dehydrogenase-like Zn-dependent
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06003"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADU06003.1"
FT                   /translation="MYEGPHEVAVNEVDDPRIEDPNDVVVQVTTTAICGSDLHMYEGRT
FT                   AAEPGIVFGHENMGVIVETGPGVTSLRVGDRVSMPFNVACGFCRNCREQRTGFCLTVNP
FT                   GFAGGAYGYVSMGPYRGGQAEYLRVPFADFNCLKLPPGTEHENDYAMLADIFPTGYHGV
FT                   AMTGLRPGENLTVMGGGPVGLMAAYSAVLIGASEVFVVDRVPDRLRLAESIGATAIDFS
FT                   AGDPVEQIRDRTDGVGTDHGVDAVGYQASAPSGEEQPALVLNTLVEVVRATGAIGVVGL
FT                   YLSADPGAPDEHSARGELLFKVGKLFEKGLRIGTGQANVKTYNAYLRNLITAGRATPSF
FT                   VVSKELPLDAAPEAYQRFDRREPGYSKVVLKPAA"
FT   gene            complement(462915..463568)
FT                   /locus_tag="ML5_0453"
FT   CDS_pept        complement(462915..463568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0453"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: saq:Sare_4356 HAD family hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06004"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADU06004.1"
FT                   /translation="MVDAVLFDLDGVIVDSEPVWEEVRRAYVARHGGVWQPDTQRRLMG
FT                   MSTAEWAAYLSGELGVDRSAEQVATEVVTEMARRYAQHVPLIDGADAVVRRIAARWPLG
FT                   LASSSPTRLIAAALDATGLAGAFGATLSTEETARGKPAPDVWLAVAQRLGVDPARCVAV
FT                   EDSSNGVRSAAAAGCRVVAVPHASYPLDPDAEALAAVLLPSIGALTPEVVAGID"
FT   gene            complement(463601..464545)
FT                   /locus_tag="ML5_0454"
FT   CDS_pept        complement(463601..464545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06005"
FT                   /inference="similar to AA sequence:KEGG:Sare_4355"
FT                   /protein_id="ADU06005.1"
FT                   /translation="MVTTGGTFARGDLPTDAEVHVAALDESGVTRQMWTLYEPVHAVTY
FT                   FHPRARAAFEAVGLRGYWRGYFAGRAAPLGPVDAPTVTAAFFSFAPAMVARALPSVWRL
FT                   ATPEETLRARLTGGVQALAEFTYELPESHLVEAADLLEEAAGRVDVAGRVLGAVNAALP
FT                   RGEYPLARLWQAATTLREHRGDGHVAALVTTGLEPAEVVAWRCRVDQSREFHQPARGWT
FT                   DEQWTAAEQRLVDKGWLTADMDPTPYATETFRVVEEATDRAAAGPWRALGAERTGRLRE
FT                   LLEPIATRCRTIIPAKAPIGLPAQRSAGAALPR"
FT   gene            complement(464589..465341)
FT                   /locus_tag="ML5_0455"
FT   CDS_pept        complement(464589..465341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0455"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   stp:Strop_3970 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06006"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ADU06006.1"
FT                   /translation="MGTLGLRAGTVCAGLGGGPPGAHPPTLQGVDVSERVENRSAGQAP
FT                   ATKAQRRLAAQLAEKKAAEARRRRQSILGAAVGVLAVVALVGGLVWLNSGDDDKTSTAG
FT                   SSASPTAPAEPTAAPAPELPAGFDPALKTKPTVQAGTGELKKLTVTTLVKGTGPAVKAG
FT                   QNITTNYVGVFYKDGKQFDASWDSGQPATFQIGVGQVIKGWDQGLVGVPVGSRVQLDLP
FT                   AELAYGNDAAGGRPAGPLRFVVDVLAAQ"
FT   gene            465405..465797
FT                   /locus_tag="ML5_0456"
FT   CDS_pept        465405..465797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0456"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: fre:Franean1_1623 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding; TIGRFAM: putative
FT                   F420-dependent enzyme; PFAM: pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06007"
FT                   /inference="protein motif:TFAM:TIGR03618"
FT                   /protein_id="ADU06007.1"
FT                   /translation="MAILSEEDLALLGEPQLAHVATIEADGTPHVTPVWVDTDGEHIVF
FT                   NTAKGRQKYLNMSRNPVVAVSVADKADDFRTLWIKGTVEFVTEGADEHIDRMAKKYLGQ
FT                   DTYPWRRPGEERVIVRVTPTEKLGRG"
FT   gene            complement(465846..466838)
FT                   /locus_tag="ML5_0457"
FT   CDS_pept        complement(465846..466838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0457"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   saq:Sare_4353 Ku family containing protein; SMART: Ku
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06008"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ADU06008.1"
FT                   /translation="MRAIWKGAVSFGLVSIGVKVYSATEEKDIRFHQVHREDGGRIRYK
FT                   RTCSVCGEEVTYDDIAKGYDIGGGEMVILTDEDFADLPLSTSHAIDVLEFVPAEQVDPI
FT                   LYNKAYFLEPEGSATKPYVLLRDALSDSERVAIVKVALRQREQLATLRVREGVLLLNTM
FT                   LWPDEIRRPDFGFLDEDLKVRPPELAMASSLIDSMAGEFEPDAFTDDYRAALQEVIDAK
FT                   VEGREVVQPEEEEAAPAAAVDLMAALKASVERARAARGEAPSGGGAEPTPISSARSAKK
FT                   AAKKAPAKKAEPAKKTTAKKAPAKKTAAKKAEPAKKTAAKKTPAKKKTA"
FT   gene            466905..467864
FT                   /locus_tag="ML5_0458"
FT   CDS_pept        466905..467864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0458"
FT                   /product="DNA polymerase LigD, ligase domain protein"
FT                   /note="KEGG: saq:Sare_4352 DNA polymerase LigD ligase
FT                   region; TIGRFAM: DNA polymerase LigD, ligase domain
FT                   protein; PFAM: ATP dependent DNA ligase; ATP dependent DNA
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06009"
FT                   /inference="protein motif:TFAM:TIGR02779"
FT                   /protein_id="ADU06009.1"
FT                   /translation="MRNYSQEVPGAPLKPMLATTGQLPAGAAWSYEFKWDGVRALADIS
FT                   RGDRHFYARSGVEITTAYPELLNLAEQVGDALLDGEVVLFTDGQPSFTALAERMHVRNP
FT                   AKAARLAATAPVTYMIFDLLRLDGVDLTARPWRERRAALESLGLGAARWAVPPVFGDGP
FT                   ATYAAAGEHGLEGVMAKRVDSLYRPGVRSPDWVKVKLEVTADFVVGGWRPGARRVGGLL
FT                   VGVPGPDGRLVYRGRVGGGIGAALERELLRELEPLRATDSPFAAGVPREDARGAIWVTP
FT                   RIVVEVKYGQRTPDGRLRFPRILRLRPDKPPEEVDDAL"
FT   gene            467854..468762
FT                   /locus_tag="ML5_0459"
FT   CDS_pept        467854..468762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0459"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="KEGG: saq:Sare_4351 DNA polymerase LigD polymerase
FT                   subunit; TIGRFAM: DNA polymerase LigD, polymerase domain
FT                   protein; PFAM: DNA primase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06010"
FT                   /inference="protein motif:TFAM:TIGR02778"
FT                   /protein_id="ADU06010.1"
FT                   /translation="MPSERLKVEVEGRPLELSNLDKVLFPKAGFTKGEVIDYYTRIAPV
FT                   LLPHLSDRALTRIRFPNGVDGGSFFEKNAPAATPGWVRTENLPAPGSTKGRETIDYVVC
FT                   DELPTLVWLANLAALELHTPQWKIGAHPDMMVVDLDPGAPAALKQCCRVALLMRDRLAS
FT                   DGISSFPKTSGKKGMQLCCPIAGTQDADFVSDYAKRIAQELEQAHPKLVVSKMAKNLRP
FT                   GKIFIDWSQNNAAKTTVAPYSLRAQSVPSVSTPLTWDEVEAGAAGKRPSTRPYTAGEVL
FT                   KRVEKQGDLLAPLLDGGPELP"
FT   gene            complement(468695..469777)
FT                   /locus_tag="ML5_0460"
FT   CDS_pept        complement(468695..469777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06011"
FT                   /inference="similar to AA sequence:KEGG:SGR_5039"
FT                   /protein_id="ADU06011.1"
FT                   /translation="MTTEPPRRRLVPAIALLLLAPWTAECSWGGFTLTGMPFVVLVLAP
FT                   MYGGAALLIRETARRFGLGWPGIALLAAAFGVIQAGLVDQSLFNPGFLDDTEFADTRAA
FT                   AEATLVPGLGFSARQAVDYVGNHVVLTVCAPIALVESYLGAGRRARPWLGRPGLTAAAL
FT                   LWLGGSLLVFADDGGRKNFLASPVQLAVATGVALALITAALLRHRHAGPPPDAPTPAGP
FT                   TPAGRPQTEAGPPRPLRPALVVAAAYVGSTIAPGWPGVVLALALAGIAAALLTRWSRRP
FT                   GWGQRHVLATGTAGLVVAAALAYTVPTYAPANPVAALVGDVAISVIVLLLVGGAWWRVT
FT                   AVRDRRRAAAPAGRPASPPA"
FT   gene            complement(469873..470247)
FT                   /locus_tag="ML5_0461"
FT   CDS_pept        complement(469873..470247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06012"
FT                   /inference="similar to AA sequence:KEGG:Sros_0284"
FT                   /protein_id="ADU06012.1"
FT                   /translation="MLTLVAYGLAIVLSLFIVLIGARFLLVPRAAAAGYGVPAAEGTGD
FT                   PAYLTIKGLRDLTYGLVGLALIAFTSADAVAWFMLVVALAPLGDTLIVLRHGGSRATAF
FT                   GIHFATAVVVLLDAALLFAL"
FT   sig_peptide     complement(470149..470247)
FT                   /locus_tag="ML5_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.671) with cleavage site probability 0.497 at
FT                   residue 33"
FT   gene            470336..470914
FT                   /locus_tag="ML5_0462"
FT   CDS_pept        470336..470914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0462"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sma:SAV_5724
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06013"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU06013.1"
FT                   /translation="MSIQARRERERAERERAIITAARDLAESEGWDAVTTRRLAAEIEY
FT                   SQPVLYSHFKGKDAIMAAVALEGCAELAVELAAARAAATDPRAAVAAIATAYAAFAERR
FT                   PALYDAIFTLPVALSFASQDTPVELVRAFAELAETLRPFTGDDDLETFTETFWSALHGQ
FT                   VTLMRGGRLRRDEHERRLALLVDRFARLG"
FT   gene            470942..471643
FT                   /locus_tag="ML5_0463"
FT   CDS_pept        470942..471643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0463"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   saq:Sare_0880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06014"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADU06014.1"
FT                   /translation="MATRAPAAVATDEPLLTYLDDATGERTELTGPQLGRWAARSAGLL
FT                   RDGCGLRPGDRVAVLLPPHWRTAAVLIGAWSIGLTVSFRPRALAGLPVLEPGADRPYDA
FT                   VFVTPERLDDWLEDVPEGTHRYLVGTGPGQLAEVPPGWLDWSAEVLRHPTDPPDYVAVD
FT                   PAGPATPDGTSFGAWRRLAAEIATQMNLHQGDRLVIDPTEDEQPLKWLLAPLSAGATVL
FT                   IHATPTPTPTP"
FT   gene            472062..473141
FT                   /locus_tag="ML5_0464"
FT   CDS_pept        472062..473141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0464"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: sco:SCO6392 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06015"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADU06015.1"
FT                   /translation="MRRIVERVADRYDVVVGVDTHTDTHTAAVVDRLGGVLAQVTVSTD
FT                   PDGLSRLLAFAVAHTPPQGRRLWAVEGTRSHGQGLCRLLTAADEPVCEAPKPPAAARRR
FT                   GGKSDQLDAVAAAHTVLALPAERIAVPRSDGPREALRLLLICRRHHTDARTAAVNLVKA
FT                   LILTADDTLREALRGLSTTIQIARLAALELPETTALPCEEHTRRRELVTLARHIHILDA
FT                   TLADNHQRLRALVTELCPPLLDQPGVGPVTAAIALTAWSHPGRVRSEAAYATLAGAAPI
FT                   PVASGRTDRHRLNRGGDRTLNSALHTIALTRRRIHPETRDYITRRHAEGRTTREITRCL
FT                   KRYIARQLYRTITTHHQTP"
FT   gene            473176..475788
FT                   /locus_tag="ML5_0465"
FT   CDS_pept        473176..475788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0465"
FT                   /product="tRNA synthetase valyl/leucyl anticodon-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06016"
FT                   /inference="protein motif:PFAM:PF08264"
FT                   /protein_id="ADU06016.1"
FT                   /translation="MGKVVECGRVAAYHRLMTDTTISPRGGVPERPSLDGLEETWARRW
FT                   QEDGTYAFDRTKERSDVYAIDTPPPTVSGELHMGHVFSYTHTDTVARFQRMRGRTVFYP
FT                   MGWDDNGLPTERRVQNVYGVRPDPSLPYDKDWRPPAAPVDDAARKNPTAISRRNFIELC
FT                   ELLTVEDEKAFEALWRRFGLSVDWSLTYTTIGSAARAASQRAFLRNLARGEAYQAEAPT
FT                   LWDVGYGTAVAQAELEDRERPGAYHRLRFTGPDGREVLIDTTRPELLPACVALVCHPDD
FT                   ERYADLVGAAARTPVFGVEVPVRAHPLADPAKGTGIAMVCTFGDLTDVTWWRELRLDTR
FT                   VVIGRDGRLLPEPPAGVPAEPYAALAGQTVNGARRTLVELLADAGDLVGEPRPITHPVK
FT                   FYERGDRPLEIVSTRQWYLRNGGRDAGLREELLARGRELRWVPEHMRHRYEHWVGGLTG
FT                   DWLVSRQRFFGVPVPVWYRLDDAGEPDWSHPLTPDEAMLPIDPTSEPPPGYEETQRGEP
FT                   GGFTGDPDVLDTWATSSLTPQIVGGWETDPDLFARVFPMDLRPQGHDIIRTWLFATVAR
FT                   SHLEHGALPWHTAVLSGWILDPDRKKMSKSKGNVVTPMALLERNGSDAVRYWAANGKPG
FT                   MDLAFDPAQVKVGRRLATKLLNASRFALGLGAADALRAAATQPLDTAMLAELSGVVATA
FT                   TTAFDGYDHTAALMATEAFFWRFCDDYIELVKERAYGTGPAADSARAALATALSVQLRL
FT                   FAPVLPFVTEEVWSWWRYGSVHRSPWPTTYEVGRAMEAPGDPELLRLAADALGQVRRAK
FT                   SERKLSMKADVPLAEALGPAAVLDRLGTVADDLRAAGRIAKLDLLPDRTTELVIACAF"
FT   gene            complement(475907..476332)
FT                   /locus_tag="ML5_0466"
FT   CDS_pept        complement(475907..476332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_0978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06017"
FT                   /inference="similar to AA sequence:KEGG:MAB_0978"
FT                   /protein_id="ADU06017.1"
FT                   /translation="MIVMSGCDDDKPSAGPAAPSAPAATSVPPVTPAPAGLDEATRKTC
FT                   ATAEKDITAALKEVAEAEKIGPPAGHSAVSAQYSAGAATLYTHAFTSSDEVNAAVKGVA
FT                   TAMTDLADTWAKAPGKAPSKADLTTARDKLKAACAAE"
FT   gene            complement(476490..477200)
FT                   /locus_tag="ML5_0467"
FT   CDS_pept        complement(476490..477200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06018"
FT                   /inference="similar to AA sequence:KEGG:Sare_4167"
FT                   /protein_id="ADU06018.1"
FT                   /translation="MSTVTWITARGLFGRSRFLMLLPLPLVLIGLAVLCRSLGVDPGQW
FT                   GPPVLVGLGLAVVLPVVALIVGTGVLGAEIDDGTVVHILTKPLPRWQIVLPKLAVAAGV
FT                   TAVTVGVPIYVAGVLADSVRLGLALVAASAAGALAYSALFLALSLVTRRPVLLGLVYVL
FT                   IWEGLLGRFVGGTRVLSIQQWVIALADRMAPTPLLGTTVSVPVAAVLTALVAVGFTVLA
FT                   IDRLRSFSVAGETS"
FT   gene            complement(477200..478159)
FT                   /locus_tag="ML5_0468"
FT   CDS_pept        complement(477200..478159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0468"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: saq:Sare_4168 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06019"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU06019.1"
FT                   /translation="MTAISTQSTAGAPAAATSTLDLAGVSRWYGNVVAVNDVTMRLGPG
FT                   VTGLLGPNGAGKTTLLHMMAGFLSPSRGTVTLDGEPTWRNPAVYRRLGLVSEREAVHTF
FT                   LSAYEFVLASAKLHRLPDPEAATRRAIELVEMEDAQTRRIGTYSKGMRQRTRVAAALVH
FT                   DPQVLLLDEPFNGMDPRQRLHMMALLHRLGDAGRTILFSSHILEEVEQVSGTVQVMVAG
FT                   RLAASGDYRTIRRLMTNRPHVFGVRSTDDRALAVALMAEASVSGVELDRTGLTVKAGDY
FT                   GAFTRALPRIALRHGIRVRQLLPEDESLESVFSYLVEA"
FT   gene            complement(478156..479034)
FT                   /locus_tag="ML5_0469"
FT   CDS_pept        complement(478156..479034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06020"
FT                   /inference="similar to AA sequence:KEGG:Strop_3789"
FT                   /protein_id="ADU06020.1"
FT                   /translation="MSDATGVIHDIGYQRYTGPRLGRRQVFGALYLHGVRTVFGLGRSA
FT                   KAKIFPWLVVSVVTVVAAGVTAVRSQIGEVVMTYAQFADAMSWLVIFFAAVAAPELVSR
FT                   DLRSGVLPLYFSRPLPRGDYALSKLLALVTALWLLLGGPQLVMFLGAAFTTNRGVRGVW
FT                   DELLDLLPGLLYAGLWAVVFASIALLVASLTGKRAFAAGGIVAVFLMTTPVVGVLSILP
FT                   SRTINELAFVASPPTLVGGVGNWALGDRLTQGRGGMPIGDFGPVYAVAAVLLVAACVSL
FT                   LLLRYRKVAAR"
FT   gene            complement(479027..479941)
FT                   /locus_tag="ML5_0470"
FT   CDS_pept        complement(479027..479941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0470"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: saq:Sare_4170 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06021"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU06021.1"
FT                   /translation="MTLLATESLTKTYGGRVTALADLTVSVEPGIIGLVGANGAGKSTL
FT                   IKILLGLLPPTSGRVQVLGLDPTTDPAAVRARVGYMPEHDALPPDLSAAELVTHLGRIS
FT                   GLPRTVARERASEALRHVGLHEERHRAVGGYSTGMKQRVKLAQALVHDPDLLLLDEPTN
FT                   GLDPAGRDAMLALIHRIGTEFGISVVVCSHLLGEVERICDTLVAIDGGRLLRADRVSAM
FT                   TTATDVLAVEVSEGTEELAARLTALDLPVTRDGRLLLVPLADDATYDQILGAVAELDLP
FT                   LHRLDQRRHRVAELFAAREPSHV"
FT   gene            480312..481841
FT                   /locus_tag="ML5_0471"
FT   CDS_pept        480312..481841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0471"
FT                   /product="adenylylsulfate kinase"
FT                   /note="KEGG: saq:Sare_4172 adenylylsulfate kinase; TIGRFAM:
FT                   adenylylsulfate kinase; PFAM: adenylylsulfate kinase;
FT                   ATP-sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06022"
FT                   /inference="protein motif:TFAM:TIGR00455"
FT                   /protein_id="ADU06022.1"
FT                   /translation="MSNGWLLPEDVLRDAPSYAPRPAELADLQLLLSGAYAPLTGFMSR
FT                   ADLSSLNRRGRLADGTPWPVPVTLQVPAALADGLDPADPARRAVVLTDGEGAPVAAMDV
FT                   TDVWPGREGMVGVGGTVRRLGDGGHGPFQRLRRGPDEVRGLLPPGRVLGVFADRPLHRP
FT                   QLAQIAHAARTLGAHLLVMIPVGEESIGGLPAESLVRSVFAARDRMPPATLVAVPLARR
FT                   RDEISDALLRARVAAAYGVTHLLSTEGMLSGAGLRVLVPRELAYDNRDGQWRWREDIPP
FT                   RNRRLALSAREIDDLLDRGFPLPEWHTPPAVAKELARARPPRRHRGLVIFLTGLSGSGK
FT                   STIARGLADVLREQGDRTITLLDGDVVRRELSAGLGFSKADRDLNVRRIGWVAAEIARH
FT                   RGVGICCPIAPYAAARATAREMAETAGAGFLLVHVATPLAVCEQRDRKGLYARARAGLI
FT                   TGMTGIDDPYEAPTDADLVVDTSDLSVEEAIGKVMEHLTETGWVEPRLQPA"
FT   gene            482020..482808
FT                   /locus_tag="ML5_0472"
FT   CDS_pept        482020..482808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0472"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: sro:Sros_7307 transcriptional regulator, DeoR
FT                   family; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06023"
FT                   /inference="protein motif:PFAM:PF00455"
FT                   /protein_id="ADU06023.1"
FT                   /translation="MLARQRQTAILERLRRAGGVRVTELAAEFGVSDMTIRRDLDTLHE
FT                   QGLLAKVHGGATPAGPGSTDEPGFHAKSVRQSAEKAAIAEHAAGLVRPGAAIALSAGTT
FT                   TAELARRLVDVPGLTVVTNSLPVAEALHVGGRPDQTVVLTGGVRTPSDALVGPLAVAAI
FT                   AALHLDLLFLGVHGISERAGFTTPNLMEADTNRALVAAADRLVVLADHTKWGTVGISSI
FT                   VPLEAADVLVTDDRLAPEARRVLDDRVGELVTVPTTRGAE"
FT   gene            482805..483878
FT                   /locus_tag="ML5_0473"
FT   CDS_pept        482805..483878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0473"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   KEGG: sro:Sros_7308
FT                   UDP-glucose--hexose-1-phosphateuridylyltransfera se; PFAM:
FT                   galactose-1-phosphate uridyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06024"
FT                   /inference="protein motif:TFAM:TIGR00209"
FT                   /protein_id="ADU06024.1"
FT                   /translation="MKRTQIALADGRELIYFDERDDAVRDQPDRRDLPPPPPASQLRYD
FT                   PLTDEWVAVAVHRQTRTFLPPADQCPLCPSRGERHSEIPAPDYDVVVFENRFPSLSQRV
FT                   ADEPAEITPFTPVRPGRGKCEVVCFTDDHNASFARLSPHRVRTVLDALADRTTALSALP
FT                   GVEQVFPFENRGVEIGVTLHHPHGQIYAYPFVTPRTRTMLAAARRYADRTGGNLYADVL
FT                   ATERASGDRVVTSNEHWTAYVPAAARWPFEVHVAPHRPVPDIPALDDAERDAFGPLYLD
FT                   LLRRFDGLFDLPMPYIAAWHQAPVRIDRELGHLHLQLFSIRRAKDKLKYLAGSESGMGV
FT                   FINDIAPERAAELLRAG"
FT   gene            complement(484191..485408)
FT                   /locus_tag="ML5_0474"
FT   CDS_pept        complement(484191..485408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0474"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /note="KEGG: saq:Sare_4173 isocitrate dehydrogenase;
FT                   TIGRFAM: isocitrate dehydrogenase, NADP-dependent; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06025"
FT                   /inference="protein motif:TFAM:TIGR00127"
FT                   /protein_id="ADU06025.1"
FT                   /translation="MAKIKVNNPVVEIDGDEMTRIIWKQIREQLILPYLDVDLHYYDLS
FT                   IQHRDATDDQVTVDAANAIKEHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILG
FT                   GVVFREPIIMSNVPRLVPGWTKPIIIGRHAHGDQYKATDFVVPGPGTVTITYTPADGGT
FT                   PMEMEVANFPGGGIAMGMYNYDESIRDFARASFRYGLDRGYPVYMSTKNTILKAYDGRF
FT                   KDIFAEVFENEFKAEFEAAGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVA
FT                   QGFGSLGLMTSVLLSPDGRTVEAEAAHGTVTRHYRQYQKGEKTSTNPIASIYAWTRGLA
FT                   HRGKLDGTPAVTEFADTLEKVIVDTVEGGQMTKDLALLISRDAPWLTTDEFMNALDENL
FT                   ARKLAA"
FT   gene            485548..486345
FT                   /locus_tag="ML5_0475"
FT   CDS_pept        485548..486345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0475"
FT                   /product="putative beta-lactamase"
FT                   /note="KEGG: scb:SCAB_2441 putative beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06026"
FT                   /inference="similar to AA sequence:KEGG:SCAB_2441"
FT                   /protein_id="ADU06026.1"
FT                   /translation="MPRSRTIGSITVTALSDGEGPFFQPRGEAFPGATQAHWAAADRLD
FT                   PGAVTDDGRWWLRFRAFAVRAGDGPVTLVDAGIGPADSLAASWAPVPGRLPAELAAAGI
FT                   GPADVRTVVLTHLHTDHVGWAGPLFPNADHLVQRAEVDALELFHPELPARLLTPLRAAG
FT                   RLRVVDGDTPLTPGVRLLHTPGHTPGHQSVLIEADDERLLITGDLLVHAIQLVDPELAY
FT                   AHEEDQPTARHSRQHLLTSLSPTVLATPHLTAPFTLHPPPRRS"
FT   gene            complement(486470..487420)
FT                   /locus_tag="ML5_0476"
FT   CDS_pept        complement(486470..487420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0476"
FT                   /product="Lactate/malate dehydrogenase"
FT                   /note="PFAM: Lactate/malate dehydrogenase; KEGG:
FT                   saq:Sare_4174 lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06027"
FT                   /inference="protein motif:PFAM:PF02866"
FT                   /protein_id="ADU06027.1"
FT                   /translation="MGKKVTVVGAGFYGSTTAQRLAEYDVFDTVVITDIVEGKPAGLAL
FT                   DLNQSRAVEGFETKVVGVTTGPNGEGYEAIEGSDVVVITAGLPRKPGMSRMDLLETNAK
FT                   IVRQVAENVAKYAPNAVVIVVSNPLDEMTALAQLATQFPKNRVLGQAGMLDTARFTNFV
FT                   AEALSVPVKSVRTLTLGSHGDTMVPVPSKSTVNGKPLRDVMPAEQIEELVVKTRNGGAE
FT                   VVALLKTGSAYYAPSAAAARMAKAVAEDSGAVMPVCAWVDGEYGISGVYLGVEAEIGAE
FT                   GVKRVVETDLDADELAALKEAAEAVRAKQGDVASM"
FT   gene            complement(487519..488382)
FT                   /locus_tag="ML5_0477"
FT   CDS_pept        complement(487519..488382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0477"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="KEGG: saq:Sare_4175 bifunctional
FT                   5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/5,10-methylene-tetrahydrofolate
FT                   cyclohydrolase; PFAM: Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain;
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06028"
FT                   /inference="protein motif:PRIAM:3.5.4.9"
FT                   /protein_id="ADU06028.1"
FT                   /translation="MTATILDGKATAAEIKDELRARVKALAERGITPGLGTVLVGEDPG
FT                   SQAYVNGKHRDCAEVGIASLRVALPADASQEQLDAALAELNADPACHGYIVQLPLPGHL
FT                   DTQRALESIDPDKDADGLHPVNLGRLVLGYDAPLPCTPRGIVELLRRHDVPLRGANVAV
FT                   VGRGNTVGRPLGLLLTRRSENATVTLCHTGTLDLAAHTRAADVVIVAAGVPGLLTADMI
FT                   NPGATVVDVGITRVIGEDGKGRYTGDVDPEVAEVAGKLVPMPGGVGPMTRAMLLTNVVE
FT                   RAERTA"
FT   gene            488773..490371
FT                   /locus_tag="ML5_0478"
FT   CDS_pept        488773..490371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0478"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: stp:Strop_3796 4-phytase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06029"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADU06029.1"
FT                   /translation="MRVRRLAAWAALPLAVTLGLTACGSGGGGGGAGDSDAAVRIEIAE
FT                   PQHLVPTNTNETSGSQVLSALFSPLVDYDEANKPHEVAADSVTTSDNKVWTVKLKPGYT
FT                   FHNGEKVTADNYIDAWNYGAYAPNGQNSSYFFEKVAGYDDLQGESPKATTMSGLKKVDD
FT                   LTFTVTLSQPYVDFKSMLGYTAFYPLPKAAFSAPGVLAEGYEQAPIGQGPFKMKGSWQH
FT                   DAKVEVERYDAFPGQQPKVGGVEFRIYQQPTAAYADVLSDNLDVIKTIPTENLSTAATD
FT                   LGDRFQQSPASSLQVLAFPTFQEEFSKPEVRKAISMAIDRDEITKSIFKDSQQPARSFV
FT                   SPVVAGYRENTIGTAGAFDPVKAKAMYEAAGGPKKIELSYNGDGGHKDWIDATCNQLKA
FT                   NLGVECVGTAEPKFADLLTKLKQKQPVGLFRMGWVMDYPSMENYLGPLYSTTGSSNYYG
FT                   YSNPEFDKLLAEGARAATEDEAIKKYQAAEDLLAQDMPVIPLRYGQNNFGHSTKVKNVH
FT                   VDLFDRVDLLKIERA"
FT   sig_peptide     488773..488841
FT                   /locus_tag="ML5_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.760) with cleavage site probability 0.252 at
FT                   residue 23"
FT   gene            490461..491399
FT                   /locus_tag="ML5_0479"
FT   CDS_pept        490461..491399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0479"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: saq:Sare_4177
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06030"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU06030.1"
FT                   /translation="MLRFILRRLLQMVLAFFGTTLIVYALMFAGQGDPIQALAGERPVT
FT                   AAQRAYLTEKYHLDATGVGGFFYRYFDYLGGLVQGDLGQSLTGRQISDILAAAWPVTLK
FT                   LAVIAMAVTVIFGVTAGVIAAIRRSGVFDHATLVLTLLVLGIPTIVLAPLAQYFLGVRW
FT                   PIFPPTAGAQPSFYALLLPGIVLGSLSLATALRLTRTSVTENLRADYVRTARSKGLRRR
FT                   RIVGVHVLRNSLIPVVTFLGVELGNLMGGAIITEGVFNVPGVGFNLFRGIRTEDGPLVV
FT                   GIVSVLVVVYLLSNLVVDVLYAVLDPRIRYE"
FT   gene            491418..492374
FT                   /locus_tag="ML5_0480"
FT   CDS_pept        491418..492374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0480"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: stp:Strop_3798
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06031"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU06031.1"
FT                   /translation="MSDFETVAATENQAARRGVSGEPGTPGRAGRPDRARSLAGDAWRD
FT                   LRRNPVFWISLLLVVLVAAMAVAPGLFAANDPRDCVLSRQHAGPSGGAVFGYDFQGCDT
FT                   FARAVYGARASLLVGAFSALITGVIALVVGMVAGYFGGWVDAVLSRVIDIVLGIPLLLA
FT                   AIVLLKRVSTSGETVRLFAVILVLALLGWTTAARVVRSSVITAREQDYVAAARMLGAGN
FT                   GRIMWRHILPNALAPAIVVLTIALGSFIAAEATLSFLGIGLKAPTISWGIDIDAGRVHM
FT                   RESATPLIVPSTFLALTVLAFIMLGDAIRDAFDPKLR"
FT   gene            492382..493419
FT                   /locus_tag="ML5_0481"
FT   CDS_pept        492382..493419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0481"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: saq:Sare_4179 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06032"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU06032.1"
FT                   /translation="MTQNAVRPTPASPTPPGGHLLEVRDLHVEFRTREGVARVINGVTY
FT                   HLDAGETLAVLGESGSGKSVTAQAIMGILDTPPAYVRAGQILYQGRDLLTRPEEERRQI
FT                   RGAEIAMIFQDALSALNPVFPVGWQIGESLRERAGMSRADARRRTVELMDLVRIPAAAK
FT                   RLGDYPHQFSGGMRQRVMIAMALALDPKVLIADEPTTALDVTVQAQIMDLLADLRRDLG
FT                   MALVLITHDLGVVAGVADRIAVMYAGRIVEHADVHALYRAPAHPYTKGLLESIPRLDVR
FT                   GQALSSIRGLPPNLMAIPSGCPFHPRCPYVQPVCVDEVPHDLVLADGRTSACHFAQEVH
FT                   DDRDG"
FT   gene            493403..494431
FT                   /locus_tag="ML5_0482"
FT   CDS_pept        493403..494431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0482"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: saq:Sare_4180 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06033"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU06033.1"
FT                   /translation="MTATAEPAKVRGETILAVDQLVKHFPISQGVLFKKTIGQVKAVDG
FT                   VSFELRRGETLGVVGESGCGKSTLARLLMRLETPTAGRVTLEGRDLLRAAGADLRRLRR
FT                   NMQMVMQDPYTSLNPRMTVGDIIGEPFEIHPEAAPKRSRRQRVQELLDVVGLNPEHVNR
FT                   YPHQFSGGQRQRIGIARALALRPEIIVCDEPVSALDVSIQAQVINLLEQLQDELGLSYI
FT                   FIAHDLSVVRHISDRVAVMYLGRIVEIGTEEQIYQRATHPYTQALLSAVPVPDPEARDR
FT                   RTIIRLTGDVPSPAEPPSGCHFRTRCWKAEEVCATQDPQAVPRAADPHPSACHFAEVRT
FT                   EA"
FT   gene            complement(494652..495101)
FT                   /locus_tag="ML5_0483"
FT   CDS_pept        complement(494652..495101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dgr:Dgri_GH10507 GH10507 gene product from
FT                   transcript GH10507-RA"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06034"
FT                   /inference="similar to AA sequence:KEGG:Dgri_GH10507"
FT                   /protein_id="ADU06034.1"
FT                   /translation="MRVRDRLTAVVVTLAFVLAGLGAAAAPAVTAPAVAPIVEALAAAR
FT                   PAPDVAPPVEALAAEPAAASASGTSPAALRAAYPRISWSELAAGPWDDHGGGLGYADGP
FT                   DDLAPAALPRMAGPAVPEPVVPAPRPPVVPLPPRGPLAARAPPAA"
FT   sig_peptide     complement(495024..495101)
FT                   /locus_tag="ML5_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.701 at
FT                   residue 26"
FT   gene            complement(495249..496823)
FT                   /locus_tag="ML5_0484"
FT   CDS_pept        complement(495249..496823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0484"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="SMART: AICARFT/IMPCHase bienzyme formylation region;
FT                   TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; KEGG: stp:Strop_3806
FT                   bifunctional phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06035"
FT                   /inference="protein motif:TFAM:TIGR00355"
FT                   /protein_id="ADU06035.1"
FT                   /translation="MNATEDAGRRPIRRALVSVYDKTGLAELARALHEAGVEIVSTGST
FT                   ASTISGAGVPVTPVEQVTGFPEILDGRVKTLHPKIHGGLLADLRKDAHAAQLDEHGIAG
FT                   IDLLVSNLYPFQATVASGADTDECVEQIDIGGPAMVRAAAKNHASVAVVTDPAAYPAVV
FT                   AALAEGGFTPARRRALAARAFADIADYDVAVADWFATTVSPAEDGWPEFAGLALRRQAV
FT                   LRYGENPHQAAALYTDPGAPAGLAQAEQLHGKEMSYNNYVDADAAWRAANDFADQPAVA
FT                   IIKHANPCGIAVGADVAEAHRKAHACDPVSAFGGVIAVNRPVDAAMAGQVAEIFTEVLV
FT                   APGFDEDALELLRAKKNLRLLRAPEFAVRPAEWRQVSGGVLVQTRDAVDAPGDDPSGWT
FT                   LATGDPADEVTLRDLAFAWRAVRAVKSNAILLARDGATVGVGMGQVNRVDSARLAVSRA
FT                   GDERARGSVCASDAFFPFADGPQILIDAGVRAIVQPGGSIRDEETIAACKAAGVTMYLT
FT                   GTRHFFH"
FT   gene            complement(496820..497440)
FT                   /locus_tag="ML5_0485"
FT   CDS_pept        complement(496820..497440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0485"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="KEGG: saq:Sare_4198 phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06036"
FT                   /inference="protein motif:TFAM:TIGR00639"
FT                   /protein_id="ADU06036.1"
FT                   /translation="MTEPASVARLVVLVSGSGSNLQALLDATADPGYGARVVAVGADRD
FT                   GIAGLDRAAAAGVPSFVERVKDHPTRADWDKALAARVAEHRPDLVISAGFLKLVGPEFL
FT                   AAFGDRYLNTHNTLLPAFPGIHGPRDALAYGVKVTGATLFFVDAGMDTGPIVAQVAVPV
FT                   QDDDDEDTLTERIKSAERRQLVEQVGRLVREGWTITGRKVTIP"
FT   gene            497619..497915
FT                   /pseudo
FT                   /locus_tag="ML5_0486"
FT   gene            497950..498510
FT                   /locus_tag="ML5_0487"
FT   CDS_pept        497950..498510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3808 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06037"
FT                   /inference="similar to AA sequence:KEGG:Strop_3808"
FT                   /protein_id="ADU06037.1"
FT                   /translation="MQPGYPGQDPYGQQPNQDPNAQPHDPYAQPPQAPQYGQQPPYGQQ
FT                   PQYGQQPTSGQPYGQPTSGQPAYGQDPYAQQQPYGAAPQYPAAGYPSGPGQGQGQNNTM
FT                   GLAGMIVGIASIVLGLCCPLLGVPAGIVAVVLGVLGQKKVQAGEASNAGQARAALICGA
FT                   VGVVVGIVSAIAGAAINMNNFGA"
FT   gene            complement(498581..499897)
FT                   /locus_tag="ML5_0488"
FT   CDS_pept        complement(498581..499897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06038"
FT                   /inference="similar to AA sequence:KEGG:Sare_4200"
FT                   /protein_id="ADU06038.1"
FT                   /translation="MSRVTPDQPRRPATGPPAGARPPGRARPAARVPAPRSGEEPRSRA
FT                   PLPVAAGVAALWAALTSWLPVSAVLGLAQLSEDAGSFGGALRAGLAGWLLGHGVPLQTT
FT                   AGPLGLAPLALSALAVWRLTRAGVHVSRAVGARGAGSPRQALTVAVAVGIGYALLGALA
FT                   AFAVDAGGLRVSPVTAALTFAAFGVPAALVGALRTTGVWALLAERCPPPVRDGLRTGLV
FT                   AALLLCGAGAGAAGLAVATGGGDAADMIGAYRTGVAGQAGITLVSLAYAPNATAWSASY
FT                   LLGPGFAVGTDTAVRTSEVSVGALPAVPLLAGLPRGPMDGLGGALLAVPVLAAMAAGWL
FT                   LARRLLRAAAEERTEVGWPALLLPAALAGPVAGALLGLFAAASGGSLGGGRLAEVGPSP
FT                   WAVAAVATLVIGVGAVLGAAATRTLTCPTPPPRATPAPR"
FT   gene            500056..500325
FT                   /locus_tag="ML5_0489"
FT   CDS_pept        500056..500325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06039"
FT                   /inference="similar to AA sequence:KEGG:Strop_3811"
FT                   /protein_id="ADU06039.1"
FT                   /translation="MHAPYPPPPPPPAVGRDRTTLWGVLGIVFGLLCCGILGIVFGALS
FT                   IRDARRNGRSQLLGWLAIAFGVINIVASAIVRARGNSYYPYWYR"
FT   gene            complement(500382..501269)
FT                   /locus_tag="ML5_0490"
FT   CDS_pept        complement(500382..501269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0490"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: stp:Strop_3812
FT                   succinyl-CoA synthetase subunit alpha; SMART: CoA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06040"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ADU06040.1"
FT                   /translation="MAIWLTKDSKVIVQGMTGSEGSKHTRRMLAAGTNVVGGVNPRKAG
FT                   TTVDFDGTELPVFASVADAMKETGADVTVIFVPPQFTKAAVVEAIDAGIDLAVVITEGV
FT                   PVHDTAAFWAYNRAQGERTRIIGPNCPGIASPGASNAGIIPADITGSGRIGLVSKSGTL
FT                   TYQMMYELRDIGFSTCVGIGGDPIIGTTHIDALAAFEADPETDAIVMIGEIGGDAEERA
FT                   AEFIKANVTKPVVGYIAGFTAPPGKTMGHAGAIISGSAGTADAKKAALEAVGVKVGKTP
FT                   TETANLMREIMSGR"
FT   gene            complement(501272..502450)
FT                   /locus_tag="ML5_0491"
FT   CDS_pept        complement(501272..502450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0491"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   KEGG: saq:Sare_4203 succinyl-CoA synthetase subunit beta;
FT                   PFAM: ATP-grasp domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06041"
FT                   /inference="protein motif:TFAM:TIGR01016"
FT                   /protein_id="ADU06041.1"
FT                   /translation="MDLYEYQGRDLFERHGLPVLAGGVATTPEEARAIAERLGGRVVVK
FT                   AQVKVGGRGKAGGVKLAEGAEETVARATDILGMDIKGHTVHKVMITVTADVAEEYYFSY
FT                   LLDRANRTFLCIASVAGGMDIEQVAAETPERVVKAPIDANTGVDEAKAREIVTAAGFPA
FT                   EIADQVVEVAVKLWQAFVAEDATLVEVNPLATTKDGKLLLLDAKVTLDENAGFRHPDHE
FT                   ALVDQASVDPLEQAAKAKDLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGERHGGVKPA
FT                   NFLDIGGGASAEVMANGLEIVLSDPSVKSVFVNVFGGITACDAVANGIVQALALLEQRG
FT                   EKATKPLVVRLDGNNAEAGRAILDGAANPLIQRVDTMDGAAERAAELAAAGV"
FT   gene            complement(502906..503310)
FT                   /locus_tag="ML5_0492"
FT   CDS_pept        complement(502906..503310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0492"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   saq:Sare_4204 cobalamin B12-binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06042"
FT                   /inference="protein motif:PFAM:PF02310"
FT                   /protein_id="ADU06042.1"
FT                   /translation="MSSRIRVVVAKPGLDGHDRGAKVVARALRDAGMEVIYTGLHQTPE
FT                   QIVETAIQEDADAVGLSVLSGAHMTLFKRVVELLTERDATDIVVFGGGIIPEADIPELE
FT                   RLGVAKIFTPGATTGSIVEWVRENVAQPVG"
FT   gene            503713..504423
FT                   /locus_tag="ML5_0493"
FT   CDS_pept        503713..504423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0493"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: saq:Sare_4205 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06043"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADU06043.1"
FT                   /translation="MRQRLSSEPDRYRGRRRVPTPPRSRYAAVVTTAFVGAGIVAIGAN
FT                   ALPDAKSVSPSVLDELRQASIASQDAAARADSAERPSRADRSDSKAAEQDPWLLPLHGY
FT                   DFKSPYGMRWGKLHTGIDLVAPEGTPYKAVHAGTVTKAGWFGGYGYAVIVQHSDGSEAI
FT                   YGHSSAVTVKEGQEVKAGDQLGLVGNTGHSYGSHLHLEIHVKGQPQDPVAFLKDRGVDI
FT                   QLEVEAVYSDVAAS"
FT   gene            504674..505447
FT                   /locus_tag="ML5_0494"
FT   CDS_pept        504674..505447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0494"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: stp:Strop_3816 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06044"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADU06044.1"
FT                   /translation="MKDPVQHSSPTPDNAPARHRRPRRARRTVYVVTGAVALLGLGIGG
FT                   VVVTTAPSDPTPAAVDLGVAARADDADRADRSAREPVTPSAVPASPSPSPSASATSPAP
FT                   KKTATAKPKPKPKKTTVAKKPTWVIPMKGADITSCYGPRWGTQHAGIDFAMPAGTPIHA
FT                   AAAGTVVKAGDVGDGYGISVFIDHHNGYLTHYAHQSRLAVGVGDTVKAGQVIGYEGSTG
FT                   DSTGPHLHFEVHQGAMWNQIDPAPFLRARGIGVAC"
FT   gene            complement(505518..507929)
FT                   /locus_tag="ML5_0495"
FT   CDS_pept        complement(505518..507929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0495"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /note="KEGG: saq:Sare_4207 ATP-dependent DNA helicase PcrA;
FT                   TIGRFAM: ATP-dependent DNA helicase PcrA; PFAM: UvrD/REP
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06045"
FT                   /inference="protein motif:TFAM:TIGR01073"
FT                   /protein_id="ADU06045.1"
FT                   /translation="MHPLFDIPTSPPAPESPPAPESRPTPPRRPGGAGSDPAALLDGLN
FT                   GPQRDAVTHAGSPLLIVAGAGSGKTRVLTNRIAYLLAARDVHPGEIIAITFTNKAAGEM
FT                   KERVAALVGPRARLMWVSTFHSACVRILRAEHEHAGLKSTFSIYDADDSRRLMQMVARE
FT                   LDLDPKRYPARGLAAQVSNLKNELVDPEEFAGRAKGPNERALAEAYTLYQRRLREAHAL
FT                   DFDDLIMTTVHLLQSHPHVAESYRRRFRHVLVDEYQDTNHAQYVLIKELVSGTEGIPPA
FT                   ELCVVGDADQSIYAFRGATIRNILEFERDFTDARTILLEQNYRSTQTILNAANAVIDRN
FT                   TSRKPKRLWSDAGSGEQIVGYVADTEHAEADWVAREIDRLVDDGETRPGDVAVFYRTNA
FT                   MSRVFEEVFIRVGLPYKVVGGVRFYERKEVRDALAYLRAVVNDDDTVSLRRVLNTPRRG
FT                   IGERAEACVEALSARDRISFGAALRRAKDAPGISTRAANGIAEFVALLDAARELAGTGT
FT                   PEEVLEAVLTRSGYLAELEESLDPQDAGRVDNLQELVSVAREYTERIEALGADDERATL
FT                   AGFLEQVALVADADQIPSDDPDHQGVVTLMTLHTAKGLEFPVVFLTGLEDGVFPHLRSL
FT                   GDTRELEEERRLAYVGITRARQRLYLSRAVTRSAWGAPAYNPPSRFLEELPPELVRWER
FT                   TEGSYTSWGGGGGGVGGRADRLGRSGFAGGTPKATELAKRLGVDASRLATASELKQAPK
FT                   VAVGDRVNHQRYGLGRVLAVEGAGPGARAQIDFGDQTMWLVLRHAPIDKL"
FT   gene            508219..508572
FT                   /locus_tag="ML5_0496"
FT   CDS_pept        508219..508572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0496"
FT                   /product="chorismate mutase"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase,
FT                   type II; KEGG: saq:Sare_4208 chorismate mutase; SMART:
FT                   Chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06046"
FT                   /inference="protein motif:TFAM:TIGR01808"
FT                   /protein_id="ADU06046.1"
FT                   /translation="MMTDVVESSGSLARHDRPAGGDPTGAAAARTGTDDAAAAERIGEI
FT                   RRRIDEIDRTLIALWQERAALSQEVGATRMASGGTRLVLSREREILERFRSELGADGTQ
FT                   LALLLLRAGRGPL"
FT   gene            complement(508658..509674)
FT                   /locus_tag="ML5_0497"
FT   CDS_pept        complement(508658..509674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0497"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: sen:SACE_0848 oligopeptide ABC transporter
FT                   ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06047"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU06047.1"
FT                   /translation="MTENIIEVRDLVKHYPVTRGVVFKKTIGHVKAVDGVSFDLKAGET
FT                   LGVVGESGCGKSTLARVLMNLEKPTGGQVLYKGQDISKLSGGALRRLRRQIQLVMQDPY
FT                   TSLNPRMTVGDLIGEPFEIHPEVAPRGSRRNKVKELLDLVGLNPEHINRYPHQFSGGQR
FT                   QRIGIARALALRPEVIVCDEPVSALDVSIQAQVMNLLEKLQTEFGLSYVFIAHDLSVVR
FT                   HLSDRVAVMYLGKMVEIGTEDEIYERPTHPYTQALLSAVPVPDPTVRESKAIIRLQGDV
FT                   PSPVSPPSGCRFRTRCWKAQDVCAQEVPLLQIRPGSDHPSACHFAEKREIVVTHEVA"
FT   gene            complement(509667..510695)
FT                   /locus_tag="ML5_0498"
FT   CDS_pept        complement(509667..510695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0498"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: sen:SACE_0847 oligopeptide ABC transporter
FT                   ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06048"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU06048.1"
FT                   /translation="MSEQSAPGADGSGRPSGRLLEVDDLRVEFRTRDGVAKVINGVTYH
FT                   VDAGETLAVLGESGSGKSVTAQTIMGILDTPPGFVTGGKVRFHGKDMLTMSPEQRRRIR
FT                   GEGIAMIFQDSLSALNPVFTVGFQIAEQFRIRRGMSRSDAKKRAIEMLDQVKIPNAKGR
FT                   FSNYPHQFSGGMRQRAMIAMSLALDPEVLIADEPTTALDVTVQAQIMDLLGELQRERQM
FT                   GMILITHDLGVVADVADRIAVMYAGRIVEEADVYDLYRKPAHPYTLGLLNSIPRMDEKG
FT                   QELRTIKGLPPNLMNIPTGCAFNPRCPMAQPMCREKVPPLLQLGNGRASACHFAEELVN
FT                   RD"
FT   gene            complement(510721..511704)
FT                   /locus_tag="ML5_0499"
FT   CDS_pept        complement(510721..511704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0499"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ami:Amir_0678
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06049"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU06049.1"
FT                   /translation="MSDPNTASIVSTPPATMPTEAGSGAPTNAGLPESAKQNKPRGLLG
FT                   DAWIDLRRKPLFWISATIILVFLVMAAFPWLFTSGDAVNGSLDRSRVEPSSAAWFGYDV
FT                   QGRDVYARVIYGARASIVVAVVSTFLTLLVGGTMGIIAGYRGGWVDALLSRIADIFFGL
FT                   PFVLGSIVILTTFNGSGTDNGEWTIMGLVILSLSVLSWPVVMRLMRSSVLATKEADYIV
FT                   AARALGAGTGRIILKHLLPNCLAPLLVYGTIMVGSFIGAEATLSFLGIGLRHPVVSWGI
FT                   MISEAQNYIRVSPYLLFFPAAFLVAAVLSFVMLGEAVREALDPKLR"
FT   gene            complement(511780..512706)
FT                   /locus_tag="ML5_0500"
FT   CDS_pept        complement(511780..512706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0500"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sen:SACE_0845 putative
FT                   peptide ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06050"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU06050.1"
FT                   /translation="MGRYLLRRLLQLVPVFIGTTFLIYWLVWSVPGDPFAGKCGDRGCP
FT                   PNYRAMMTEKYNLDESIWVQYASYMKNLLQGDFGITFGGREISDIIATSYPNTLKLAVV
FT                   ALAIEAVIGLGAGILTGLRRNGFLDNLVLVSTLFLIALPVFVIGFVLQWLLGVKWGIIN
FT                   PTVSNEMRFSELIVPGFVLGSASMAYIARVARTSIAENRRADYVRTAIAKGLPMRRVVG
FT                   VHLLRNSLIPVVTLLGTDLGALMGGAIVTEGIFGINGIGRQVLRSIVTKESATVVGIVV
FT                   VLVLVYLIMNLVVDLLYAALDPRIRYE"
FT   gene            complement(512851..514494)
FT                   /locus_tag="ML5_0501"
FT   CDS_pept        complement(512851..514494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0501"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: sen:SACE_0844 oligopeptide binding protein of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06051"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADU06051.1"
FT                   /translation="MRVSKRASGALAVGAAFALVASGCSSGNNDGGDAGASKDGAIVID
FT                   GTQPENPLVPANTTETGGGAIIDWMWSGLVEYPNNGGAPQNLLAESIDTSDSKVFKVKI
FT                   KQNTKFHDGTTVKAESFVKAWNWAAYGPNGAQNASFFSDIQGFDEVYTEDPDGPDGPQK
FT                   APEPKAKEMSGLKVIDDWNFEVTLSAPTAVFPTKLGYSAFVPLPDAFFSSTPADFGKKP
FT                   IGNGPVKLVSWQDDVEIKLTRFDDYSLRDKMKIKDVTVKIYQDDVAAYNDLVSNNLDFQ
FT                   QQVPVSALAGEKWKTDLAERAMASTTPSTGIIAFPIYDKRFQNPKLRKAISLSIDRQSI
FT                   TDKIFFGTRKPADSWANPLTPGAEPGNCTACKFDVAQAKQLLQEAGGFQGKLTLSYNAD
FT                   ASHKEWMEAVAQQIKTNLGIDAVAVGVPTFAVFRANINAYKMTGAYRAGWQQDYPDVEN
FT                   WINPLYVTGGSSNDGKYSNPQVDALAKEASAAPSIEEAHKKFAEAVKLIDQDVPSMPIY
FT                   FGGQQSGHSEKIKKLELTNVGELDITSVEL"
FT   sig_peptide     complement(514423..514494)
FT                   /locus_tag="ML5_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.440 at
FT                   residue 24"
FT   gene            complement(515081..515758)
FT                   /locus_tag="ML5_0502"
FT   CDS_pept        complement(515081..515758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0502"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: saq:Sare_4214 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06052"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU06052.1"
FT                   /translation="MSEQEPVEGTAPSGPLRVFLVDDHAMFRAGVRAELGTRVEVVGEA
FT                   SSVAEAVTRIAATAPDVVLLDVHMPDGGGRAVLEAMRRTHPQVRFLALSVSDAAEDVIG
FT                   LIRAGARGYVTKTISPEELTDAIRRVADGDAVFSPRLAGFVLDAFASRPDAPVADPELD
FT                   QLTNREREVLRLLARGYAYKEIAKELYISIKTVETHVSNVLRKLQMSNRYELSRWAADR
FT                   RLV"
FT   gene            complement(515760..516941)
FT                   /locus_tag="ML5_0503"
FT   CDS_pept        complement(515760..516941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0503"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; PspC
FT                   domain protein; KEGG: stp:Strop_3825 ATPase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06053"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU06053.1"
FT                   /translation="MAAGIAEHLGIPVLRVRVAFMVLLGLSGLGLLLYAAFWAVVPPRP
FT                   GDTAVPPRRDLAQLLPFVVIGLGVLLLQVVAFNSVGAAGTAGWLVAIIAVGAGVIWHQS
FT                   APERRRQWGDSAVPWLGAVVEESDRRAFVLRFIGGGVLVAVGIIGVAAVYSPAQNFDAV
FT                   LNGVIFALVGLAGVGVVTGPVLWRTWNQLRSEREGRIREQERAELAAMVHDQVLHTLAL
FT                   IQRNASDVKTVQRLARGQERSLRNWLYKPTASPTERFAAALEQAAAEVEDTFAITVEVV
FT                   VVGDRETDERVGAIVAAAREALVNAARHAGVQTVSLYAEVEPEQVSVFVRDRGKGFDPD
FT                   TVENHRHGVRGSIIGRMKRHGGRAEIRSEPGEGTEVRLILPISGSGSTAERDK"
FT   gene            517187..519037
FT                   /locus_tag="ML5_0504"
FT   CDS_pept        517187..519037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0504"
FT                   /product="PspC domain protein"
FT                   /note="PFAM: PspC domain protein; KEGG: saq:Sare_4216 phage
FT                   shock protein C, PspC"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06054"
FT                   /inference="protein motif:PFAM:PF04024"
FT                   /protein_id="ADU06054.1"
FT                   /translation="MNEDAARPPRPWAAAQDAPPPPPGAAPTDQAPPPPGGGTPFGGPP
FT                   PGGYAPPPGAAGFTTRYGLVRPREGRYLAGVCAAIGRATNTDPVLWRVLLAVLGFFGGI
FT                   GIIVYVAGWLIIPGEGDTASPVEAMLGRGRSSMSPITVIVLGIVVALGFAYVVTDGFRA
FT                   ILLGAVILIGGALLLNREQRGPAQRPAQPAPPHGPPPGPVPPVAWPAPPAPAPGTWTAA
FT                   PPAAQWTGTPAGPAHPAAAPSGGMPAEPGYPPAPASEPGYPPVSASEPGYPPAAPSEPG
FT                   HPATSDAEREPGHPGPTTGYPTLPAPGWPAAAGTRPGPSEPTTVAMQHVTGPVADTATW
FT                   PAYGANPAWPGARDAGARLDEPAAVPPPAPVGAPLPPGGYRPPFAPHGPYAGSPPVPPP
FT                   FPPPVRPPRPPKRPKERSPLGAITFSLIFLALGMVAMLDLLDVFPVGAAGYFAAVLATI
FT                   GLGLLVGTWFGRARWLIALGLVTAAALGIATVAESYDRVRGIDGNVTWAPTDLRDLADR
FT                   YENNLGDATLDLRGIDFDKQDVQVTVDVNLGNATVVVPPDVDVTTVADVNAGDATVFGR
FT                   RSGGLGGRQWETTDPGADGPGGGKLRLYVHVNAGKLEVTR"
FT   gene            519034..519471
FT                   /locus_tag="ML5_0505"
FT   CDS_pept        519034..519471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06055"
FT                   /inference="similar to AA sequence:KEGG:Sare_4217"
FT                   /protein_id="ADU06055.1"
FT                   /translation="MKAHRTDIVSFAFGLVFLGLSVWWLLARILGLSVPPVGWFLAGGL
FT                   VLIGLLGLIGALRSGRPPEQPTTQPAPDVTVSAPYGSPAAGAETAGGAETIAGPETPDR
FT                   ADEWATEATTDSAEPATRELPPLDPPADEAAPQRRTPGDPA"
FT   gene            519628..520875
FT                   /locus_tag="ML5_0506"
FT   CDS_pept        519628..520875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0506"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="TIGRFAM: phosphatidylserine decarboxylase related
FT                   protein; KEGG: saq:Sare_4218 phosphatidylserine
FT                   decarboxylase related protein; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06056"
FT                   /inference="protein motif:TFAM:TIGR00164"
FT                   /protein_id="ADU06056.1"
FT                   /translation="MTQSPAVRVTAPSGAVRIGERAARTLVSEFARRNDPKAGLLVGAT
FT                   PESAVLAAAIEALLPGDRLTVVPAEGAAAAALREHVTAQGRWVADRVRVVDTLAEADAA
FT                   AVVVVAEPFTGTADEARVAIDGLAKYLAEGAVLSVAAPLFRTEGADGELDRQGVLHGVR
FT                   TDLVLRNTPPVRVHHLRFTPAPVALAASLSPAYRPSSVPLTRGMHIDSNGVAAAGITLG
FT                   LAALARAARPKSKLWLLPALAAAPVAAFFRDPERDVPEDPSAVVASADGQVLSVQRLQD
FT                   ERFGDGEWLRIAVFLSVLDVHVNRAPVAGKVVDYFVADGGFVNAMKPDAEHNVAAYTVL
FT                   DTDHGTVVVAQRTGLIARRIVQRAPVGSLLARGERFGLIRFGSRTDVYLPADAADPLVG
FT                   PGDKVVGGATVIARWR"
FT   gene            complement(520934..521848)
FT                   /locus_tag="ML5_0507"
FT   CDS_pept        complement(520934..521848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0507"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   saq:Sare_4219 CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06057"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ADU06057.1"
FT                   /translation="MRRSSTFARQVLLVRVGRRDGAAVSGTDLVTPDHRYADRQRLRYG
FT                   RLDTDIEAVRPISPALPPATPVDDESPAMSIPLLPGERTAARRAKFALVNACTLSSLML
FT                   GMLAIFLAMRGEVQIAAICLIACVAFDGLDGALARKLGVASPFGAQMDSLADMCSFGLA
FT                   APVVVYASLAGSVPPAAAAVSCALVAACAAVRLARFNVSPKDGRFFCGVPTTMAAAVLA
FT                   LTVAIGVPVPGLVMVAGVALLAFAMVSSFPYAKLARLLKLPPWLWLAPVVGALVDIRLT
FT                   FALVVVGYLVSGPLLWLHQRRTA"
FT   gene            complement(522194..523105)
FT                   /locus_tag="ML5_0508"
FT   CDS_pept        complement(522194..523105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0508"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: saq:Sare_4220 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06058"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADU06058.1"
FT                   /translation="MEQRRRVGAYGVLRDSDGRVLLARGSARCPYPGVWQLPGGGVEHA
FT                   EHPADTVVREFAEETGLTVAPGAIRAAVADVAAFADLGIALHTDRLVFEVEARGGRLRP
FT                   EPAGGSDEVGWFTPDEAAARQLMPFTAELLGLPVTPLPADLPRALPAEPAGPSVDRRQR
FT                   FAAYGLVTDPADRVLLTMIADGYPGAGRWHLPGGGTDHGEQPAAGLLRELVEEAGQLGR
FT                   VVDLIAVDNLHNPAALGPEGRPLDWHGVRVIYRVRVDAPTDAVVTELAGGSTARAAWFA
FT                   PEQVTGLSMTDVAARATGQRVS"
FT   gene            complement(523250..524197)
FT                   /locus_tag="ML5_0509"
FT   CDS_pept        complement(523250..524197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0509"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: stp:Strop_3831 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06059"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADU06059.1"
FT                   /translation="MTTSLEPLRRIAAYAVCADSNGRVLLVRASERSGTPGTWSLPGGA
FT                   VDHGEDPKHTVVRETAAETGLSVAVAGLQDVLADMRALPERHITIHTDRLLYTVSVRGG
FT                   TLTERVDRPTDLARWFTLDEARELPLRSFTARALGLPTSTDDIVPEEVPEFPSFYAVPG
FT                   PDGLHRAQRFAAYAVVTDPEERVLLTRVSDGYPGAGCWHLPGGGTDYGEQPGAALIREL
FT                   VEETGQTGRLVELLGVASHRDAASLGPEGYPIDWHGVRAFYRVVVDQPAPPTVADIGGS
FT                   TCEARWFRREELGALPTDRLTEVTAEAVQAAHLL"
FT   gene            524342..524704
FT                   /locus_tag="ML5_0510"
FT   CDS_pept        524342..524704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0510"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: saq:Sare_4222 phage
FT                   shock protein C, PspC"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06060"
FT                   /inference="protein motif:PFAM:PF04024"
FT                   /protein_id="ADU06060.1"
FT                   /translation="MTFPNPSQAPYKQLRRPVSDRMIAGVASGLGRYFAADPTLIRVIF
FT                   ATATVLTGGLAALAYPIMWFLMPEEPAGAPAWPHPPGTAPGWPPVPPAGPVPPGTPTEP
FT                   RTPGGPQAGPQTPPAA"
FT   gene            complement(524711..526267)
FT                   /locus_tag="ML5_0511"
FT   CDS_pept        complement(524711..526267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0511"
FT                   /product="GMP synthase, large subunit"
FT                   /note="KEGG: saq:Sare_4223 GMP synthase; TIGRFAM: GMP
FT                   synthase, large subunit; GMP synthase, small subunit; PFAM:
FT                   GMP synthase domain protein; glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06061"
FT                   /inference="protein motif:TFAM:TIGR00884"
FT                   /protein_id="ADU06061.1"
FT                   /translation="MSTPRPVLVVDFGAQYAQLIARRVREAKVYSEIVPHSMPVSEMLA
FT                   KNPAAIILSGGPASVYAADAPQIDAGMFDAGVPVFGICYGFQAMAQVLGGTVARTGNRE
FT                   YGGTPLRPRLTEPGVLLRDLPADLPVWMSHGDCVTEAPDGFTVTAESAGAPVAAFEDLA
FT                   GRRAGVQFHPEVGHTAHGQEMLSRFLYDIAGIEPTWTPSNIIDEQVARIREQIGDKEVI
FT                   CGLSGGVDSAVAAALVHRAVGDQLTCVFVDHGLLRAGEAEQVEKDYVAATGIKLKVVDA
FT                   RERFLGALAGVTDPEQKRKIIGREFIRVFEAAAREIAAHGDVEYLVQGTLYPDVVESGG
FT                   GTGTANIKSHHNVGGLPEDLKFALVEPLRTLFKDEVRTIGLELGLPEAMVWRHPFPGPG
FT                   LAIRIIGAVDEERLAVLRKADLIARQELTAAGLDRGVWQFPVVLLADVRSVGVQGDGRT
FT                   YGHPVVLRPVSSEDAMTADWSRLPYDVVARISTRITNEVAEVNRVVLDVTSKPPGTIEW
FT                   E"
FT   gene            complement(526387..528069)
FT                   /locus_tag="ML5_0512"
FT   CDS_pept        complement(526387..528069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0512"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   saq:Sare_4224 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06062"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADU06062.1"
FT                   /translation="MRYDVLVIGSGFGGSVTALRLAEKGYTVGVLEAGRRFADDEFPRT
FT                   SWRARRFLWAPRLGCFGLQRITLLRSADRKAGGGVLVLSGAGVGGGSLVYANTLYEPLD
FT                   AFYADPQWRNITDWRDELARHYDQAKRMLGVTTYPIDTRADQAVRAVAERMGVAHTYHP
FT                   TPVGVHIGRPGERVADPYFGGAGPDRTGCSHCGSCMTGCRHGAKNTLVKNYLWLAERLG
FT                   VQVHPLTTVTAVRPDPAGGYAVHTERTGAWLRKRREVIHADQVVFAAGALGTQRLLHEM
FT                   KSTGALPALSPRLGELTRTNSEAILGASVAPGAARKRGLDFTEGVAITSSFHPDAQTHI
FT                   EPVRYGKGSNAMGLLQSLLVDGGPRRVRRWLGSIVRQPVLAARMLSVRRWSERTVIALV
FT                   MQSVDNSLTTRYRKGRLVSGPGHGAPNPTWIPAGNTAARLLAEEIGGTPGGAVTEPFNI
FT                   PVTAHILGGAVIGATPDEGVIDPWHRVYGHPGLHVVDGAAVSANLGVNPSLTITAQAER
FT                   AMSYWPNKGEADPRPALGSAYTRVEPVPPRRPAVPAHAPAALR"
FT   gene            528211..529311
FT                   /locus_tag="ML5_0513"
FT   CDS_pept        528211..529311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0513"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: saq:Sare_4011 cell envelope-related
FT                   transcriptional attenuator; TIGRFAM: cell envelope-related
FT                   function transcriptional attenuator, LytR/CpsA family;
FT                   PFAM: cell envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06063"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADU06063.1"
FT                   /translation="MTRRRLLGLAALVAALLVATGAVVTTRLVANRPAAPAAGPSTAPP
FT                   ASPTPAPTTASPTPPPGADLKGPLNLLLVGVDTRVSIPGWEPHADAVLLLHVPAGLDKA
FT                   YLFSLPRDLVVDIPPYPKARYPGGRTKLTHAMSYGSRVPGDKRNPSTAQGYELLRTTVS
FT                   RYTGLRIDAGAVITFGGFDKLVDTLGGVDLYVDQRVESRHRRPDGTMRTLTGGGYTGPQ
FT                   MVYEKGTRHLTGWQALDYARQRYTAGGDYTRQRHQQQLLRALARKILDQGTARDPQRVE
FT                   QVVAALGKTLVYAGGGRKLIDYAYVLGGLPADRLTLVVLPGAGVSSGGAYRGEQLKPLG
FT                   RDFLTALRGRRADAFLAAHPSLRVKN"
FT   sig_peptide     528211..528276
FT                   /locus_tag="ML5_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.543 at
FT                   residue 22"
FT   gene            complement(529317..530774)
FT                   /locus_tag="ML5_0514"
FT   CDS_pept        complement(529317..530774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0514"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: saq:Sare_4225 peptidase M1 membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06064"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ADU06064.1"
FT                   /translation="MTRRGARRRIGLLTCGTLLLAGCGSAEPDPGPSSPAGPAPATSRS
FT                   FAPGAAGAGDAYFPSYGNGGYDVAHYTVKVRYDPETDKLSGTTTLRATATADLSAFNLD
FT                   LAGLTVRSVTVDGTAARHSRTEDELVITPAIGLTSGNGFTAEIRYDGRPEALRTEALGE
FT                   GGWLHTVDGAIALGQPESASTWFPVNDHPSDKATYDMEITVPKGLTAVSNGVPKGKATS
FT                   GAWTTWKWSETAPAASYLTTVAIGKFRVTTGQHKGRPVYSAVTTQVAQGAPDRSVARTV
FT                   EVADYLESVFGPYPFDSYGGVVIADERIRYALETQSRPVYSASFFRQGDNTGVVAHELA
FT                   HQWYGNSVSIQRWQDIWLNEGLATYAEWLWAEHSGSTTVQRMFEQRYANAGGQVWRTPP
FT                   GKPGVANLFSRSVYDRGGMTVHALRVAVGDTAFFTILRTWAAERKNGNATTADFVALAE
FT                   RISGKKLAKVFDPWLYGTERPPAPKPL"
FT   sig_peptide     complement(530694..530774)
FT                   /locus_tag="ML5_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.934 at
FT                   residue 27"
FT   gene            complement(530864..532258)
FT                   /locus_tag="ML5_0515"
FT   CDS_pept        complement(530864..532258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0515"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: saq:Sare_4225 peptidase M1 membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06065"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ADU06065.1"
FT                   /translation="MGRGRVWAAGLVTAALALSGCTGGDDNGFRPGAADAGDPYVPGAG
FT                   NGGYDVGHYALDVRYDPASDRLTGTATLTVTATRALSRFQLDLAGLDVERVRVDGEAVK
FT                   HRHDGAELIVTPSGGLPSGRRFTVEITYGGVPKPLPNAELGDGGFHATPDGAIALGQPE
FT                   SASTWYPVNDHPSDKATYDLAVTVPDGLAALSNGVPEGRTSSGGWTTWRWAERAPMASY
FT                   LSTLVIGDYRVSSGTHAGKPLVTAVAAALPADGPAAASVARTGEVADFLAARFGPYPFE
FT                   AYGGVVVADERIRYALETQSRPVYGPAFFRGDRPNTEVVAHELAHQWFGDSVSVARWSD
FT                   IWLNEGFATYAEWLWAEHDGGRTVAQTVVERYAATDWSRPTVDPGRAGMFGDAVYQRGA
FT                   LAVHALRRAVGDEAFYRVLRGWLAQHRDGNVTTADFIGYAERTSGRPLRALLDAWLVGG
FT                   TPPGLP"
FT   gene            complement(532347..533465)
FT                   /locus_tag="ML5_0516"
FT   CDS_pept        complement(532347..533465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0516"
FT                   /product="IMP dehydrogenase family protein"
FT                   /note="KEGG: stp:Strop_3836 IMP dehydrogenase family
FT                   protein; TIGRFAM: IMP dehydrogenase family protein; PFAM:
FT                   IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06066"
FT                   /inference="protein motif:TFAM:TIGR01304"
FT                   /protein_id="ADU06066.1"
FT                   /translation="MRDVVEIGLGKTAQRGYHLDDIAIVPSRRTRDVDDVSTAWQLDAY
FT                   QFGIPCVAHPSDATMSPASAVRLGQLGGLGVLNVEGLWTRYENPAKILEELAGLGEDAR
FT                   ATKRLQEVYAEPIRPDLIAERVRELREGGGTVAVRVSPQHTLALAPVILDAGVDILVIQ
FT                   GTLVSAEHVSTTDEPLNLKEFIADLDLPVVVGGCTDYKTALHLMRTGAAGVIVGIGGDD
FT                   WSTTESVLGIRVPMATAIADAAAARRDYLDETGGRYVHLIADGDMQTSGDIAKALGCGA
FT                   DAVMLGEPLSLCEEAPAGGAWWHSAASHPSLPRGAFEVAGEPLGSMEQLLFGPADEPDG
FT                   QLNLFGGLRRAMAKCGYRDLKEFQKVGLVLDR"
FT   gene            complement(533497..535059)
FT                   /locus_tag="ML5_0517"
FT   CDS_pept        complement(533497..535059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0517"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="SMART: CBS domain containing protein; TIGRFAM:
FT                   inosine-5'-monophosphate dehydrogenase; KEGG: saq:Sare_4227
FT                   inosine-5'-monophosphate dehydrogenase; PFAM: IMP
FT                   dehydrogenase/GMP reductase; CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06067"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ADU06067.1"
FT                   /translation="MENSPSTEIPAGTDGGELGGHLPELPAGSARVVPLGLTFDDVLLQ
FT                   PGESDVVPSRVNTRTRLTRNIELTVPLLSSAMDTVTEARMAIAMARQGGIGVLHRNLSV
FT                   EDQALQVDLVKRSESGMITNPVTASPDDTLREVDALCGRYRISGVPVVDGQGQLVGIVT
FT                   NRDMRFVSDPATPVREIMTRTPLITAPVGVSKDDALGLLRQHKIEKLPIVDAGGKLRGL
FT                   ITVKDFTKSEQYPNATKDDAGRLRVAAAVGVGEDGYKRARALVDAGVDVVIVDTAHGHQ
FT                   RAVLEMVARLKRDVTIDIVGGNIATYAGAKALVEAGADGVKVGVGPGAICTTRIVAGVG
FT                   VPQITAIMEAARAAGPAGVPVIGDGGIQYSGDIAKALVAGADTVMLGSLLAGCEESPGE
FT                   LIFINGKQYKAYRGMGSLGAMQSRGQGKSYSKDRYFQQDVLAEDKLVPEGVEGQVPYRG
FT                   PLSAVAHQLIGGLRAAMGYVGAESIPELHRRGQLIRITAAGLKESHPHDIQMTVEAPNY
FT                   HSR"
FT   gene            535257..535661
FT                   /locus_tag="ML5_0518"
FT   CDS_pept        535257..535661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06068"
FT                   /inference="similar to AA sequence:KEGG:Strop_3838"
FT                   /protein_id="ADU06068.1"
FT                   /translation="MHDEPIDPFNGDPADPAAGLHDPGDDDALDPLSEVERQDVLEDLA
FT                   DLEIYQALLQPIGVRGLVIECEDCREPHYFDWDLLRGNLRHLLNSGRPRVHEPAYDPDP
FT                   DHYVSWDYARGYADGVHDTLTEGTDDSAQE"
FT   gene            complement(535674..536492)
FT                   /locus_tag="ML5_0519"
FT   CDS_pept        complement(535674..536492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0519"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: stp:Strop_3839 regulatory protein, LuxR; PFAM:
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06069"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADU06069.1"
FT                   /translation="MRSVLVCVRTPLAAQHLTSAAARLGLSGVVRTAVSDPEVMLRLAE
FT                   RPVDVVLADTALTRPDSAGFVRRVLARAPQAAVLLLGAEESESAAATISAGARGLIQNA
FT                   DHDLTSAVAKALLLLSAPGRSNRHRVADTARDAAAVGGPTRPAAPGRTQGGPGWPATAP
FT                   VDAAGLPTVVPVQRGEDPDDPAAADGAEAPRPGAAQRPARSPRSAIGLTERELQVLLGM
FT                   AEGKSNAEIGRELFVSEDTVKTHARRLFRKLGARDRAHAVAAGFRAGLVA"
FT   gene            536745..537128
FT                   /locus_tag="ML5_0520"
FT   CDS_pept        536745..537128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0520"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: gob:Gobs_4450
FT                   transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06070"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ADU06070.1"
FT                   /translation="MSNVRRLPGPIDELWDWQRLGACRGRDSAQFFHPDGERGSSRLRR
FT                   EMGAKSVCRACPVRAECAAHALSVREPYGVWGGFSESERLRLLALGWEDLADRRQTKVD
FT                   IARLEARLGRPHNTAVPDQRKVA"
FT   gene            complement(537301..539010)
FT                   /locus_tag="ML5_0521"
FT   CDS_pept        complement(537301..539010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0521"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG: saq:Sare_4230
FT                   oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06071"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ADU06071.1"
FT                   /translation="MPLRNADDIGSRAGGSTRLDAVSTLSRRRAALAGVVAAVVALGTA
FT                   EPVAVLTGPRSAPLVAVGGLVVDLVPEPVKQFAIDVFGTYDKIALLVGTALLLAAFGAL
FT                   LGLAAARRLVVGLAGVAAFAVLGVAAALTRAGANAFDALPSLVGGGLGALTLWAFVAGP
FT                   LGAGPARREQAGRDRADAADRPPSAPPPAVAALAGEERTPGGWEPVRHDDDAESRRRFL
FT                   RGAGLLTGAAAVAGLGGHWLAGRRGVSAAREAVTLPAPAVPAPQVPAGADLSLPRLAPY
FT                   VTPNREFYRIDTALVVPQVDPATWRLRIHGRVRNPIELSFDDLLARPMVERYVTLACVS
FT                   NEVGGDLIGNARWLGVPIRELLDEAGPEEGADQVVGRAVDGWTCGTPTSVLRDGRDALL
FT                   AVGMNGEPLPIQHGFPVRMVVPGLYGYVSACKWLTELELTSFADFDAYWVPRGWSAQGP
FT                   IKTQSRIDTPRPRSRPAAGPVIVAGVAWAQRRGIRRVEVRVDGGPWQEATPAPAVSADT
FT                   WVQWSWRWDATPGEHTLQVRATDTTGETQTEQRAPVAPDGATGWHTVRVTVT"
FT   gene            complement(539071..540714)
FT                   /locus_tag="ML5_0522"
FT   CDS_pept        complement(539071..540714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0522"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: saq:Sare_4231 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06072"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADU06072.1"
FT                   /translation="MAKILSFSDDARHLLEHGVNALADAVKVTLGPRGRNVVLDKKFGA
FT                   PTITNDGVTIAKEIELTNPYENLGAQLVKEVATKTNDVAGDGTTTATVLAQAMVREGLR
FT                   NVAAGTNPTGLKRGIDAAAAKVSEALLGKAVEVAGKESIAHVATVSAQDAAIGDLIAEA
FT                   MEKVGRDGVITVEEGSALTTELEVTEGLQFDKGFISPNFVTDLEAQEAVLEDPYILITT
FT                   QKISAIEELLPLLEKVLQNNKPLLIVAEDVEGQALSTLVVNALRKTVKVCAVKAPGFGD
FT                   RRKAMLQDMAILTGAELVAPELGYKLDQVGLEVLGTARRVVVDKENTTVVDGGGQASEV
FT                   ADRVAQIRKEIEASDSEWDREKLAERLAKLSGGIAVIKVGAATEVEMKERKHRIEDAIA
FT                   ATKAAVEEGTVPGGGAALAQILPALDDDLGFTGDEKVGVSIVRKALVEPLRWIAQNAGH
FT                   DGYVVVQKVVAQDWGHGLDAATGEYVDLAKSGIIDPVKVTRNAVSNAASIAGLLLTTES
FT                   LVVEKPAEPEPAAGGHGHSHGHGHQHGPGF"
FT   gene            complement(540785..541093)
FT                   /locus_tag="ML5_0523"
FT   CDS_pept        complement(540785..541093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0523"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: saq:Sare_4232
FT                   chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06073"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADU06073.1"
FT                   /translation="MTTATKVAIKPLEDRIVVQANEAETTTASGIVIPDTAKEKPQEGT
FT                   VLAVGPGRIDDKGNRVPIDVKVGDTVLYSKYGGTEVKYAGEEYLVLSARDVLAVIEK"
FT   gene            541354..542586
FT                   /locus_tag="ML5_0524"
FT   CDS_pept        541354..542586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0524"
FT                   /product="RNA methylase"
FT                   /note="PFAM: RNA methylase; KEGG: saq:Sare_4233
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06074"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ADU06074.1"
FT                   /translation="MDLDQLAALRTPEGSAALAAAERVAGGDPLAAAAALRSAGIPGGL
FT                   AAAALTQAELRRRAVGKFGAAAAGMFLTRAGLEQATRRAVADRRAARLRAAGVTTLADL
FT                   GCGLGADALAAARAGIWVYAVEADPVTAAMAAANAEAAGLADLVTVERGDATAFDATGV
FT                   DAVFCDPARRRAGTGRRVFDPNAYSPPWDFVTGLAARVPRTVVKVAPGLDHALIPAGAE
FT                   AEWVSVDGDLVEAALWCGELAEVPRRATLLREKEGPLLNASGSKRVPSYHLTGTGAQEA
FT                   PVGPVRRFLYDPDPAVVRAHLVAELAADLDATLADPSIAYLYADEARPTPFARCLEITD
FT                   VLPFSLKRLRALLRERRVGRVEIRKRGSALEPEKLRRDLRLSGDEAAGLALTRVAGDPT
FT                   VLVCRPVPPGG"
FT   gene            542642..543121
FT                   /locus_tag="ML5_0525"
FT   CDS_pept        542642..543121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0525"
FT                   /product="ybaK/ebsC protein"
FT                   /note="KEGG: saq:Sare_4234 YbaK/EbsC protein; TIGRFAM:
FT                   ybaK/ebsC protein; PFAM: YbaK/prolyl-tRNA synthetase
FT                   associated region"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06075"
FT                   /inference="protein motif:TFAM:TIGR00011"
FT                   /protein_id="ADU06075.1"
FT                   /translation="MAGPGTPAIALLSKRKIAHSTHTYDVSPGAPNYGALVATALGVAP
FT                   ERVFKSLVTEVDGGLTVAVVPVTGELDLKALAAAAGGKRATMAERTTAERATGYVRGGI
FT                   SPLGQRKRLPTVIDASALTHPTVYVSAGRRGLQVQLAPTDLVALTGATTASIATA"
FT   gene            543325..544428
FT                   /locus_tag="ML5_0526"
FT   CDS_pept        543325..544428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06076"
FT                   /inference="similar to AA sequence:KEGG:Strop_3846"
FT                   /protein_id="ADU06076.1"
FT                   /translation="MRKGFLTFAAVGLLATGSMAACGDNGGSSDEAGGSNAKKPKIGVI
FT                   LPDSKSSARWEGADRKYLKAAFDAAGVESDIQNAQNDKTAFQTIADQMITNGVNVLMIV
FT                   NLDSGTGKAVLDKAKSQGVATIDYDRLTLGGSAQYYVSFDNEAVGKLQGEGLSKCLTDK
FT                   GVKNPSIAYLNGSPTDNNATLFKNGYDSVLKPKFDSKEYTKVADDSVPAWDNAQAATIF
FT                   EQQLTKAGGKIDGVLAANDGLGNAAISVLKKNKLNGKVPVTGQDATKEGLQNILAGDQC
FT                   MTVYKAVKKEADAAAELAIALAKGERKDTGQTVKDPEGGRDVPSVLLEPKAIYKDNVKD
FT                   VVADGYVTKEELCTGAFAKLCTDAGVS"
FT   sig_peptide     543325..543396
FT                   /locus_tag="ML5_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.688 at
FT                   residue 24"
FT   gene            544470..545345
FT                   /locus_tag="ML5_0527"
FT   CDS_pept        544470..545345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0527"
FT                   /product="ABC transporter related protein"
FT                   /note="manually curated; PFAM: ABC transporter related;
FT                   KEGG: saq:Sare_4237 ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06077"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU06077.1"
FT                   /translation="MPGGARAGRDPRPPSAQRRTPCPQPPLLELRGIDKSFGPVQVLRD
FT                   VAFAAHAGEVTALVGDNGAGKSTLVKCISGIHPTDAGEFVFDGRPVTINSPRDAAALGI
FT                   EVVYQDLALCDNLDIVQNMFLGREKRSGIVLDEPTMEQMAAETLAGLSVRTVKSLRQHV
FT                   ASLSGGQRQTVAIAKAVLWNSRLVILDEPTAALGVAQTAQVLELVRRLADNGLAVVLIS
FT                   HNMNDVFAVSDRIAALYLGQMVAQVKTTDITHSQVVELITAGRSGSLGLTGEPGGNGAA
FT                   PADTTPGAVR"
FT   gene            545342..546601
FT                   /locus_tag="ML5_0528"
FT   CDS_pept        545342..546601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0528"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   stp:Strop_3848 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06078"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU06078.1"
FT                   /translation="MTAIVVKKEGPAGVTPTPTVGSHVNNYWRRVRGGDIGALPAVVML
FT                   VALAVGFSIARPSFFTAGNLANLFTQGAAVTLIAMGLVFVLLLGEIDLSAGFASGVCAA
FT                   ILANVVTVLGYPWYVAVLSAVVTGVVIGTVLGLLVAKVGIPSFVVTLAGFLAFQGVVLT
FT                   LMDEGANIAVRDDVLVAIANRNLSPVLGWSLAAVAVAGYAAVQLLRHRNRAARGLLTDP
FT                   IAVVAARIAGLAVILGVAVYVLNLERSRNVLVVSLKGVPIVVPIIAILLVVWTFVLQRT
FT                   SYGRHIYAVGGNAEAARRAGINVDRIRISVFIICSSMAAIGGIVAASRANSVDPNTGGS
FT                   NVLLYAVGAAVIGGTSLFGGKGRVLDAVLGGAVVAVIDNGMGLMGYSSGVKFVVTGVVL
FT                   LAAATIDALSRRRAAATGTR"
FT   gene            546621..547808
FT                   /locus_tag="ML5_0529"
FT   CDS_pept        546621..547808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0529"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: saq:Sare_4239 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06079"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADU06079.1"
FT                   /translation="MAVAMRAGPSQDEIRRQNLGALLRYVHVHGATTRAELTTALGLNR
FT                   STIGALTADLAGAGLVSEGTPKETGRAGRPSLVVRPESGRVYAYAYSVEVDRLRAARVG
FT                   LGGEVLDRREMDRPRNLVAGEAAPLLAGAVKEMHQSVPPDAICVGAGVAVCGMVRREDG
FT                   LVRLSPTTGWVDEPIGAALAVELGIDVPITVGNVADVAAYAEHARGAAVGCDNVIYIYG
FT                   DVGVGAGIIAGGRRLRGHGGYGGEVGHMVVVRDGVRCDCGRRGCWETEIGEHGLLRAAG
FT                   RSEARGRDALLAVFDAADRGDARAQTAVRQAGDWLGFGVANLVNIFNPEMVIFGGTMRD
FT                   LYLASAAQVRSRLNSNGLPACLEHVRLRTPKLGGDAALIGAAELAFERLLADPLN"
FT   gene            547907..548644
FT                   /locus_tag="ML5_0530"
FT   CDS_pept        547907..548644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scb:SCAB_20771 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06080"
FT                   /inference="similar to AA sequence:KEGG:SCAB_20771"
FT                   /protein_id="ADU06080.1"
FT                   /translation="MASLESARRKLAHRVVLLLAALGAGIGVIPGTAQAAPNPGVQMNA
FT                   ADMTLLNGVRLAGLWEMPAGQMAAEKGQSARVREVGAEIAKQHAELDLLVVEAANKLGA
FT                   TLPTDPTAEQKGWLTEMQNATGARFDQIFVTRLRVAHGKIFPVIGAVRASTRDPIVRKL
FT                   AEDANTFVNDHMTMLESTGLVRWQQLPPAALPPAQSDSLVAAAQANVGSGGGLQVGTGV
FT                   VWAVFLIALGTGGYATWRLTRRT"
FT   sig_peptide     547907..548014
FT                   /locus_tag="ML5_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 36"
FT   gene            complement(548698..550467)
FT                   /locus_tag="ML5_0531"
FT   CDS_pept        complement(548698..550467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0531"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sro:Sros_8452 ABC-type multidrug transport
FT                   system, ATPase and permease components; PFAM: ABC
FT                   transporter related; ABC transporter transmembrane region;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06081"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU06081.1"
FT                   /translation="MSNALPVADIAQVRRYVRELIRRHPRGLAVALGLHALAAGAGLVA
FT                   PRLLGDLVEGISQGIAATTVDRVVAAIAAFVVVQAVLVRFAHLASARLGERVLAELREE
FT                   FVDRVLALPLATVERAGTGDLLTRTSRDVAALSRTVRFAGPETLIAALTVLLILGALVL
FT                   TGPLLALPSLLAVPVLWAGTRWYLRRAPQGYLRENAAYSDITDGISETVEGARTTEALR
FT                   QAARRRARGDADISRSYAAERYTLYLRTVFWPVAEFGYLVPMVATLLIGGWFHLKGWAS
FT                   LGQVTAATLYAQQLTDPIERLLGWLDEFQVGGASLARLLGVAAEPDERAKAFATPDERA
FT                   AAAGSAGGAGRLAAHDVRYAYRPGHDVLHGVTLEPRPGERLAMVGPSGAGKSTLGRLLA
FT                   GVHAPSAGTVTVDGRPLAGMPLAELRTHVALVSQEHHVFIGTLADNVAMVRPDADPARV
FT                   RAALAAVDALDWALALPDGLDTAVGAGGHPLTPAQAQQLALARLVLADPHTLVLDEATS
FT                   LIDPRAARALERSLAAVLHGRTVVAIAHRLFSAHDADRVAVVADGRITELGSHDELVAA
FT                   GGSYAALWRSWHG"
FT   gene            complement(550464..552170)
FT                   /locus_tag="ML5_0532"
FT   CDS_pept        complement(550464..552170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0532"
FT                   /product="ABC transporter transmembrane region"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; KEGG: sro:Sros_8453 ABC-type multidrug
FT                   transport system ATPase and permease components-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06082"
FT                   /inference="protein motif:PFAM:PF00664"
FT                   /protein_id="ADU06082.1"
FT                   /translation="MRFSPAGDPGTPDARSATRYLVWLAGRHPVIFGAGLALGVIWMLA
FT                   QALVPAVLGRAVEAGLAQRDPDALVRWSLALLGLGLVQAVAGILRHRCAVHNWLGAAYR
FT                   TVQVTVDATNRLGAALPRRVAAGEVVSIGTADIEHIGSAIDITARGAGSVVGIVTVAVI
FT                   LLSASQPLGLVVVLGVPLLMALVALLIRPLHRQQAAYRDSTGRLTARAADIVSGLRVLR
FT                   GVGGEPVLSERYRQRSQALRADGLRVARVESLLQAAQILLPGVFVVLVTWLGARFALRG
FT                   EISAGELVSFYGYTAFLVSPLRNLTEAADKLTRGHVAARRVVRLLRLAPEFTDPATPVP
FT                   VPAGPGELADVRSGLVLRPGRLTALAAATPQDATEIADRLGRYADGDVTLHGVPLRDVA
FT                   LATVRERILVADNDAQLFSGVLRTELDPHDRAEPGAVAAALAAASATDIVEALPGGLDG
FT                   EVAERGREFSGGQRQRLRLARALVADPETLILVEPTSAVDAHTEARIAERLGPARRGRT
FT                   TLVCTTSPLVLGHADHVVFVEDGKVVAEGRHEELLAGEPRYAATVSREEDR"
FT   gene            complement(552241..552495)
FT                   /locus_tag="ML5_0533"
FT   CDS_pept        complement(552241..552495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06083"
FT                   /inference="similar to AA sequence:KEGG:Sare_4240"
FT                   /protein_id="ADU06083.1"
FT                   /translation="MIVRMWEAKAEPYGFADLITWVCETALPEFEHDPMHVSSEVFSST
FT                   DHRLVVISKWRNSPRDLPEPPARLIARPPHSWDFTQVDR"
FT   gene            complement(552513..553559)
FT                   /locus_tag="ML5_0534"
FT   CDS_pept        complement(552513..553559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0534"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: metalloendopeptidase, glycoprotease family;
FT                   KEGG: stp:Strop_3851 putative DNA-binding/iron
FT                   metalloprotein/AP endonuclease; PFAM: peptidase M22
FT                   glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06084"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADU06084.1"
FT                   /translation="MADEPLILGIETSCDETGVGIVRGHTLLADALASSVEEHARFGGV
FT                   VPEVASRAHLEAIVPTMDRALREAGVTIADIDAIAVTSGPGLAGALLVGVAAAKGYAVA
FT                   AEKPVYGVNHLAAHVAVDTLEHGPLPEPAIALLVSGGHSSLLRVDDLARDVVPLGATID
FT                   DAAGEAFDKVARLLGLPFPGGPYIDREARAGDPASIAFPRGLTAAKDLVGHRYDFSFSG
FT                   LKTAVARWVEARQRAGEPVPVADVAASFQEAVCDVLVGKAIDACRSSGIDTLVIGGGVA
FT                   ANSRLRAMAEQRAGRHGIRVRTPRPKLCTDNGAMVAALGSHLVAAGVAPSRLDLPADSA
FT                   MPLTVVSV"
FT   gene            complement(553565..554008)
FT                   /locus_tag="ML5_0535"
FT   CDS_pept        complement(553565..554008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0535"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="KEGG: saq:Sare_4242 ribosomal-protein-alanine
FT                   acetyltransferase; TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06085"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADU06085.1"
FT                   /translation="MRLGRFRWWHIDEVLPIEADLFGAEQWSAAMFWNELANGHFYLVA
FT                   TDDDGAVLGYAGLAVSPPDEAWVQNVAVRRDAHRRGIGRLLLEALLAEAVRRGARSTLL
FT                   EVAADNAPAQRLYATYGFEPIGVRRGYYQPSNTDALVMQRNED"
FT   gene            complement(554005..554682)
FT                   /locus_tag="ML5_0536"
FT   CDS_pept        complement(554005..554682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0536"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   stp:Strop_3853 peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06086"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADU06086.1"
FT                   /translation="MLVLVVDSSTPAVTAALAEVSADGVAVRASRCTVDARAHGELLAP
FT                   QVDAVLADVGARPADLAAIVAGLGPGPFTGLRVGLVTAATMGQVLGVPTYGVCSLDGLG
FT                   HPAAAGEPVLAASDARRREIYWAVYDGAGRRLAGPEVAAPAVVAERARDLAVTVAVGDG
FT                   AHRYADVLGLLVRDEPHYPDPLALARLAAPRIRAGAPGETLTPLYLRRPDAVAATGHKP
FT                   VLP"
FT   gene            554896..555621
FT                   /locus_tag="ML5_0537"
FT   CDS_pept        554896..555621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0537"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: xce:Xcel_1144 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; POU-specific domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06087"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU06087.1"
FT                   /translation="MTESRLVREIARTLRREREQAGLTQQALAARSGLSQAAIARIERG
FT                   DRLPSLTAAERLLAALGRQLRIEVEPLDSHLDAALDEMAGTVLAERIEVLRLDRIMDAL
FT                   GDLPYVLSGGTAALLQGAPLPVDAVEIAVRWRDSPQFSALLDRIYAQRWDARWQVWGGI
FT                   HTEPEEPGEHRWLTRYGELRARMCEELPEPIEVRLGERTYPVEPLVEVEVTDRRTAELL
FT                   SRYRRRLAAAGEAPGGSAG"
FT   gene            complement(555610..556308)
FT                   /locus_tag="ML5_0538"
FT   CDS_pept        complement(555610..556308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0538"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="KEGG: saq:Sare_4244 uracil-DNA glycosylase; TIGRFAM:
FT                   uracil-DNA glycosylase; PFAM: Uracil-DNA glycosylase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06088"
FT                   /inference="protein motif:TFAM:TIGR00628"
FT                   /protein_id="ADU06088.1"
FT                   /translation="MPDAPTLDLPALLPEAWRAVLTPHLDPARTAALAEFVAREYATAT
FT                   VFPPLEDLFSAYRLCGPADTRVLILGQDPYHKAGQAHGLSFSVREGVAVPPSLRNVFKE
FT                   LGEDLGVPKPRSGNLDGWAAQGVLLLNSVLTVRQATPGSHANKGWEEFTDATIRALDAL
FT                   DQRVVFLLWGGYARKKAALVTNPQHVVLEAGHPSPMNPRGFLGSRPFSAANKALADAGL
FT                   PTVDWERSAG"
FT   gene            556490..557872
FT                   /locus_tag="ML5_0539"
FT   CDS_pept        556490..557872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0539"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: sgr:SGR_252 putative secreted lipase; PFAM:
FT                   secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06089"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ADU06089.1"
FT                   /translation="MSRRNTRPRTPSAAPSPRRTTGLRMLAVAAAAATYLAGSGAAAAA
FT                   DGTTPVVSRGVTIPAFYHPPADLPATNGTLIRTEPLPLGLSIPGLDGRPMPGTATRLMY
FT                   RSTDSNGRAVGVTGAYIEPSAAWRGAGPRPLVAVASGTMGQGDQCAPSFALQHPLTLTG
FT                   DTLSVGYEALAIYRLLATGAAVVVTDYVGLGATDRLHTYVNRLDEGRALLDAARAARTV
FT                   PGASVTDRSRVGLYGYSQGGGASAAAAELQPTYAPDVPLAGTYVGAPPADLTAVIGGID
FT                   GSALAGALGWSLNGFAQSDPAVRDVIEANVNDAGRAALTDTSTMCVGDAILRYAFTKSS
FT                   RWITGGRSLTAVIAASPEAAAVLDRQRIGTLKPAGPVRVATGVQDDIVPHRQARQLAVD
FT                   WCRKGANVTYQAVSLPNLGDKLLTNHLAPLITDQGDAVAWLTDRLAGRTAYSNCWTMPL
FT                   QP"
FT   sig_peptide     556490..556624
FT                   /locus_tag="ML5_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 45"
FT   gene            complement(557869..558351)
FT                   /locus_tag="ML5_0540"
FT   CDS_pept        complement(557869..558351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0540"
FT                   /product="Uncharacterized protein family UPF0079, ATPase"
FT                   /note="PFAM: Uncharacterised protein family UPF0079,
FT                   ATPase; KEGG: saq:Sare_4245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06090"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADU06090.1"
FT                   /translation="MTVVVELKTVEDTHEFGRRLAGVLRAGDLLLLSGPLGAGKTALTQ
FT                   GIGAGLGVRGDITSPTFVIARVHRPDPARGGRVTLVHADAYRLGEAADPRAEIDDLDLD
FT                   ASVDEAVTVVEWGEGMVEQLVDAHLRVRIDRRDDDTRAVTLEPVGGDWTARVAELS"
FT   gene            complement(558348..559433)
FT                   /locus_tag="ML5_0541"
FT   CDS_pept        complement(558348..559433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0541"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: saq:Sare_4246
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06091"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADU06091.1"
FT                   /translation="MSVRLPRPRTAAGKVAGLVGAAVGVAAAGLAAGVVSERVLVRRLK
FT                   NDPTDRYADEVFGEQRYDEAYRLEMPDGTDIHVEVVEPTRPVAGHPTVVLVHGFCLDMG
FT                   TFHFQRKRLAERGDYRVVAYDQPGHGRSGRLESGEYDLTALGHTLRRVLDEVAPDGPLV
FT                   LVGHSMGGMTIMALAELYPEMFGDRVVGTVLMATSGGLAAETKLVAPALLGRVGSPVLY
FT                   MMSNATRYGGTVIDRARRSTSNVAWLLTRKYGFGTSKPSPALVSYVEMMNSRTSADTVT
FT                   RYLRTIATHSRFPALAALAGTPVLVIVGDKDMITPVTHSEEIVRRLPHAEFVKINDSGH
FT                   VVMLEHADEVNVALERFLDSL"
FT   sig_peptide     complement(559338..559433)
FT                   /locus_tag="ML5_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.786) with cleavage site probability 0.449 at
FT                   residue 32"
FT   gene            complement(559430..560548)
FT                   /locus_tag="ML5_0542"
FT   CDS_pept        complement(559430..560548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0542"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; KEGG: saq:Sare_4247
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06092"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADU06092.1"
FT                   /translation="MWQSEVRVDLDAIRENVTRLKAGTSAELMAVVKGDGYGHGMVPAA
FT                   RAALDAGADQLGVCTLDEALRLREEGITAPVLAWLLSPGLPLHDGITVGVDLGCAGLTQ
FT                   LDEMIQASRRADRPARLHLKIDTGLARGGATVADWPALLEAAAKAQADGLVEVVGVWSH
FT                   FVYADSPGHPTTDRQLAVFQEGLEMVTRAGLRPRYRHLANSAATLTRPDTHFDLVRPGI
FT                   AVYGLSPVAGEQFGLRPAMTARARVMLTKRVAAGTGVSYGHTYLTEQEANLAVVPLGYA
FT                   DGVPRHASNTGPVQLAGKRRTISGRVCMDQFVVDCGDDEVADGDVATLFGSGADGEPTA
FT                   DDWAEAVGTINYEIVTRFGGVRVPRVYDGEHA"
FT   gene            complement(560633..562102)
FT                   /locus_tag="ML5_0543"
FT   CDS_pept        complement(560633..562102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0543"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="manually curated; TIGRFAM: carbohydrate kinase, YjeF
FT                   related protein; KEGG: stp:Strop_3858 carbohydrate kinase,
FT                   YjeF related protein; PFAM: protein of unknown function
FT                   UPF0031; YjeF-family domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06093"
FT                   /inference="protein motif:TFAM:TIGR00196"
FT                   /protein_id="ADU06093.1"
FT                   /translation="MRQVWRVADVRAAEAGLMATLPPGALMQRAAAGLARRCALLLADR
FT                   GGVYGARVLVLAGSGDNGGDALFAGAHLARRGVAVTALLLTPGRAHAEGLAALRAAGGR
FT                   VADRPPAVVDLVLDGIVGIGGAGGLRETAEQLAASLTGQRGRGGTRATVVAVDVPSGVA
FT                   VDTGHVPLTDAGRPRAVRADVTVAFGALKPALVVGPAAELAGEVELVDIGLTPWLRGTP
FT                   ALQVIEQTDVADWWPALGASSEKYTRGVVGVATGSATYPGAAVLSVAGALAGPTGLVRY
FT                   AGSAEGEVLHQHPSVIATGRVADAGRVQAWVCGSGLGTGEDSAAELRAVLAAPVPVVLD
FT                   ADALTLLVDGKLADRLRGRDAPIVVTPHDREYARLCGEMPGDDRVAAALRLAAWMNAVV
FT                   LLKGDRTVIGTPDGRAYVNPTGTPVLATGGTGDVLAGLLGSLLAAGLAPERAAAAAAYL
FT                   HGLAGREAARGGPVTAPDVAAALRPVLARLG"
FT   gene            562319..562621
FT                   /locus_tag="ML5_0544"
FT   CDS_pept        562319..562621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_3480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06094"
FT                   /inference="similar to AA sequence:KEGG:Amir_3480"
FT                   /protein_id="ADU06094.1"
FT                   /translation="MVEKPFDVDPELLRSVARELADDAYRLARGPGAAPESLLVAAPDG
FT                   WRSAVALAELESAVRRWSGALGARVADTAQALRRGADGYEAVDERAARRLTGVLR"
FT   gene            562618..564240
FT                   /locus_tag="ML5_0545"
FT   CDS_pept        562618..564240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0545"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   sna:Snas_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06095"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADU06095.1"
FT                   /translation="MNDGPADAVDVPVGYAQLWRADPGAWSTAGAAWRGITTPVRQRAD
FT                   ALTARIGTLRPGWSGAASTAAQRRIGDLRTDLTDVLPALVEVDQVLAEFGARLGAAKAR
FT                   LGAEVARAESGGLLVDRTGAVRPDPARPPGQTGPAVVDARAGIRGALTLAGAADREAAG
FT                   RLAELTTAAVRGWVSVPPAWRPGPGAGPAEVSRWWAGLSAAERRWLVGREPGRIGRLDG
FT                   LPAAVRDQANRLLLGDRREQLLARRLGLLHPLPAGPLEASRRVRLAAVEAALRGLDGLG
FT                   ERLAAGGAPRAYLLGLDPAGDGRAVVALGNPDRAASVLTYVPGMTSDLADAPAELGRAA
FT                   RVLQRCAALGPGEEAAAVLWLDYDAPGFLTEAAGTRQAEDAGPALHRFQDGLRAAHEGP
FT                   PARQTVLGHSYGSLVVGTAARDHGLGADALVFVGSPGVGVDHAAELRMPAGQVWSSTAP
FT                   DDVIRLARPPDELARRALLAGTPLGPALAVLDPHGERLWFGADPSAPDFGGRRFPSAPH
FT                   GHTGYWDPDNPALDGMARIVLGR"
FT   gene            complement(564360..566273)
FT                   /locus_tag="ML5_0546"
FT   CDS_pept        complement(564360..566273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0546"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: stp:Strop_3860
FT                   glucosamine--fructose-6-phosphate aminotransferase;
FT                   TIGRFAM: glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; PFAM: sugar isomerase (SIS); glutamine
FT                   amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06096"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADU06096.1"
FT                   /translation="MCGIVGYAGARPALGIVLDGLRRLEYRGYDSAGVAVVCEDELLTE
FT                   KKAGKLANLEKVLSERAADNPEDCAASPIGIGDGTTGIGHTRWATHGGPTDRNAHPHLS
FT                   PDGRVAVIHNGIIENFAKLRAELEDEGVEFASDTDTECAAHLIARALADLRSAGETDSP
FT                   ALLAAAMRVVCARLEGAFTLLAVDAGIPGAVVGARRNSPLVVGRGDGENYLASDVAAFI
FT                   EHTRDAVELGQDQIVLITPDSIDITDFHGQPASGTDFHIDWDSSAAEKGGYDWFMLKEI
FT                   EEQPQAIADTLLGRLTETGEIALDEVRLSEQDLRDVDKIFIVACGTSYHAGLVAKYAIE
FT                   HWTRIPCEVELASEFRYRDPVLDRSTLIVVISQSGETMDTLMALRHAKEQKARVLAICN
FT                   TNGSTIPRESDAVLYTHGGPEIAVASTKAFLTQVVACYLIGLHLAQVRGIKFADEVGAV
FT                   VAQLQEMPGKLRELLDRIEPVRELGRELKSEPTVLFIGRHVGYPVALEGALKLKELAYM
FT                   HAEGFAAGELKHGPISLIDQGTPVICIVPSPVGRGMLHDKVVSNIQEVRARGARTIVIA
FT                   EEGDQAVVRYADHLIYVPRTPTLLAPLVTTVPLQVLAAEIAAARGHDVDQPRNLAKSVT
FT                   VE"
FT   gene            566546..567523
FT                   /locus_tag="ML5_0547"
FT   CDS_pept        566546..567523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0547"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfo:BRAFLDRAFT_88007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06097"
FT                   /inference="similar to AA sequence:KEGG:BRAFLDRAFT_88007"
FT                   /protein_id="ADU06097.1"
FT                   /translation="MSETTPAPEPASGPSDPTAAPATPQPSSWTPPDPLAAPQPWTPPA
FT                   PWSPPPAPSPWAAAGPESASGTDPASSPSGTGRPVGEPGWAAPADPAATPRPAVPPASG
FT                   DPQAPGFPATPGWPSQPGVPDFSAQPAWTPGAYPPGPHKSGSYPPGPYPPPYAYPGMPP
FT                   RRSGGGWVAGLVIGIVTVLALIVCGCVGLSFLGRSMTDGTASGDRYDGPLYGEPDGWAD
FT                   EPTGPPARPVTTPSGGPGRFTVLYEVTATDGEAEVQFYDADANFHQPGAVDTPWRLSLT
FT                   ANDRERVQIIASPVESGEVTCRITVNGKVVSTDSGEYGATCFGW"
FT   gene            567555..568742
FT                   /locus_tag="ML5_0548"
FT   CDS_pept        567555..568742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0548"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   stp:Strop_3861 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06098"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADU06098.1"
FT                   /translation="MTTTDPLVARMRPFGTTVFAEMSALAVRTGAVNLGQGFPDTDGPP
FT                   EMLAAAAEALRTGHNQYPPGPGIPALRAAVAGHQRRFWGLEYDPDGEIVVTAGATEAVA
FT                   ASILALCEPGDEVICFEPYYDSYAASIALAGAVRRPVTLRPGPDGRYAFDPDELRAAFG
FT                   PRTRLVLLNSPHNPTGKVFTADELTTVAELCREHDVYAVTDEVYEHLVFTDAAAPHVPL
FT                   ATLPGMRERTLRISSAGKTFSCTGWKVGWVSGPAPLVAAVLRVKQFLTFVNAGPLQPAV
FT                   AVALGLPDAYFTGFRDDMQRRRDQLAAGLADAGFGVLAPEGTYFVTADVTPLRGRDGVE
FT                   FCRALPERCGVVAVPTQVFYDDVEAGRRLIRFAFCKRPEVLAEAVTRLRRLRADG"
FT   gene            568739..569845
FT                   /locus_tag="ML5_0549"
FT   CDS_pept        568739..569845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0549"
FT                   /product="aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: sco:SCO3385
FT                   L-allo-threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06099"
FT                   /inference="protein motif:PFAM:PF01212"
FT                   /protein_id="ADU06099.1"
FT                   /translation="MSDEQATRLRRFTAQRDCDTMLSGVRPASVREQLAALDQVAGDDP
FT                   PDLYGEGGPVAELELRVAELLGAEAAAFFPSGTMAQQVAMRHGAELTGRAGVGLHPLSH
FT                   PLTHERDAYALLAGVRAVRTTSAPRNPAADEVAALDEPIGTLFLELPLRDAGFVLPTWD
FT                   ELVAVVAAARARGARVHFDGARLWESSVHLGYSPAEIAALADSTYVSFYKSLGGISGAA
FT                   LAGDAELIRYARAWRHRYGGTLFQQWPAALAALAGLTRELPRLPGYVVHARVVAEALAA
FT                   LPGARVYPAPPHTHQFRFWLPYPAAVLDAANLALAEEERAWFVGGWRDTEVPGLALAEV
FT                   TVAGPAQELDAGAVADLAARFLRRVQAN"
FT   gene            complement(569903..571258)
FT                   /locus_tag="ML5_0550"
FT   CDS_pept        complement(569903..571258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0550"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: stp:Strop_3862 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06100"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADU06100.1"
FT                   /translation="MGRLFGTDGVRGRANADLTPELALAVAVAAAHTLAETDKSHPPLA
FT                   VVGRDTRASGEMLEAAVVAGLTSAGANVVRVGVLPTPAVAFLTAEAKADLGVMLSASHN
FT                   PMPDNGIKLFAAGGHKLPDEIEMRIEEAVKANATTAWKRPVGAGVGRVHDLLDGADHYV
FT                   QHLVGTVPHRLDGIKVVVDCANGAAADVAPVAYREAGAEVIAIHAEPDGLNINDECGSN
FT                   HIEALRAAVVEHGAHLGIAHDGDADRCVAVTADGNEVDGDQVMAILALAMRDAGELTQD
FT                   TLVATVMSNLGLRLAMSEHGIRLVETKVGDRYVLEELRASGLALGGEQSGHIVLPAYAT
FT                   TGDGVLTGLHLMARMAATGTSLAELAAVVTKLPQVLINVPVGDRTVGAAAPAVRAEVER
FT                   AEAELGETGRVLLRPSGTEPLVRVMVEAATEDTAREVAERIAEQVRTASPVA"
FT   gene            complement(571375..571839)
FT                   /locus_tag="ML5_0551"
FT   CDS_pept        complement(571375..571839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0551"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: saq:Sare_4253 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06101"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADU06101.1"
FT                   /translation="MTDITATEVAPEATEAPAPVARAPRGDRPIQTVGRRKEAIVRVRI
FT                   IPGSGKITCNGRDLEAYFPSKVHQQLIKDPLVTAEKPEAFDVIANLRGGGTTGQAGALR
FT                   LAIARALIVSEPDDRPALKKAGFLTRDARVKESKKYGLKKARKAPQYSKR"
FT   gene            complement(571860..572303)
FT                   /locus_tag="ML5_0552"
FT   CDS_pept        complement(571860..572303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0552"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: saq:Sare_4254 50S ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06102"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADU06102.1"
FT                   /translation="MRTYSPKPGEIERQWHVIDASDVVLGRLATHAATLLRGKHKPTFA
FT                   PHVDTGDFVVIVNAGKVALTGNKRQTKVAYRHSGYPGGLKRVGYDELLTKRPERAIELA
FT                   VKGMLPHNKLGRQLLKKLKVYAGAEHPHTAQQPVPFEIKQIAQ"
FT   gene            complement(572513..573880)
FT                   /locus_tag="ML5_0553"
FT   CDS_pept        complement(572513..573880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0553"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fra:Francci3_1315 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06103"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU06103.1"
FT                   /translation="MSTLVSAPTTPPATTAGRLTEWRPEDPAFWAAGGARVARRNLYVS
FT                   IFAEHVGFSVWSLWSVTVLFLGPEYGIDPAGKFLLTAVPAALGAVLRLPYTLAVARFGG
FT                   RNWTIVSALLLLVPAVPMAVLIEPGVSYATLMVLACLSGVGGGNFASSMANINLFFPER
FT                   LKGRALGLNAGGGNLGVPAVQLVGLAVLATAGAAYPRLVPAVYLPLIVLAALAAARWLD
FT                   NVPGARNEPGALRAAARDPHTWVMSLLYVGTFGSFIGFGFAFGQVLQLQFHDRFPTPVD
FT                   AAWLTFLGPLIGSLIRPVGGQLADRLGGARVTFWNFVAMAAGAGLVLYAAREKSFPLYL
FT                   AGFLALFVFSGIGNGSTYKMIPAIFRARAVAESELTGDPEAAQRRARRLAGAVIGIAGA
FT                   VGASGGVLVNVAFRQSFLASGTADAAYLAFIGWYALCFLVTWVVYLRPGPRTLVGV"
FT   gene            complement(574003..574296)
FT                   /locus_tag="ML5_0554"
FT   CDS_pept        complement(574003..574296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06104"
FT                   /inference="similar to AA sequence:KEGG:Sare_4256"
FT                   /protein_id="ADU06104.1"
FT                   /translation="MLRRGEVWRISGARERFGLVISSDVYNATAVPIVIVAEVVEESLL
FT                   RDSPLAVPMGAYVVMPDRISSPMKKWFTECVDVADTETMQRVGRALRILQDL"
FT   gene            complement(574286..574561)
FT                   /locus_tag="ML5_0555"
FT   CDS_pept        complement(574286..574561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06105"
FT                   /inference="similar to AA sequence:KEGG:Sare_4257"
FT                   /protein_id="ADU06105.1"
FT                   /translation="MGSLRGMTAKVTLSFSDETIEEARRFAKREGLSLSAWMDQAAREK
FT                   ALREVFTAHADAVGRAGLDLEAAALADAQEVALVDDALFGGRPRAA"
FT   gene            574722..575189
FT                   /locus_tag="ML5_0556"
FT   CDS_pept        574722..575189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0556"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="KEGG: rce:RC1_3519 DNA binding domain, excisionase
FT                   family, putative; TIGRFAM: DNA binding domain protein,
FT                   excisionase family; PFAM: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06106"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADU06106.1"
FT                   /translation="MSLRTGMAASVMPTEGAERQKAAAMEEFLVRHPLAAGGGVARLVS
FT                   ADGEEVEVPAQMFDVLHQISAMLARGDGVAISAISRELTTTEAAKLLGMSRPTLVRLLE
FT                   DGSIASHRVGSHRRLFLRDVLAFRQRQMEERRKSYEALMWESDALGFTDDV"
FT   gene            575286..575741
FT                   /locus_tag="ML5_0557"
FT   CDS_pept        575286..575741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro11110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06107"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro11110"
FT                   /protein_id="ADU06107.1"
FT                   /translation="MYRLRRKRPEHSEQAIGGQRRRFVQAFPYGLVTGYSPNDVPCPPD
FT                   PDDRHVLAAAVHGRADILVTDDRRAFPPECVRESLSVRTGDEFLNWVADRSMPLVMRTL
FT                   ARQIDYYRRSLVAEDKDAVELIAHLRKAGASRFADRLENHLADPSGR"
FT   gene            complement(575714..576424)
FT                   /locus_tag="ML5_0558"
FT   CDS_pept        complement(575714..576424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0558"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: fal:FRAAL4892
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06108"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADU06108.1"
FT                   /translation="MSVADAFDAVAGSYDQARRRLVPCFDAFYGTAVEVAAPPLRAALA
FT                   AGRTPEVLDLGAGTGLLSLLLTAAVPGVRLTLVDGAPGMLAVAAGHLDARGVPHRTVHA
FT                   DLAGPLPAGRYDAVVSALAIHHLDDEGKRALYKRAADALVPGGVFVNAEQVAGPTPALD
FT                   RRYDEVWTARITELGSDAEEIAGARERMRHDRPAPVAEQCRWLTEAGLVDVDCFFKEWR
FT                   FAVFGGQRPDGSAR"
FT   gene            576571..578682
FT                   /locus_tag="ML5_0559"
FT   CDS_pept        576571..578682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0559"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="KEGG: stp:Strop_3867 molybdopterin oxidoreductase;
FT                   manually curated; PFAM: molybdopterin oxidoreductase;
FT                   molybdopterin oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06109"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ADU06109.1"
FT                   /translation="MTDGARTATRTGSRLVEAATHCPYCALQCGMVLRATGDGVEVGAR
FT                   DFPTNRGGLCQKGWTAADLLDHPDRLTTPLLRDRPGGELRPATWDEALDRVAAGVKDVQ
FT                   HHHGPDAVAVFGGGGLTNEKAYALGRFARVTLRTRHIDYNGRWCMSSAAAAGNRAFGID
FT                   RGLPFPLADLGHADTLLLVGANPAETMPPLMRHVADLRERGGRLIVVDPRATATARQAD
FT                   LHLQPLPGTDLAVANALLHIALTEGWLDRAYVAERTTGFDDVRRTVAGYWPAEVERLSG
FT                   VPVADLYATARALATVDRAVVLTARGAEQHAKGVDTVTAFINLALALGLPGRPGSGYGC
FT                   LTGQGNGQGGREHGQKADQLPGYRRIDDPAAREHVAGVWGVEPDSLPGPGVPAYQLLDA
FT                   LGTPSGARALLVFGSNPVVSAPRAARVESRLRALDLLVVADFVRSETAELADVVLPVAQ
FT                   WAEEDGTMTNLEGRVLRRRALREPPAGVRTELEILAALAERLTGGGTPLPADPREVFAE
FT                   LGRASAGGPADYAGITWDRIDADTGVFWPCPDRDGPDTPRLFADRFPTPDGRARFHAVT
FT                   HRPAAEPVCADYPLHFTTGRVLAQYQSGAQTRRVAALRRAAPGGFVELHPDLAARIGVT
FT                   DGAPVRVVSRRGELRAPARLSTAIRPDTVFAPFHWPGAQRANSVTNDALDPVSGMPEFK
FT                   ICAVRVEAA"
FT   gene            578679..580151
FT                   /locus_tag="ML5_0560"
FT   CDS_pept        578679..580151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0560"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: saq:Sare_4259 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06110"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADU06110.1"
FT                   /translation="MSEHIVVVGYGMAGARLAAELHARGGDRRITVLGAEPHRAYNRIM
FT                   LSTLLAGRIGEPDVELVEAIGPEVGVRTGAAVTAVDRATREVVTDDGERHGYDHLVLAT
FT                   GSRAVVPPLPGLAPLPERVVPFRTLGDCRRILAAAEGARRVIVLGGGLLGLEAARGLAA
FT                   RGLDVTVVHPVGHLMERQLDPPAGAVLAGTLAGLGVRSRLGVAATAVTADATGVRLHLG
FT                   DDETLAADLLVLCCGVRPDTALAAAAGLAVERGVVVDDRMRTSDRRISAIGDCAQHDGT
FT                   LTGLVAPAWAQAQVVADVLTGADPLARYRPRPAVTRLKAAGIDLAAMGDVAGTGDPGGP
FT                   VEELTFADPVRGTYARLRIRDERLTGAILLGDNPAVGTVVQLFDRGAPVPADRRSLLLG
FT                   RAFGETPAGPAASPALMPDAATVCRCNDVSKGALVACWRAGARTAAALSAATRAATGCG
FT                   SCRDAVAGIAGWLAEADPSTTDEVRETVEVAS"
FT   gene            580148..582679
FT                   /locus_tag="ML5_0561"
FT   CDS_pept        580148..582679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0561"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /note="KEGG: saq:Sare_4260 nitrite reductase (NAD(P)H),
FT                   large subunit; TIGRFAM: nitrite reductase [NAD(P)H], large
FT                   subunit; PFAM: nitrite and sulphite reductase 4Fe-4S
FT                   region; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06111"
FT                   /inference="protein motif:TFAM:TIGR02374"
FT                   /protein_id="ADU06111.1"
FT                   /translation="MTERISRLVVVGNGMVGQRFVEALRARDTDGRWRVTVLAEERRPA
FT                   YDRVRLSAVFDGVDADELTVHTPDAGVDLRLGEPATGVDRARRVVTTAAGEYPYDALVL
FT                   ATGSYAFVPPVDGTDLPGVFVYRTLDDLTAIREHARGRRAGAVIGGGLLGLEAANALRL
FT                   LGLATSVVEFAPRLMPVQVDEAGGAMLRRYVEELGVTPYLGVATTALRPGPDGTVAALD
FT                   LADGRTLDAELVVVAAGIRPRDELARAAGLPLGPRGGVLVDAACRTADERIWAVGECAA
FT                   VDGVCHGLVAPGYATAEVVADRLLGGAATFPGADTATKLKLLGVDVASFGDAHGVTPGC
FT                   LDVTYTDPAARSYAKLVLSDDARTLLGGVLVGDASAYPALRASVGGPLPAPPLALLAPA
FT                   GGAGAGAGALPAGAQVCSCNAVTRADLDAAIAGGAADVPALKACTRAGTSCGSCVPMLK
FT                   QLLDAAGVRQSTALCEHFDHSRQKLFDLIRVRGIRTFSRLVAEHGRGSGCDICKPVVAS
FT                   ILASLGTGHVLDGEQASLQDTNDHFLANLQRDGSYSVVPRIPGGEITPEKLIAIGEVAR
FT                   DFRLYTKITGGQRIDLFGARVDQLPQIWRRLVDAGFESGHAYGKALRTVKSCVGDTWCR
FT                   YGVQDSVGLAVALELRYRGLRAPHKLKSAVSGCARECAEARSKDFGIIATESGWNLYVG
FT                   GNGGFRPRHADLFATDLSTTELVTLIDRFLMYYIRTADRLQRTAAWIEAMDGGLDHLRS
FT                   VLVDDSLGLCADLDAAMARHVTSYSDEWRDVLEDPDRLRRFTSFVNAPEVPDPSITFTQ
FT                   ERGQPVPARGAPPDGGHRRQPVALGLPEVRR"
FT   gene            582676..583023
FT                   /locus_tag="ML5_0562"
FT   CDS_pept        582676..583023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0562"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   KEGG: saq:Sare_4261 nitrite reductase (NAD(P)H), small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06112"
FT                   /inference="protein motif:TFAM:TIGR02378"
FT                   /protein_id="ADU06112.1"
FT                   /translation="MSPVVTLDWTPVCPLDRLDPDRGVAALVDGVQVAVFRTANGLYAV
FT                   DNLDPVGGAYVMSRGLVGSRGGVPTLASPLHKQVYDLTTGRCLDLPGVTLRRHPVRCRD
FT                   GLVEVRLRQEE"
FT   gene            583023..584111
FT                   /locus_tag="ML5_0563"
FT   CDS_pept        583023..584111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0563"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="KEGG: saq:Sare_4262 bifunctional
FT                   uroporphyrinogen-III synthetase/response regulator domain
FT                   protein; PFAM: Uroporphyrinogen III synthase HEM4;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   transcriptional regulator domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06113"
FT                   /inference="protein motif:PFAM:PF02602"
FT                   /protein_id="ADU06113.1"
FT                   /translation="MRDELAGFTIGVTADRRRDELAALLQRRGARVVLAPALRIVPLAD
FT                   DTDLREATRACLEHPPDVLMANTGIGMRGWLEAAEGWGLAEPLRTTLARAYVVSRGPKA
FT                   TGAIRAAGLREHWSPDSESCDEVVEHLVRRGVAGQVVAMQLHGERQPECADALVAAGAT
FT                   VIEVPVYRWAPPADPAPLHRLIDLVAGRLVDAVTFTSAPAAEALLRAAGDRTETVLEAL
FT                   RGDVLAGCVGTVTAEPLVRRGVPVSAPSRARLGALVRTIVEELPRRTVSVKAAGHVLTL
FT                   RGHAAVVDGELRQLAPAPMAVLRALAASPGKVLSRTALLRTLPRGADEHAVEMAVARLR
FT                   AGLTAPRVVQTVVKRGYRLRVD"
FT   gene            complement(584123..584740)
FT                   /locus_tag="ML5_0564"
FT   CDS_pept        complement(584123..584740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0564"
FT                   /product="protein of unknown function ATP binding protein"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   saq:Sare_4263 protein of unknown function ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06114"
FT                   /inference="protein motif:PFAM:PF03029"
FT                   /protein_id="ADU06114.1"
FT                   /translation="MDFANYDPDGVNRGREIISAKIVIAGGFGVGKTTLVGAISEIQPL
FT                   TTEALMTAAGVGIDDASKVPGKETTTVAMDFGRITMAEDLILYLFGTPGQTRFWFMWDE
FT                   IIRGAVGAAVLVDTRRITDAFAPLDYFENRKLPYVVALNRFGDAPHYELEEVREALAIS
FT                   PDVPMVLCDARQRDSVKQVLVTVVEHAMLRLQAEHGYPASVG"
FT   gene            complement(584721..585083)
FT                   /locus_tag="ML5_0565"
FT   CDS_pept        complement(584721..585083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0565"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742; KEGG:
FT                   saq:Sare_4264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06115"
FT                   /inference="protein motif:PFAM:PF05331"
FT                   /protein_id="ADU06115.1"
FT                   /translation="MDPRRDPRGALVRPYAVTRGRTEPLQNIALEAVLSSTPTQSAEAR
FT                   FAGHDKYRISSVCEGRAQSLAEIAAYTRMPLGVTRVLVADMVAEGLLTLHTAAPATGFA
FT                   ARMNLLGRVLSGLREL"
FT   gene            complement(585146..585553)
FT                   /locus_tag="ML5_0566"
FT   CDS_pept        complement(585146..585553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0566"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   stp:Strop_3874 roadblock/LC7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06116"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ADU06116.1"
FT                   /translation="MNRPAAMQDMGWLLTNFADSVAGIAHVVAVSADGLLLASSRDLPG
FT                   DRADQLAAITSGVVSLTEGAARMFSAGGVLQTVIEMDSGYLFLMSISDGSSMAVLAARS
FT                   CDVGQVGYEMALLVERVGQALVPLPRDAVRS"
FT   gene            complement(585550..588606)
FT                   /locus_tag="ML5_0567"
FT   CDS_pept        complement(585550..588606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0567"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: stp:Strop_3875 ATPase domain-containing
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06117"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU06117.1"
FT                   /translation="MSTGPTTLPGSPNAEQRNRRRLLPRLRDARIRSKLALILVVPVAA
FT                   VIALATIRLISVGQGAYEADQVRSLSAVSVDIAALTQDLHKERMAAAVFLADPNQKPDA
FT                   YNLRVRQTDERIAAYQDERGKLGDVTGAISNQLKVIDAHLSTLNGTRQEVLDRLQMPVA
FT                   EASLRYGIVLDDLVAYSDALAQQPGADSLADARRAVAAFAHAKAEVAEEQAVAFTALDG
FT                   GRIDEEQFSSFVATLTGQQEALLTFSRSATPSQRALVDRTVSGDAVQLADRVAGDISRS
FT                   IGRQALVTRDEASAAIGAVDDLMRWAEIQLLDDMLADADEARADVIRQAIVESLLVLLT
FT                   LAVAVTLAVVLARSLNDSLRRLREGALAVANHDLPDAVSRLQNVNAIGDGGVDEIVQQV
FT                   RDPIKLSNRDEVGQVAVAFNVVHREAVRVAAEQAALRTSVSAMFLNLARRSQSLVDRMI
FT                   GELDAIERSEEDPKRLAQLFELDHLATRMRRNDENLLVLAGADSAVPRRDDALLVDVLR
FT                   AAQSEVELYNRIEFGTVDTDISVAAHAVNDVVRLVAELLDNATRFSPPNTTVVADGRRI
FT                   RDYVLIQIEDRGLGLSDDQLDSLNRRLAAPPTVDVAAFRLMGLAVVSRLASRYGIRVEL
FT                   RRNVEGGTVAQVTLPNSTVVLPANRGQAPLTRPRQPLAVEQSPLSQVGAADALAGAGRG
FT                   AATATLADQWRGATTAPPSRWQTPGETRDTTPAVQLGGATGALPTVAAPAPVAAAPATA
FT                   PAPVSGAGWSAGGPTVAYPALDPLPKRTPGVETAQPATQAAPPAYQPLAAAPAVESTPA
FT                   TPVVARPEQRAEAPIFREMEAVWFRSHGEDETTIFTRPTFDEPPAPAQPAVAPPAAPAR
FT                   PKLPTRTPGAQASGLTTSTTPSAYSPPEDPSTPPAAATPPPAPPAAAPAPAPPIDPEAW
FT                   RTAADEGWSRASRAAEPTTGGTTRSGLPKRVPQAQLVPGGIEPKSGRDRSRRTPDEVRG
FT                   LLSAYHRGVQRGRTAGADLNSTSTKETNR"
FT   gene            589054..590235
FT                   /locus_tag="ML5_0568"
FT   CDS_pept        589054..590235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0568"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   stp:Strop_3876 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06118"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU06118.1"
FT                   /translation="MSPIRSARIAALASAVLATTLTGCGIGGEPQDTSPIVIAADLELS
FT                   GASAPVGKVYQRALELKVEQLNASGALGGRKIDLRVKDNRSDAAESLRNINDFSGDSRV
FT                   SAVIMGGCNECAVGAARTIGEKRIPTIALASSSAVTEPVAERRYVFKLAPNATDSAAAL
FT                   AAELDRRGVRKVALLHSAEGYGQEGLTALRRELSKTTVKLVGNESVRATDTEVGTQINE
FT                   LIARKPQALVLWTTPEQATLAATTARQSKFRGSLFFDATAAGDLFLGPSARSTEEATLI
FT                   FTQTMVIDDVIATTPAKAARRQWFQDYTARFGGYNGFSSFAADAVQLIADAEQRAGGDP
FT                   GKVDRDALRDVLETSQLDGLSGPIRMTPDNHSGLMPQALTTLVARGGRWRLAG"
FT   sig_peptide     589054..589137
FT                   /locus_tag="ML5_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.317 at
FT                   residue 28"
FT   gene            complement(590403..591233)
FT                   /locus_tag="ML5_0569"
FT   CDS_pept        complement(590403..591233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0569"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: stp:Strop_3877
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06119"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU06119.1"
FT                   /translation="MTQSTEARPEAPPRPAVRRGMAVRPAAVGLPALGLVIAVAAWWLV
FT                   TSGLNLVHPAALPPPQAVGKSLAGTTEVLLPALGITTWMTVFGFLLSSAAGVLIGMALA
FT                   ASRRVERMFAPLLVAVNAVPKIAFGPLLVVAVGWGQKPILTMVFLLCFFPIVLSTATGL
FT                   TTTPADLAELGRSLNASWWQSFRKVRFPAALPQIFVGLKVAMPLAAIGAVIGEFYSDRP
FT                   GLGYQILQYNGVGDTATAWAAIVLVALMSIVLYAVLSLVERLALPWVRATTSAR"
FT   gene            complement(591337..592365)
FT                   /locus_tag="ML5_0570"
FT   CDS_pept        complement(591337..592365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0570"
FT                   /product="membrane lipoprotein lipid attachment site"
FT                   /note="KEGG: stp:Strop_3878 membrane lipoprotein lipid
FT                   attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06120"
FT                   /inference="similar to AA sequence:KEGG:Strop_3878"
FT                   /protein_id="ADU06120.1"
FT                   /translation="MRRLTRTVAAAAMATALALVGGCSSDSEKSESGGGNGAALEKVTY
FT                   LTSFGNFGRDSYAWVAKDKGFFKEAGFDVDIKPGQGTGSVIQTITGGQADFGPIDLTGG
FT                   ILQLGNGQAKDFVAVAAIQQRTMAAIVTVEGKNIATPKDLEGKKLADTPTSVVRNLFPT
FT                   YARLAGIDGSKVTWVNGEAQGLIGMLGSGSVDGIGQFVVGQPTVETVTKKKPVVLPYSN
FT                   VMQDLYGNALITSSKIAKEKPEMVKKFTAALLKGLEYSLANPDEAGEILKKNVPAAVPA
FT                   AASAELQLMAAYVRSSNSGTAIGTLDSGRVAKSIALLQGAGALKQNLTPDQIIDFNLAP
FT                   KA"
FT   sig_peptide     complement(592288..592365)
FT                   /locus_tag="ML5_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.801 at
FT                   residue 26"
FT   gene            592650..593432
FT                   /locus_tag="ML5_0571"
FT   CDS_pept        592650..593432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0571"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: stp:Strop_3879 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06121"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU06121.1"
FT                   /translation="MIRLSGVSRTFDGRSGRVEALRGIDLDVAEGEFVAVLGRSGCGKS
FT                   TLLRMIAGLLPVTGGEITVGGTPITKPRRDVAMLFQRPALLPWRSVLDNVLLPVEIFGW
FT                   RRAEHRDRARQLLEMAGLGGFEKRLPHELSGGMQQRVSLCRSLIGSPRVMLMDEPFSAL
FT                   DALTREELSGELQRVHMETKATIVFVTHSIDEAVLLADRVVVLSPRPGRIREVVEVNVP
FT                   RPRTLGRHEHLEDVARISAELHELLMERDAPGVPVGGR"
FT   gene            593435..594385
FT                   /locus_tag="ML5_0572"
FT   CDS_pept        593435..594385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0572"
FT                   /product="putative F420-dependent oxidoreductase"
FT                   /note="KEGG: saq:Sare_4271 luciferase family protein;
FT                   TIGRFAM: putative F420-dependent oxidoreductase; PFAM:
FT                   Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06122"
FT                   /inference="protein motif:TFAM:TIGR03560"
FT                   /protein_id="ADU06122.1"
FT                   /translation="MRVSVFTEPHRGADYDDQLRFARLVEETGFEGFFRADHYRAMGDE
FT                   PALPGPTDAWLTLAALARETSRIRLGTLVTSATFRLPGPLAVMVAQVDRMSGGRVELGI
FT                   GAGWYEREHTAYGIPFPPVSERFDRLAEQLEIVTGLWRTPSDETYSFTGEHYRLVDAPA
FT                   LPKPVQQPGPPVIVGGRGPKRTPELAARYADEFNMPFKSVAETAAAYERVREACDRAGR
FT                   DAAGRAPLTLSAGIVVAIGRTDAEAQRRAAPLHVTSALPPEDPVVGSPAQLVDRIGEFA
FT                   AIGATRVHLRLIDFDDLDHVELIAAEVLPRLDGTR"
FT   gene            594382..594690
FT                   /locus_tag="ML5_0573"
FT   CDS_pept        594382..594690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0573"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   stp:Strop_3881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06123"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADU06123.1"
FT                   /translation="MTELSADLELGPVGQEIVYENDRVRVWHIRLEPGERQPLHRHDHP
FT                   YLVVAIQGAKNVVQTIDGTTIDADEPTGGVVYRDPGAVHMLTNVGDTTYLARLVELK"
FT   gene            594765..597434
FT                   /locus_tag="ML5_0574"
FT   CDS_pept        594765..597434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06124"
FT                   /inference="similar to AA sequence:KEGG:Sare_4273"
FT                   /protein_id="ADU06124.1"
FT                   /translation="MAFRTWGRLLLTALGVSVLAGAGQLGIAYGFGVVRLDGAFVDVSV
FT                   NRWPAQLVWVGWFAAVATVAGAVLTERFARRDDSPGGTTELLSIAGVSALGATVVAPLC
FT                   MQPARAAELGGSVDPVWAAGICAALGAVVGAGAAIAVLLKPPFGWGVAITAGIVWLMAL
FT                   LSVAPTIVSSRPLATVRLGVLEPSWLDPEAAQRLSMLLLPVLTLLAGGAVGVLARRAEW
FT                   PPLVGGAAGAAGPVLVAFAYLTAGPGSATDRYQVAPYYGALIAVIAGALGSTATTVLPR
FT                   PVTATGDPDAVEATDILAPLPHSSTPGAPAAPPAPPVTSGAAAPAHWNWPEPGGSATAT
FT                   APAGTDLPAAGRPALADRPAVDQPAVAERPAGERPAVADTGHGQPMPGLLPPGRRTSAI
FT                   DVLAAGRPDPVPVAGPGTDMGTGPVPGTDVGTAHAGGTGEAVTTDRAGTADRAVAGSEP
FT                   ADATSGQATGVPDSEAASGTGSAAGTDDAAPEPPQEAAATTPRVTRPRRTRASRSSGTT
FT                   DRSTSPADATAPRPADAASPSAAAGTTSEATSPATGGTAEGHVPGPRTDSGALAGPVTA
FT                   DADSDTPAAPPAEATGDTGATGRSTRSRRPRAPKAGPRATGPASPGSGPADAAPTTPIE
FT                   QADARSTMPSSPADAPLTTPSSPAPRTDAPTGDVAPTGRPGRNFFFDDPAPTPSSRPRF
FT                   PMFEDVTGAPGEVRPAWPITPAARPHRATTEPDAPARDDAEASAPAEPAPRPRHRGLPE
FT                   PGASTGWDALATNARPAGPLARPEAGRPVARPEAATAAPGEAGAALPEAAAAETEADSR
FT                   RGRHAEPDDADASGGKPKTRRGLFRRNRAKGDPEPADRTAEPGAEADDEYVDWVAGLAS
FT                   DDNADDARSLRTGRHHRE"
FT   gene            complement(597481..599073)
FT                   /locus_tag="ML5_0575"
FT   CDS_pept        complement(597481..599073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0575"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="KEGG: saq:Sare_4274 thiamine biosynthesis protein
FT                   ThiC; TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06125"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ADU06125.1"
FT                   /translation="MQARRKVYVEGSRPDVRVPFAEVTLTGDNPPVRLYDTSGPGSDPE
FT                   VGLPALRGTWIAERGDVAPVRGAGTPLAGVEGKRPTQLAYARAGIVTPEMEFVAVRESV
FT                   APEFVRDEIAAGRAVLPLNVNHPECEPAVIGKAFLVKVNANIGTSAVTSSVAEEVEKLT
FT                   WATRWGADTVMDLSTGKRIHETREAIVRNAPVPIGTVPIYQALEKVGGDPVKLSWEVFR
FT                   ETVIEQAEQGVDYMTVHAGVLLPYVPLAVDRVTGIVSRGGSIMAAWCLAHHEENFLYTN
FT                   FRELCSLLAKYDVTFSLGDGLRPGSIADANDEAQFAELRTLGELTKVAWEYDVQVMIEG
FT                   PGHVPMHKIKENVDLQQEWCHEAPFYTLGPLTTDVAPAYDHITSAIGAAMIGMFGTAML
FT                   CYVTPKEHLGLPDRDDVKAGVIAYKIAAHAADLAKGHPGAQAWDDALSKARFEFRWEDQ
FT                   FNLALDPETARAYHDATLPAEPAKTAHFCSMCGPKFCSMKITQELKDYAARGMRGKSEE
FT                   FVASGSRVYLPLA"
FT   gene            complement(599091..600653)
FT                   /locus_tag="ML5_0576"
FT   CDS_pept        complement(599091..600653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0576"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="KEGG: stp:Strop_3884 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; thiamine
FT                   monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06126"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ADU06126.1"
FT                   /translation="MTALRVADPGTEAPLEGRPRTRIYTGPTGVVLLTDRRVAKGALVD
FT                   VVAGAVGGGVRWVVLREKDLPRAERLALAVELRAILAEAGGTLVVAGPDPLDGDAVHLP
FT                   AAGPYPPPAVGLVGRSCHDTAELARLTTEHYATLSPVYETRTKPGYGPALRPTGLRELI
FT                   AASKVPVLALGGIETTAQVTACVEAGATGVAVLGAIMRAPDPTETATTLGRAFEEAATR
FT                   VARTHPARSDQGPHAAAPTATTVGRSRHSNHRRREPVTPKTVLSIAGSDSGAGAGIQAD
FT                   LKTFAALGAYGTSVLTAVTAQSTRGVDALLPLPPQTVRDQMDSVLGDFDVRAVKTGMLG
FT                   TPAVADAVAEAARAGRLPHLVVDPVLVATSGHRLGVVEAVERLLPYAEVATPNCAEAAA
FT                   LTGGPVGTVEEMVAAAEALAARGPAFVVVTGGDVDADGESVDVLAGGGTTRLLRAPRVD
FT                   TRHNHGTGCSFSAAVAVRLAAGDAVPVAVAAAKEYVTRALTGARTWELGAGRGPLDHFG
FT                   WSA"
FT   gene            complement(600650..601423)
FT                   /locus_tag="ML5_0577"
FT   CDS_pept        complement(600650..601423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0577"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   saq:Sare_4277 thiazole biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06127"
FT                   /inference="protein motif:PFAM:PF05690"
FT                   /protein_id="ADU06127.1"
FT                   /translation="MSTLEIGGVAFGSRLILGTGGAANLHVLEQAIRASGTELVTLALR
FT                   RVDTTPGGSGGLLDLVERCGVRLLPNTAGCRTAVEAVKTAHLAREAFDTDWVKLEVVGD
FT                   ERTLLPDGVELLRAAEELVADGFTVLPYTSDDPVLARRLADVGCAAVMPAGSPIGSGLG
FT                   IGNPHHIRLIRAAVDVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPVAMATA
FT                   MRYAVEAGHLAYGAGRITRRFHALPSTPDEGRPDL"
FT   gene            complement(601428..601628)
FT                   /locus_tag="ML5_0578"
FT   CDS_pept        complement(601428..601628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0578"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="KEGG: stp:Strop_3887 thiamine biosynthesis protein
FT                   ThiS; TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06128"
FT                   /inference="protein motif:TFAM:TIGR01683"
FT                   /protein_id="ADU06128.1"
FT                   /translation="MELIVNGTGRTLPEGVTVAEVVRTVTDRERGLAVAVNGEVVPRGG
FT                   WAASVLRDGDRVEVLSATQGG"
FT   gene            complement(601619..602689)
FT                   /locus_tag="ML5_0579"
FT   CDS_pept        complement(601619..602689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0579"
FT                   /product="glycine oxidase ThiO"
FT                   /note="KEGG: saq:Sare_4279 glycine oxidase ThiO; TIGRFAM:
FT                   glycine oxidase ThiO; PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06129"
FT                   /inference="protein motif:TFAM:TIGR02352"
FT                   /protein_id="ADU06129.1"
FT                   /translation="MAVVGAGPVGLAIAWRCAQRGLRVVVHDDRPGSGASSVAAGMLSP
FT                   VAEAYFGEHELTALLVGSAARWPGFAAELTEASGVDLGYRTEGTLVVGLTADDLAEAGR
FT                   LWSYQRGLGLPITPLRPSELRDREPALAPRVRGGAVAPGDHQVDPRRLVAALRTAVERA
FT                   GVELRPARVGALSEVDARVTVVAAGCGAAGLTGLPVRPVKGQVLRLRAPGGGPPGFRHV
FT                   IRGYADSEPVYLVPRDSGEVVVGATVEERADTEVTAGGVLTLLRAAAELVPELVEYELV
FT                   EAVAGLRPGTPDNAPIIGPLPGRPGVLAATGHHRHGIVLTPVTADLVTELIVTGEPDPA
FT                   LAPFTPDRFGKERTWN"
FT   gene            complement(602743..603369)
FT                   /locus_tag="ML5_0580"
FT   CDS_pept        complement(602743..603369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0580"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /note="KEGG: saq:Sare_4280 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06130"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ADU06130.1"
FT                   /translation="MLSLGRLHLITDTRPGRDPLAVLRAALPVAGAELVVQVRVEDDAT
FT                   DREAYELACRVTEACRPYGAQFLVNDRLHVALAVDAAGGHVGADDLPVAAARRVLGPDA
FT                   VLGATARGPVGARTAVDAGASYLGVGPCHVTTTKSGLPDPIGPEGIRAVAEAVSVPVIA
FT                   IGGVTAASVPALRAAGAYGVAVVGALSLAADPAHATAELLRALTC"
FT   misc_binding    complement(603364..603475)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 55.19"
FT   gene            603594..604505
FT                   /locus_tag="ML5_0581"
FT   CDS_pept        603594..604505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gob:Gobs_0898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06131"
FT                   /inference="similar to AA sequence:KEGG:Gobs_0898"
FT                   /protein_id="ADU06131.1"
FT                   /translation="MSVPARVPRRLAILPFRGSHAVSEGLLTWTMLRGPTWIRLLPDVY
FT                   VHRDGYRADDHRMWCEAVALRLPPGAALAGRSAAWLFGTDVLSRDAPVTVLLPSPARMR
FT                   PHPRLLVTRSPLPESDRTRFAGLPVTTPLRTAFDLGRQGSLAEALVAVDALLRRRVVKL
FT                   PVLRAYAADRPGWPGAPLLREVLAMAEPLSESPMETRLRLLLLDAGLGPLTAQHEVRTG
FT                   GRFVARVDLAWPALRLAVEYDGDHHRERAHFRRDVARLNALRAAGWVVLRFTVDDVLRR
FT                   PDATVALVRQALAERRAAAANH"
FT   gene            complement(604961..605905)
FT                   /locus_tag="ML5_0582"
FT   CDS_pept        complement(604961..605905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0582"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: saq:Sare_4281
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06132"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU06132.1"
FT                   /translation="MTYRRLGDSGLVVSVVGIGCNNFGRKLDLDGTRAVVDAALDAGIN
FT                   FFDTADIYGEPQGASEELLGRALKGRRDDVVVATKFGMDMNGANGPDHGARGARRYIAR
FT                   AVEASLRRLGTDHIDLYQMHEPDPGTPIDETLAALDDLVTAGKVRYLGNSNFAGWQIAD
FT                   ADWTASSQGRTRFISAQNHYSLVERGVEDEVIPACERFGLGMLPFFPLANGLLTGKYKR
FT                   GEAPPAGSRLAGGGRYAERLAAARWDVIEAIEAYAAERGISMLQVAIGGLAARPAVTSV
FT                   IAGATTGEQVKANAEAGTWQPSDEDLTALDAIL"
FT   gene            complement(605945..606751)
FT                   /locus_tag="ML5_0583"
FT   CDS_pept        complement(605945..606751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0583"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: sro:Sros_7419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06133"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADU06133.1"
FT                   /translation="MIDRDLADRLCAVDGVVAVALGGSRARGDHRPDSDWDVGLYYRGA
FT                   PDLAGLRAVAASIADGPVDLTAPGGWGPWVDGGGWLRVGGVAVDWIYRDLDRVHRVWAD
FT                   CRAGRYTVEAQAGHPLGFYSHAYAGEVALGRVLGDPTGELTALRAETFDYPPALGAALI
FT                   AGGWETGLLLDGAAKGAAGGDAGYVAGCLFRVVGVLVHALHGRAGRWLVNEKGMIVSAG
FT                   RLPGAPPDFAERAQALLGAVGRTPEELAATIGAARTLADQVLPLPG"
FT   gene            complement(606748..608427)
FT                   /locus_tag="ML5_0584"
FT   CDS_pept        complement(606748..608427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0584"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: saq:Sare_4282 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06134"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU06134.1"
FT                   /translation="MGYVDVAGVGHILPDGRELFSDVSFRVGEGAKVALVGPNGAGKTT
FT                   LLRMVAGDLPVKTGAVARSGGLGVMRQFIGMIGDESTLADLALSLAPPALRDAGRRLAE
FT                   TEAAMRAAEVRGKYSSAAAKTQLAYAEALAAWGETGGYDAEVLFDTVATIVLDLPWDSA
FT                   RERPVRTLSGGQQKRFALELLLRGPDEVLLLDEPDNFLDVPGKRWLEARLRESGKSVLY
FT                   VSHDRELLAQTADRVVAVEGGSAWVHPGGFASWHEARVARHARLDELRKRWDEEHQKLR
FT                   ELMLMYKQKAAYNDGMASRYQAAQTRLRKFEEAGPPPVPPKDQDIRMRLTGGRTGKRAV
FT                   IAEQLELDGLTYPFDLELWYGDRVAVLGANGTGKSHFLWLLARGGTDPEPGNTPVDGAA
FT                   ALAPVAHGGVVRLGARVRPGHFSQTHDRPELMGKTLVEVLWRGDDHRAGMDRHAAMAAL
FT                   SRYELAGQGDQRFGTLSGGQQARFLVLLLELSGATLLLLDEPTDNLDLASAEALEAGLT
FT                   AFEGTVVAVTHDRWFTRTFDRFVLFRGDGDVVETPEPVWDVG"
FT   gene            complement(608469..609140)
FT                   /locus_tag="ML5_0585"
FT   CDS_pept        complement(608469..609140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0585"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: stp:Strop_3892
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06135"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADU06135.1"
FT                   /translation="MACDPARDTVAGTPAARCENAGVTGDHYFTAEPSTPARPREVEFT
FT                   VAGRDYTLASAGGVFSADRLDPGTAVLLRKADLPAADVTGALLDIGCGFGPITCVLATV
FT                   APKATVWAVDVNERARALTTANAARVGAADRVRAVAPDELPDDVTFAQIWSNPPIHIGK
FT                   PELRGLLLRWLPRLAPDGVAWLVVARHLGGDSLHRWLVEQGWSVERHASQKGYRVLRVT
FT                   R"
FT   gene            609497..610405
FT                   /locus_tag="ML5_0586"
FT   CDS_pept        609497..610405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_1220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06136"
FT                   /inference="similar to AA sequence:KEGG:Snas_1220"
FT                   /protein_id="ADU06136.1"
FT                   /translation="MPQPAPPMPAPVPAAANRPTVPIPASPTARAADVSELPRTRRAER
FT                   RGGGRFWQTLVGGAAVLLLLSLTGLAVAALLDERTTTPPAGQPTPQPTESSTPSGGTDL
FT                   DSRDTDQASLTAKEVFPTKDLVVTDGKPAYRVLKTQASTKCQVAATGEIADLLVRLGCN
FT                   QVVRGTLRSPDGDHLITAGLFNLTDVATAQRVRDRIRPLLDARQGRFRGMAAGDDTDAV
FT                   EKAAARVAWQVRGHYVAFCLVTRADGERIPSDDATAREIMYDLVELHLNRGVLDRRAAA
FT                   GTAGQPDADSAEDSAGQRGTD"
FT   gene            complement(610413..611246)
FT                   /locus_tag="ML5_0587"
FT   CDS_pept        complement(610413..611246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0587"
FT                   /product="tRNA-pseudouridine synthase I"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: stp:Strop_3893 tRNA-pseudouridine synthase I;
FT                   PFAM: Pseudouridine synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06137"
FT                   /inference="protein motif:PRIAM:5.4.99.12"
FT                   /protein_id="ADU06137.1"
FT                   /translation="MDERTRLRLDVSYDGTDFSGWAPQPARRTVAGVLMQTLDLVLGAG
FT                   TATGLTVAGRTDAGVHATGQVCHLDLPTPVWREHEGRLLRRLARLLPPDVRVRAMTEVP
FT                   ADFDARFSATFRRYEYRVTDAPWGAEPLRRGDTLAWPKPLDLAALNAAAAGLVGEHDFA
FT                   AYCRRKENATTLREVTRLDWRRDPDGILVATVQADAFCQNMVRSLVGAMLVAGDGRRPV
FT                   QWPAGLLTRRERSSEVTVAPAHGLALVAVGYPGDPAEYARRAEETRRLRVPVAEG"
FT   gene            complement(611317..611877)
FT                   /locus_tag="ML5_0588"
FT   CDS_pept        complement(611317..611877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0588"
FT                   /product="ribosomal protein L17"
FT                   /note="KEGG: stp:Strop_3894 50S ribosomal protein L17;
FT                   TIGRFAM: ribosomal protein L17; PFAM: ribosomal protein
FT                   L17"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06138"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADU06138.1"
FT                   /translation="MPTPTKGPRLGGSPAHERLMLANLATALFQHGKIQTTETKARRLR
FT                   PLAEQLITKAKRGDLASRRRVLGVVKDKDVVYALFDQIAPRYANRNGGYTRIVKTGPRK
FT                   GDAAPMAIIELVEELQVAEPKANKKTAARKAAQQDKVEALAPAEETPRSSAGDQDAEAP
FT                   VSASGDTAAAREDSDEATENDKA"
FT   gene            complement(611912..612934)
FT                   /locus_tag="ML5_0589"
FT   CDS_pept        complement(611912..612934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0589"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase dimerisation;
FT                   RNA polymerase alpha subunit domain protein; KEGG:
FT                   saq:Sare_4286 DNA-directed RNA polymerase subunit alpha;
FT                   SMART: RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06139"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ADU06139.1"
FT                   /translation="MLISQRPSLSEESINETRSRFTIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSIKIDGVLHEFTTIPGVKEDVVELVMNIKELCVSSEHDEPVSMYLRKQGPGD
FT                   VTAGDIQPPAGVSVHNPDLKLATLNGKGRLDMELTVERGRGYVTAAQNKQAGAEIGRIP
FT                   VDSIYSPVLKVTYRVEATRVEQRTDFDRLIIDVETKPSMGPRTALASAGSTLVELFGLA
FT                   RELDETAEGIDIGPSPQDAQLAADLALPIEELDLTVRSYNCLKREGINSVGELIGRTEA
FT                   DLLDIRNFGQKSIDEVKMKLAGMGLGLKDSAPNFDPAHVVDAFGEADYDTDDYRETEQL
FT                   "
FT   gene            complement(613030..613656)
FT                   /locus_tag="ML5_0590"
FT   CDS_pept        complement(613030..613656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0590"
FT                   /product="ribosomal protein S4"
FT                   /note="TIGRFAM: ribosomal protein S4; PFAM: RNA-binding S4
FT                   domain protein; ribosomal protein S4; KEGG: saq:Sare_4287
FT                   30S ribosomal protein S4; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06140"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ADU06140.1"
FT                   /translation="MARYTGADCRRCRREKMKLFLKGSKCDGPKCPFESRPFPPGQHGR
FT                   GRTKETEYLLQLREKQKARRVYGVLEKQFRGYYEEAVSKEAKTGEVLLQILESRLDNVV
FT                   YRAGYAKSRDMARQLVKHGHFTVNGKKVDIPSYRVKEHDIIEVRAKSKELTPFLVAQGE
FT                   AGSRTVPAWLEAIPSQMKILVHSLPARQVIDTQVQEQLIVELYSK"
FT   gene            complement(613671..614078)
FT                   /locus_tag="ML5_0591"
FT   CDS_pept        complement(613671..614078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0591"
FT                   /product="30S ribosomal protein S11"
FT                   /note="KEGG: saq:Sare_4288 30S ribosomal protein S11;
FT                   TIGRFAM: 30S ribosomal protein S11; PFAM: ribosomal protein
FT                   S11"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06141"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ADU06141.1"
FT                   /translation="MPPKARAGAAVKKVRRKERKNVAHGQAHIKSTFNNTIVSITDPTG
FT                   AVISWASSGQVGFKGSRKSTPFAAQLAAEAAARRAMEHGMRKVDVFVKGPGSGRETAIR
FT                   SLQAVGLEVGQISDVTPQPHNGCRPPKRRRV"
FT   gene            complement(614097..614477)
FT                   /locus_tag="ML5_0592"
FT   CDS_pept        complement(614097..614477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0592"
FT                   /product="30S ribosomal protein S13"
FT                   /note="KEGG: saq:Sare_4289 30S ribosomal protein S13;
FT                   TIGRFAM: 30S ribosomal protein S13; PFAM: ribosomal protein
FT                   S13"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06142"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ADU06142.1"
FT                   /translation="MARLVGVDLPREKRMEIALTYIFGVGRTRALETLAATGISPDKRV
FT                   RDLTDEELVELRNHIEGNYKVEGDLRREVAADIRRKVEIGCYAGIRHRRGLPVRGQRTR
FT                   TNARTRKGPKRTVAGKKKPGKK"
FT   gene            complement(614689..614802)
FT                   /locus_tag="ML5_0593"
FT   CDS_pept        complement(614689..614802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0593"
FT                   /product="ribosomal protein L36"
FT                   /note="KEGG: saq:Sare_4290 50S ribosomal protein L36;
FT                   TIGRFAM: ribosomal protein L36; PFAM: ribosomal protein
FT                   L36"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06143"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ADU06143.1"
FT                   /translation="MKVKPSVKRICNKCRVIRRHGRVMVICTDPRHKQRQG"
FT   gene            complement(614895..615116)
FT                   /locus_tag="ML5_0594"
FT   CDS_pept        complement(614895..615116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0594"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: saq:Sare_4291 translation initiation factor
FT                   IF-1; TIGRFAM: translation initiation factor IF-1; PFAM: S1
FT                   IF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06144"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ADU06144.1"
FT                   /translation="MPKKDGAIEIEGRVIEPLPNAMFRVELANGHKVLAHISGKMRQHY
FT                   IRILPEDRVVVELSPYDLTRGRIVYRYK"
FT   gene            615241..615342
FT                   /locus_tag="ML5_0595"
FT   CDS_pept        615241..615342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06145"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU06145.1"
FT                   /translation="MAEWTLCADQKVYADPYVLAKPTGATVTRTARI"
FT   gene            complement(615349..615876)
FT                   /locus_tag="ML5_0596"
FT   CDS_pept        complement(615349..615876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0596"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="PFAM: protein of unknown function DUF1707; KEGG:
FT                   saq:Sare_4292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06146"
FT                   /inference="protein motif:PFAM:PF08044"
FT                   /protein_id="ADU06146.1"
FT                   /translation="MRAADADREATAERLRAALNEGRLDLHEYDDRLRRAYGSKTYGEL
FT                   DELLTDLPGAGPAGRPLPAPRAAGEGGVAVPGTEAVSGARSAWLLGVWGPWLKVALILT
FT                   AIWFVSQLAEGEFEFDDYWPLWVLGPWGAVLLYQTAQGLATGAPEKDAERRRRKQVERE
FT                   ARRRAKRELPET"
FT   gene            complement(615967..616818)
FT                   /locus_tag="ML5_0597"
FT   CDS_pept        complement(615967..616818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0597"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; KEGG:
FT                   stp:Strop_3901 methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06147"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADU06147.1"
FT                   /translation="MRRPQLDIQLKTPEQIELMRAAGLVVARALRRMREAVAPGVSTAD
FT                   LDAIAESTIREAGAVPSFKGYHGFPASICSSVNRQVVHAIPSAEQVLREGDLISIDCGA
FT                   VLDGWHGDAAVTVPVGEVDPALLRMTAVAEDAMWAGIAAAARGAASGKGRLTDISHAVE
FT                   TAVRKGGRYGIVDGYGGHGIGTEMHQDPHVLNHGRPGKGPRLVPGLALAIEPMITMGSP
FT                   RTVELSDGWTVVTRDGSMAVHVEHSMALLDDGVWVLTAEDGGRARLGDLVTKRQTSVDS
FT                   PA"
FT   gene            complement(616916..617569)
FT                   /locus_tag="ML5_0598"
FT   CDS_pept        complement(616916..617569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0598"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: saq:Sare_4294 adenylate kinase; TIGRFAM:
FT                   adenylate kinase; PFAM: adenylate kinase; adenylate kinase
FT                   lid domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06148"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADU06148.1"
FT                   /translation="MRLVLVGPPGAGKGTQAEFVAAHLSVPKISTGDIFRANVSQGTPL
FT                   GVEAKRYMDAGKLVPDEVTINMVRDRLAEPDASEGFLLDGFPRTTPQAAALDKLLADLG
FT                   TALDLVLELVVDDDEVIRRLSGRRTCRGCGKIWHVEFDSPSREGVCDRCGAELFQRDDD
FT                   KPETIAARLREYAEKTAPLVDYYGAQGKLVGIDATGPVEDVTVRAIDALRSYGG"
FT   gene            complement(617570..618898)
FT                   /locus_tag="ML5_0599"
FT   CDS_pept        complement(617570..618898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0599"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="KEGG: stp:Strop_3903 preprotein translocase subunit
FT                   SecY; TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06149"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ADU06149.1"
FT                   /translation="MLSAFLSAFRTPDLRKKLLFTVGIIAVYRLGATLPSPGVSYGNVQ
FT                   KCLDTIQGGSTGVLNLLDLFSGGALLQLSVFALGIMPYITASIILQLLTVVIPRLEQLR
FT                   KEGQAGQAKITQYTRYLTLGLGVLQASAFVALARSGQLFNNQCDQFPIVPEGTGIPNWL
FT                   TLSILVMTMTAGTGVVMWLGELITDRGVGNGMSVLIFTSIAARLPSEGWKIKTTKGWGM
FT                   FLLVIALVLVVITAVTFIEQAQRRIPVQYAKRMIGRRMYGGTSTYIPLKVNQAGVIPVI
FT                   FASSLLYLPQLALQFFDQNDPGKVQAWIQNHIVKASAPEHIAIYFLLIIFFTYFYVSIT
FT                   FNPTEVADNMKKYGGFVPGIRPGKPTAEYLDFILSRITLPGALYLGIVAILPNFFFIWL
FT                   DNQQFQNFPFGGTAVLIMVGVGLETVKQIESQLMQRNYEGFLR"
FT   gene            complement(619137..619580)
FT                   /locus_tag="ML5_0600"
FT   CDS_pept        complement(619137..619580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0600"
FT                   /product="ribosomal protein L15"
FT                   /note="KEGG: stp:Strop_3904 50S ribosomal protein L15;
FT                   TIGRFAM: ribosomal protein L15; PFAM: Ribosomal protein
FT                   L18e/L15"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06150"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADU06150.1"
FT                   /translation="MTIKVHHLRPAPGAKTDKTRVGRGEGSKGKTAGRGTKGSKARKNI
FT                   SAAFEGGQMPIHMRLPKMKGFKNKFKVVFQVVNLDRLAELFPNGGQVGPVELVEAGAVR
FT                   KGHPVKVLGTGDLGGVSLQVSAHAFSASAKEKITAAGGSVTEL"
FT   gene            complement(619580..619762)
FT                   /locus_tag="ML5_0601"
FT   CDS_pept        complement(619580..619762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0601"
FT                   /product="ribosomal protein L30"
FT                   /note="KEGG: saq:Sare_4297 50S ribosomal protein L30;
FT                   TIGRFAM: ribosomal protein L30; PFAM: ribosomal protein
FT                   L30"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06151"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ADU06151.1"
FT                   /translation="MARLKVTQVRSEIGTKKNQRDSLRSLGLKRINDVVVKEDRPEIRG
FT                   MIFTVNHLVKVEEVE"
FT   gene            complement(619762..620376)
FT                   /locus_tag="ML5_0602"
FT   CDS_pept        complement(619762..620376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0602"
FT                   /product="ribosomal protein S5"
FT                   /note="KEGG: saq:Sare_4298 30S ribosomal protein S5;
FT                   TIGRFAM: ribosomal protein S5; PFAM: ribosomal protein S5
FT                   domain protein; Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06152"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADU06152.1"
FT                   /translation="MPGQQRRGGGSGGNEGGRRDNRREGGRGNAPVEKTPHLERVVAIN
FT                   RVAKVVKGGRRFSFTALVIVGDGDGTVGVGYGKAKEVPAAIAKGVEEAKKHFFKVPRIG
FT                   QSIPHPVTGEDAAGVVLLKPASAGTGVIAGGPVRAVLECAGIHDVLSKSLGSSNPINIV
FT                   HATVAALKGLESPEQVAARRGLPVEDVAPAAMLASRAGVAS"
FT   gene            complement(620410..620799)
FT                   /locus_tag="ML5_0603"
FT   CDS_pept        complement(620410..620799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0603"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: saq:Sare_4299 ribosomal protein L18; TIGRFAM:
FT                   ribosomal protein L18; PFAM: ribosomal protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06153"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADU06153.1"
FT                   /translation="MSATLLKRRRGVAAKRAVGRARRHFRVRKNVSGTAERPRLVVTRS
FT                   LRHVVAQVVDDTKGHTLASASTMDASLRGAEGDKSALAGKVGALLAERAKAAGVSKVVF
FT                   DRGGNRYAGRVAALADAAREAGLEF"
FT   gene            complement(620796..621338)
FT                   /locus_tag="ML5_0604"
FT   CDS_pept        complement(620796..621338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0604"
FT                   /product="ribosomal protein L6"
FT                   /note="KEGG: saq:Sare_4300 50S ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06154"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ADU06154.1"
FT                   /translation="MSRIGRKSIPVPAGVDITIDGRTVKVKGPKGELSHVLAEPITAER
FT                   GEDGELHVNRPNDERKAKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDL
FT                   EFALGFSHPVLVPAPEGITFTVEKPTLFHVAGIDKQQVGEVAANIRKIRPPEPYKGKGV
FT                   KYQGEVIRRKAGKAGKK"
FT   gene            complement(621355..621762)
FT                   /locus_tag="ML5_0605"
FT   CDS_pept        complement(621355..621762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0605"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: saq:Sare_4301 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06155"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADU06155.1"
FT                   /translation="MTMTDPIADMLTRLRNANQAYHDRVTMPYSKIKANIAEVLKAEGY
FT                   IATWSVEEPEEGAVGKRLVVELKYGQNRERSLAGIKRVSKPGLRVYAKSDGLPRVLGGL
FT                   GVAIISTSQGLLTDRQARKRSVGGEVLAFVW"
FT   gene            complement(621861..622046)
FT                   /locus_tag="ML5_0606"
FT   CDS_pept        complement(621861..622046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0606"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: saq:Sare_4302 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06156"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ADU06156.1"
FT                   /translation="MAKKALILKAAAKPKFSVRAYTRCQRCGRPKAVYRKFGLCRVCIR
FT                   EMAHRGELPGVSKASW"
FT   gene            complement(622048..622617)
FT                   /locus_tag="ML5_0607"
FT   CDS_pept        complement(622048..622617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0607"
FT                   /product="50S ribosomal protein L5"
FT                   /note="KEGG: stp:Strop_3911 50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06157"
FT                   /inference="similar to AA sequence:KEGG:Strop_3911"
FT                   /protein_id="ADU06157.1"
FT                   /translation="MTTATETKTLPRLKERYRNEIVGELQKQFEFANPMQVPRLVKIVV
FT                   NMGVGEAARDAKLIDGAVRDLATITGQKPQVRRATKSIAQFKLREGMPIGAKVTLRGDR
FT                   MWEFLDRLLSIALPRIRDFRGLDGRKLDGHGNYTFGLTEQSVFHEIDQDKIDRQRGMDI
FT                   TVVTTATTDDEGRALLKLLGFPFKEN"
FT   gene            complement(622617..622937)
FT                   /locus_tag="ML5_0608"
FT   CDS_pept        complement(622617..622937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0608"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: stp:Strop_3912 50S ribosomal protein L24;
FT                   SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06158"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADU06158.1"
FT                   /translation="MTVKVKKGDTVVVIAGKDKGAKGKVIAAYPRQDKVLVEGVNRVKK
FT                   HTRISTTQRGAKTGGIVTQEAPIHVSNVMVLDSDGKPTRVGYRIDDNGQKVRIARSTGK
FT                   DL"
FT   gene            complement(622934..623302)
FT                   /locus_tag="ML5_0609"
FT   CDS_pept        complement(622934..623302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0609"
FT                   /product="ribosomal protein L14"
FT                   /note="KEGG: saq:Sare_4305 50S ribosomal protein L14;
FT                   TIGRFAM: ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06159"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADU06159.1"
FT                   /translation="MIQQESRLRVADNTGAREILCIRVLGGSGRRYASIGDVIVATVKD
FT                   AIPGAGVKKGDVVKAVVVRTAKEKRRPDGSYIRFDENAAVIIKDGGDPRGTRIFGPVGR
FT                   ELRDKRFMKIISLAPEVL"
FT   gene            complement(623401..623676)
FT                   /locus_tag="ML5_0610"
FT   CDS_pept        complement(623401..623676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0610"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: saq:Sare_4306 30S ribosomal protein S17;
FT                   TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal protein
FT                   S17"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06160"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADU06160.1"
FT                   /translation="MSENTTAPARSRRKVREGLVVSDKMDKTVVVEVEDRVKHALYGKI
FT                   MRRTSKLKVHDEQNSAGIGDRVLIMETRPLSATKRWRLVEILEKAK"
FT   gene            complement(623673..623909)
FT                   /locus_tag="ML5_0611"
FT   CDS_pept        complement(623673..623909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0611"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: saq:Sare_4307 50S ribosomal protein L29;
FT                   TIGRFAM: ribosomal protein L29; PFAM: ribosomal protein
FT                   L29; Protein of unknown function DUF2216"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06161"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADU06161.1"
FT                   /translation="MAAGVKPSELRELSEEELVTKLREAKAELFNLRVQAATGQLDNNR
FT                   RLQVIRREIARIYTIMRERELGLSAAPTEVTAS"
FT   gene            complement(623909..624334)
FT                   /locus_tag="ML5_0612"
FT   CDS_pept        complement(623909..624334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0612"
FT                   /product="ribosomal protein L16"
FT                   /note="KEGG: saq:Sare_4308 50S ribosomal protein L16;
FT                   TIGRFAM: ribosomal protein L16; PFAM: Ribosomal protein
FT                   L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06162"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADU06162.1"
FT                   /translation="MLMPRKPPKGFRKPHHPDRSGASKGGNRVVFGEFGIQALEPAYVT
FT                   NRQIESARIAMTRHIKRGGKVWITIFPDQALTKKPAETRMGSGKGSPEWWVANVKPGRV
FT                   LFEMSFPNEQIAREAMRRAIHKLPMKCRIVTREVGES"
FT   gene            complement(624338..625225)
FT                   /locus_tag="ML5_0613"
FT   CDS_pept        complement(624338..625225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0613"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; Ribosomal protein S3 domain; KH
FT                   type 2 domain protein; KEGG: saq:Sare_4309 ribosomal
FT                   protein S3; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06163"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADU06163.1"
FT                   /translation="MGQKVHPTGFRLGISTDWKSRWFADKLYKDYIGEDVKIRRMMSKG
FT                   LERAGISKVDIERTRDRVRVDIHTARPGIVIGRKGAEADRIRGELEKLTGKQVQLNIIE
FT                   VKNPESDAQLVAQGVAEQLSSRVSFRRAMRKAMQSAMKNPACKGIRVQVSGRLGGAEMS
FT                   RTEFYREGRVPLHTLRANIEYGFFEARTTFGRIGVKVWIYKGDAVPGREAPAEAAPSRG
FT                   PRRDRGDRPDRPRRGRSGSSGTTAGGTEAGRAAATTIAQQAETPAGEPVDSSAVAAAAS
FT                   APVGNQPAETQQEG"
FT   gene            complement(625225..625674)
FT                   /locus_tag="ML5_0614"
FT   CDS_pept        complement(625225..625674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0614"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: stp:Strop_3918 50S ribosomal protein L22;
FT                   TIGRFAM: ribosomal protein L22; PFAM: ribosomal protein
FT                   L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06164"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADU06164.1"
FT                   /translation="MPGKGDAPVLPGARAVARHVRISPMKARRVVNLVRGLPAKEALTV
FT                   LQFAPQAASEQVYKVLASAIANAENNERLDPDALLVSEAFVDEGPTMKRFRPRAQGRAY
FT                   RIRKRTCHITVAVEAVAAATPKKSAKKAAPAKPAAEEQSTTEGAE"
FT   gene            complement(625715..625996)
FT                   /locus_tag="ML5_0615"
FT   CDS_pept        complement(625715..625996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0615"
FT                   /product="ribosomal protein S19"
FT                   /note="KEGG: saq:Sare_4311 30S ribosomal protein S19;
FT                   TIGRFAM: ribosomal protein S19; PFAM: ribosomal protein
FT                   S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06165"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADU06165.1"
FT                   /translation="MPRSLKKGPFVDDHLLKKVETQNDKGSKNVIKTWSRRSTIIPEML
FT                   GHTIAVHDGRKHVPVFVTEAMVGHKLGEFALTRTFKGHEKDDRKSRRR"
FT   gene            complement(626009..626848)
FT                   /locus_tag="ML5_0616"
FT   CDS_pept        complement(626009..626848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0616"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: saq:Sare_4312 50S ribosomal protein L2;
FT                   TIGRFAM: ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06166"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADU06166.1"
FT                   /translation="MAIRKYKPTTPGRRGSSVADFAEITRSTPEKSLLAPLPKKGGRNA
FT                   HGRITTRHHGGGHKRQYRLIDFKRVDKDGVPAKVAHIEYDPNRTARIALLHYADGEKRY
FT                   IIAPKDLKQGDRVESGPGADIKPGNNLPLRNIPVGTTIHNVELRPGGGAKLARSAGVGI
FT                   QLLGREGAYATLRMPSGEIRRVDVRCRASIGEIGNADQSNINWGKAGRMRWKGKRPTVR
FT                   GVAMNPVDHPHGGGEGKTSGGRHPVNPQGKPEGRTRRKGQPSDRLIVRRRYATRKRG"
FT   gene            complement(626861..627163)
FT                   /locus_tag="ML5_0617"
FT   CDS_pept        complement(626861..627163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0617"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: saq:Sare_4313
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06167"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADU06167.1"
FT                   /translation="MSTIADPRDVIVAPVVSEKSYSELNRNWYTFLVHPDANKTEIKIA
FT                   IQQIFNVRVLTVNTLNREGKRKRTRTGFGKRKDTKRAMVKLADGDRIEAFGGPVS"
FT   gene            complement(627160..627825)
FT                   /locus_tag="ML5_0618"
FT   CDS_pept        complement(627160..627825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0618"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: stp:Strop_3922
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06168"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADU06168.1"
FT                   /translation="MTTVDVINVEGAKSGSVELPADIFDAQANIALMHQVVVAQLAAAR
FT                   QGTHKTKTRGEVSGGGKKPYKQKGTGRARQGSTRAPQFAGGGVVHGPVPRDYSQRTPKK
FT                   MKAAALRGALSDRARAGQVHVVEAFVSGEKPSTKAALATLTKLTQARRVLVVLSSTDEL
FT                   NWVSLRNLRNARDSRVHLIEAGQLNTYDVLVADDVVFTKEALDEFLGVPAETTEEDGK"
FT   gene            complement(627822..628487)
FT                   /locus_tag="ML5_0619"
FT   CDS_pept        complement(627822..628487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0619"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: stp:Strop_3923 50S ribosomal protein L3;
FT                   TIGRFAM: 50S ribosomal protein L3; PFAM: ribosomal protein
FT                   L3"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06169"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADU06169.1"
FT                   /translation="MDRQVKGILGAKLGMTQVWDNNKVVPVTVVQAGPCVVSQVRSADK
FT                   DGYSAVQLAYGVIDPRKVKKPIAGHYAKADVAPRRHIVELRTSDAADYAPGQEVTVEEF
FT                   PAGVVIDVTGKTKGKGYAGPMKRHGFHGLRASHGVERKHRSPGSIGACATPGRVFKGTR
FT                   MAGRMGGVRYTVQNLTVQAVDTENNLLLVRGAIPGPKGALVLVRTAAKAKVKKGGAAK"
FT   gene            complement(628499..628807)
FT                   /locus_tag="ML5_0620"
FT   CDS_pept        complement(628499..628807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0620"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: saq:Sare_4316 30S ribosomal protein S10;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06170"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADU06170.1"
FT                   /translation="MAGQKIRIRLKAYDHEVVDSSARKIVETVTRTGAQVAGPVPLPTE
FT                   INRFCVIRSPHKYKDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDIEIKL"
FT   gene            complement(629163..630356)
FT                   /locus_tag="ML5_0621"
FT   CDS_pept        complement(629163..630356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0621"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: saq:Sare_4317 elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor Tu
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06171"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADU06171.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHIDHGKTTLTAAITKVLHDQYPDLNP
FT                   YTPFDEIDKAPEEKARGITISIAHVEYQTEARHYAHVDCPGHADYIKNMITGAAQMDGA
FT                   ILVVAATDGPMPQTREHVLLARQVGVPYIVVALNKSDMVDDEELLELVELEVRELLSSQ
FT                   EYPGDDLPVVRVSALKALEGDPEWTGKLLDLMNAVDTAIPQPERETEKPFLMPIEDVFT
FT                   ITGRGTVVTGRAERGILKPNEEVEIVGIREKSMKTTCTGIEMFRKLLDEARAGENVGLL
FT                   LRGIKREDVERGMVVIKPGTTTPHTEFEATVYILSKEEGGRHTPFFQNYRPQFYFRTTD
FT                   VTGVVTLPEGTEMVMPGDNTSMTVKLIQPIAMEENLKFAIREGGRTVGAGRVTKIIK"
FT   gene            complement(630580..632676)
FT                   /locus_tag="ML5_0622"
FT   CDS_pept        complement(630580..632676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0622"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: saq:Sare_4318 elongation factor G; TIGRFAM:
FT                   translation elongation factor G; small GTP-binding protein;
FT                   PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   elongation factor G domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06172"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADU06172.1"
FT                   /translation="MAAADALANVRNIGIMAHIDAGKTTTTERILFYTGITYKIGEVHE
FT                   GAAVMDWMEQEQERGITITSAATKCEWKGHTIQIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VYDGVAGVEPQTENVWRQADKYNVPRMCFVNKLDRTGADFFRCVQMMIDRLNATPLVLQ
FT                   IPIGAESDFIGVVDLVEMRALTWRGETQKGEDYAVEEIPADLADSAAEWREKLMETLAD
FT                   VDDSVMEKYLEGEEISVDEIKAAIRRSTIAGKANPVLTGTAFKNKGIQPMLDAVVAYLP
FT                   SPLDIPAIEGTATDGETPLQRKPSVSEPFSGLAFKIQTDKHLGKLTYVRIYSGTLESGS
FT                   QVINSTKDRKERIGKIYQMHANKREERSSAQAGDIIAVQGLKQTTTGDTLCDPANPVIL
FT                   ESMTFPEPVIEVAIEPKTKADQEKLSTAIQRLAEEDPTFRVKLDDQTGQTVISGMGELH
FT                   LDILVDRMRREFNVEANIGKPQVAYRETIRRKVEKVEYTHKKQTGGSGQYARVIISVEP
FT                   LPLGNDAPTYEFANAVTGGRIPREFIPSVDAGAQDAMQYGILAGFPLVGVKLTLVDGQY
FT                   HEVDSSEMAFKIAGSMAMKEAARKADPALLEPMMAVEVTTPEENMGDVIGDLNSRRGII
FT                   QAMEERSGARVVRALVPLSEMFGYVGDLRSKTQGRASYSMQFDSYAEVPNSVAKEIIAK
FT                   ATGE"
FT   gene            complement(632752..633222)
FT                   /locus_tag="ML5_0623"
FT   CDS_pept        complement(632752..633222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0623"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: stp:Strop_3927 30S ribosomal protein S7;
FT                   TIGRFAM: ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06173"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADU06173.1"
FT                   /translation="MPRKGPAPRKPLVADPVYNSPLVTQLVNKILLRGKRQLAERIVYA
FT                   ALEGCREKSGTDPVVTLKRAMDNVKPTLEVRSRRVGGATYQVPVEVRPSRATTLGLRWL
FT                   VTYSRARREKTMVERLMNELLDASNGLGAAVKRREDTHKMAESNKAFAHYRW"
FT   gene            complement(633224..633598)
FT                   /locus_tag="ML5_0624"
FT   CDS_pept        complement(633224..633598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0624"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: saq:Sare_4320 30S ribosomal protein S12;
FT                   TIGRFAM: ribosomal protein S12; PFAM: ribosomal protein
FT                   S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06174"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADU06174.1"
FT                   /translation="MPTIQQLVRKGRQAKTTKTKTPALKGSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVKLSSQIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGSLDT
FT                   QGVRNRKQARSRYGAKKEKS"
FT   gene            complement(634099..634716)
FT                   /locus_tag="ML5_0625"
FT   CDS_pept        complement(634099..634716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0625"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06175"
FT                   /inference="similar to AA sequence:KEGG:Strop_3929"
FT                   /protein_id="ADU06175.1"
FT                   /translation="MTEPAPPGGDQPRPGPYPPGSASAPAHQPGPYGAYPGSPPAHGGG
FT                   WPAPASVPGHGGWGPHGGPALPPPPAETPRPPKRVDAVPGTPFGVVHLDVPPVTSGLAI
FT                   GSLVAGIAAIGVSLLVLCFGLAGRDVGGAWAAGAFTVLGGLIGAGAVVAGLLARRQIRR
FT                   PAPPPSVRFTGAGLAVAGISCGAAGVLFGLIGLALALVVQIT"
FT   gene            complement(634821..635180)
FT                   /locus_tag="ML5_0626"
FT   CDS_pept        complement(634821..635180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0626"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06176"
FT                   /inference="similar to AA sequence:KEGG:Sare_4322"
FT                   /protein_id="ADU06176.1"
FT                   /translation="MPGQAPVVPQAYRHPYDPEPVRSTKARAVFALGLIGVLTGLFLGG
FT                   AVPATIALVLARQARREAYASGGYLTGADWLRRGEQMARTGLVLTAAAVVAAVVIGVVR
FT                   AADASFGHDFAPNFD"
FT   gene            complement(635304..639191)
FT                   /locus_tag="ML5_0627"
FT   CDS_pept        complement(635304..639191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0627"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase alpha
FT                   subunit; RNA polymerase Rpb1 domain 3; RNA polymerase Rpb1
FT                   domain 4; RNA polymerase Rpb1 domain 5; KEGG:
FT                   stp:Strop_3932 DNA-directed RNA polymerase subunit beta';
FT                   SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06177"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ADU06177.1"
FT                   /translation="MLDVNFFDELRIGLATADDIRQWSHGEVKKPETINYRTLKPEKDG
FT                   LFCEKIFGPQRDWECYCGKYKRVRFKGIICERCGVEVTRSKVRRERMGHIELAAPVTHI
FT                   WYFKGVPSRLGYLLDLAPKDLEKIIYFASYVVTSVDAEARHRDLSTIENEILAEKRQAE
FT                   NSRDSEIEKRAAKLEADLAELEAEGAKADVRRKVKEGGEREMRQIRDRAQREIDRLDEV
FT                   LDTFRKLEPKQLVTDELLYRELRDRFGEYFTGSMGAEAIKALVQNMDLEAEAENLRETI
FT                   RSGKGQRKIRALKRLKVVAAFQNTRNSPLGMVLDCVPVIPPDLRPMVQLDGGRFATSDL
FT                   NDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPL
FT                   KSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPKLKLHQCGLPKQMALELFKPFVMK
FT                   RLVDLNHAQNIKSAKRMVERQRPVVWDVLEEVIGEHPVLLNRAPTLHRLGIQAFEPQLV
FT                   EGKAIQIHPLVCTAFNADFDGDQMAVHVPLSAEAQAEARILMLSSNNILKPADGKPVTM
FT                   PTQDMVIGLYHLTHLTPGGKGEGRAFSSDAEARMAYDNGELHLQTPVRIRLRDVVGVDN
FT                   GAGAEPWTAPEGWTEGEPVTVETTLGRVLFNETLPPGYRFVNYEIRKGQLSAIVNDLAE
FT                   RFPKVALAATLDGLKEAGFHWATWSGVTIGMEDVIAPPRKREILERYEKEADRIDKQYQ
FT                   RGLMTAEERRGELIEIWTKATNEVAKEMDTALPQENPLWKMINSGARGNLLQLRQIAAI
FT                   RGLVANPKGEIIPRPIKASYREGLSVLEYFISTHGARKGLADTALRTADSGYLTRRLVD
FT                   VSQDVIIREEDCGTDRAIPMQVGERIDGKLVVHEHAETSVHARTLADDIKGPDGTVVAH
FT                   RGQDINSILVDAIVAAGTETVRVRSVLTCESKLGVCGACYGRSLPTGKTVDVGEAVGII
FT                   AAQSIGEPGTQLTMRTFHTGGVAGEDITQGLPRVQEIFEARVPKGKAPIADTPGRIRIE
FT                   DGERSRKIVVIPDDGSDEIVYDKISKRVRLRAHDGDHVEVGEKLTEGTIDPHELLRILG
FT                   PRAVQVHLTQEVQEVYRSQGVLIHDKHIEIIIRQMLKRVTVIDSGSTEFLPGVLVDRAL
FT                   FESENRRLVGEGGEPAAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAIHARSDS
FT                   LIGLKENVIIGKLIPAGTGISKYRNVRVEPTEEAKAKVYSMTGYPETDYGFGPASGQAV
FT                   PLDDFDFGSYR"
FT   gene            complement(639272..642703)
FT                   /locus_tag="ML5_0628"
FT   CDS_pept        complement(639272..642703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0628"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="KEGG: stp:Strop_3933 DNA-directed RNA polymerase
FT                   subunit beta; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   Rpb2 domain 3; RNA polymerase beta subunit; RNA polymerase
FT                   Rpb2 domain 2; DNA-directed RNA polymerase, beta subunit,
FT                   external 1 domain; RNA polymerase Rpb2 domain 7"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06178"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADU06178.1"
FT                   /translation="MAASRPAKTSRTSSAFAPRRVSFGRITEHLEVPNLLAIQNESFDW
FT                   LVGNEAWQGRSADDPHARSGLAEILDEISPIEDFSGTMSLSFSAPRFDEVKASIEECKE
FT                   KDLTYCAPLFVTAEFTNNTTGEIKSQTVFMGDFPMMTPKGTFIINGTERVVVSQLVRSP
FT                   GVYFDKQPDKTSDRDLSSVKVIPSRGAWLEFDIDKRDTVGVRIDRKRRQAVTVLLKAIG
FT                   WSAERIREKFGWSELMMTTLEKDHIAGQDEALLDIYRKLRPGEPPTRENAQTLLDNLFF
FT                   NPKRYDVAKVGRYKFNKKLELDVPITTGTLTEDDIVATVEYLCRLHAGEEGYEADDIDH
FT                   FGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDVEAITPQTLINIRPVVAAIKEFF
FT                   GTSQLSQFMDQTNPLAGLTHRRRLSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPE
FT                   GPNIGLIGALSTFARVNPFGFIETPYRKVIDGRVTDQIDYLTADEEDRFVKAQANAPLK
FT                   SDGTFAEDRVLVRRKGGETEDVAPGAVDYMDVSPRQMTSVATAMIPFLEHDDANRALMG
FT                   ANMQRQAVPLVKAEAPLVGTGMEYRAAVDAGDVVVAEVGGVVEDLCADYITVHQDDGHR
FT                   RTYLLHKFRRSNAGSCVNQKPVVFEGDRVEAGQVIADGPCTDEGEMALGRNLLVAFMCW
FT                   EGHNYEDAIILSQRLVQQDVLTSIHIEEHEVDARDTKLGPEEITRDIPNVSEEMLADLD
FT                   ERGIIRIGAEVVPGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGET
FT                   GTVIGVRTFSREDGDELPPGVNELVRVYVAQKRKIQDGDKLAGRHGNKGVISKILPIED
FT                   MPFLEDGTPVDIVLNPLGVPSRMNIGQVLETHLGWVAKTGWSVDGDDAEWKRQLRSINA
FT                   HESEPDTNVATPVFDGAREEEISGLLASTLPNRDGNQLIGGSGKAQLFDGRSGEPLPDP
FT                   IAVGYVYILKLNHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGA
FT                   AYALQELLTIKSDDVLGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSS
FT                   DGVALEMRETDDEVFRAAEELGIDLSRREPSSVEEV"
FT   gene            complement(643278..643664)
FT                   /locus_tag="ML5_0629"
FT   CDS_pept        complement(643278..643664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0629"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: saq:Sare_4326 ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06179"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADU06179.1"
FT                   /translation="MAKLSTDELLDAFKEMTLIELSEFVKQFEETFEVTAAAPVAVAGP
FT                   AGPGAPAAEAEPEKDEFDVILDADGGKKIQVIKVVRELTGLGLKEAKDLVEAAPKAVLE
FT                   KANKETAEKAKAKLEGEGAKVTLK"
FT   gene            complement(643719..644267)
FT                   /locus_tag="ML5_0630"
FT   CDS_pept        complement(643719..644267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0630"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: saq:Sare_4327 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06180"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ADU06180.1"
FT                   /translation="MADKPIRADKATAVAELTESFRNAGATVLTEYRGLTVSQLTQLRR
FT                   SLGKETSYTVAKNTLAKRAAADAGISGLDELFSGPTALTFVSGDVVEAAKGLRDFAKAN
FT                   PKLVIKGGVFEGKAISAAEVTKLADLESREVLLAKLAGAMKGNLSKAAALFQAPLSKAA
FT                   RAAAALADKKREQEGAEAA"
FT   gene            complement(644584..645273)
FT                   /locus_tag="ML5_0631"
FT   CDS_pept        complement(644584..645273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0631"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_1873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06181"
FT                   /inference="similar to AA sequence:KEGG:Sros_1873"
FT                   /protein_id="ADU06181.1"
FT                   /translation="MIALVRLRLAGFVRTGRALAPVLAGLLVLGVLYGGGRARPAEAYG
FT                   VSAVVLFPVLAWQTKILLDVEPDVQRRMARVVAGPARERAAGLLAALVAGLAVVLVALA
FT                   LPWPLGGVTAAVGPGERPVLVGVALGLWAHLLSLPAAVALGALASRAVTRSAGYGVAVL
FT                   VTGAVGVVVLGLSGSVVPWLAPPVMATARAVTGPVAAGAGLLLTGWALAWTAVALTGYA
FT                   WARRTRA"
FT   gene            complement(645270..646157)
FT                   /locus_tag="ML5_0632"
FT   CDS_pept        complement(645270..646157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0632"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tcu:Tcur_3400 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06182"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU06182.1"
FT                   /translation="MRLDGVWLRYHRHGPWVLRQVDVAIGSGEAAVVLGRNGAGKSTLL
FT                   QLAAGVLRPSRGRVADRPPVVGWVPERFPADQPFTVGAYLSAMGRVAGLPGPAADRAVR
FT                   HWVERLGLTRFHDVRLPRLSKGTAQKVGLAQALLRPPGLLVLDEPWEGLDATARESVPE
FT                   IIGEVLADGGTVLVSDHRGETVRLPGARHLSVTDGTVTEEASSGGAAVAVVELAVPAAG
FT                   LAAAVARLRADGHQILRVREHAVPPPATHPVPASAGPSGTRGSVGASAAGSPDQAGAEA
FT                   GDSARPGPAPEVAR"
FT   gene            complement(646240..646956)
FT                   /locus_tag="ML5_0633"
FT   CDS_pept        complement(646240..646956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0633"
FT                   /product="ribosomal protein L1"
FT                   /note="KEGG: saq:Sare_4328 50S ribosomal protein L1;
FT                   TIGRFAM: ribosomal protein L1; PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06183"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADU06183.1"
FT                   /translation="MQRSKSYRKAADVIDRSKLYTPVEAVKLAKETTNVKFDATVEVAM
FT                   RLGVDPRKADQMVRGTVNLPHGTGKTARVIVFAAGAKAEEAVAAGADEVGTDELVARIQ
FT                   GGWLDFDAAIATPDQMAKIGRIARILGPRGLMPNPKTGTVTMDVTKAVSDIKGGKITFR
FT                   VDKHSNLHLIIGKASFSENQLVDNYAAVLDEVLRAKPSAAKGTYLKKVTLTTTMGPGVP
FT                   VDPKVVKNFQEGSAEG"
FT   gene            complement(647045..647476)
FT                   /locus_tag="ML5_0634"
FT   CDS_pept        complement(647045..647476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0634"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: Ribosomal
FT                   protein L11-like; KEGG: saq:Sare_4329 50S ribosomal protein
FT                   L11; SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06184"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADU06184.1"
FT                   /translation="MPPKKKLVKTFTLQLPAGQATPAPPVGPALGQHGVNIMEFCKSYN
FT                   AQTESQRGDIVPAEISVYEDRTFTFVLKTPPAARLLIKAAGVQKGSGVPHKEKVGSVTR
FT                   AQLREIAEKKMADLNANDIDQAEKIIAGTARSMGLTVAD"
FT   gene            complement(647664..648386)
FT                   /locus_tag="ML5_0635"
FT   CDS_pept        complement(647664..648386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0635"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain-containing protein; KOW
FT                   domain protein; KEGG: stp:Strop_3938 transcription
FT                   termination/antitermination factor NusG; SMART: NGN
FT                   domain-containing protein; KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06185"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADU06185.1"
FT                   /translation="MPEYDETAGTPDEQSTVATAANNESVEAASEPEFPTTEPAPDEDF
FT                   DPVAELRQKLRYAPGDWYVVHSYAGYENKVKTNLETRITSLDMEDFIYQVEVPTREEVE
FT                   VKNGKRSQVQAKVFPGYILVRMELTAESYSCVRNTPGVTGFVGATDRADRPAPLSLDEV
FT                   LKWLAPAVETEQKKAKPEIKVLDFEVGDSVTVTDGAFASLPATISEINADQQKLKVLVS
FT                   IFGRETPVELNFNQVAKI"
FT   gene            complement(648422..648814)
FT                   /locus_tag="ML5_0636"
FT   CDS_pept        complement(648422..648814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0636"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="KEGG: saq:Sare_4331 preprotein translocase, SecE
FT                   subunit; TIGRFAM: preprotein translocase, SecE subunit;
FT                   PFAM: protein secE/sec61-gamma protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06186"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ADU06186.1"
FT                   /translation="MAESKRRGEDDGDERLNDDATVDDVADDDATDADEPVARGGTATR
FT                   KRAQAEPAEGRKTRKDTERIGLFARIARFFREVVAELRKVIWPTRKELLTYTAVVVTFV
FT                   AVMLAIVAGLDYGFAKAVLWVFGESS"
FT   gene            complement(649028..649100)
FT                   /locus_tag="ML5_R0010"
FT                   /note="tRNA-Trp1"
FT   tRNA            complement(649028..649100)
FT                   /locus_tag="ML5_R0010"
FT                   /product="tRNA-Trp"
FT   gene            complement(649228..649620)
FT                   /locus_tag="ML5_0637"
FT   CDS_pept        complement(649228..649620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0637"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   saq:Sare_4332 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06187"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADU06187.1"
FT                   /translation="MELPTQTYRVTRADLVRYAGASGDFNPIHWSDRTATGVGLPGVIA
FT                   HGMFTMALVGRAVAGWAGAPDAVVDFGVRFTRPVVVPDTEEGTEIEVSAVVKEVTEEGL
FT                   TRLDITATCRGEKVLSQARALIRTTR"
FT   gene            complement(649625..650071)
FT                   /locus_tag="ML5_0638"
FT   CDS_pept        complement(649625..650071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0638"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   saq:Sare_4333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06188"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADU06188.1"
FT                   /translation="MSLDPSFVGRTYPPTAPYQVGREKIREFATAVGATDPVHHDPEAA
FT                   RALGHPDVVAPPTFPVVVTMSASRQIVEDPALGVDYSRVVHGDQRFAYTRPVVAGDELV
FT                   CVNTIEEVTTRGGHGFLTTRTDVSTVDGEPVVAVWSKIVVRGEA"
FT   gene            complement(650192..650359)
FT                   /locus_tag="ML5_0639"
FT   CDS_pept        complement(650192..650359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0639"
FT                   /product="ribosomal protein L33"
FT                   /note="KEGG: saq:Sare_4334 50S ribosomal protein L33;
FT                   TIGRFAM: ribosomal protein L33; PFAM: ribosomal protein
FT                   L33"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06189"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ADU06189.1"
FT                   /translation="MAKATDVRPKITLACVECKERNYITRKNRRNDPDRIELKKFCPRD
FT                   GKHTVHRETR"
FT   gene            complement(650492..650564)
FT                   /locus_tag="ML5_R0011"
FT                   /note="tRNA-Met4"
FT   tRNA            complement(650492..650564)
FT                   /locus_tag="ML5_R0011"
FT                   /product="tRNA-Met"
FT   gene            complement(650590..650662)
FT                   /locus_tag="ML5_R0012"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(650590..650662)
FT                   /locus_tag="ML5_R0012"
FT                   /product="tRNA-Thr"
FT   gene            complement(650759..653281)
FT                   /locus_tag="ML5_0640"
FT   CDS_pept        complement(650759..653281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0640"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; GAF domain
FT                   protein; KEGG: saq:Sare_4335 diguanylate
FT                   cyclase/phosphodiesterase with GAF sensor; SMART: EAL
FT                   domain protein; GGDEF domain containing protein; GAF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06190"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADU06190.1"
FT                   /translation="MASQGRPRRSTERAWLVTAPLALLAVVFSTCIALVADHPFGKWPL
FT                   AFVFFVVMAGISFAVLNVYVRRQSVGVTLTEVPLIVALYFLPPLSVVLIYTLSVLIWSA
FT                   SHRFGAAKLWFNVAKAAAATSLASLVLLALPPLRGVGPGTWGSLFLAVCVVTLVSLVSV
FT                   VGVHVLLQGWQAGRDALRSMPTALLTAAINVAIGLLVLIALKTTWWSALLLAALFSGLV
FT                   LVYRSYSQFFRQHRTLAGMYELTRLLASGTERSLADILLDRVRALMQAEYATLWLPAQG
FT                   RHPEVLLTARVDTPGLLDLAPTPASLRQQVHKKGRTLSIGRWLGGDPALRQAAGEERVK
FT                   DAIVVPLRSGQAVIGTLEVTNRLSDIGHFAPGDIPVFETVAAHAAVALENSRLVDRLRH
FT                   DADHDALTGLPNRRRLTSSVAEAVKIRAPGEVVALLLFDVDRLRQVNESLGHAAGDKVL
FT                   MEVAERLRSCAPSSALVGRAGGDEFLVTLRLESTEAALELAAQLREQIRDEMVFDALTL
FT                   DVDTVVGVAVHPDHGSDAVALLQRVDLAATAAKSVPGSVQLYSPALESRSLRRLGLAGD
FT                   LQRALDEGELEVYFQPKVTLRDRRLVGVECLARWEHPAHGSVAPDDFVAVAEHTGQLGR
FT                   LTEFVLRESLRRSRDWSHGEQPLSVAVNLAARTLTDQHFPALVRDLLAEYGVPPQRLTL
FT                   EVTEAGVLDGTDRPIPTLRSLRDLGVRLSVDDFGTGNSSLAQLRRLPVHEVKVDRSFVQ
FT                   GMATDPGDLAIVNAVVTLSQQFGLAVVAEGVESELTLELLQDIGCEIGQGFLFSRPLPY
FT                   ERLEAWFGAQVDPETVVAGELPRLRVVP"
FT   gene            complement(653332..653469)
FT                   /locus_tag="ML5_0641"
FT   CDS_pept        complement(653332..653469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0641"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA4058 putative ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06191"
FT                   /inference="similar to AA sequence:KEGG:ebA4058"
FT                   /protein_id="ADU06191.1"
FT                   /translation="MSGRTLGRLLGSLLVLAAIAGAFGILPGTSSAQLADIVWTMDAPR
FT                   "
FT   sig_peptide     complement(653371..653469)
FT                   /locus_tag="ML5_0641"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.779 at
FT                   residue 33"
FT   gene            complement(653892..654128)
FT                   /locus_tag="ML5_0642"
FT   CDS_pept        complement(653892..654128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0642"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_4081 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06192"
FT                   /inference="similar to AA sequence:KEGG:Francci3_4081"
FT                   /protein_id="ADU06192.1"
FT                   /translation="MLATAEFTRRMRAGKPRGGFQIDDWQISEPYEAQVRGLRGTERLL
FT                   VVDFVPRGETRARGHCKLSVAVDPDTGVADMLR"
FT   gene            complement(654213..654572)
FT                   /locus_tag="ML5_0643"
FT   CDS_pept        complement(654213..654572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0643"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_2913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06193"
FT                   /inference="similar to AA sequence:KEGG:AMED_2913"
FT                   /protein_id="ADU06193.1"
FT                   /translation="MIEAGSRMRGQAPPPAVVFEALTEPDRDPARPWLRLLDDEQRPQI
FT                   LRRERPNLVVWSSLWSKRPDAQVRFDLASDGHQGTLLRWTLLLAEPLPDPSLLGHLRRR
FT                   LNELINANLRYTFGQ"
FT   gene            complement(654854..655432)
FT                   /locus_tag="ML5_0644"
FT   CDS_pept        complement(654854..655432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0644"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_6953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06194"
FT                   /inference="similar to AA sequence:KEGG:SACE_6953"
FT                   /protein_id="ADU06194.1"
FT                   /translation="MGVEAAQRLAALGCCEIEDGLTDAEFARIEREFGFEFAEDHRAFL
FT                   AVGLPVSSAPEDGATWSNPWPDWRGGDPEALRMHVNWELDFLIERVEDGEWDPRWGSRP
FT                   STRDMASREARRVLLAAPKMVPVYGHRFLPAGRGSYGHPVLSMWGWDIIVYGADLLDYI
FT                   GNEFDRTYDDRQQAEVTVPFWRDYLPTQA"
FT   gene            complement(655515..656951)
FT                   /locus_tag="ML5_0645"
FT   CDS_pept        complement(655515..656951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0645"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sco:SCO4615
FT                   integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06195"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADU06195.1"
FT                   /translation="MKSYEVQIWEIGKRADRKARPWRVRWAVSGQRFEEMFRTKALAHS
FT                   FRAELVQAANAGEPFDPATGRPVSDARTKNPTTWYAHSRAYVEMKWPRAAAKTRRSIVE
FT                   ALTSITVTLTRPAKRGRPAEPLLREALYLYGLNPRRWSDEIPTEHAAALAWLETASLPV
FT                   VELDSPAMVRRVLDSLCVRLDGKPAAASTVQRKRATFYNVLGYAVELELIDSNPVDKVQ
FT                   WTAPEVAQSIDRRVVANPAQVATLLEAVRSLGKRADKVTAFFGCLYYAGMRPSEAADLR
FT                   REDCDLPGRCVDCGADFDDLAAVKPSRSCDHEKIEHRWGRLVLAGTSPRAGSHWTDDGG
FT                   SHERRGLKHRGRAETRTVPIPPWLVELLCVHVENHGVGPDGRFFRGLHGGPLSESVYDR
FT                   WWKLAREKALTESQVASPLVRRPYDLRHAAASLWLNAGVPPTEVARRLGHGVAVLLRVY
FT                   ANCIDGGDDTMNDKITDALP"
FT   gene            complement(656948..657133)
FT                   /locus_tag="ML5_0646"
FT   CDS_pept        complement(656948..657133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0646"
FT                   /product="putative DNA-binding protein"
FT                   /note="KEGG: tcu:Tcur_3944 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06196"
FT                   /inference="similar to AA sequence:KEGG:Tcur_3944"
FT                   /protein_id="ADU06196.1"
FT                   /translation="MNEELLTVREVLAELRVPRSTWFYWRQTGKGPRVIKLPNGQLRVR
FT                   RSALGRWLGELEQDAA"
FT   gene            complement(657130..658896)
FT                   /locus_tag="ML5_0647"
FT   CDS_pept        complement(657130..658896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0647"
FT                   /product="replication initiator protein"
FT                   /note="KEGG: fal:FRAAL1734 replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06197"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1734"
FT                   /protein_id="ADU06197.1"
FT                   /translation="MTAPTLPGLGPAAPTPVAPRPGSRAARMALPRSVDVLKEIAAEYG
FT                   VCVRPLAMRRTDLDTGLTEVIDLPCGATREDKCAPCAKKNRRLRQAQIREGWHRDDEPL
FT                   PGPEPATEAQKSLILFRAHLEFSRDEAVRGAQWDQVTDLDEAIREVEEAIAAEGLRGRV
FT                   GPPHATADEDSDDEPGRRRKRSTKRRQDAPELPRRKVERRTIGKTYTAPDGATFRPSMW
FT                   LTLTLDSYGPVHLDGTPLNPDRYDYRRAAWDAVHFPRLLDRFWQNLRRCEGWNVQYAGC
FT                   VEPQRRLAPHAHFAIRGTIPRDVLRTVAAATYHQVWWPAVDVQRYTLDRLPVWDEQAAA
FT                   WVDPDTREPLITWTEALDAIDDDPDSEPVHVVRFGAQVDARGVMPGTEDAERTIRYVTK
FT                   YITKHTGDVHKATTDRQRKHLDRLWQQLQVTPCTDRCANWLLYGVQPKKAHAKLKPGRC
FT                   KGKVHQRDTLGIGGRRILISRDWSGKTLADHKHDVRAWARALLGATTDSATAGQLVDDQ
FT                   GATAERIRHAWELARPDDPDVGPLAHRLMRSISERARWRSELLAAKDRAAQGSTDLSAT
FT                   QHSAQHDGEGTQ"
FT   gene            complement(658893..659453)
FT                   /locus_tag="ML5_0648"
FT   CDS_pept        complement(658893..659453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0648"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_2056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06198"
FT                   /inference="similar to AA sequence:KEGG:Sare_2056"
FT                   /protein_id="ADU06198.1"
FT                   /translation="MIRHRAESGIRVLILLTIGIMAGAAAFTHVHDLTVAHGQPDWIGW
FT                   ANAVAVELMAIYLGLEIRARRRAGRPVGLVGVLLVAFALLSLAAQVAEAEPSVWGWIVA
FT                   AVPSLAFLALVKVVLSSAPAPAPEPDQPPVDWTYEVPEQVVTEPEPQQPTAPDPAVRPA
FT                   PAAVLPPLGVVQPNRPQVVGIIR"
FT   sig_peptide     complement(659361..659453)
FT                   /locus_tag="ML5_0648"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.854) with cleavage site probability 0.622 at
FT                   residue 31"
FT   gene            complement(659450..659641)
FT                   /locus_tag="ML5_0649"
FT   CDS_pept        complement(659450..659641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06199"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU06199.1"
FT                   /translation="MSLKRFFLGTHRIKPLNIDLDGSPDRLAAALHGLAHMVRRRDDLD
FT                   GQRIRITVTIRIPEGDFE"
FT   gene            complement(659647..659901)
FT                   /locus_tag="ML5_0650"
FT   CDS_pept        complement(659647..659901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0650"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_3017 MaoC domain-containing protein
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06200"
FT                   /inference="similar to AA sequence:KEGG:Snas_3017"
FT                   /protein_id="ADU06200.1"
FT                   /translation="MTAPTFYRLRAPNPDGASSTAVSVRVDPDRPDPYPVYLAVGGSRR
FT                   RMHLTPDEAWALWRCLSEAVASLGEPPDHIRTRVTPDRR"
FT   gene            complement(659898..661487)
FT                   /locus_tag="ML5_0651"
FT   CDS_pept        complement(659898..661487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0651"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG:
FT                   fre:Franean1_5523 cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06201"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADU06201.1"
FT                   /translation="MTTAGDLLVIRPKRFVLPMWAVVLGLLLRWFARGCWWCLRHPVIV
FT                   GLVVLAVVLYADYGWAGLVVPLVLASAVSAVWRWRDEASWWRWCAGPLLGRFRQVFVYR
FT                   RAWREAMTLCGLAETYDRRAVLPELLRVRSDQALDVLTIRMVRGQTPADFQRVTANLAY
FT                   AFGRRHARVYSERPDDPTTRTGYWALLLGWVDRVRFRDRPTVVYLVLVRTDALRPVVAP
FT                   FDAPAVPDLTALPLARREDLGTWSLHLLATHVLIGGATRSGKGSVLWSLVRSLAGGITS
FT                   GLVRLWVIDPKGGMEFAMGRPLFARFACKSFEAMADLLDEAVTVMRERQTRLAGRVRVH
FT                   TPTEADPLVVVVIDEMAALTAYLQDAELRKRIAGSLGLLLSQGAGVGVLVVAALQDPRK
FT                   EVLPFRDLFPTRIALGLTEAAQVDLVLGDGARNRGALADQMPRWAKGVGYVILDGTPEP
FT                   MRVRFSYVTDDHIRDLAREYPAPADAADILAQVGRESTPAPVRPALPRQRRGPLLPDAL
FT                   RNILDADGGESR"
FT   gene            complement(661788..662183)
FT                   /locus_tag="ML5_0652"
FT   CDS_pept        complement(661788..662183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0652"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06202"
FT                   /inference="similar to AA sequence:KEGG:Sros_0698"
FT                   /protein_id="ADU06202.1"
FT                   /translation="MALRGGTRFAVRFEDVFPAGCALVPESMGEVEDYDEKTGRRSPAK
FT                   DKVTGQRVWQVRVMDLDPELGKRSRETTVKISADYQPVPPTGAPFEAVEFEGMTVTPYV
FT                   SNNGRMAYSLRATGMRAPAGVAKKAAA"
FT   gene            662655..662822
FT                   /locus_tag="ML5_0653"
FT   CDS_pept        662655..662822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06203"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU06203.1"
FT                   /translation="MKSVRKKGRQVPTKTRQADAEQTRRSSEWVVPALRVLAYALWLAA
FT                   TLAGKGCGPN"
FT   gene            663208..663654
FT                   /locus_tag="ML5_0654"
FT   CDS_pept        663208..663654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0654"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: saq:Sare_4336 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06204"
FT                   /inference="similar to AA sequence:KEGG:Sare_4336"
FT                   /protein_id="ADU06204.1"
FT                   /translation="MANDHGRAVDQDHSRPANVDDTTVEALGELSKALETVHRVRGHLY
FT                   SAHQLVGGADLTLDRVVKLLREAGHDETADRVEHELLGRNLLPGRWTFQIMEEFDDGYY
FT                   AAFQEIERDAREKLAGGRRHIYEAEMKERRRTHGMPGHEATPEA"
FT   gene            complement(663638..664414)
FT                   /locus_tag="ML5_0655"
FT   CDS_pept        complement(663638..664414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0655"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sco:SCO3865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06205"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADU06205.1"
FT                   /translation="MENLTQFVSVITPVHAPSIEHLAGAYESLAKQEMPAGWDWQWLVQ
FT                   EDGQTGALVDALPDDPRISLGTGRPGGPGVARTLALSRVSGDLIKVLDADDQLTPGALA
FT                   RDIAAFDVHPHIGWTTSRVLDLLPDGSTAGWDKDPDGGVVDRGEVLLFWQANDYRASVH
FT                   PATLCLRRDLVFALGGWMALPASEDTGLLLAANAISAGYFTREYGLLYRKWPGQVTSQA
FT                   AHREPAEYQARMRIIEARANALTSMLPNGLPLTPLA"
FT   gene            complement(664402..665223)
FT                   /locus_tag="ML5_0656"
FT   CDS_pept        complement(664402..665223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0656"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: sco:SCO3864 transcriptional regulator; PFAM:
FT                   regulatory protein GntR HTH; UbiC transcription
FT                   regulator-associated domain-containing protein; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06206"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADU06206.1"
FT                   /translation="MTGVHGRDWRPRYLQLAEELRVKIMSGEMAPGTLMPSETELAESS
FT                   GLSRTSVRNAIRQLREWGLVRAEQGRGTYVRAPRQRVRRRNSERYQWEKDRVLLDEAER
FT                   LKTGATEHDTGLTVDDLKFHAEYSRVEADAEMAAALQVEPDTPLLRRVYWTSSRHESAP
FT                   LTVSYSYLPYDLVAANPDLLDESKEPWPGGTQHQLYTLGIELDRIDDEIRARPPSPDEA
FT                   ELLDIDPGVSVLTVRKTSVDTMGRVVEVADVVMPGDRTELVYSHKLQRWKT"
FT   gene            complement(665373..665618)
FT                   /locus_tag="ML5_0657"
FT   CDS_pept        complement(665373..665618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0657"
FT                   /product="precorrin-4 C(11)-methyltransferase"
FT                   /note="KEGG: rha:RHA1_ro00827 precorrin-4
FT                   C(11)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06207"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro00827"
FT                   /protein_id="ADU06207.1"
FT                   /translation="MHRGFIATIGRERTGWVSLQLLIDRFERRDLAVKLDATRYGATQT
FT                   VLLSAAQLDRLIDELTRARDVMRAPVSHGHRPGETR"
FT   gene            complement(665707..665919)
FT                   /locus_tag="ML5_0658"
FT   CDS_pept        complement(665707..665919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06208"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU06208.1"
FT                   /translation="MFRVGDVRSSGVVVTYLIGADALAPLVALHSTCRVGNCWAELSLS
FT                   QVTELIEHLRGLVEQANGDRGTSDE"
FT   gene            666593..667015
FT                   /pseudo
FT                   /locus_tag="ML5_0659"
FT   gene            667696..668478
FT                   /locus_tag="ML5_0660"
FT   CDS_pept        667696..668478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0660"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   saq:Sare_3105 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06209"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADU06209.1"
FT                   /translation="MLSYPAAIPLSTRSLNHLAALIRTRRQQQRSRWRRLDPGRQALLA
FT                   LAHLRNGDTYTRLAAGFDIGVMTAWRYVREAIDLLAATADDLATAMTRIRLLAYAILDG
FT                   TLIPIDRVANQKPYYSGKHKRHGVNVQVIADAAGRLVWASAALPASTHDLTAARTHGII
FT                   DALASTDVMTFADKGYQGAPGSVRTPFKRRRFRPKLSRRQKAVNRAHAKIRARGERAIA
FT                   TLKTWKILVKLRCCPRRATAIVQAILVLHRVEADRHAG"
FT   gene            complement(668507..670294)
FT                   /locus_tag="ML5_0661"
FT   CDS_pept        complement(668507..670294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0661"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; regulatory protein Crp;
FT                   KEGG: fre:Franean1_7144 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06210"
FT                   /inference="protein motif:PFAM:PF04326"
FT                   /protein_id="ADU06210.1"
FT                   /translation="MPGRPAVNTEELAEIVENLRVLGSDVADVEVKKALGGLPRSVRET
FT                   LSSFSNTRGGVIILGLDESEGFAATGLSDPATMAANFASTCSDEMEPPVRALVQIQEFE
FT                   GAQVLVAEIPEIDRSQKPCYYKGAGLTKGAYIRVHDGDRQLSSYEVQVMLSSRGQPLDD
FT                   SQPVPGVGLEALDRHLTASTILRLRESRPYAYRDLDVEGVLRKAKILVPDGNGDDVVSL
FT                   AGLLALGQYPQEHFPQLMLSFVHYPSDSGPDNETGVRFLDSVAIEGPIPAMVRDAMSVI
FT                   RRNMVRRSIVTGAGRQDIWEYPETALREAITNALVHRDLSPAARGTQVQIEMFPNRLVI
FT                   RNPGGLYGPVTVENLGEEGVSSSRNALLLRILEDVPIPGEERTVCENRGSGIRAMVGSL
FT                   RRAGMTAPSFDDRISAFIVAFPNHSLLNDEAVQWIASLGEANLTDSQCLALAILHNGAS
FT                   LDNATYRKAAGLDSRVATIELQDLVARELVEQIGTRRWARYRLPPRIEEDAEHGGRPRR
FT                   RSPADRRQEILDALGAQTLSRAELAEATGLTDQTVRRWLLVLRREGLVTTTEGSTSSKN
FT                   TKYRRIPGRQLGQPLPFTS"
FT   gene            670554..671798
FT                   /locus_tag="ML5_0662"
FT   CDS_pept        670554..671798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0662"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: sma:SAV_347
FT                   IS256 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06211"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADU06211.1"
FT                   /translation="MAASESVNPVDLLREQIEGASSDVLQAMIKTFVQAVMSAEADAIC
FT                   GAGYGQRSDERVNSRNGYRPREWDTRAGTIDLAIPKLRHGSYFPEWLLTHRRRAEQALV
FT                   SVVATSYLLGVSTRRVEKLVEQLGIRQLSKSQVSEMAAHLDAQVEAFRNRPLDAAHYTF
FT                   VWMDALTMKVREHGRTVNVHALIAVGVNADGGREVLGLDVASDEDGAGWLAFLRSLTAR
FT                   GLSGVRLVISDAHAGLVAAIGAALPGASWQRCRTHYLRNLLTKVPKSAQPWIATLVRTI
FT                   FDQPDADAVRAQFDRVVTTIEAKFPAAAEHLDAARDDLLAFTGFPREIWRQIWSNNPQE
FT                   RLNKEIRRRTDVVGIFPNRAAIIRLVGAVLAEQTDEWTEGRRYMGLELLAKARLITIDT
FT                   DQHATDQTDPTSIAA"
FT   gene            complement(672264..672791)
FT                   /locus_tag="ML5_0663"
FT   CDS_pept        complement(672264..672791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0663"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_0676 ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06212"
FT                   /inference="similar to AA sequence:KEGG:Rxyl_0676"
FT                   /protein_id="ADU06212.1"
FT                   /translation="MGSFNEPLSRLTSNRLNNLKSELERCGLEQITNEEYVQHLVAELS
FT                   LAAVTLSDGLPPEVTEGKDGLKVLVKTPASAGPVELLDKYDVEKPSYNEVLYIRDKAVH
FT                   SVRTFPHDAATDDVRAWVKAERERHHRIVKGFNDAALALNGQLQEMAQKIAAKRRAAGG
FT                   RASQLAADIQDL"
FT   gene            673058..673932
FT                   /pseudo
FT                   /locus_tag="ML5_0664"
FT   gene            complement(674464..675294)
FT                   /locus_tag="ML5_0665"
FT   CDS_pept        complement(674464..675294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0665"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: dma:DMR_32060 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06213"
FT                   /inference="similar to AA sequence:KEGG:DMR_32060"
FT                   /protein_id="ADU06213.1"
FT                   /translation="MEHQVLRDDVNPETVILAVAKAIEATFDRSSWLELALLTNTRDVV
FT                   LSHHRLLRSMDWGDPDYFGNIAEVVPQMLGEGRQRRSRTSARTSFPNFKIVEDFLDLPN
FT                   WLRRSVPDLYAKLYGGPVPVDALQAAATELGITDVDEHAARIRRGLHDDPAQAIGSAKE
FT                   LLETVLKSILGLHGTGRETRLDIPELLKKANVQLGLDPAGVRARDPGAEQRRKALGALT
FT                   QLVVSTAELRNAGFGTGHGVSQRPELDVATARLVVAAATAAATFYLEAHAADDD"
FT   gene            complement(676095..676178)
FT                   /locus_tag="ML5_R0013"
FT                   /note="tRNA-Tyr1"
FT   tRNA            complement(676095..676178)
FT                   /locus_tag="ML5_R0013"
FT                   /product="tRNA-Tyr"
FT   gene            676326..676820
FT                   /locus_tag="ML5_0666"
FT   CDS_pept        676326..676820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0666"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   saq:Sare_0477 putative nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06214"
FT                   /inference="protein motif:PFAM:PF04461"
FT                   /protein_id="ADU06214.1"
FT                   /translation="MAANPSFDIVSKVDRQEVDNAVRQSEKELSTRFDFRGTGAEISWS
FT                   GEEAISLQAETEERVRAALDVFKEKLVKRNISLKSLDAGEPRQSGKIFKIDAKVVQGID
FT                   SDKAKAISKKIRDEGPKGVQAQIQGDQLRVTGKKKDDLQAVIALLKGEDFGLALQFTNY
FT                   R"
FT   gene            676999..678486
FT                   /locus_tag="ML5_0667"
FT   CDS_pept        676999..678486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0667"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   saq:Sare_2001 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06215"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU06215.1"
FT                   /translation="MTPAMLLPYRPVLGQPVLRRLLPGLATSALGDGLALVAVTWLALQ
FT                   LAPVGQRGTWTAFAVAAYTLPGAAGTLLLGRWLGARSGAQLAGWDATVRAAALGAIPVA
FT                   HLAGVLDVGLYVALLAVSSLLHPWGSAGRFTLVAELLPQRHHLAANALLGVFGQAATIV
FT                   GPPLAGLLIAWVGAVWVIAVDAASFAVLAVSYRLVVRDREAAAVSERDTAAVRDREAAA
FT                   VRDGDTATVHDRDTNGRYRNAPAGAGPSRTSGFRIIGRDRSLLGLLALTFAFFFLFGPF
FT                   YVAMPVHVTDDLHASAGTLAAYYTAFGVGSLLGGLLTGHLRGRPLRTTLAGIVVLFGAA
FT                   LMPLGLGAPVVLSLPAFALAGLVWAPYQPTATALFQRRSGTVDLPRVLAANGAVTVLAV
FT                   PLGTMLGGPATAAFGARPTLLACAVAILALGLVAAVSAARPGPGAHNTEQTGPAGPHDR
FT                   PGPQTTGPRDRPGPQTTGPHDRPGRVKVPDRVRPGAS"
FT   gene            678552..679058
FT                   /locus_tag="ML5_0668"
FT   CDS_pept        678552..679058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0668"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: saq:Sare_0800 ECF subfamily RNA polymerase
FT                   sigma-24 factor; TIGRFAM: RNA polymerase sigma-70 factor,
FT                   sigma-E family; RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06216"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADU06216.1"
FT                   /translation="MDGPEDFDAFYTATARRVVHHVYALCGDLAEAQDVTQEAYARAWQ
FT                   RWSTVGAYEDPEGWVRTVAWRLTANRWRGLRRWFAARARLGRETPAPGPNPDRVALLAA
FT                   LRRLPDAQRLVVVLHHLHDLPVAEIARTTGMPEGTVKSYLSRGRAALAVLLTDDKEEVD
FT                   VGTHW"
FT   gene            679039..679554
FT                   /locus_tag="ML5_0669"
FT   CDS_pept        679039..679554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0669"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmi:CMM_2067 D-alanyl-D-alanine
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06217"
FT                   /inference="similar to AA sequence:KEGG:CMM_2067"
FT                   /protein_id="ADU06217.1"
FT                   /translation="MSARIGEALRELEQDMTGLRLSPAAQVRARGRARSRRRAAVLAGV
FT                   AAVTVTGGAATMATLSGPATPMPAGGGAATPSAAASAACQADPPVRLDVVFRPGAGTPQ
FT                   IGEVDYRIGQARGDTGLRCGGRTVAARPDGDGRVVLSVLLAQGEDPAPIRAAVEKLPGV
FT                   ERVVTAGG"
FT   gene            complement(679559..680818)
FT                   /locus_tag="ML5_0670"
FT   CDS_pept        complement(679559..680818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0670"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ami:Amir_3935 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06218"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU06218.1"
FT                   /translation="MAALRQYQGVWRIPGAPMLLILGIIGRLGIGMTPLALLLVVEQVT
FT                   GRYSLAAVAGGIYALSGAALSPVAGRIADRVGPTPVLLLTAVTHPLALIGLLVATRSDS
FT                   GNLGLIYLASGVAGATYPPLTAAIRGAWNDLTAPATGRAHLRNTALAAETTLFEVVFVI
FT                   GPLLVAGFVLLADASAALVGAAVVTLIGTGTVALGRVMRGWRPHPREHHARGLGPLRLG
FT                   GFPALLLCVASLGIAFGASGVIVPAFAGNSGADDPESLAGVLLAVWGIGSAIGGFWFGV
FT                   RKPAANMTRQFAWLLGTVAASFAVFAVMPGPAALGVALVLGGAAIAPALTLENTLVGRI
FT                   TPAGMLNEAYTWVVTMSVAASAAGGSIAGLIIDHAGGVSWAFVFAGVAVAVGAAVAALP
FT                   GGPIARAEATAVRAEQTLAA"
FT   gene            complement(680956..681834)
FT                   /locus_tag="ML5_0671"
FT   CDS_pept        complement(680956..681834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0671"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: saq:Sare_0474
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06219"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADU06219.1"
FT                   /translation="MHHNRLKTAALLGLLTSLILAVGYWFGGSGGLVIAVVVSLLMNGV
FT                   TYFYSDKLALRSMKAQPVSEAQFPELYQMVRELSTQAGKPMPRLYVSPTSQPNAFATGR
FT                   NPENAAVCVTQGIVEILDYRELRGVIGHELSHVYNRDILISSVAAGLAGIITMLANLAW
FT                   FIPLGSSDDEDAPNPAVLLLTLILGPIAATVIQLAISRSREFQADQSGAELSRDPLALA
FT                   SALRKIHMGTQARPLAPQGQLASTAHLMIDNPFKRGGGIAAMFATHPPMEQRVARLEQM
FT                   ARNSGPVQFQR"
FT   sig_peptide     complement(681727..681834)
FT                   /locus_tag="ML5_0671"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.611 at
FT                   residue 36"
FT   gene            complement(681984..683450)
FT                   /locus_tag="ML5_0672"
FT   CDS_pept        complement(681984..683450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0672"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: stp:Strop_0405 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06220"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADU06220.1"
FT                   /translation="MSLVQSVDNVAMLPAYLAAGTAVLVLLFDLLVARPAVTVAVAALG
FT                   AAGTAAGAALVGAAGERRTFCVGADCSWVWGGRAALVGAVIALLTLGVLALSGPLLRAG
FT                   RTPVGEYCFLLACAMTGGVVLGAAGDLITLIVALETLTLPLYVLVGLRRGSLAGAEAAV
FT                   TFFVVSVVATTVTLLGAALLYAVTGTLHLDRLGATLAARDDLTDLPLTTVAVALVVAGL
FT                   AFKVAAVPFHAWAPATYDGAPLPVAAYLSTASKLGGVVALLAVVQRALPGDLTGPVLAA
FT                   LAVLTMTVGNLVALRQRRTVRLLAWSSVAQAGYILAPLGALALAAGRTGDARAAAYAAA
FT                   VAYAIFFVLLELAAFAAVVALRPADGDGGTLADLRGAARRHPWVGGAFALALIGLAGLP
FT                   PGLAGLFAKVTVVRALLAGNAGWLALVVALNAVIGLAYYLRVTASLYATPAGVATVRPA
FT                   RTVVLALGVATVAAVVIGFAPQLVLDVAAR"
FT   gene            complement(683447..684952)
FT                   /locus_tag="ML5_0673"
FT   CDS_pept        complement(683447..684952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0673"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /note="KEGG: saq:Sare_0472 proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain M;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06221"
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /protein_id="ADU06221.1"
FT                   /translation="MTFGQVLLVSVVAVPALGALATAVVPGDRAGRVVGTVAAALTLLA
FT                   TLPLVGGDHGWFGYGPRPAVQPWHQVDLTWVPGLDLRFHLGVDGISWPLVVLTALLTLL
FT                   CCAYTLWRVPTGGGSGRALVALLLVVEVGILGTFLALDLVLFFLFFEVVLLPMYAVIAG
FT                   WGGADRRRAARKFALYTLFGSVLLLVGVYVVVAAAGTADLVTLTGGAGLSRGTQLAAFT
FT                   LLALAFAVKSPLWPLHSWLPDAHTQAPTVGSVILAGVLLKMGTYGLIRVAVGVAPEGAR
FT                   WAAPVLGVLAVAAILVGGLVCLAQDDLKRLIAYSSVGHMGFVLLGVATLTATGIQAALI
FT                   GNIAHGVITGLLFFLAGAVKDRAHTGSLAELSGLRETAPRLAGLLGFAAVASLGLPGLA
FT                   GFWGEAFAVVAAVQRGGPLWLTLAVLAALGGALTAAYFLRLLRRVTHGRPSPAVAGLAP
FT                   GLAGAELTAWAPLVLLALAVGLAPALVLSYASGPVEALLGVVP"
FT   gene            complement(684949..686874)
FT                   /locus_tag="ML5_0674"
FT   CDS_pept        complement(684949..686874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0674"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /note="KEGG: saq:Sare_0471 proton-translocating
FT                   NADH-quinone oxidoreductase, chain L; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06222"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ADU06222.1"
FT                   /translation="MSTPTLWLAAVLPAAPLVASLLGLLLPPAPRQDRAAARRSAVALG
FT                   VAGAAVSLLAALALLVRVDAPVEASTTWVDLGGLRVTLGLRLDGVAVLVATAVAAVALA
FT                   VQVYSIGYLRRGPHDDVDVDHRYPPYAAQLSLFTAAMLTVVVSGDLIMLLVGWEVMGVC
FT                   SYLLIAHDRRLPEAPGAAVKAFLVTRVGDVGFLLGIALLGVGAGSFRIADVLAHDYGTG
FT                   TLTAACLLLLAGVAGKSAQFPLHTWLPDAMAGPTPVSALIHAATMVAAGVYAVARLFPL
FT                   FERAPAALAVLGVMAAITMLLGAFAATAQDDIKRVLAWSTVSQIGYMTGALAVGAPAAA
FT                   LFHLLTHAAFKALLFLAAGAVIHAVGTTLMSRMGGLRTAMPVTFWCMVVGLGALAGVPP
FT                   LSGFWSKDGVLAAAEAAALDGAGPTAAWVGWLVWLAGLVGVAVTAWYATRLLLRTFLGR
FT                   TRTPLLRPHDPPALLRWPVLLLTVPAALLGLAAFAPWFADRLRVPGDDTAEAVELVHLA
FT                   PNLILPFLLLLAGAGVAWAGWRRDLAADPARFLGPLRPVFARAFRLDDVQHALVVRPAG
FT                   ALARVVRTGDELGVDGLVEGSGRAAVEVGGGLAALHRAALPRAAAGVLAGALLIGLAVA
FT                   LIGVTS"
FT   gene            complement(686871..687251)
FT                   /locus_tag="ML5_0675"
FT   CDS_pept        complement(686871..687251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0675"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   stp:Strop_0402 NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06223"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADU06223.1"
FT                   /translation="MRPVIPYVTAALLFGLGVYGVLRRRNAVLVLMAVELMLNAVNLVL
FT                   VTADTTVKAVLPHSGQVFALFVIVLAAAEIGVGLAIVLQLYRLRASVTVDDVPLDEPAP
FT                   AVAVAPGGLPTPESPGTEGAVR"
FT   gene            complement(687248..687796)
FT                   /locus_tag="ML5_0676"
FT   CDS_pept        complement(687248..687796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0676"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: stp:Strop_0401 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase, chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06224"
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /protein_id="ADU06224.1"
FT                   /translation="MTGADVLLLALGAVAVGAGALVVATRHLVRAGLWLVVCLGALAGD
FT                   YLVLTAELVAWVQVLIYVGAVVVLLLFAVMLTRAPIGPSDDLDRPGWAAALVGAGSGLG
FT                   LAVLLIDAFRWSRVDLPVAGTAERLGEQLFRSWVLPFEVLSVLLLAALVGAIVLSRPDI
FT                   GRRSTDTSAAQPADEGRRP"
FT   sig_peptide     complement(687725..687796)
FT                   /locus_tag="ML5_0676"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.717) with cleavage site probability 0.278 at
FT                   residue 24"
FT   gene            complement(687793..688383)
FT                   /locus_tag="ML5_0677"
FT   CDS_pept        complement(687793..688383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0677"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /note="KEGG: saq:Sare_0468 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06225"
FT                   /inference="similar to AA sequence:KEGG:Sare_0468"
FT                   /protein_id="ADU06225.1"
FT                   /translation="MSEHGGVPGGGLVKGLAVTLKTMTRRSTTQQYPDVEPELPPRSRG
FT                   VIALLEENCTVCMLCARECPDWCIYIDSHKEEVAVPGAARPRQRNVLDKFDIDFSLCMY
FT                   CGICVEVCPFDALYWSPEFEYAEYDIKNLLHDKDHLGEWMATVPPPPAHDPLGDPSKEE
FT                   TTAARKAAGPSARPAPSRVRPDAATDPGGGTAS"
FT   gene            complement(688457..688879)
FT                   /locus_tag="ML5_0678"
FT   CDS_pept        complement(688457..688879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0678"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   kfl:Kfla_2035 protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06226"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ADU06226.1"
FT                   /translation="MTDVEAAARRFVADVWNAGREESAYELVAADCPGLGGTGPAAMLA
FT                   WHRDRRASFPDLRYKIVDVVATGTRVAVRWRAAGTQAGQFGPVPPTGRVVSYSGATFLR
FT                   FDDDGRIVDVWSVNELFQVLQQLGVEMLPPLTPGEA"
FT   gene            688974..690017
FT                   /locus_tag="ML5_0679"
FT   CDS_pept        688974..690017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0679"
FT                   /product="Glutathione transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="KEGG: stp:Strop_0399 glutathione S-transferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06227"
FT                   /inference="protein motif:PRIAM:2.5.1.18"
FT                   /protein_id="ADU06227.1"
FT                   /translation="MGSDDEVLDRTGGKYVEPGGEFTRDQRYIATRITADERDGWPVEP
FT                   GRYRLAVSRACPWANRLIIIRRLLGLEDAISMAVAGPTHDKRSWTFDLDPDGKDPVLGI
FT                   ERLADAYFARFPGYERGITVPALVDVPTGQVVTNDYAQMSLDLTTEWTAHHRPGAPDLY
FT                   PEPLRGEIDEVNQVVFADVNNGVYRCGFAGSQEAYDKAYHRLFDRLDWLSERLAGQRYL
FT                   VGDTITEADVRLFTTLVRFDPVYHGHFKCNRQKLSEMPVLWAYARDLFTTPGFGDTIDF
FT                   DHIKRHYYEVHRDINPTGIVPLGPDLSNWLIPHGREELGGRPFGDGTPPPPPPPSERVD
FT                   PSHTPLR"
FT   gene            690404..691483
FT                   /locus_tag="ML5_0680"
FT   CDS_pept        690404..691483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0680"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: sco:SCO6392 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06228"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADU06228.1"
FT                   /translation="MRRIVERVADRYDVVVGVDTHTDTHTAAVVDRLGGVLAQVTVSTD
FT                   PDGLSRLLAFAVAHTPPQGRRLWAVEGTRSHGQGLCRLLTAADEPVCEAPKPPAAARRR
FT                   GGKSDQLDAVAAAHTVLALPAERIAVPRSDGPREALRLLLICRRHHTDARTAAVNLVKA
FT                   LILTADDTLREALRGLSTTIQIARLAALELPETTALPCEEHTRRRELVTLARHIHILDA
FT                   TLADNHQRLRALVTELCPPLLDQPGVGPVTAAIALTAWSHPGRVRSEAAYATLAGAAPI
FT                   PVASGRTDRHRLNRGGDRTLNSALHTIALTRRRIHPETRDYITRRHAEGRTTREITRCL
FT                   KRYIARQLYRTITTHHQTP"
FT   gene            691771..692628
FT                   /locus_tag="ML5_0681"
FT   CDS_pept        691771..692628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0681"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gob:Gobs_1242 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06229"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU06229.1"
FT                   /translation="MDGTDALVWREFGEDDLPALTGLAQACLATDGGLPLFGRTPLARA
FT                   RLLQTRTHGVWSGDDLVAAVGVGTGRTPATATGLVHPAWRGRGLGGALLDRAEKQAEGA
FT                   GLLVTTETWTAGAEELFAARGYTRTFLEWVLRHDLDALPEVAAPDGVTVEPATLGPELF
FT                   ATYRASFADRPGFVEPEAGEWLGDLRDDEDFRPELTLLARGPDGAPAGFVTVLDNWIDQ
FT                   VGVVPGWRGRRVGAYLVARVLRGLADAGADAAWLCVNDDNPAAGLYRRLGFRDFGRRAR
FT                   YLHG"
FT   gene            692621..692944
FT                   /locus_tag="ML5_0682"
FT   CDS_pept        692621..692944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0682"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_2634 RNA polymerase, sigma 28
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06230"
FT                   /inference="similar to AA sequence:KEGG:Rxyl_2634"
FT                   /protein_id="ADU06230.1"
FT                   /translation="MADPTREAILRALADLWANGCPLPAPELRERLADVGLRRWRSVAR
FT                   RHRGRRLGPDDRLRDLVRGLVAAFEPDPKLVGPLVRDYECVARAIADAVTSTEPPGAVA
FT                   DAR"
FT   gene            693037..693990
FT                   /locus_tag="ML5_0683"
FT   CDS_pept        693037..693990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0683"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_4739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06231"
FT                   /inference="similar to AA sequence:KEGG:Snas_4739"
FT                   /protein_id="ADU06231.1"
FT                   /translation="MHRKPTIHLAVLVAAAATFLTAGGASATTAPVAASPAVAECDPGA
FT                   DNHSAARVREGATVKEPELYSTNEAKAYGVIKDSPRLANGSVTVPTIFHMISDHELSAA
FT                   EKARWNTLISAQMTVLNDSFAGRTAADASDTPFRFSLVDTTWTVNSSWYTVVPGKSERD
FT                   MKKALYTGDSRTLNVYAANIGDGLLGWAYFPKGYNNGRDYIDGVVMLDESMPGGTAGKY
FT                   ALGDTLTHEVGHWLMLEHTFAHGCSASGDFVADTPREAAPQFNCPIGADTCTAPGLDPI
FT                   HNFMDYTQDSCMNMFTPGQADRMSDAWVAFRAGGRG"
FT   sig_peptide     693037..693120
FT                   /locus_tag="ML5_0683"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.877 at
FT                   residue 28"
FT   gene            694141..697047
FT                   /locus_tag="ML5_0684"
FT   CDS_pept        694141..697047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0684"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_7437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06232"
FT                   /inference="similar to AA sequence:KEGG:Sros_7437"
FT                   /protein_id="ADU06232.1"
FT                   /translation="MRARRMLAASLGIVLGAGLISVDTAPAQAYEHRTTGKSGWAYTDS
FT                   QQPRKSFVNTDGDAPVGAWTDATGTKHKSRSYFTFDISRFRGTVVHKADLVVAERSAAD
FT                   CATAQPVELWRTDPITATTSWASSPRRRELLGTVQAGGEAACPGYLAWDIMPALQKLAD
FT                   QGKQTLTVEIRVPHGSEGKLSHGRKLRPFPVINSEANHAPTVGQIGIDFPAWACGTKTE
FT                   PQPVGPRNHGLMVKGADADSNDANYRGQFAAWPVGHEDQRAEQFGYSYGGALSKLDWDM
FT                   SQYPHGTVVAWTARAYDDHDFSPWAEPCYVKVDAQRPAAPVVTSEKYPNDGLPHGGAGV
FT                   PGTFTFKANGSPDVVGYYWGRFGDAYNYIPAPAPGADVTLEYTPTSFSDSLSVRSVDSA
FT                   SNSSETVRYEFWVKSTAPEVQVTMAGIGLPSKLAVSTNVEGVTEFGYRIGAGGETRVPV
FT                   NPDGPTEIPVTFAEAGLVKVEVRSYVGSEFVGGYTENVSVRDLPTVESADFSFPEHDGV
FT                   VDRPGSFTFRPGRTAVVAYEYSFGDGNLLRVDAAADGTAVLHWTPTEPGWYALTVRSVS
FT                   ADGTVSETQEHQFNVIDTKPSVYSSTYYEYGAWGGVGMPGEFQFDTVMPDVDAYVYRLN
FT                   DGPEQVVDTDSSWTRVMLTPDRSGSNMLTVRTRFLDGSFSPTRTYTFEVSDAPVVTSSD
FT                   YPENDSAGQPGQTGRFTFNPGRPGVTEYRYVLEYSGEEQVVAAGADGRATIEITPTHSG
FT                   YTLLTVTSRTADGTVSPERRYYFRVREPRVNVSSAYDEYSPRGGVGSVGTFGVYTEISE
FT                   VTTFEYQLNGGAWQSVPKKPDAFVTDITVTMDRNGANLISVRGRTASGDQTPQTDYPFL
FT                   VGTAPLVASGTYPAGQWSGGVGVAGEFTFTQGSPGVTEFEYAVDDGQPVTVAANAAGVA
FT                   TATFTPTSAGSYTMRVRGRTADGVWTDTTSYYFLVNYS"
FT   gene            complement(697095..698942)
FT                   /locus_tag="ML5_0685"
FT   CDS_pept        complement(697095..698942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0685"
FT                   /product="helicase domain protein"
FT                   /note="KEGG: saq:Sare_4341 helicase domain-containing
FT                   protein; PFAM: helicase domain protein; type III
FT                   restriction protein res subunit; SMART: DEAD-like helicase
FT                   ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06233"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ADU06233.1"
FT                   /translation="MTLPVQRDFFAAPSGVQHWMVGLRQVSRGADGMPGDRVPGDEFPG
FT                   SGFRAMREDAGVSGGPLIVQSDKTLLLEVDHPDAQACRMAIAPFAELERSPEHVHTYRL
FT                   TPLGLWNARAAGHDAEGVVDSLIKYSRYPVPHGLLVDVAETMDRYGRLQLANDPVHGLV
FT                   LRALDRVVLIEVAKSKKLAGMLGAKLDDDTVAVHPSERGRLKQALLKLGWPAEDLAGYV
FT                   DGEAHPIELAESGKDGGKPWTLRSYQREAVEAFWAGGSGVVVLPCGAGKTLVGAAAMAE
FT                   AKATTLILVTNTVAGRQWKRELIARTSLTEEEIGEYSGERKEIRPVTIATYQVLTSRRG
FT                   GAFTHLDLFGARDWGLVVYDEVHLLPAPIFRFTADLQARRRLGLTATLVREDGREGDVF
FT                   SLIGPKRYDAPWKDIEQQGWIAPAECTEVRVTLTDAERLAYATAEAEERYRMAATARTK
FT                   LPVVRALVDRHPSEQVLVIGGFLDQLHQLGEYLDAPIVQGSTTNKERERLFDAFRSGEI
FT                   RTLVISKVGNFSIDLPEAAVAIQVSGTFGSRQEEAQRLGRVLRPKADGRQAHFYTVVSR
FT                   DTIDTEYAAHRQRFLAEQGYAYTIVDADDVLGPSLPTVD"
FT   gene            698991..699866
FT                   /locus_tag="ML5_0686"
FT   CDS_pept        698991..699866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0686"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
FT                   Peptidoglycan-binding domain 1 protein; KEGG: sna:Snas_6098
FT                   ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06234"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADU06234.1"
FT                   /translation="MQRVRFLARVTALAVVVLVGVGACALDPQAEGAGGSTPGPVGLTE
FT                   GASGASASPTPDQPVTSPSAQPSRTASPKPSRSPEATKTTKPKPKPSASAGCPQGEHQR
FT                   AVETYLTRLGGFGTLTVDGEQSAADCAAIKKFQIRYGISPSSGRAGPTTYDVAKRLAAT
FT                   DTARCRAGSRLTFCVDLTRQTVWAMRGGTVVMGPTVTRTGMSGYATPAGTYSVGRKNPR
FT                   EWSNPYEVWLPYWQQFNGGIGFHETTTYLHNGAIGSHGCVNLLHRDAVRLWELGSVGTR
FT                   VVVIGRRPGT"
FT   sig_peptide     698991..699068
FT                   /locus_tag="ML5_0686"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.835 at
FT                   residue 26"
FT   gene            700011..700247
FT                   /locus_tag="ML5_0687"
FT   CDS_pept        700011..700247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0687"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06235"
FT                   /inference="similar to AA sequence:KEGG:Sare_4340"
FT                   /protein_id="ADU06235.1"
FT                   /translation="MTVDQDVLPEDERTRQQEVPTAVVLAYAAAAAGVFGWFLFGLLVQ
FT                   QQGFVDSVGESAGAAFALLLAVSVIGTLRRNGE"
FT   gene            complement(700249..702711)
FT                   /locus_tag="ML5_0688"
FT   CDS_pept        complement(700249..702711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0688"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06236"
FT                   /inference="similar to AA sequence:KEGG:Sare_4339"
FT                   /protein_id="ADU06236.1"
FT                   /translation="MTTSLADHLRALPDESLAALLQLRPDLVVPVPADVSALALRAQSR
FT                   VSVARALDGLDQFTLQILDAARLTRGPEGATSTDQILAMATAGPQPPAPTAVRAAVDRL
FT                   RARFLLYGPEHDLCVAGGIDEVSPYPAGLGRPAAELDPRAAALCADPAKLRRTLLSAPP
FT                   SARAVLDRLAAGPPVGTVAPGALEAPATGAEDVLPPDLVNGGAPTGSPIRWLVEHRLLV
FT                   RMSGGRNGTVELPREVGLVLRRDAGPLGPLRTSPPVVSGPPREVKSVDSAGAGQTMEVV
FT                   RHTEAMLEALTAEPAPVLRSGGVGVRDLRRLARGLGLDEPTTALLFEVAYAAGLTGEME
FT                   LTGAATTRYGGDQQILPTGGYEVWRAVSLAQRWEQLARAWMSMPRQAGLIGQRDDRDRP
FT                   ISVLSAEAERAGAPAARRAVLAVLADLPPGTAPTTDEVLELLDWRAPRRARGRETAHRE
FT                   VLAEAATLGVTGLNALTSYGRLLLAELTEADERGDDPLGLRSDAESGDASTTVRALDGL
FT                   LPAPVDHVLVQADLTVVVPGPPDPALAAELDVVAEHESAGGASVHRVTTASIRRALDAG
FT                   YTADDLHALFRRRSRTPVPQGLTYLVDDAARKHGGLRVGSAGAYVRSDDETLLSEVQAD
FT                   RRLEPLAFRRLAPTVLVTPYQVNRMLTALRDAGYAPVPEDASGATVLARPKTRRAPART
FT                   AIGRAVDPLATPKLPMPRLLGVVEQIRRGEAAARAARRAPAVVRGAPAAGGPAPVSGHG
FT                   DALAVLQQAVRDKALVWVGYVDAHGATASRLVRPVSIGAGYLRAEDDRTEMLHTFALHR
FT                   ITAAVLEE"
FT   gene            702749..703372
FT                   /locus_tag="ML5_0689"
FT   CDS_pept        702749..703372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0689"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="KEGG: sco:SCO4323 hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06237"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADU06237.1"
FT                   /translation="MSPLMVGFDLDMTLVDSRPGIAAAFRALTARTGVHVDGELAVSRL
FT                   GPPLRTELAHWFPPERVEEAVTLYRELYPAYAITPTVPMPGAEAALCAVQARGGRTMVV
FT                   TAKMGRLAKLHLDHLGLPVDELAGDVFAEQKAVALREHGATLYVGDHVADMAAARAAGI
FT                   PGVAVATGPCSADELTEAGAYLVLDDLVEFPRALDRIIGLALEG"
FT   gene            703416..703787
FT                   /locus_tag="ML5_0690"
FT   CDS_pept        703416..703787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0690"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: saq:Sare_4338 cold-shock DNA-binding
FT                   domain-containing protein; PFAM: Cold-shock protein
FT                   DNA-binding; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06238"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADU06238.1"
FT                   /translation="MKWYDAAKGYGFVTSDEGGDVFLPKGALPAGVADLKGGQRVDFSV
FT                   VDSRRGAQAMGVKLLEAPPSVAELRRRPAEELHGLVEDMIKVLEAKVQPDLRRGRFPDR
FT                   KTSQKIAQLVHAVARELEV"
FT   gene            complement(703748..704578)
FT                   /locus_tag="ML5_0691"
FT   CDS_pept        complement(703748..704578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0691"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06239"
FT                   /inference="similar to AA sequence:KEGG:Sare_4337"
FT                   /protein_id="ADU06239.1"
FT                   /translation="MALSLAISPCPNDTFVFDALVHGRVPGAPAVEVTYADVDVTNTAA
FT                   ERGAFDLVKVSYAALPWLLDDYHLLPCGGALGRGCGPLVLTRGDRTDLSGATVAVPGER
FT                   TTAYLLFRLWAADQAPARIEVVPFHEIMPGVAAGRYDAGLVIHEARFTYPRHGLTALVD
FT                   LGEWWEGDTGLPIPLGAILARRGAVDPVEAAAWIRESVRQAWADPEASREYVLAHAQEM
FT                   EPDVVDRHIGLYVNEFTADLGEAGFAAVEALLGRAADAGLVPQTSSSRATAWTS"
FT   gene            complement(704613..705323)
FT                   /locus_tag="ML5_0692"
FT   CDS_pept        complement(704613..705323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0692"
FT                   /product="Tetracyclin repressor domain-containing protein"
FT                   /note="PFAM: Tetracyclin repressor domain-containing
FT                   protein; regulatory protein TetR; KEGG: saq:Sare_0638 TetR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06240"
FT                   /inference="protein motif:PFAM:PF02909"
FT                   /protein_id="ADU06240.1"
FT                   /translation="MAEQTETVRRTPLTRDRVLRTAVVLADRTGIESLSMRNLAQDLGV
FT                   VPMALYKHVANKDELLDGMIDIVVTEIDPPAPGDWKQAIRRRILSARQMLLRHPWASLA
FT                   IESRTTPTPAVLAYLDSTVGALRAGGFSTDLAHHVMHALGSRVLGFSQELFDTSRQAGR
FT                   SGATSADPPADLPPEAAARFPHLAAIATAASHDDDSVVGPGCDDQFEFEFALDLLLDGI
FT                   ERLHRNGWTSHRTG"
FT   gene            705441..706424
FT                   /locus_tag="ML5_0693"
FT   CDS_pept        705441..706424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0693"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   saq:Sare_0637 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06241"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADU06241.1"
FT                   /translation="MKAIVQERYGPPETLVLADVETPAPGPGDVLVRVEAAALNAYDWH
FT                   VMRGDPRLSRLALGLARPRARIRGRDFAGRVEAVGAQVRQVRPGDAVFGDLGEADGAFA
FT                   EYVCVPEHLVAPRPANLTAAQAAALPLAGVTALQGLRDAGQVRPGHRVLINGASGGVGT
FT                   LAVQLAKALGATVTGVCRTRNVALVRSLGADHVVDYTRDDFTRDGRRHDVVFDLVGNRS
FT                   LTALRRALTPDGTLVLSGGGVYRGGSLLGPIGLLARGRLLAPVIRQRVVVLATSPGRAH
FT                   LDVLREHAEAGRLTPVVDRTHPLREVPEAVRYLETEHARAKVVITI"
FT   gene            complement(706480..707193)
FT                   /locus_tag="ML5_0694"
FT   CDS_pept        complement(706480..707193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0694"
FT                   /product="futalosine nucleosidase"
FT                   /note="KEGG: stp:Strop_0412 hypothetical protein; TIGRFAM:
FT                   futalosine nucleosidase; PFAM: purine or other
FT                   phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06242"
FT                   /inference="protein motif:TFAM:TIGR03664"
FT                   /protein_id="ADU06242.1"
FT                   /translation="MTGLLVVTAVPAEAEAIRAGLTAPAAPNGTAAPDGTAPPDATAPP
FT                   DVTVLPVGVGPAVAGAATARLLALAEAAGRPYRAVVSAGIAGGFVGRVAVGGTVLADRS
FT                   VAADLGAESPAGFIPVEDLGMPPELLGGGRIVLADPGLLARLRAALPGATVGTVLTVST
FT                   VTGTAASTAALAERHPDAVAEAMEGYGVAVAAAQAGVPFAELRTVSNPIGPRDRSAWRM
FT                   REAFAALTAAAAALQ"
FT   gene            complement(707190..708806)
FT                   /locus_tag="ML5_0695"
FT   CDS_pept        complement(707190..708806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0695"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0413 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06243"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU06243.1"
FT                   /translation="MALSSRSGRSFLGRTVGTGIRATRLLLRGSLHGGRWMTRRAGTAR
FT                   ARSAGNEVGMVRLFDLHALSCAGDTLIAIGLAGTIFFDVPLGEARNKVALYLLVTMVPF
FT                   AMLAPVVGPLLDHFRHGRRYALATTMLGRAFLAWLISDYIGGFGLYPAAFGVLALSRAY
FT                   GVARSAAVPRLLPEGLGLSQVGARASVYGTVAGALVAPIGLAAFWFGPQWPLRVASVIF
FT                   LIGMVISLRLPPKADSEPPERMPHPLRALRRRDGERPLGRGRPSGRLVIATLIGAAALR
FT                   GLYGFLLLFLAFAIKAGDLTTDFFGRDLGAQGALGLVGGALAVGTFLATALGTRLRIHR
FT                   PTALQSSGTIVVAGVAVLAALKFSLPMVALLCLVAAMMSGIAKLAVDASIQERIPERLR
FT                   ASSFAHSETALMLAFVAGGGLGLVPFTGLIGVTVAAAVAALVAVRGVLVAGKLRGEHLA
FT                   GRPLGDEELAAEQATRAEKPATTSFDDPAPTSPAPQRSGPPPDDDGLAPPGFHIYRPSS
FT                   SVGGPGGVEDTERRDPRGPVA"
FT   gene            708894..709733
FT                   /locus_tag="ML5_0696"
FT   CDS_pept        708894..709733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0696"
FT                   /product="Protein of unknown function DUF3027"
FT                   /note="PFAM: Protein of unknown function DUF3027; KEGG:
FT                   saq:Sare_0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06244"
FT                   /inference="protein motif:PFAM:PF11228"
FT                   /protein_id="ADU06244.1"
FT                   /translation="MGNNGQVTRPASARAPRLDQVCAAAVEVARDAITEVEPTDIGDHL
FT                   QAVAEGDRVVTHYFECRMAGYRGWRWAVTVTRVPRSRHVTICETVLLPGPDALLAPGWL
FT                   PWQERLKPGDLGPGDLLPTPADDERLAPGYLLSDDPAVEETAWELGLGRARVLSREGRA
FT                   EAAQRWYDGDHGPDAAISAAAPAAARCGTCGFYLPLAGSLRLAFGACGNFYAPDDGRVV
FT                   SADHGCGAHSETMIEAAETSVDELPTVYDDSAVEAMTVSRAPGSVEAAEPAEPYGHP"
FT   gene            complement(709738..710001)
FT                   /locus_tag="ML5_0697"
FT   CDS_pept        complement(709738..710001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0697"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06245"
FT                   /inference="similar to AA sequence:KEGG:Sare_0503"
FT                   /protein_id="ADU06245.1"
FT                   /translation="MSQEQQPRPEPLDPPMVPFAVAGLIAWAVAGLVLLIFFRDWLTES
FT                   GRQNWLWTCLAGFLWGFPGLAVMMRHDANRRRRRAADAQRAR"
FT   gene            710094..711575
FT                   /locus_tag="ML5_0698"
FT   CDS_pept        710094..711575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0698"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   stp:Strop_0416 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06246"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADU06246.1"
FT                   /translation="MSIAPPPDHGTPPDPAHPRNAFDRFFLISARGSTLSRELRGGFAT
FT                   FFTMAYIVVLNPLILGSGKDGDGRSLAIPALAAATALVAGLMTILMGVVARFPIALAAG
FT                   LGVNALVAYEIAPQMTWADAMGLVVIEGVLIGILVLTGLRTAVFRSVPTQLKTAIGVGI
FT                   GLFLTIIGLVDAGFVRRVPDAANSTVPVGLGINGKIVSWPMLVFVVGLLITLVLVVRRV
FT                   RGAILIGILASTVLAIVVEAIADVGPSFVDGKPNPKGWALNVPELPKQIVDLPDLSLLG
FT                   QFNVLNSWSRVGWLVPLMFIFTLLITDFFDTMGTMVAIGQEGDMLDETGTPPKAKEILL
FT                   VDSIAAAAGGAASVSSNTSYIESAAGVAEGARTGVANLVTGALFLLAMFLAPLSLIVPF
FT                   EAASTALVVVGFLMMTAVRTIDWTDYEIAVPAFLTIALMPFTYSISNGIGAGVISFVLL
FT                   KVAKGKAREVHPLLYGVAVLFIVYFLRGPVESVLL"
FT   gene            711652..712086
FT                   /locus_tag="ML5_0699"
FT   CDS_pept        711652..712086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0699"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: saq:Sare_0505 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06247"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU06247.1"
FT                   /translation="MTAKRVPPAQLAPQLRDAITRLNRRVRQARPVGDLTVTQLSALTS
FT                   LNLAGALTPRELADVERVQPPTMTKIVAKLEERGLVQRTPHPTDGRQVILAATEGGRAV
FT                   LDQFERARNEWLATRLAALTEDERETLRRAADILQGIARA"
FT   gene            712155..713441
FT                   /locus_tag="ML5_0700"
FT   CDS_pept        712155..713441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0700"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   saq:Sare_0506 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06248"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU06248.1"
FT                   /translation="MQAKLSTMFQSLRVRNYRLFATGQLIKLIGVWMMFIAQDWLVLEL
FT                   SDNSATALGVVTALQFTPVLLLTLLSGRLADRYDKRMLLFVANAFWTVLSLAMSILVLT
FT                   GLVQLWHVFTFAALLGVANAVETPVRQAFVSELVGMPLLPNALSLNAAVFNSARIVGPA
FT                   VAGLAIAVVDVGPVFLVTALSSIAPLVNVVRMRTDELHRKDLPPVGERDQARVVDGLRY
FT                   VARRPDILLPMVLMSVIGMSLFNFQLTLAALAKTVFNTGAASFGLFSTALAAGALVGAL
FT                   AGTGRRSRPSVWLVLGAAIGCAIFGTLVGLAPAYWMVVTLLLPAGFFMIYFAQAANQRV
FT                   QLGVDASFRGRVMALWVLVFLGTNPVGAPLIGWVAETYGAGASIWAGGLISLTAALLAL
FT                   TWQLRRSGARLRMRVLPMPRFYVVSPGAK"
FT   gene            713517..714026
FT                   /locus_tag="ML5_0701"
FT   CDS_pept        713517..714026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0701"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06249"
FT                   /inference="similar to AA sequence:KEGG:Strop_0419"
FT                   /protein_id="ADU06249.1"
FT                   /translation="MEVGQGLLLALAILAVCCLPALFALLFCADEIIDRVACGWAEWRE
FT                   QRRERRTIARLDRAIEAEALTRDIDLTEFDKDGRRPLEQLATDLRRLGGHRLAAADRSV
FT                   VWHGAVIEAYDERLRAACHALGIAEHLAELDGVDREIERVRVEGLLHAAGLTLPAARAA
FT                   HHQRHR"
FT   gene            714031..714594
FT                   /locus_tag="ML5_0702"
FT   CDS_pept        714031..714594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0702"
FT                   /product="2'-5' RNA ligase"
FT                   /note="KEGG: stp:Strop_0420 2'-5' RNA ligase; TIGRFAM:
FT                   2'-5' RNA ligase; PFAM: Phosphoesterase HXTX"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06250"
FT                   /inference="protein motif:TFAM:TIGR02258"
FT                   /protein_id="ADU06250.1"
FT                   /translation="MRLFAAIYPPAVVVADLTARMKGLRVAAARHARLADPANLHLTLA
FT                   FLGEVPDDRLPDVKHALASAARTARSPRLCLAGGGRFGEGRSTVLWVDVRGEVEVLDAL
FT                   ALSIREGLREAGLPCDDKPFRAHLTIARPGDRVPEADVRSDVHTLHDYAGPQWTAGEVL
FT                   LIRSHLGRTPRYTPVAAWALAAGA"
FT   gene            complement(714663..715649)
FT                   /locus_tag="ML5_0703"
FT   CDS_pept        complement(714663..715649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0703"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sna:Snas_1656
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06251"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU06251.1"
FT                   /translation="MEYTNLGRTGLSVSRLCLGTMNFGPQTDEPDSFAIMDRALEHGIN
FT                   FFDTANVYGWKLGEGVTEQIVGRWFAQGGGRRDKVVLATKVYGKMGEWPNEQGLSARHI
FT                   IRACEDSLRRLQTDTIDLYQMHHISRTTPWEEIWQAMETLVAQGKVLYVGSSNFAGWHI
FT                   AQAQAAAGKRNFLGLVSEQCIYNLLTRYVELEVVPAAQHYGLGIIPWSPLHGGLLSGII
FT                   RKMAEGSAARGTTGRSADALAEHRNTIEAYEKLCADLGHDPADVALAWLLSRPGVTAPI
FT                   VGPRTMDQLDRNLGALDVQLDESTLTRLDELFPPVGNGGPGPEAWAW"
FT   gene            complement(715713..716801)
FT                   /locus_tag="ML5_0704"
FT   CDS_pept        complement(715713..716801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0704"
FT                   /product="Protein of unknown function DUF3071"
FT                   /note="PFAM: Protein of unknown function DUF3071; KEGG:
FT                   saq:Sare_0509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06252"
FT                   /inference="protein motif:PFAM:PF11268"
FT                   /protein_id="ADU06252.1"
FT                   /translation="MRPVRFVALSEDGQALVLADEVGRLLALPIDERIASALHAEPGAP
FT                   PLAVVPSATDPTPSLSPRDIQARIRSGESAEDVARIAGVPVDRVLRYAGPVLQERAMLA
FT                   QHARRTRLKGAEKPTPLAEVVNGRLAQHGIDTEKISWDAYRRDDGTWRIIATWPSGKAT
FT                   AQAVWDLDKTRQNVAPHDDMAQYLCAERPTPILGQEPAPERGGHALPGPSRGEPSRGGH
FT                   GLPAASEHARPGRDPIRAGRDALLASLDRPLGGTSGRGLDTRSPAALAGQEAPRQRAVA
FT                   GGAAALLGGGQGSAFDDDSDAPKEIPAVPSLAVLRPRRTGPAAATGGAAAESTDAGGKP
FT                   RKRLPSWDDVLFGTGPAARESS"
FT   gene            complement(716993..718120)
FT                   /locus_tag="ML5_0705"
FT   CDS_pept        complement(716993..718120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0705"
FT                   /product="phosphoserine aminotransferase"
FT                   /note="KEGG: saq:Sare_0510 phosphoserine aminotransferase;
FT                   TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06253"
FT                   /inference="protein motif:TFAM:TIGR01366"
FT                   /protein_id="ADU06253.1"
FT                   /translation="MADAPTIRIPDEIRPADGRFGCGPSKVRPAAVSALSDVATSYLGT
FT                   SHRQKTVRDQVSRLRRGLAEFFSLPEGYEVVLGNGGTTAFWEVATFGLIRDRAQFASFG
FT                   EFGAKFAKSVKDAPFLGEPTVRKSDAGSAPSLVAEAGVDVYATPHNETSTGVAVPISRV
FT                   AGADEGSLLLVDATSGAGGLDVDVAQTDVYYFAPQKCFGSDGGLWLALMSPAALARATE
FT                   VKESGRYIPAFLDLVTAIDNSRLEQTYNTPALATIFLAAEQTDWMNSQGGLAWAAKRTA
FT                   ESAGIVYGWAERSSFATPFVSDPALRSNVVATIDFADEVDATAIAKALRANGIVDTEPY
FT                   RKLGRNQLRVALFPAVEPADVEALTASIDYVVERL"
FT   gene            complement(718403..719509)
FT                   /locus_tag="ML5_0706"
FT   CDS_pept        complement(718403..719509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0706"
FT                   /product="Citrate (Si)-synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: stp:Strop_0423 citrate synthase 2; PFAM:
FT                   Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06254"
FT                   /inference="protein motif:PRIAM:2.3.3.1"
FT                   /protein_id="ADU06254.1"
FT                   /translation="MSDFKPGLEGVVAFETEIAEPDRAGGSLRYRGVDIEDLIGQVSFG
FT                   NVWALLVDGRFGPGLPPAEPFPVPVHSGDIRVDVQSAVAMLAPYWGLNQLLDISDEQAR
FT                   EDLARVSVTALSFVAQSARGLGLPAVPQKEIDKAETIVERFMKRWRGEPDPRHVKAVDA
FT                   YFISAAEHGLNASTFTARIVASTGADAAACISSGIGALSGPLHGGAPSRVLSMLEAVER
FT                   SGDADGYVKGVLDRGERLMGFGHRVYRAEDPRARVLRRTAKELGAPRFEVAEALEKAAL
FT                   AELQARRPDRVLATNVEFWSAVVLDFAEVPAHMFTSMFTCARMGGWSAHILEQKKLQRL
FT                   VRPSATYVGHGPRKPQQVEGWDAIPHGV"
FT   gene            719753..720412
FT                   /locus_tag="ML5_0707"
FT   CDS_pept        719753..720412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0707"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase; KEGG:
FT                   stp:Strop_0424 pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   Pyridoxine 5'-phosphate oxidase, dimerisation-like"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06255"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ADU06255.1"
FT                   /translation="MTGDTPAPAGMRNEYAADLGLTETDLAPDWHTQFARWFADAVAHQ
FT                   LPEPNAMVLGTADDRGRPSGRTVLLKGYGPEGFVFYTNHGSRKGAEVIGNPWASLVFPW
FT                   FPMQRQVIVTGRVEQVDRAETEAYFATRPRGSQLGAWASAQSTVVPDRTALDAAYRAAA
FT                   ERFADVDPIPAPPYWGGFRVRPETVEFWQGRASRLHDRLRFRRTGDGFFVVERLAP"
FT   gene            720409..721701
FT                   /locus_tag="ML5_0708"
FT   CDS_pept        720409..721701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0708"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0425 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06256"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU06256.1"
FT                   /translation="MTDVTQARRRGARRWAIDLRPLRVPAYRRVWTGNAIAMFGFQFTA
FT                   VAVPVEMFDLTGGSLWVGLLGIAGFVPLLIFGLWGGAVADARDRRRVLLVGGCVLWVST
FT                   LGLLVQSLAGARSPLLLLLLVGLQSTAFAITSPARSAILPRLVPAELVPAATTLNFTTF
FT                   TAAAVFGPLAAGLIFAAWQVGVALPIAYAADALLFTASLWATLRLPAMPPAPDPDGGVR
FT                   KAGFASIVDGFRYLATTRVLLLSFAIDLIAMILAMPRALFPELAQERFGGASAVGWLYS
FT                   SIAIGAMLGGLTSGWIGRVRRQGLALTVAVVGWGVAIALAGLAGQLWVAVVLLGVAGAA
FT                   DLVSATLRQSMLLVYAPDRMRGRLQGVNTVVVAGGPRLGDLRAGAMAAGFGTGFAMVGG
FT                   GLAAAVLAVLLVVAFPALLRYRSTTPAEDRH"
FT   gene            721718..722644
FT                   /locus_tag="ML5_0709"
FT   CDS_pept        721718..722644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0709"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: saq:Sare_0514 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06257"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ADU06257.1"
FT                   /translation="MGIDVQPPSGTQWTIAADGHEAVVVEVGGGLRAYRYDGVDHLDGY
FT                   AEDEVCPGSAGQVLAPWPNRVRDGVYTVGERSFQLDLTEPERHNALHGLVNWVRWQPIE
FT                   QSADSVTVGYDLPPSPGYPWALRLRARWSVGPDGLRAEHEATNVSDEPAPFGFSVHPYL
FT                   QLPKVGVDELRLHVPARRRVLVDSRLLPVAAAEVTGSEFDFTSPRPIGDLVLDTAFGDV
FT                   ERDADGGSAVVLSAPDGSSGLRIWADREFGWWQVFTGDTLGGERHRRSVAVEPMTCPPD
FT                   AFRSGKDLIMLEPGQTWRGAWGVRPEV"
FT   gene            722647..723249
FT                   /locus_tag="ML5_0710"
FT   CDS_pept        722647..723249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0710"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: stp:Strop_0427
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06258"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADU06258.1"
FT                   /translation="MEFADVVRRRRMVRNYDPDRPVPPEVVDRLLDHAVRAPSAGFSQG
FT                   WGFLVLEEPEDRERFWAATTPGGGGRERWLAGMRRAPLIVVPHANRDAYLDRYAEADKG
FT                   WSDRAEDRWPVPYWYVDTGFAALLMLLTAVDEGLGACFFGIPPQRIGAYREAFGVPPEL
FT                   HPIGAITVGYRAVDHRSPSLRRGRRPVQDVVRRGRWT"
FT   gene            723303..723608
FT                   /locus_tag="ML5_0711"
FT   CDS_pept        723303..723608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0711"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06259"
FT                   /inference="similar to AA sequence:KEGG:Sare_0516"
FT                   /protein_id="ADU06259.1"
FT                   /translation="MIFRAVRDGRPYPEHNLTLKQWAEIPPRPLRLDQLITTKRELALD
FT                   KLLAEDSTFYGDLFPHVVQWNGGLYLEDGLHRALRAALQQRNQIHARVLVLGDQGE"
FT   gene            723640..724800
FT                   /locus_tag="ML5_0712"
FT   CDS_pept        723640..724800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0712"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: saq:Sare_0517 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06260"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADU06260.1"
FT                   /translation="MTPLDLLDIDASLSDEERQIRTVVRRLVTDRVRPHVAGWYEDGQV
FT                   PARELAREFGKLGLLGMHLTGYGCAGASAVAYGLACLELEAGDSGVRSLVSVQGSLAMY
FT                   AIWRYGSEEQKQRWLPAMAAGEAIGCFGLTEPDHGSDPASMATRARRDGDDWILNGSKL
FT                   WITNAPIADVGVIWARTDDGVRGFAVPMDTPGVTAREIRHKMSLRASLTGEIALDDVRL
FT                   PADARLPEAIGLKAPLGCLTEARHGIVWGALGAARDCLETALEYATTRTQFGRPLAGFQ
FT                   LTQAKLADMAVEWNKGMLLALHLGRLADAGTLRPDQVSVGKLNNVREALAIARQCRTIL
FT                   GANGVSGEYPVMRHANNLESVLTYEGTSEIHQLVIGQRLTGLSAFA"
FT   gene            724934..725710
FT                   /locus_tag="ML5_0713"
FT   CDS_pept        724934..725710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0713"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6854 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06261"
FT                   /inference="similar to AA sequence:KEGG:SGR_6854"
FT                   /protein_id="ADU06261.1"
FT                   /translation="MARDGDINEPTREFPDYPTSESLRDRAEGSPDHDREYAPGAPASG
FT                   GGPARGLLWVLGAAALAVVVLLGVQATGLLPDFRNPFAKEQTDRSQPPLLKSIRDLSRY
FT                   VAAEGNFQVVVDVQNDRRNVPDFLLNERTLFVGAGRVEAYVDFGKIADGAVVVSEDGKS
FT                   AEIKLPAPQLGETDLDMDKSYVFAEQRGLINRLNDLVAGDPNRQQQVYKLAEDRITAAA
FT                   RDSGLTARAQENTRKMLEGLLRSLGYEKVTVTYTAP"
FT   gene            complement(725791..725994)
FT                   /locus_tag="ML5_0714"
FT   CDS_pept        complement(725791..725994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0714"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: sen:SACE_7288
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06262"
FT                   /inference="protein motif:PFAM:PF04024"
FT                   /protein_id="ADU06262.1"
FT                   /translation="MSRKLVRPRQGRMIAGVCAGLGQRFGMSAGMVRLLFLLSLLLPGT
FT                   QVIIYLILWILMPNEDRYLATR"
FT   gene            726834..728204
FT                   /locus_tag="ML5_0715"
FT   CDS_pept        726834..728204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0715"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="TIGRFAM: L-serine dehydratase 1; KEGG: saq:Sare_0518
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06263"
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /protein_id="ADU06263.1"
FT                   /translation="MISVFDLFSVGIGPSSSHTVGPMRAARTFVAGLKADGMLADVARV
FT                   RAELFGSLGATGHGHGSDRAVLLGLEGEVPETVDTDSVGPRVERIRTQRRLDLFGSQGV
FT                   DFDPDTDLVLHRRRSLPYHPNGMTFAAYDAAGGEVRTRTYYSVGGGFVVDEAAAGADRI
FT                   KADSTRVRHPFLTGAELLTVTSETGLSISEVMLANEVSWRSEADVRAGLLEIWRVMREC
FT                   VENGCTRDGVLPGGLKVRRRAAEMRRGLEAETGSGDPLRAMDWVTLFALAVNEENAAGG
FT                   RVVTAPTNGAAGIIPAVLHYYTRFVPGASEEGVVRFLLAAGAIGVLFKENASISGAEVG
FT                   CQGEVGSACSMAAAGLAEALGGTPEQVENAAEIGMEHNLGLTCDPVGGLVQIPCIERNA
FT                   VASIKAITAARLALRGDGVHHVSLDKVIKTMRETGADMKVKYKETARGGLAVNVIEC"
FT   gene            728271..729098
FT                   /locus_tag="ML5_0716"
FT   CDS_pept        728271..729098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0716"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: stp:Strop_0431
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06264"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADU06264.1"
FT                   /translation="MTSGVAALWSARTSLRILVRRDLAVKYQQSVLGYFWSLIEPLGMG
FT                   LIYWFVFGVLYSGATRRHLGEAAGSYPLFLITGIFAWMWASSALTEAANALTGQSRLIT
FT                   TMNLPRPIFPIGRVAGRFAEYLAGLPILAAVAAIYASQGKIRPGWSLLALPLAVAVQFV
FT                   LLVGLALLLSAGNVLMRDIERTMRLVIRLLFYATPIIYPLDLVRESGMPGWLKIGYELN
FT                   PLVGIFQLHHAVWYPDEFPDARLLTITVTGSVLVLALGWWAFHRLEPAVLKEL"
FT   gene            729099..729842
FT                   /locus_tag="ML5_0717"
FT   CDS_pept        729099..729842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0717"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: stp:Strop_0432 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06265"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU06265.1"
FT                   /translation="MAPIIEADGLGIRFVRNRRRQLRLRELIVHRGARDPDAGRFWPLR
FT                   DLSFRVEPGETVGVVGRNGTGKSTLLRLIAGVLIPDEGSIRVHGRVAPLLELSAGFSGD
FT                   LTGRENLYLVGGLHGLSSAYLREHFDEIVSFAGEQVERAIDTSVRHYSSGMKVRLGFAV
FT                   IAHLPHPVLLVDEVTAVGDAEFRAKCYATIERLLAEGRTLVLVSHNDKDLTRFCRRGLY
FT                   LDAGRLIVDGTIDEALAAYADAAKR"
FT   gene            729839..731740
FT                   /locus_tag="ML5_0718"
FT   CDS_pept        729839..731740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0718"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   stp:Strop_0433 CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06266"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ADU06266.1"
FT                   /translation="MTLAIVLAADPAAGHLTERLAAQWRRAGADDVRIAADLTELADLV
FT                   AAATGPVLVSGADLVAHTAVLKHLATSPVGPTVALVLTDPPAPGQATVREERGQVVEVG
FT                   AAEASGVFGGALRVGAADLPALAEAARRAAGGGPLGAVDRLVADLAARGTLIFAHRVRL
FT                   LVAHRVGDEAQRVAAESAVAAVDEDRAELKLSVKERDDFFTTFFVSTWSPYVTKAAARI
FT                   GIGPTGVTMVSVAFAVAAAVLFGAGGRPALVAGAVLLYLGFVLDCVDGQLARYTRHFSA
FT                   WGGWLDTMADRFKEYVVYAGLGFGATHAGFRYGWALALAAMTLQTVRHMTDTWYGALHD
FT                   EAARRPKVVSADAGGIGGKLNAASTRVQADTGSVSYWLKRTVVFPIGERWALIAIAAAL
FT                   FGPLVALVAVLVWGTLAFAYTGGLRTLRARWMRVPVLTTVDAGLHRDDGLLVRTLPTAR
FT                   RPLLLAVLGALGAAGTLVWALLAVHGGGDLPVFVPVLALVLLLGAAQASRAPHDGSLDW
FT                   LVPAALRAAEYLFAIAVGVAGRAPAWLIFGYVLVLTLLHYDLTARLEKRQSAPPLHAAT
FT                   LGWPGRSLLLAIGLIAGYASIALATIGAYLLVVFVASVVLAWVVLPARARGGVRSPG"
FT   gene            731757..733940
FT                   /locus_tag="ML5_0719"
FT   CDS_pept        731757..733940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0719"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; glycosyl transferase family 2;
FT                   KEGG: stp:Strop_0434 CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06267"
FT                   /inference="protein motif:PFAM:PF04464"
FT                   /protein_id="ADU06267.1"
FT                   /translation="MTLISFVVPAFKVQGYLRECLDSILGQPFGDIEVIGVDDASPDDS
FT                   GEILAEYALRDPRVRPVRLAENVGLGPARNIGLDRAVGEYVWFVDGDDWLVPGCLPHVA
FT                   DRLRDTAPDVLIVDHVRAHWNNIGTRSAMRDVFPDPPGATTFTLRDRPETLKLLHTAWN
FT                   RVVRREFLLERGLRFEPGWYEDVSFSYPALMAAGRIGVLDRICLNYRQRRTGAITKTRG
FT                   DRHFEVFAQWHRVFGLMDRWHVTGLRPAVFERMIWHYLTVLGNGDRIAPELRAPFFAQM
FT                   HADYVRFLPPEGYPVPSGPEGLKHRLVAAGRWRTFSALREAHQAGETARRTARRARRRV
FT                   TPVVRRTARRARDLALGEYYRAELHRPIDPTLAVYAAYWYRGYSCNPAVIYEAARRLAP
FT                   QVRGVWIVRRDRVATLPPGVEYVVAGSREYHRVLARARWLVNNVNFPDFVRKRPGSVHV
FT                   QTHHGTPVKVMGLDQQRYPVGAMGMNFAGLLRRVDRWDYSITSNSFSTQMWERAYPADY
FT                   TTLEVGYPRNDRLALATAEDRGQVRAALGIAPDEYVVLYAPTHREHLPGWRPPFDPDRM
FT                   LDVLGPRGRLLMRSHYFHDRERHPRGPAADGVLDVSAYDRVEDLYLAADVLVTDYSSAM
FT                   FDYAVLDRPIVVYAPDWDAYRVARGVYFDLLAEPPGAVALDFPGLLDVFRSGAVDDEAA
FT                   ERARTAFRSRFCALDDGHAAERVVRRVFLGETP"
FT   gene            734098..735411
FT                   /locus_tag="ML5_0720"
FT   CDS_pept        734098..735411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0720"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: stp:Strop_0435 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06268"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="