(data stored in ACNUC9435 zone)

EMBL: CP002400

ID   CP002400; SV 1; circular; genomic DNA; STD; PRO; 3008576 BP.
XX
AC   CP002400; ADJQ01000000-ADJQ01000077;
XX
PR   Project:PRJNA39729;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Ethanoligenens harbinense YUAN-3, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Ethanoligenens harbinense YUAN-3
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Ruminococcaceae;
OC   Ethanoligenens.
XX
RN   [1]
RP   1-3008576
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Misra M., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Jeffries C., Kyrpides N., Ivanova N., Mikhailova N., Wang A.,
RA   Mouttaki H., He Z., Zhou J., Hemme C.L., Woyke T.;
RT   "Complete sequence of Ethanoligenens harbinense YUAN-3";
RL   Unpublished.
XX
RN   [2]
RP   1-3008576
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Misra M., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Jeffries C., Kyrpides N., Ivanova N., Mikhailova N., Wang A.,
RA   Mouttaki H., He Z., Zhou J., Hemme C.L., Woyke T.;
RT   ;
RL   Submitted (16-DEC-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; ddc75e3886aec18c00bf03557966455f.
DR   BioSample; SAMN00008641.
DR   EnsemblGenomes-Gn; EBG00001011232.
DR   EnsemblGenomes-Gn; EBG00001011233.
DR   EnsemblGenomes-Gn; EBG00001011234.
DR   EnsemblGenomes-Gn; EBG00001011235.
DR   EnsemblGenomes-Gn; EBG00001011236.
DR   EnsemblGenomes-Gn; EBG00001011237.
DR   EnsemblGenomes-Gn; EBG00001011238.
DR   EnsemblGenomes-Gn; EBG00001011239.
DR   EnsemblGenomes-Gn; EBG00001011240.
DR   EnsemblGenomes-Gn; EBG00001011241.
DR   EnsemblGenomes-Gn; EBG00001011242.
DR   EnsemblGenomes-Gn; EBG00001011243.
DR   EnsemblGenomes-Gn; EBG00001011244.
DR   EnsemblGenomes-Gn; EBG00001011245.
DR   EnsemblGenomes-Gn; EBG00001011246.
DR   EnsemblGenomes-Gn; EBG00001011247.
DR   EnsemblGenomes-Gn; EBG00001011248.
DR   EnsemblGenomes-Gn; EBG00001011249.
DR   EnsemblGenomes-Gn; EBG00001011250.
DR   EnsemblGenomes-Gn; EBG00001011251.
DR   EnsemblGenomes-Gn; EBG00001011252.
DR   EnsemblGenomes-Gn; EBG00001011253.
DR   EnsemblGenomes-Gn; EBG00001011254.
DR   EnsemblGenomes-Gn; EBG00001011255.
DR   EnsemblGenomes-Gn; EBG00001011256.
DR   EnsemblGenomes-Gn; EBG00001011257.
DR   EnsemblGenomes-Gn; EBG00001011258.
DR   EnsemblGenomes-Gn; EBG00001011259.
DR   EnsemblGenomes-Gn; EBG00001011260.
DR   EnsemblGenomes-Gn; EBG00001011261.
DR   EnsemblGenomes-Gn; EBG00001011262.
DR   EnsemblGenomes-Gn; EBG00001011263.
DR   EnsemblGenomes-Gn; EBG00001011264.
DR   EnsemblGenomes-Gn; EBG00001011265.
DR   EnsemblGenomes-Gn; EBG00001011266.
DR   EnsemblGenomes-Gn; EBG00001011267.
DR   EnsemblGenomes-Gn; EBG00001011268.
DR   EnsemblGenomes-Gn; EBG00001011269.
DR   EnsemblGenomes-Gn; EBG00001011270.
DR   EnsemblGenomes-Gn; EBG00001011271.
DR   EnsemblGenomes-Gn; EBG00001011272.
DR   EnsemblGenomes-Gn; EBG00001011273.
DR   EnsemblGenomes-Gn; EBG00001011274.
DR   EnsemblGenomes-Gn; EBG00001011275.
DR   EnsemblGenomes-Gn; EBG00001011276.
DR   EnsemblGenomes-Gn; EBG00001011277.
DR   EnsemblGenomes-Gn; EBG00001011278.
DR   EnsemblGenomes-Gn; EBG00001011279.
DR   EnsemblGenomes-Gn; EBG00001011280.
DR   EnsemblGenomes-Gn; EBG00001011281.
DR   EnsemblGenomes-Gn; EBG00001011282.
DR   EnsemblGenomes-Gn; EBG00001011283.
DR   EnsemblGenomes-Gn; EBG00001011284.
DR   EnsemblGenomes-Gn; EBG00001011285.
DR   EnsemblGenomes-Gn; EBG00001011286.
DR   EnsemblGenomes-Gn; EBG00001011287.
DR   EnsemblGenomes-Gn; EBG00001011288.
DR   EnsemblGenomes-Gn; EBG00001011289.
DR   EnsemblGenomes-Gn; EBG00001011290.
DR   EnsemblGenomes-Gn; EBG00001011291.
DR   EnsemblGenomes-Gn; EBG00001011292.
DR   EnsemblGenomes-Gn; EBG00001011293.
DR   EnsemblGenomes-Gn; EBG00001011294.
DR   EnsemblGenomes-Gn; EBG00001011295.
DR   EnsemblGenomes-Gn; EBG00001011296.
DR   EnsemblGenomes-Gn; EBG00001011297.
DR   EnsemblGenomes-Gn; EBG00001011298.
DR   EnsemblGenomes-Gn; EBG00001011299.
DR   EnsemblGenomes-Gn; EBG00001011300.
DR   EnsemblGenomes-Gn; EBG00001011301.
DR   EnsemblGenomes-Gn; EBG00001011302.
DR   EnsemblGenomes-Gn; EBG00001011303.
DR   EnsemblGenomes-Gn; EBG00001011304.
DR   EnsemblGenomes-Gn; EBG00001011305.
DR   EnsemblGenomes-Gn; EBG00001011306.
DR   EnsemblGenomes-Gn; EBG00001011307.
DR   EnsemblGenomes-Gn; EBG00001011308.
DR   EnsemblGenomes-Gn; EBG00001011309.
DR   EnsemblGenomes-Gn; EBG00001011310.
DR   EnsemblGenomes-Gn; EBG00001011311.
DR   EnsemblGenomes-Gn; EBG00001011312.
DR   EnsemblGenomes-Gn; EBG00001011313.
DR   EnsemblGenomes-Gn; Ethha_R0001.
DR   EnsemblGenomes-Gn; Ethha_R0002.
DR   EnsemblGenomes-Gn; Ethha_R0003.
DR   EnsemblGenomes-Gn; Ethha_R0004.
DR   EnsemblGenomes-Gn; Ethha_R0005.
DR   EnsemblGenomes-Gn; Ethha_R0006.
DR   EnsemblGenomes-Gn; Ethha_R0007.
DR   EnsemblGenomes-Gn; Ethha_R0008.
DR   EnsemblGenomes-Gn; Ethha_R0009.
DR   EnsemblGenomes-Gn; Ethha_R0010.
DR   EnsemblGenomes-Gn; Ethha_R0011.
DR   EnsemblGenomes-Gn; Ethha_R0012.
DR   EnsemblGenomes-Gn; Ethha_R0013.
DR   EnsemblGenomes-Gn; Ethha_R0014.
DR   EnsemblGenomes-Gn; Ethha_R0015.
DR   EnsemblGenomes-Gn; Ethha_R0016.
DR   EnsemblGenomes-Gn; Ethha_R0017.
DR   EnsemblGenomes-Gn; Ethha_R0018.
DR   EnsemblGenomes-Gn; Ethha_R0019.
DR   EnsemblGenomes-Gn; Ethha_R0020.
DR   EnsemblGenomes-Gn; Ethha_R0021.
DR   EnsemblGenomes-Gn; Ethha_R0022.
DR   EnsemblGenomes-Gn; Ethha_R0023.
DR   EnsemblGenomes-Gn; Ethha_R0024.
DR   EnsemblGenomes-Gn; Ethha_R0025.
DR   EnsemblGenomes-Gn; Ethha_R0026.
DR   EnsemblGenomes-Gn; Ethha_R0027.
DR   EnsemblGenomes-Gn; Ethha_R0028.
DR   EnsemblGenomes-Gn; Ethha_R0029.
DR   EnsemblGenomes-Gn; Ethha_R0030.
DR   EnsemblGenomes-Gn; Ethha_R0031.
DR   EnsemblGenomes-Gn; Ethha_R0032.
DR   EnsemblGenomes-Gn; Ethha_R0033.
DR   EnsemblGenomes-Gn; Ethha_R0034.
DR   EnsemblGenomes-Gn; Ethha_R0035.
DR   EnsemblGenomes-Gn; Ethha_R0036.
DR   EnsemblGenomes-Gn; Ethha_R0037.
DR   EnsemblGenomes-Gn; Ethha_R0038.
DR   EnsemblGenomes-Gn; Ethha_R0039.
DR   EnsemblGenomes-Gn; Ethha_R0040.
DR   EnsemblGenomes-Gn; Ethha_R0041.
DR   EnsemblGenomes-Gn; Ethha_R0042.
DR   EnsemblGenomes-Gn; Ethha_R0043.
DR   EnsemblGenomes-Gn; Ethha_R0044.
DR   EnsemblGenomes-Gn; Ethha_R0045.
DR   EnsemblGenomes-Gn; Ethha_R0046.
DR   EnsemblGenomes-Gn; Ethha_R0047.
DR   EnsemblGenomes-Gn; Ethha_R0048.
DR   EnsemblGenomes-Gn; Ethha_R0049.
DR   EnsemblGenomes-Gn; Ethha_R0050.
DR   EnsemblGenomes-Gn; Ethha_R0051.
DR   EnsemblGenomes-Gn; Ethha_R0052.
DR   EnsemblGenomes-Gn; Ethha_R0053.
DR   EnsemblGenomes-Gn; Ethha_R0054.
DR   EnsemblGenomes-Gn; Ethha_R0055.
DR   EnsemblGenomes-Gn; Ethha_R0056.
DR   EnsemblGenomes-Gn; Ethha_R0057.
DR   EnsemblGenomes-Gn; Ethha_R0058.
DR   EnsemblGenomes-Gn; Ethha_R0059.
DR   EnsemblGenomes-Gn; Ethha_R0060.
DR   EnsemblGenomes-Gn; Ethha_R0061.
DR   EnsemblGenomes-Gn; Ethha_R0062.
DR   EnsemblGenomes-Gn; Ethha_R0063.
DR   EnsemblGenomes-Gn; Ethha_R0064.
DR   EnsemblGenomes-Gn; Ethha_R0065.
DR   EnsemblGenomes-Gn; Ethha_R0066.
DR   EnsemblGenomes-Gn; Ethha_R0067.
DR   EnsemblGenomes-Gn; Ethha_R0068.
DR   EnsemblGenomes-Gn; Ethha_R0069.
DR   EnsemblGenomes-Gn; Ethha_R0070.
DR   EnsemblGenomes-Gn; Ethha_R0071.
DR   EnsemblGenomes-Gn; Ethha_R0072.
DR   EnsemblGenomes-Gn; Ethha_R0073.
DR   EnsemblGenomes-Gn; Ethha_R0074.
DR   EnsemblGenomes-Gn; Ethha_R0075.
DR   EnsemblGenomes-Tr; EBT00001538211.
DR   EnsemblGenomes-Tr; EBT00001538212.
DR   EnsemblGenomes-Tr; EBT00001538213.
DR   EnsemblGenomes-Tr; EBT00001538214.
DR   EnsemblGenomes-Tr; EBT00001538215.
DR   EnsemblGenomes-Tr; EBT00001538216.
DR   EnsemblGenomes-Tr; EBT00001538217.
DR   EnsemblGenomes-Tr; EBT00001538218.
DR   EnsemblGenomes-Tr; EBT00001538219.
DR   EnsemblGenomes-Tr; EBT00001538220.
DR   EnsemblGenomes-Tr; EBT00001538221.
DR   EnsemblGenomes-Tr; EBT00001538222.
DR   EnsemblGenomes-Tr; EBT00001538223.
DR   EnsemblGenomes-Tr; EBT00001538224.
DR   EnsemblGenomes-Tr; EBT00001538225.
DR   EnsemblGenomes-Tr; EBT00001538226.
DR   EnsemblGenomes-Tr; EBT00001538227.
DR   EnsemblGenomes-Tr; EBT00001538228.
DR   EnsemblGenomes-Tr; EBT00001538229.
DR   EnsemblGenomes-Tr; EBT00001538230.
DR   EnsemblGenomes-Tr; EBT00001538231.
DR   EnsemblGenomes-Tr; EBT00001538232.
DR   EnsemblGenomes-Tr; EBT00001538233.
DR   EnsemblGenomes-Tr; EBT00001538234.
DR   EnsemblGenomes-Tr; EBT00001538235.
DR   EnsemblGenomes-Tr; EBT00001538236.
DR   EnsemblGenomes-Tr; EBT00001538237.
DR   EnsemblGenomes-Tr; EBT00001538238.
DR   EnsemblGenomes-Tr; EBT00001538239.
DR   EnsemblGenomes-Tr; EBT00001538240.
DR   EnsemblGenomes-Tr; EBT00001538241.
DR   EnsemblGenomes-Tr; EBT00001538242.
DR   EnsemblGenomes-Tr; EBT00001538243.
DR   EnsemblGenomes-Tr; EBT00001538244.
DR   EnsemblGenomes-Tr; EBT00001538245.
DR   EnsemblGenomes-Tr; EBT00001538246.
DR   EnsemblGenomes-Tr; EBT00001538247.
DR   EnsemblGenomes-Tr; EBT00001538248.
DR   EnsemblGenomes-Tr; EBT00001538249.
DR   EnsemblGenomes-Tr; EBT00001538250.
DR   EnsemblGenomes-Tr; EBT00001538251.
DR   EnsemblGenomes-Tr; EBT00001538252.
DR   EnsemblGenomes-Tr; EBT00001538253.
DR   EnsemblGenomes-Tr; EBT00001538254.
DR   EnsemblGenomes-Tr; EBT00001538255.
DR   EnsemblGenomes-Tr; EBT00001538256.
DR   EnsemblGenomes-Tr; EBT00001538257.
DR   EnsemblGenomes-Tr; EBT00001538258.
DR   EnsemblGenomes-Tr; EBT00001538259.
DR   EnsemblGenomes-Tr; EBT00001538260.
DR   EnsemblGenomes-Tr; EBT00001538261.
DR   EnsemblGenomes-Tr; EBT00001538262.
DR   EnsemblGenomes-Tr; EBT00001538263.
DR   EnsemblGenomes-Tr; EBT00001538264.
DR   EnsemblGenomes-Tr; EBT00001538265.
DR   EnsemblGenomes-Tr; EBT00001538266.
DR   EnsemblGenomes-Tr; EBT00001538267.
DR   EnsemblGenomes-Tr; EBT00001538268.
DR   EnsemblGenomes-Tr; EBT00001538269.
DR   EnsemblGenomes-Tr; EBT00001538270.
DR   EnsemblGenomes-Tr; EBT00001538271.
DR   EnsemblGenomes-Tr; EBT00001538272.
DR   EnsemblGenomes-Tr; EBT00001538273.
DR   EnsemblGenomes-Tr; EBT00001538274.
DR   EnsemblGenomes-Tr; EBT00001538275.
DR   EnsemblGenomes-Tr; EBT00001538276.
DR   EnsemblGenomes-Tr; EBT00001538277.
DR   EnsemblGenomes-Tr; EBT00001538278.
DR   EnsemblGenomes-Tr; EBT00001538279.
DR   EnsemblGenomes-Tr; EBT00001538280.
DR   EnsemblGenomes-Tr; EBT00001538281.
DR   EnsemblGenomes-Tr; EBT00001538282.
DR   EnsemblGenomes-Tr; EBT00001538283.
DR   EnsemblGenomes-Tr; EBT00001538284.
DR   EnsemblGenomes-Tr; EBT00001538285.
DR   EnsemblGenomes-Tr; EBT00001538286.
DR   EnsemblGenomes-Tr; EBT00001538287.
DR   EnsemblGenomes-Tr; EBT00001538288.
DR   EnsemblGenomes-Tr; EBT00001538289.
DR   EnsemblGenomes-Tr; EBT00001538290.
DR   EnsemblGenomes-Tr; EBT00001538291.
DR   EnsemblGenomes-Tr; EBT00001538292.
DR   EnsemblGenomes-Tr; Ethha_R0001-1.
DR   EnsemblGenomes-Tr; Ethha_R0002-1.
DR   EnsemblGenomes-Tr; Ethha_R0003-1.
DR   EnsemblGenomes-Tr; Ethha_R0004-1.
DR   EnsemblGenomes-Tr; Ethha_R0005-1.
DR   EnsemblGenomes-Tr; Ethha_R0006-1.
DR   EnsemblGenomes-Tr; Ethha_R0007-1.
DR   EnsemblGenomes-Tr; Ethha_R0008-1.
DR   EnsemblGenomes-Tr; Ethha_R0009-1.
DR   EnsemblGenomes-Tr; Ethha_R0010-1.
DR   EnsemblGenomes-Tr; Ethha_R0011-1.
DR   EnsemblGenomes-Tr; Ethha_R0012-1.
DR   EnsemblGenomes-Tr; Ethha_R0013-1.
DR   EnsemblGenomes-Tr; Ethha_R0014-1.
DR   EnsemblGenomes-Tr; Ethha_R0015-1.
DR   EnsemblGenomes-Tr; Ethha_R0016-1.
DR   EnsemblGenomes-Tr; Ethha_R0017-1.
DR   EnsemblGenomes-Tr; Ethha_R0018-1.
DR   EnsemblGenomes-Tr; Ethha_R0019-1.
DR   EnsemblGenomes-Tr; Ethha_R0020-1.
DR   EnsemblGenomes-Tr; Ethha_R0021-1.
DR   EnsemblGenomes-Tr; Ethha_R0022-1.
DR   EnsemblGenomes-Tr; Ethha_R0023-1.
DR   EnsemblGenomes-Tr; Ethha_R0024-1.
DR   EnsemblGenomes-Tr; Ethha_R0025-1.
DR   EnsemblGenomes-Tr; Ethha_R0026-1.
DR   EnsemblGenomes-Tr; Ethha_R0027-1.
DR   EnsemblGenomes-Tr; Ethha_R0028-1.
DR   EnsemblGenomes-Tr; Ethha_R0029-1.
DR   EnsemblGenomes-Tr; Ethha_R0030-1.
DR   EnsemblGenomes-Tr; Ethha_R0031-1.
DR   EnsemblGenomes-Tr; Ethha_R0032-1.
DR   EnsemblGenomes-Tr; Ethha_R0033-1.
DR   EnsemblGenomes-Tr; Ethha_R0034-1.
DR   EnsemblGenomes-Tr; Ethha_R0035-1.
DR   EnsemblGenomes-Tr; Ethha_R0036-1.
DR   EnsemblGenomes-Tr; Ethha_R0037-1.
DR   EnsemblGenomes-Tr; Ethha_R0038-1.
DR   EnsemblGenomes-Tr; Ethha_R0039-1.
DR   EnsemblGenomes-Tr; Ethha_R0040-1.
DR   EnsemblGenomes-Tr; Ethha_R0041-1.
DR   EnsemblGenomes-Tr; Ethha_R0042-1.
DR   EnsemblGenomes-Tr; Ethha_R0043-1.
DR   EnsemblGenomes-Tr; Ethha_R0044-1.
DR   EnsemblGenomes-Tr; Ethha_R0045-1.
DR   EnsemblGenomes-Tr; Ethha_R0046-1.
DR   EnsemblGenomes-Tr; Ethha_R0047-1.
DR   EnsemblGenomes-Tr; Ethha_R0048-1.
DR   EnsemblGenomes-Tr; Ethha_R0049-1.
DR   EnsemblGenomes-Tr; Ethha_R0050-1.
DR   EnsemblGenomes-Tr; Ethha_R0051-1.
DR   EnsemblGenomes-Tr; Ethha_R0052-1.
DR   EnsemblGenomes-Tr; Ethha_R0053-1.
DR   EnsemblGenomes-Tr; Ethha_R0054-1.
DR   EnsemblGenomes-Tr; Ethha_R0055-1.
DR   EnsemblGenomes-Tr; Ethha_R0056-1.
DR   EnsemblGenomes-Tr; Ethha_R0057-1.
DR   EnsemblGenomes-Tr; Ethha_R0058-1.
DR   EnsemblGenomes-Tr; Ethha_R0059-1.
DR   EnsemblGenomes-Tr; Ethha_R0060-1.
DR   EnsemblGenomes-Tr; Ethha_R0061-1.
DR   EnsemblGenomes-Tr; Ethha_R0062-1.
DR   EnsemblGenomes-Tr; Ethha_R0063-1.
DR   EnsemblGenomes-Tr; Ethha_R0064-1.
DR   EnsemblGenomes-Tr; Ethha_R0065-1.
DR   EnsemblGenomes-Tr; Ethha_R0066-1.
DR   EnsemblGenomes-Tr; Ethha_R0067-1.
DR   EnsemblGenomes-Tr; Ethha_R0068-1.
DR   EnsemblGenomes-Tr; Ethha_R0069-1.
DR   EnsemblGenomes-Tr; Ethha_R0070-1.
DR   EnsemblGenomes-Tr; Ethha_R0071-1.
DR   EnsemblGenomes-Tr; Ethha_R0072-1.
DR   EnsemblGenomes-Tr; Ethha_R0073-1.
DR   EnsemblGenomes-Tr; Ethha_R0074-1.
DR   EnsemblGenomes-Tr; Ethha_R0075-1.
DR   EuropePMC; PMC3558957; 23408234.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002400.
DR   SILVA-SSU; CP002400.
DR   StrainInfo; 677383; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085559
CC   Source DNA and organism available from Defeng Xing
CC   (dxing@hit.edu.cn) and Christopher Hemme (hemmecl@ou.edu)
CC   Contacts: Defeng Xing (dxing@hit.edu.cn)
CC             Christopher Hemme (hemmecl@ou.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Ethanoligenens harbinense YUAN-3T, DSM 18485
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Sludge
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 18485, JCM 12961, CGMCC 1.5033
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Obligate anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02545
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 103079
CC   Funding Program     :: DOEM 2007
CC   Isolation Site      :: Anaerobic activated sludge of molasses
CC                          wastewater in a continuous stirred-tank
CC                          reactor
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 20 - 44C
CC   pH                  :: 3.5 - 9.0
CC   Gram Staining       :: Gram+
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3008576
FT                   /organism="Ethanoligenens harbinense YUAN-3"
FT                   /strain="YUAN-3"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="anaerobic activated sludge of molasses
FT                   wastewater in a continuous stirred-tank reactor"
FT                   /db_xref="taxon:663278"
FT   gene            331..1674
FT                   /locus_tag="Ethha_0001"
FT   CDS_pept        331..1674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   cbl:CLK_3133 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25592"
FT                   /db_xref="GOA:E6U5C5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5C5"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADU25592.1"
FT                   /translation="MQSFKEVWEGVCLFCKEKISDVAFKTWIYCMEPVELHSNEAVFFV
FT                   RSDFQRNIIYDRYKQLLKDGFEHILGFPVDIRIVTEDDKPNGYRSQYDFVVTQNPEDIE
FT                   QTYASADYEYTFDTFIVGSSNKFAHAASMAVASTPAMAYNPLFIYGGSGLGKTHLLHAI
FT                   RHEILKNNPNSKILYIKGEDFTNELVESIRQNSQIQFRNKYRQTDVLLVDDIQFVAGKE
FT                   STQEEFFHTFNSLYESKKQIVLTSDRPPKEIQTLEDRLRTRFEWGLLADIQPPDFETRL
FT                   AIIRRKAELLGINIPDEVDEYIANRLKNNIRQLEGAVKKIKAYNLLTGDPPSIAIAQNA
FT                   IRDILNDNQPVPVTIDRIIGEVSRTFGVSADDIKGKMRSGNVSTARQVSMYIIREITQM
FT                   STSAIGEKFNGRDHSTVVYAIQKVEDDMKNKPHLKATVEDIIKNIRAN"
FT   gene            1981..3090
FT                   /locus_tag="Ethha_0002"
FT   CDS_pept        1981..3090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: ctc:CTC00093 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25593"
FT                   /db_xref="GOA:E6U5C6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5C6"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADU25593.1"
FT                   /translation="MQFRCNTKKLAEALAVAGRAVSSKTSMPALEGILIRTGDHQIILQ
FT                   AYDLELGISTTIEAECRSDGEIVLNAKIFADMVRKLPGDTVEVKSDDKLLTIVTSGAAE
FT                   FTILGTPAVEFPELPSLSDGASIELPENLLSSMIRQTIFAISTDESNPIHTGILFELQE
FT                   KTLRLVAVDGFRLAIRTEPVTQDGSFAFVVPGKTLAEISKLLHSESDEKITVTVGEKHI
FT                   LFDIAGYTVISRLLEGQFLDYKSVLGGNTTAHARVNARALTDSIDRASLLITDRLKSPV
FT                   RCIFESDRIRIKCSSSIGKVYDEVSAAFEGEPCEMGFNNRYLMDALKAADCDEVRIQLG
FT                   GPLSPMKICPPDGDAFIFLVLPVRLNADG"
FT   gene            3083..3298
FT                   /locus_tag="Ethha_0003"
FT   CDS_pept        3083..3298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0003"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   cyb:CYB_1892 S4 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25594"
FT                   /db_xref="GOA:E6U5C7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5C7"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADU25594.1"
FT                   /translation="MAEPIEIQTPFIKLEQLLKLAGAFPTGGGCKEAIQSGQVQVNGAV
FT                   CLLRGKKLHPGDQVTCGGHIWQVITP"
FT   gene            3295..4422
FT                   /locus_tag="Ethha_0004"
FT   CDS_pept        3295..4422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: cth:Cthe_2374 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25595"
FT                   /db_xref="GOA:E6U5C8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5C8"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADU25595.1"
FT                   /translation="MIVHRLSLQGFRNLEQTVLEPDPSVNIFYGQNAQGKTNLLEAIWL
FT                   FTGARSFRGAKDSELVGFQAEKADLSLSFTAGGRLQEAVLSIREGRRYARLNDVPLQSP
FT                   AGLSGEFCAVIFSPEHLSLVKDGPSVRRAFLDEAICPLRPRHAAILAAYHKALIQRNAL
FT                   LKDIPHHMDLLDTLDVWDERVGKLGAAILHARLRYLARLLPKAERLHQSISNSHEQAAF
FT                   RYESAKGLQNVLDDPGRHASEIEQALRAAMRERRRADLETGVTGVGPHRDDLTISVAER
FT                   PARSFASQGQQRTAALALKLAEAEVLTDVMGEPPVLLLDDVFSELDGSRRDYLMHHIDG
FT                   AQVFITCCDPQELASSAGAVFSLSNGQIRRGFHAS"
FT   gene            4479..4763
FT                   /locus_tag="Ethha_0005"
FT   CDS_pept        4479..4763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cce:Ccel_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25596"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5C9"
FT                   /inference="similar to AA sequence:KEGG:Ccel_0005"
FT                   /protein_id="ADU25596.1"
FT                   /translation="MYLHIGQDTVVRLQDIVGIFDIDTTSISAITREYLKHAQQAGLVV
FT                   NVTEELPKSFVVCHEKSKSEDGPHIKVYISQISSTTLLKRSAAPGFTDA"
FT   gene            4877..6805
FT                   /locus_tag="Ethha_0006"
FT   CDS_pept        4877..6805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: cce:Ccel_0006 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25597"
FT                   /db_xref="GOA:E6U5D0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D0"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADU25597.1"
FT                   /translation="MNENQLEPENKDYGADQIQVLEGLEAVRKRPGMYIGSTGSPGLHH
FT                   LVYEIVDNAIDEALAGYCHNIHVEILPENVIRVTDDGRGIPVGIHPKMGIPAVTVVFTM
FT                   LHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVEVAHEGKLYQQRYERGTPVTKLEI
FT                   VGDTDRVGSIITFKPDCEIFETCVYDYDIILARLREQAFLNAGIRIVLEDKREPGGRND
FT                   SLCYEGGIREFVQYVHKRKGLTALHPDVIYFSASAETSMAEVALQYNDSYNEVIYSFAN
FT                   DIHTVEGGTHETGFKSALTRVFNDYGRKYNILKDSDSKLSGEDVREGLTAVISVKLEEA
FT                   LFEGQTKAKLGNTEMRQLVDGMLYDKLMTYFEENPAVARSIFDKALAANRAREAARKAR
FT                   DLSRRKSALDSASLPGKLADCSDKDNTYTEIYIVEGDSAGGSAKEGRDRKFQAILPLWG
FT                   KMLNVEKARLDRVYGNEKLMPVVTALGTGIGEDFDISKLRYGKIIIMADADVDGSHIRT
FT                   LLLTFFFRFMRPLIEEGHIYIAQPPLFKISKGKKSVYAFSDKERDTAIAEMGGKCDIQR
FT                   YKGLGEMDPIQLWETTMNPDGRTILRVDMEDAAAADEIFTILMGDKVEPRREFIEVNAG
FT                   KVRELDV"
FT   gene            7060..9600
FT                   /locus_tag="Ethha_0007"
FT   CDS_pept        7060..9600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: cno:NT01CX_0861 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25598"
FT                   /db_xref="GOA:E6U5D1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D1"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADU25598.1"
FT                   /translation="MNFDGQKLIPVEIREEMEKSFLEYSMSVIVSRALPDVRDGLKPVH
FT                   RRILYAMYEDNLLPTNAYRKSATTVGNVLGRYHPHGDASVYDALVRMAQSFSLRYPLVD
FT                   GHGNFGSIDGDGPAAYRYTEARMSRISLEMLQDIEKETVDFQPNFDDVRKEPIVIPSRF
FT                   PNILVNGSSGIAVGMATNIPPHNLGEVIDGMALLIDNPDATLEELTAHIQGPDFPTGGI
FT                   IMGRAGIREAYVKGRSRITLRAKATIEEDDNGRSRIIVTEIPYMVSKARIVEGIAELHK
FT                   EKRIEGISDLRDESDREGLRIVVELKRDANPQVVLNRLYTYSQLQETVPVIMLALVNGH
FT                   PRVLPLRDILTEYIHFQEQVVTRRTQYDLRKAEERAHILEGLKIALDFIDEVIRILRAS
FT                   KSIPEGKAALMERFELDDIQAQAIVQMRLGQLTNLEREKIEEELAALETKIANFKAILA
FT                   DEQRILQIVKEEALEVKAKFGDERRTRIENVSGEVDVEDLIPVEDVVLTLTNFGYIKRL
FT                   PAAAYHSQRRGGRGVNGLTRREEDVARELFVCSTHDFVLFFTSHGRCYRLKGYEVPEGS
FT                   RTSKGMNVANILPVAQDENITAMIKVPKFEEDCYLVMVTKKGIVKRTSLKEYDTARKAG
FT                   VIGILLEEDDELVGVLLTDGSAHILVGTRNGVAIRFVETDARPMGRAAHGVKAISLEGG
FT                   DYVVGVTVPNGAGSLLLITENGYGKRVPFEDFRVQNRGGKGLTSYNINEKTGPVAGLRV
FT                   VEESDDALFISSDGVVIRVPVAEIPVYSRYAQGVRVMRVGEETKVVTVTSAAHEEESEE
FT                   ESETSPEDAEQPETETAENSEKPDGGSTDNKPQS"
FT   gene            9706..9882
FT                   /locus_tag="Ethha_0008"
FT   CDS_pept        9706..9882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25599"
FT                   /db_xref="GOA:E6U5D2"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D2"
FT                   /inference="similar to AA sequence:KEGG:Geob_0432"
FT                   /protein_id="ADU25599.1"
FT                   /translation="MLWVIAGVLLVLWLVGILAAYTLGGLVHLLLIAALVLIIVKIVQS
FT                   IRHTTDQHHEPMK"
FT   sig_peptide     9706..9768
FT                   /locus_tag="Ethha_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.621 at
FT                   residue 21"
FT   gene            10002..10151
FT                   /locus_tag="Ethha_0009"
FT   CDS_pept        10002..10151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25600"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D3"
FT                   /inference="similar to AA sequence:KEGG:Geob_0432"
FT                   /protein_id="ADU25600.1"
FT                   /translation="MFWAIIAVLFILWLLGVLLAHVFGGLIHLLLILLIVLVIVKIIRN
FT                   IRRL"
FT   sig_peptide     10002..10064
FT                   /locus_tag="Ethha_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.661 at
FT                   residue 21"
FT   gene            complement(10218..10955)
FT                   /locus_tag="Ethha_0010"
FT   CDS_pept        complement(10218..10955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0010"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="KEGG: acd:AOLE_18415 lyzozyme M1
FT                   (1,4-beta-N-acetylmuramidase); PFAM: glycoside hydrolase
FT                   family 25; SMART: Glycoside hydrolase, family 25 subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25601"
FT                   /db_xref="GOA:E6U5D4"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D4"
FT                   /inference="protein motif:PFAM:PF01183"
FT                   /protein_id="ADU25601.1"
FT                   /translation="MKTVLETIKGFFSSLWNKFSALPKIARIISITAGCVVLAGLVAFG
FT                   AWYWFYPTTILGMDASHYQGAISWKAIRQNSGVRFVYLKATEGKAYVDARFKQNWSGAA
FT                   AAGLKVGAYHFFSTSSSGEDQAKNFIATVPKESGELPPAIDIESSVTQESDFKQQVADY
FT                   VKLVQAHYGQKPVFYVSARMFDLLYDQFSDYPFWIINYKTKPNIKDWTFWQYSEKGKLP
FT                   GVDGSVDLDRYHGSRFAFYFLSL"
FT   sig_peptide     complement(10818..10955)
FT                   /locus_tag="Ethha_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.931 at
FT                   residue 46"
FT   gene            11201..11656
FT                   /locus_tag="Ethha_0011"
FT   CDS_pept        11201..11656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0011"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: vpr:Vpar_1625 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25602"
FT                   /db_xref="GOA:E6U5D5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D5"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU25602.1"
FT                   /translation="MDISDGLPLSGESSGYLFSQTYNRWHTEIKKRLRKMEITHPQFSV
FT                   LASLDCLTQQKAFATQAEIAKRAGMDVMTVCGIIHTLEGKRFLKRTANPNDARASAVYL
FT                   LEKGRMKLEEAFPAVRQIDEEFFGRLGDARATFNALLAVILSEQPGE"
FT   gene            11698..13104
FT                   /locus_tag="Ethha_0012"
FT   CDS_pept        11698..13104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0012"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: cby:CLM_0752 drug resistance transporter,
FT                   EmrB/QacA family; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25603"
FT                   /db_xref="GOA:E6U5D6"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D6"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADU25603.1"
FT                   /translation="MELSKTRKNLILAVSCVEAFMATLDGSIVNIALPDISKQMRVEIS
FT                   AVQWVSTAYLLAIVLLLLLWGKLADLRGKKGVIITGFLFFAAGSALCSFSKSLEFLIIA
FT                   RIIQAVGAGAMMSLSQGIVTSTFAPGERGSALGQVGMMVALGSLAGPFLGGILVSAFGW
FT                   PSIFIINVPIAVASAVLAFCVLPSHMENPEKQTFDWRGAVLFSAGILVLFLTLLLAQQG
FT                   SISSIWLLPAVAVAAAALFGFIYTERRVPDPLVHLGLFRKQPFSLGLLQGYLIFIALSA
FT                   TLLFIPFYLQDLLRYDAFHAGLIVAVYPIVLAFVSPLSGRLADRMSTRPLTASGTGISA
FT                   AALFVLAFVRQDTPMWVIIVALAALGVGNGLFQSPNNSDIFNTVPPAQLGIAGGINALF
FT                   RNLGFVSGTAFSVLIFSFTAGLNVNSISGTMDAHAFMRGFSPVFLFCGACAAAALALCF
FT                   VRIAKRTRTA"
FT   gene            13400..13954
FT                   /locus_tag="Ethha_0013"
FT   CDS_pept        13400..13954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0013"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="KEGG: drm:Dred_1680 bifunctional pyrimidine
FT                   regulatory protein PyrR uracil phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25604"
FT                   /db_xref="GOA:E6U5D7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D7"
FT                   /inference="protein motif:PRIAM:2.4.2.9"
FT                   /protein_id="ADU25604.1"
FT                   /translation="MQKIKAEIMDEKGMCRATARISYEIVERNHGTANVCIIGIRRRGA
FT                   VIAARIAEKLADIEGAPVSTGFLDITLYRDDLDAKDGPARAPLGSDIPFEVTGRRVVLV
FT                   DDVLFTGRSVRAAIDAIMDRGRPERVQLAVLIDRGHRELPISPDFVGKNVPTSQNETVA
FT                   VRVTEFDGENRVVICENGGKA"
FT   gene            13951..15237
FT                   /locus_tag="Ethha_0014"
FT   CDS_pept        13951..15237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0014"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="KEGG: gsu:GSU1272 dihydroorotase, multifunctional
FT                   complex type; TIGRFAM: dihydroorotase, multifunctional
FT                   complex type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25605"
FT                   /db_xref="GOA:E6U5D8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D8"
FT                   /inference="protein motif:TFAM:TIGR00857"
FT                   /protein_id="ADU25605.1"
FT                   /translation="MNGLLLIKGATLVDPEEVYAGVGDLLVKDGKIAAVAESGGNLAAP
FT                   AGTTVLDARGLYLSPGLVDMHVHLRDPGQTHKETIETGCAAAAAGGVTALAAMPNTSPA
FT                   ADTPAVLVYEAAQAEPTGVRVFPIAAVSKAQAGDELTDFEMLSEAGAVAFSDDGHPVRD
FT                   AAQMLEAMRRAHALGKRVISHCEDESLADAGIVSDTAAKRLDVPGIPAATEAVHAAREA
FT                   VLAESTGTPVHIAHVSSRFTVALLRDAKRRGAPVTCETCPHYFSLDDSLLDARDADYRM
FT                   NPPLREKADVAAVIKGLRDGTIDAIVTDHAPHTAGEKADFTAAPNGVVGLETSLAAGIT
FT                   YLVRPGHLSLPQLIRKMTTVPADLLGIRAGRLKIGTRADMVLFDPAAPWTVRPEALHSK
FT                   SHNTPYKGMTLYGEVRYTISDGCIIFSKT"
FT   gene            15412..16344
FT                   /locus_tag="Ethha_0015"
FT   CDS_pept        15412..16344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0015"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; KEGG:
FT                   cpy:Cphy_0882 orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25606"
FT                   /db_xref="GOA:E6U5D9"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D9"
FT                   /inference="protein motif:TFAM:TIGR02127"
FT                   /protein_id="ADU25606.1"
FT                   /translation="MDTLRKKIAARQNPTVAGLDPDFAKLPAFLREQAVARRGKTLEAA
FT                   ADAVLAFNRAIIDALCDVVPAVKPQAAYYELLGWPGVRALAETIAYAREKGLFVITDAK
FT                   RGDIGSTMAAYARAHLGTVEIEGAEITPFGADALTVNAYLGSDGVLPALEVCKAHGKCI
FT                   FVLGKTSNPSSGEIQDKLVDGEPVYSLLGHLCAHWSGMAAGGEPSGRYGTVGLVAGATY
FT                   PAQLAELRQNLPHTFFLVPGYGAQGGGARDVAPAFDENGDGAIVNSSRAILYAWRKEGC
FT                   NERDFAGAARREALRMKEDLNAVLADHSK"
FT   gene            16399..17487
FT                   /locus_tag="Ethha_0016"
FT   CDS_pept        16399..17487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0016"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="KEGG: cth:Cthe_0950 carbamoyl-phosphate synthase
FT                   small subunit; TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: Carbamoyl-phosphate synthase small chain;
FT                   glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25607"
FT                   /db_xref="GOA:E6U5E0"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E0"
FT                   /inference="protein motif:TFAM:TIGR01368"
FT                   /protein_id="ADU25607.1"
FT                   /translation="MTKAYLLLADGTVFEGVSIGARGTSIGETVFNTGMTGYQETLTDA
FT                   SYYGQIVTQTYPLVGNYGVNGEDVESRRSWVRGYIVRENCEQPSNFRCAGSLDTFLKEQ
FT                   GVVGLCGIDTRRLTRLLREHGVMNGAITDSLAEKDALLEAINAYSISGAVEAVTVEKPF
FT                   TEGSENGLRVALLDYGYKVNILRSLVARGCRVTVFPASASPADVLASRPDGIMLSNGPG
FT                   DPSACGKQIENLREIFRSGAPIFGICLGHQLMALAQGGRTEKLKYGHRGANHPVKDLAH
FT                   GRTYITSQNHGYAVVDGSIGAEVGAVSHVNLNDGTVEGVRYKNAPVFTVQFHPEASPGP
FT                   HDSAYLFDEFVALMKERNLQHA"
FT   gene            17480..20683
FT                   /locus_tag="Ethha_0017"
FT   CDS_pept        17480..20683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0017"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="KEGG: cth:Cthe_0949 carbamoyl phosphate synthase
FT                   large subunit; TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; Carbamoyl-phosphate synthetase large chain
FT                   oligomerisation; MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25608"
FT                   /db_xref="GOA:E6U5E1"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E1"
FT                   /inference="protein motif:TFAM:TIGR01369"
FT                   /protein_id="ADU25608.1"
FT                   /translation="MPKNPDIHKVLVIGSGPIVIGQAAEFDYAGTQACRALREEGIEVV
FT                   LVNSNPATIMTDKLMADKIYIEPLTPEVVERIIEIEKPDSILPTLGGQTGLNLAMQIAE
FT                   EGFLEKAGVKLLGTRPETIRKAEDRQAFKDTMEAIGEPCIASEVVESIEGAVAFSEKIG
FT                   YPVIIRPAYTLGGSGGGIAETKEELVDIATNGLRLSRIHQILVEKCIAGWKEIEYEVIR
FT                   DALGNVITVCNMENIDPVGIHTGDSIVVAPSQTLSDKDYQMLRSASLNIISALGVEGGC
FT                   NVQLALHPDSYEYAVIEVNPRVSRSSALASKATGYPIAKVAAKIAIGYTLDEIKNAVTG
FT                   KTYACFEPALDYCVVKFPKWPFDKFVYARRTLGTQMMATGEVMAIGNSFELAMMKAVRS
FT                   IELKLTTLSSPKLAEKTDGEIRELLHNQDDERIFVVYEAIKRGISADDIFAVTKIDRWF
FT                   LAKFAHLASVEQGLQDGALIEERYLEAKKCGFLDGDIERLSGQKIPQKRHAVYKMVDTC
FT                   AAEFAAETPYFYSTWDEENEAAQYLDEHKNGKKKVLVFGSGPIRIGQGIEFDYCSVHSV
FT                   WALRENGYEAVIVNNNPETVSTDFDTGDRLYFDPLTPEDVDNIIATEQPWGVVVQFGGQ
FT                   TAIKLANHLAARGVRILGTSADGVDEAEDRERFDAVLEKCGIPRPAGHTALTAEEALEA
FT                   ARALGYPVLLRPSYVLGGQNMIIAYADTDVTEYMGIITAHGIDNPVLIDKYLMGKEVEV
FT                   DAICDGEDILVPGIMEHIERAGVHSGDSISVYPAQTLSAAVRATVLDYTEKLAKALKVI
FT                   GMVNIQFVVYNETVYVIEVNPRSSRTVPYISKVTGVPMIDLATHCMLGQKLKDLGYGTG
FT                   LWPEGGYVAVKVPVFSFAKLHGVDTLLGPEMKSTGEVLGIAKTFDEALLKGLTAAGYRL
FT                   KGRHGNVLFTVKDSDKQEIIPLAEKFARLGYTLYATAGTALTLNSNMVAANTVRKLGEP
FT                   EPNIGTLLDSGKIDYVISTATTGRAPQLDDVRIRRKTVERSIPCLTSLDTASALLSCLE
FT                   MEKSMADVPLVDIAHLERR"
FT   gene            20724..21491
FT                   /locus_tag="Ethha_0018"
FT   CDS_pept        20724..21491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0018"
FT                   /product="Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulfur cluster binding domain"
FT                   /note="PFAM: Dihydroorotate dehydrogenase, electron
FT                   transfer subunit, iron-sulphur cluster binding domain;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Oxidoreductase FAD-binding domain protein; KEGG:
FT                   amt:Amet_4209 oxidoreductase FAD/NAD(P)-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25609"
FT                   /db_xref="GOA:E6U5E2"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E2"
FT                   /inference="protein motif:PFAM:PF10418"
FT                   /protein_id="ADU25609.1"
FT                   /translation="MTISALPCPVLSRENIAAGVYDVWLSAPQAEQAKPGQFVGVRCEG
FT                   FTLRRPVSICEIDRARGRLRLIFEERGEGTRWMTSVRVGETMDLLAPLGNGFNLGDAGR
FT                   AAVFVGGGIGVPPLLEAAKPFAGHADAILGFRSKPNVILKADFERFGAHVTVVTQDGTE
FT                   GETGVVTPPLEKRLDSAPCGVIFACGPRPMLAAVAGVAEARGIPCFVSMEARMACGVGA
FT                   CLSCAIPVKVGNEVQNWHVCKNGPVFDAARIVW"
FT   gene            21509..22432
FT                   /locus_tag="Ethha_0019"
FT   CDS_pept        21509..22432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0019"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="KEGG: cce:Ccel_0618 dihydroorotate dehydrogenase
FT                   family protein; TIGRFAM: dihydroorotate dehydrogenase
FT                   family protein; PFAM: dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25610"
FT                   /db_xref="GOA:E6U5E3"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E3"
FT                   /inference="protein motif:TFAM:TIGR01037"
FT                   /protein_id="ADU25610.1"
FT                   /translation="MDKQSSALAVTVAGVTFRNPVIAASGTFGFGREYAKVFDLSGLGG
FT                   IALKGMTLKSRSGNPSPRVAETPSGMLNCIGLQNPGVEYFLKNELPFLQKQGTRLISNI
FT                   AGDAPEDYAALAARLDGEPVDMLELNISCPNVKTGGMAFGVTCEGAAEVTRAVRAATKK
FT                   PLCVKLSPNVTDIASIAQAVEDAGADALSLINTLLGMRIDIRTRRPILSNNVGGLSGPA
FT                   VFPVALRCVWQVAKAVRIPVIGMGGIATWEDAVQMFLAGASAVQVGTATFTDPYAMLAI
FT                   RDGLADYLETEHIAHISELTGQIRPN"
FT   sig_peptide     21509..21580
FT                   /locus_tag="Ethha_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.931 at
FT                   residue 24"
FT   gene            22787..23452
FT                   /locus_tag="Ethha_0020"
FT   CDS_pept        22787..23452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0020"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: csc:Csac_1937
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25611"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E4"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADU25611.1"
FT                   /translation="MTRIYLIRHAEAEGNLRRIFQGHTDADISTNGQRQLERLSERFEP
FT                   VHLDALYASPLKRAYKTAQAVDAVRHLPIITLEGLMEINGGCWEGKPWAKLPALYPQDN
FT                   DAWENRPWDFAPAGGEPMRQVYARMWETLGGIARRHPGKTVGVASHGCAIRNYLCQAHG
FT                   WPIERLGEVGWCDNTAVSIIEYREGGQVTITMENDASHLDDELSTVAKQDWWRRSTRA"
FT   gene            23449..23880
FT                   /locus_tag="Ethha_0021"
FT   CDS_pept        23449..23880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0021"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="KEGG: bse:Bsel_2440 Holliday junction resolvase
FT                   YqgF; PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25612"
FT                   /db_xref="GOA:E6U5E5"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E5"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ADU25612.1"
FT                   /translation="MKVMAVDYGDARTGIALSDPSGFLASPVCVIHETDETQILAKTAE
FT                   QVARTGAERVVVGLPKNMNGTLGPRAEKAQAFAKALEAACGVPVLLFDERRTTLTAQVY
FT                   FNATNTRGKKRKNSIDAAAATIILQDYLDSVRNTPNGKA"
FT   gene            23867..25282
FT                   /locus_tag="Ethha_0022"
FT   CDS_pept        23867..25282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0022"
FT                   /product="RNA methylase, NOL1/NOP2/sun family"
FT                   /note="KEGG: hmo:HM1_1033 nol1/nop2/sun family putative RNA
FT                   methylase; TIGRFAM: RNA methylase, NOL1/NOP2/sun family;
FT                   PFAM: Fmu (Sun) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25613"
FT                   /db_xref="GOA:E6U5E6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR027391"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031340"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E6"
FT                   /inference="protein motif:TFAM:TIGR00446"
FT                   /protein_id="ADU25613.1"
FT                   /translation="MAKRKARPPVPQAVPPAAFLARMRGLLGEADFAAFEAAQTAPVRR
FT                   GLRLNLLKCRDASAFARIAGFSLSPLPFSPEGFSVEGGDVSGRHPWHHAGVFYLQEPSA
FT                   MSAVTALDPRPGQRVLDLCAAPGGKSTQIAARLGGQGLLVANEIVPGRAKILLSNLERF
FT                   GVRNACVYNETPERLCAAFPGFFDAVLVDAPCSGEGMFRREPAAAAEWTPETPAACARR
FT                   QRAILDWAKTALRPGGVLVYSTCTFAPEENECVVAAFLKENPDFSMEPIPCAFGRPARP
FT                   DWGGGEPSLELARRIFPQDGGEGHFVARLRMGAGAAAGTARFHAQENGDGMDDAQADVL
FT                   LRAFFAEQFGEPPYGRPHAAGEVLFLLPEELPALPQGLRLLRAGVCAGRIKSGRFEPTH
FT                   ALYLAAAPGACRRAVDLPLGDARLAAFLHGEQIEADGAAGYIAVLAAGHAVGFGKASGG
FT                   VLKNHYPRALRTL"
FT   gene            25375..26592
FT                   /locus_tag="Ethha_0023"
FT   CDS_pept        25375..26592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0023"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="KEGG: cbe:Cbei_2184 diguanylate phosphodiesterase;
FT                   PFAM: EAL domain protein; Metal-dependent hydrolase HDOD;
FT                   SMART: EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25614"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E7"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADU25614.1"
FT                   /translation="MDVFLATQPIFDAENRVFGYEILYRENETNTFSEETDADFASGNT
FT                   LVRCFMDFGLPTLTNNTRAFVNFTTEFIKNEVATLFPKDQLVVEILETVEITGEILDAC
FT                   RKLKAHGYLLAIDDFVYQPGYEKLLPLVDIIKVDFKQSGPAEQAEIIRKYGRPGLSFLA
FT                   EKVETQEEHDRALKQGYAYFQGYFYARPSINRAKKLTPYSQTRIRLINLLNEPEPDFRQ
FT                   IAGLVETDIAFSYEILRLVNSAYYSPAKPITSISFAISVLGIEELRKWLYIVFISGLQE
FT                   NQPGELVRTSLLRGKVMENLAEAAGRPHQKSTMMTIGMFSLLDVLLERPMAEAIEGLHF
FT                   PEEIKNALIGSGGEDFLHSCEEVAICYEHGVWQKATQQAGRIGITPQMLQTAYANAVKW
FT                   METFYL"
FT   gene            26717..27445
FT                   /locus_tag="Ethha_0024"
FT   CDS_pept        26717..27445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0024"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   cce:Ccel_0181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25615"
FT                   /db_xref="GOA:E6U5E8"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E8"
FT                   /inference="protein motif:PFAM:PF01709"
FT                   /protein_id="ADU25615.1"
FT                   /translation="MSGHSKWKNIMHKKEKSDAQRAKIFTKIGREIAVVVKQGGADPNS
FT                   NSKLYDLIVKAKANNVPNDNIDRIIKKAAGGQEKDDYEDIVYEGYGPCGVAVVVQTLTD
FT                   NRNRTAGDLRHYFDKFGGNLGQTGCVGWMFQEKGVIVLEKASVNEDKLMEDCLEAGAVD
FT                   FNSDEEVFEVFTDPSELPGVRGALSQKGYEFLSAQEERIPANYVRIDGEDDRKKMENLL
FT                   DALEDDDDVQNVWHNWENDE"
FT   gene            complement(27542..28165)
FT                   /locus_tag="Ethha_0025"
FT   CDS_pept        complement(27542..28165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmt:Tmath_0367 Putitive phosphate transport
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25616"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E9"
FT                   /inference="similar to AA sequence:KEGG:Tmath_0367"
FT                   /protein_id="ADU25616.1"
FT                   /translation="MDARNILDRLFPVKYHFYEMIDRQANINELAVETLARWLDSGSEA
FT                   DSDALLGHVKESDTARRLLEKSLIEAFATPFDRVDIYSLSSAMDKVIQYTKSTLLSMRA
FT                   YGVKPNDTITRMVGKLKDGTAIFYRSAKDLEGNPSKSEEDFSKMRDTHIAIEQLYQDGM
FT                   TIVFKSNDPMHALRQREVYHHIKDASANLEDAVDVLHRIVVRLT"
FT   gene            complement(28186..29226)
FT                   /locus_tag="Ethha_0026"
FT   CDS_pept        complement(28186..29226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0026"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: dar:Daro_0679
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25617"
FT                   /db_xref="GOA:E6U5F0"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F0"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADU25617.1"
FT                   /translation="MIAVHVSLILFLVFAIGLVFALTNGLHDASSVVATFIVCDAATPK
FT                   QAIGLASAFGLLGAVFGGSQVASTISKVIDLPANTALLPVLLAAILGAAAWNLITWRLG
FT                   LPSSSTHALVGGIIGAVLVSSGYRHVLWGWNELTGASHQLTGIAEIVAALLFSPLLGFA
FT                   LAFVLEKVMNLLLRNARFSINTRIRRIQWAIAACLAFSHGANDTQKIIGLFTLALAAGG
FT                   GTVISTAPLWVRICGGTVMFIGTMLGGWSIMKTVGRGIYNIRPIHSLNSQLASVGSILL
FT                   ATAFGAPVSTTHVVVGSVMGVGAADEYRMVHWAIVKDIIVAWVITIPLSAAVSASIYAL
FT                   FAFIFK"
FT   sig_peptide     complement(29161..29226)
FT                   /locus_tag="Ethha_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.689 at
FT                   residue 22"
FT   gene            complement(29624..30268)
FT                   /locus_tag="Ethha_0027"
FT   CDS_pept        complement(29624..30268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0027"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   cbe:Cbei_1289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25618"
FT                   /db_xref="GOA:E6U5F1"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F1"
FT                   /inference="protein motif:PFAM:PF02677"
FT                   /protein_id="ADU25618.1"
FT                   /translation="MQKPNYQKQMDQTLDALARAHQTPRLLLHSCCAPCSSYVLEYLAS
FT                   HFEITVFYENPNIAPKEEYEKRLAEQKRLIAALPVPHPVGFLESHYAPERFLEAARGLE
FT                   NEPEGGARCAVCFRLRLEATARAAKAGGFDYFTTTLSVSPHKNAQALAEIGEACARRWG
FT                   VPYLAADFKKRGGYLRSIRLSETYGLYRQNFCGCVFSKRQSGTAAAPPQKA"
FT   gene            complement(30281..31084)
FT                   /locus_tag="Ethha_0028"
FT   CDS_pept        complement(30281..31084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0028"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="KEGG: dae:Dtox_1670 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25619"
FT                   /db_xref="GOA:E6U5F2"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F2"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ADU25619.1"
FT                   /translation="MRHALTIAGSDPSGGAGIQADLKTFAAFGVYGMSAITAATVQNTC
FT                   GVREAQALKPGLVAAQIGCLFEDIRVDAVKIGMTADADVISAIAGELRKHPGVPVVLDP
FT                   VMVSTSGHALLDPAAVHALTRQLLPLAALITPNLPETTVLTGREVRTVEDMRTAAVDLI
FT                   ALGARAVVVKGGHLDGDAVDVFFDGRDFLLLPQPRVATRNTHGTGCTFSSAVAAALANG
FT                   KPLPDAVRVAKTYISEAIAHAETLGHGHGPVNHFYAATFGSADLL"
FT   gene            31311..31940
FT                   /locus_tag="Ethha_0029"
FT   CDS_pept        31311..31940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0029"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cbe:Cbei_0259
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25620"
FT                   /db_xref="GOA:E6U5F3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU25620.1"
FT                   /translation="MNNGKPVRVPRQTRSLATKGKLLAAAKELFCEVGYYKTTANAIAR
FT                   KAGTAVGSFYAYFPDKEAVFAELMERLCQRLRTVLEQCAKQLRQPDFDPKVWIAQMARQ
FT                   SVEVYVSEPKFSPQIAVLYYNREPRVTAMMQREQSFIQQMIRSYFALAGDSLSIRDPEV
FT                   SAVVVQKILIQLPEKVLYDWENIGQEEIINATIDLLQRYLTNYHKS"
FT   gene            complement(31969..32649)
FT                   /locus_tag="Ethha_0030"
FT   CDS_pept        complement(31969..32649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0030"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   har:HEAR0371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25621"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F4"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ADU25621.1"
FT                   /translation="MAQIPYTLVRSTRKTVAIQIRQDGEVIVRAPQRMPAAAIESFLCE
FT                   KQRWVESARKRMRERAAQRACAAAEPGGTLWYLGRPYPVAAREDADLPDPPVWDGNAFY
FT                   LPSRDPARAAAAFFTARAEERLLARAAFFAKQAGLSYPSLTVGSARSRWGSCGKDNRLR
FT                   FSWRLLCAPPPAVDYVVAHELAHIRHHDHSPAFWREVARVWPEWETGADALRLFERQVD
FT                   LRAL"
FT   gene            32825..34078
FT                   /locus_tag="Ethha_0031"
FT   CDS_pept        32825..34078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0031"
FT                   /product="hydrogenase large subunit domain protein"
FT                   /note="PFAM: hydrogenase large subunit domain protein;
FT                   KEGG: dhd:Dhaf_0813 hydrogenase large subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25622"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F5"
FT                   /inference="protein motif:PFAM:PF02906"
FT                   /protein_id="ADU25622.1"
FT                   /translation="MEEYQEMSRRLQKATAEGRLQDEIDAIRASGSEKEKQQLDMLLHP
FT                   ENYPPVVRLEDCMCSTDHQAACEVSCLFEAIGRDRDGKLVITGDCVGCGQCVERCEQKA
FT                   LAGRKDLIPLLKLLRERSTPVYAMIAPAFSGQFTAEVTSGRLRTAFKRLGFYGMIEVAL
FT                   FADILTLKEALEFDQTIQSDEDFMLTSCCCPMWVALIKKGFSELIPHVPPSVSPMVACG
FT                   RTIKKIHPEAKTVFIGPCIAKKAEARQPDVADAVDFVLTFDEVGQMFADAELDLPNLPE
FT                   DMSDHSSTAGRIYARTGGVSQAVQATLDRLRPDHKIPLRAIQADGIVACKQLLADLKDG
FT                   KIKANFMEGMGCKGGCVGGPKSLLPKEEATGHVNAYGEQAGYATPADNPYVLEILRRLG
FT                   FDTIESLLERDNTFIREF"
FT   gene            34655..35740
FT                   /locus_tag="Ethha_0032"
FT   CDS_pept        34655..35740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0032"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="TIGRFAM: phosphoserine aminotransferase; KEGG:
FT                   cpy:Cphy_3383 phosphoserine aminotransferase; PFAM:
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25623"
FT                   /db_xref="GOA:E6U5F6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F6"
FT                   /inference="protein motif:TFAM:TIGR01364"
FT                   /protein_id="ADU25623.1"
FT                   /translation="MNSRVYNFSAGPSMLPEPVLSRAASEMLNYQGSGQSVMEMSHRSK
FT                   VFDGIIVRCEELLRKVLGIPSNYKVLFLQGGASSQFAMIPLNLMNGSGKADYILTGQWA
FT                   TKAQKEAARYGDARVVASSKDKTFTYIPKTTAADFDPEADYAYICMNNTIYGTKYAELP
FT                   DTGKVPLVADVSSCILSEPLDVSKFGLVFAGAQKNMGPAGLTVVIVREDLIGHARDITP
FT                   TMFNYQTHADNRSLFNTPPCYAIYICMLVLEWLEELGGLEEMAKINRKKAGILYDFLDN
FT                   SKLFRGTVEKEYRSLMNVPFVTGSDELDKKAVKEAEAEGFINIKGHRTVGGLRASIYNA
FT                   MPLEGVEKLVDFLGRFEKANS"
FT   gene            35770..36933
FT                   /locus_tag="Ethha_0033"
FT   CDS_pept        35770..36933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0033"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; amino acid-binding ACT domain protein;
FT                   KEGG: cth:Cthe_3035 D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25624"
FT                   /db_xref="GOA:E6U5F7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F7"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADU25624.1"
FT                   /translation="MYQIKTINKISPSGLTRFAPGEFQYGDEIENPDAFIVRSASLHEV
FT                   ELPASLKAIARAGAGVNNIPVDKCSEEGIVVFNTPGANANGVKELLIAALILSSRNVLD
FT                   AVAWAKTLKGQGADVPKLVEKGKKQFVGPEIAGKKLGVIGLGAIGVKVANAAHALGMEV
FT                   YGYDPYLSVEAAWGISQGIHHAASLNVIYEQCDYITIHVPLTPETRGTFNAESIAAMKK
FT                   GVRLFNLARGELAVPADIVEALKSGQVASYVVDFPCDELLDVPGVIPIPHLGASTPESE
FT                   DNCAAMAADELIALLKTGAIRNSINFPNVDMPLSSPARVTVIHKNVPNMLSQITACFAN
FT                   AGINIDNIIDKSKKEMAYTIIDAADKKLDAVADALRAVDGVIRVRVI"
FT   gene            complement(37037..37225)
FT                   /locus_tag="Ethha_0034"
FT   CDS_pept        complement(37037..37225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: clj:CLJU_c06140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25625"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F8"
FT                   /inference="similar to AA sequence:KEGG:CLJU_c06140"
FT                   /protein_id="ADU25625.1"
FT                   /translation="MTQHSMSNVTKGIIAGVVAGAAVGMIAGWPMDRRKRNNVRKNANR
FT                   ALHAMGELVQNAQYMMR"
FT   gene            complement(37451..38722)
FT                   /locus_tag="Ethha_0035"
FT   CDS_pept        complement(37451..38722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_4521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25626"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F9"
FT                   /inference="similar to AA sequence:KEGG:Amet_4521"
FT                   /protein_id="ADU25626.1"
FT                   /translation="MVRSIGVCKTRCIKVARKRYQFDPSGRRHKRGGSNPLMTALIVVA
FT                   VAALVFIGWNIYVPLQRVLKGDAGKTVESAASHVSSASHAASKPSSSSGSTSSAAATAM
FT                   RGIYLPGGTLTTATISQTLQAAKSAGVTTAIAELKSDDGVLHYASKISEVQNNGIVASG
FT                   ALDGAAIAQAITQSGMTPAARISCFKDPLAPTVMRDAAVKYAGNHSTNWLDESGNRWLN
FT                   PYSATTVQYLTDLAAEAASMGFKQIYLDNVQFPSGAQNHVWYGDNLPSKESALQSFVAA
FT                   VTQKVHTTGGTVTLVLPANAAVGSGQASLGQDQDPFGYGADTVSPLLTPVSLDGLTVGG
FT                   TALPNPISDFGAAVSAAAQGLKTLNASKYGDMVPFIQAGTVSGSGTVTADTVNAEVSAL
FT                   KAAGIDHFVFYATGGYNLTGVAAK"
FT   gene            39105..39713
FT                   /locus_tag="Ethha_0036"
FT   CDS_pept        39105..39713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0085 negative regulator of genetic
FT                   competence"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25627"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G0"
FT                   /inference="similar to AA sequence:KEGG:Cthe_0085"
FT                   /protein_id="ADU25627.1"
FT                   /translation="MNIEKLSPDKLRVTLESAELDRYDLDYISISNESPGTQRMLKDIL
FT                   LAAFSSVGFSTKGSRLFIEVLPGKNEGCVLYLTKVEETHSGAGGDAPAPRRAKTSHGGY
FT                   LLACHTLEDLIGAVGRFTEYPDIPLHRSALYSLNGEYHLAFSPVRFGLDHARMRALLAE
FT                   LSEYGQAEEATPLREAVLAEHGSTIQQDRAVEQFIRYFQ"
FT   gene            complement(39771..40415)
FT                   /locus_tag="Ethha_0037"
FT   CDS_pept        complement(39771..40415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0037"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="TIGRFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   dau:Daud_1586 ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25628"
FT                   /db_xref="GOA:E6U5G1"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G1"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ADU25628.1"
FT                   /translation="MVKIAPSILSADFSCLGEELQKIEAAGADLVHIDVMDGHFVPNLT
FT                   FGPPVVRALRGCTPLPFDVHLMMDDPGSLLGAFLDAGADSVTLHIEACKQPQALLNRLH
FT                   EAGVGAALSVKPGTPAETVFPFLDQLSMVLVMTVEPGFGGQKLIPETLRKAAAIRQECA
FT                   RRGLALDIEVDGGINAQTAVNAVQSGANVLVAGSAVFGAADMAAAIRTLRA"
FT   gene            complement(40800..41912)
FT                   /locus_tag="Ethha_0038"
FT   CDS_pept        complement(40800..41912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0038"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: dat:HRM2_04090
FT                   putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25629"
FT                   /db_xref="GOA:E6U5G2"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G2"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU25629.1"
FT                   /translation="MEMRTTQKTGIKTSLLGFGCMRLPQKDGAIDYAETERMLDAAYDA
FT                   GVNYFDTAYVYHGGKSEGVMGSILKKHPRASFYVADKMPVWLPKTRDDLERIFNEQLER
FT                   LGLEYIDFYLMHSMTVNNWSAVKRLDMLRFAEEKRAQGKIRYIGFSFHDTPELFREILD
FT                   AYDWDFAQIQYNYLDEKGQRAGELCDMLEQRGLFTVVMEPVRGGDLAALPEVAAGPLRQ
FT                   TTPGRSLASWALRFVGSRPGVNVILSGMSDPEQVRDNLRTCSPFDPLDERERSALAQTV
FT                   AELERIPHIACTGCRYCMPCPAGVDIPGNFDFYNGFQRFGPNPGRVRRWGMLDKKYDAC
FT                   IACGACLSKCPQHLAIPEELKRLAEVAAAL"
FT   gene            42155..43606
FT                   /locus_tag="Ethha_0039"
FT   CDS_pept        42155..43606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0039"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: rmr:Rmar_1306
FT                   L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25630"
FT                   /db_xref="GOA:E6U5G3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G3"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADU25630.1"
FT                   /translation="MNRSVKEVYDVLIVGSGAAGLHAALSLDAGFSVLVLSKDAADVCN
FT                   SAYAQGGVAAVLNPQEDNEELHFQDTMIAGGHRNDPAAVRVLVHEGPASVLELRELGVA
FT                   FDTGRDGALDLTLEGGHSRRRIAHHEDQTGAEIVRGLLAALAGRPNISLAADTVLTRLE
FT                   KDAGGFHALIEQGGAFATVNARFCILATGGIGRVFRYTTNSPVATGDGIVFAEKLGARI
FT                   KGMNLVQFHPTALARGPEERFLISESVRGEGAKLLNSRGERFMQRYDGRGELAPRDVVS
FT                   RCIMEEARRTGSNEFYLDITAEPADFVRGRFPAIYRKCMEYGIDMTKDRIPVYPCQHYL
FT                   MGGIDVDLNARTTVDGLYAVGECSHTGVHGANRLASNSLLEALVFSRRAAADILAAGHA
FT                   PAEVRPLTPAQGKPAPVELRETIQGMVQESFFVTANLEKARENLPRVEAIARQMEDGYA
FT                   DSRGLTELRSLAGVAALILKEVLSA"
FT   gene            43603..44439
FT                   /locus_tag="Ethha_0040"
FT   CDS_pept        43603..44439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0040"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   KEGG: cth:Cthe_2354 nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating]; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25631"
FT                   /db_xref="GOA:E6U5G4"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G4"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ADU25631.1"
FT                   /translation="MILPMHYDEVILRGLKEDINYIDVTTDNLIPEEQQSGAVFLAKED
FT                   GVLCGLDVALRTLRLLDAGVTAEVLRKDGDMLQKGEIIARVHGNTRALLKGERTALNLL
FT                   QHLSGIATATARAVQTVEGTCASVCDTRKTLPGLRVLEKYAVTVGGGKNHRFNLSDAAL
FT                   IKDNHVDAAGGIGKAVATLRARVGHTVKIEVETRDLKELADALAAGADIIMLDNMSLED
FT                   MREAVRVTAGRVPLEASGGVTQETLRGIAETGVNLISIGALTHSVKALDISMKLRD"
FT   gene            44817..47363
FT                   /locus_tag="Ethha_0041"
FT   CDS_pept        44817..47363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0041"
FT                   /product="peptidase C1A papain"
FT                   /note="KEGG: mac:MA1513 hypothetical protein; PFAM:
FT                   peptidase C1A papain; SMART: peptidase C1A papain"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25632"
FT                   /db_xref="GOA:E6U5G5"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR040528"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G5"
FT                   /inference="protein motif:PFAM:PF00112"
FT                   /protein_id="ADU25632.1"
FT                   /translation="MKNRLVKVVGVVCAVGFFAVFDCGLALEAAASAVSTASLSSVAIQ
FT                   EDGPQSVSGGSYAASRYTVPHAGASAVRLYGASNIPSSYDLRAQNKVTSVKNQGSEGDC
FT                   WAYAAMGSLESTLKPAEDDTFSESALESNSGFDLGVNAGGNDQMSTAYLARWSGPVNQS
FT                   GTSGVQKHVQNVDWLPGRSGYGDTTADNAIKQELLAGTAVTASLYYGSGYYTSGTSSYY
FT                   YNGSSVPNHEIDVVGWDDNYPAANFAGSSAGTPAHNGAFLCQNSWGTGWGANGYFYVSY
FT                   DDTAFGRDGCAAFNDAESTGNYSEVYQYDPLGFTASTPGSSGVQWMANVFKAEDSNSLT
FT                   AVSFYTLSPSMGYQIYVIPQYTSSLSSDTRTLVASGTESSAGYHTVSFSSSVALTQGSS
FT                   FAVEVRFTTSGASIPLEMPISGYSSKATASSGQSYISYDGNGWADTTQAFGLSNINVCL
FT                   KAFTKAPASGSSSSGSSSSGSSSSSGSSGSSSLGGASSLGSSVKPNPSLPAKIAVDSPS
FT                   DSMQYGNVTVSGWALSGWGITRIDMYLDLGTPWQKGGYSTKAVNSRPDVQAVMDPQNQY
FT                   PNSATSGYSLTIPAGDLTVGRHTVYVAAIANDGSVDWAVRGFWVGPSAAGNLDSPADTV
FT                   NCGDVTVSGWALNHAGMNRVDVYVDLGTAQQKFYSTLVNIPRPDVKTIIDPYGHYIGST
FT                   TSGYSLTIPAEDLTAGRHTVNVAAIGNDGTVQWFVRGFTVGPDAAGNLDSPSNSMQYGN
FT                   VTVSGWALNHAGIQRVDVYVDLYTAQQQFYSTSAHLSRPDVRAVVDPCGRYIGSTNSGF
FT                   SLTIPASALTAGRHTVNVAAIGNDGTVQWFVGSFNH"
FT   gene            complement(47445..48044)
FT                   /locus_tag="Ethha_0042"
FT   CDS_pept        complement(47445..48044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_1735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25633"
FT                   /db_xref="InterPro:IPR025374"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G6"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_1735"
FT                   /protein_id="ADU25633.1"
FT                   /translation="MENGAFGGGVDPGGLRDADDVKILICYLLKNLKQPLPLQTLAEAL
FT                   QQDGLVNYFTLADALHALLLSGHVDQVEQDGEKAYKATRLGAGTADMFERRLPLSVREK
FT                   AVRAGVRLLARQKRDAENKVEITPSGAGFAVRCTVLDGEDTLLSISLLVPDRAQAEAVR
FT                   QQFLHDPATVYRGAVALMTGDIDAVGGMLPRKPPVE"
FT   gene            48389..49996
FT                   /locus_tag="Ethha_0043"
FT   CDS_pept        48389..49996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0043"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: GGDEF domain containing protein; PAS fold domain
FT                   protein; KEGG: dhd:Dhaf_2264 diguanylate cyclase and metal
FT                   dependent phosphohydrolase; SMART: GGDEF domain containing
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25634"
FT                   /db_xref="GOA:E6U5G7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADU25634.1"
FT                   /translation="MNVLSLISFFNCIGFSCFAICIAKSEATGGERRSGTLINISAAVW
FT                   AFAYTFFYSAADQHAAWFWLKVGALGWCTLPCFSTYYYVQLSEADKHLGKGWRNLLFFL
FT                   FPAVLTLSNLLSTKTSVAYALVESDSGWGWTYVNSPDSIRLWVYIAYLLFYFGVGFYLV
FT                   FRWGKRKKLIYFKRQANLIVYIFGLIVVLGLFSDLVLPLFSHFFPPPAVLFLIVVLYGD
FT                   WVITARLNFLAVSDQIKSRLMLETITDAVLAVNRRGGIIRANRAASDLFGIPAQTLIGR
FT                   CIRTFLADPLVLSKNLQNLVDKHTRKDMDIKIRNVDGRVIPTVVSASIAENSAHGFLGV
FT                   VLSFHDISRQKEMENALRDGQERYKSLASDYYHLANYDVLTGLANRRHFFEQVGRLQFE
FT                   SGLSSAGIALIFMDLNGFKKINDQYGHAIGDQLLVEASKRLRACRGEKDILARMGGDEF
FT                   VLLLVDADIHGAGERIGQIRMQFQKPIVLGAVEHMVGIAAGFSVCLKKRLEKDDISFLL
FT                   READEAMYKDKQMQKHSG"
FT   misc_binding    50181..50314
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 112.18"
FT   gene            50401..50979
FT                   /locus_tag="Ethha_0044"
FT   CDS_pept        50401..50979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: esi:Exig_2318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25635"
FT                   /db_xref="GOA:E6U5G8"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G8"
FT                   /inference="similar to AA sequence:KEGG:Exig_2318"
FT                   /protein_id="ADU25635.1"
FT                   /translation="MYTRQQKTLRMIILGLLAAISIVLYYYEVPFFSNYLKLDFSDLPA
FT                   AVAAILFGPLAGIVVELIKNLIFFLTRDIGVTMGYGSLINFIVGTALVVPLSLVVRAWI
FT                   HRGHKWLTAILLGGIAGLASMVAVGVVANYLIAPPFFLHVLHIPLGGTALWAAIGSATI
FT                   LNLVKPVLTAAVLIPVMAAVQKNTHALKV"
FT   gene            51152..51961
FT                   /locus_tag="Ethha_0045"
FT   CDS_pept        51152..51961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0045"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: ote:Oter_2169 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25636"
FT                   /db_xref="GOA:E6U5G9"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G9"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADU25636.1"
FT                   /translation="MPTAALGCDTVFEHHQAAIEAATKELSTWDEVLGVIIYGSVAHGF
FT                   ALENSDVDIKIVCTDDFFTAKEHMGNVSYFDRDATPYEGGYVDGEFITPMHIERIAADG
FT                   SESARFDFQDAIVTFDRQGGLEDLVRGAARYPVEQKRRKMVRFYAQFSAWKAHYYEALR
FT                   RDNHYLAHLSALQFALYAGRLFLAYNETLFPGHKWFLQVLSGVPQKPAGLMRCLNTLVD
FT                   QKRAEDVERLYNMVSDFACWPHDSSQDRQFLWDVRMGRIEDFPFAAD"
FT   gene            complement(52027..53271)
FT                   /locus_tag="Ethha_0046"
FT   CDS_pept        complement(52027..53271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0046"
FT                   /product="small GTP-binding protein"
FT                   /note="KEGG: tpd:Teth39_0245 small GTP-binding protein;
FT                   TIGRFAM: small GTP-binding protein; PFAM: GTP-binding
FT                   protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25637"
FT                   /db_xref="GOA:E6U5H0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H0"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ADU25637.1"
FT                   /translation="MDTTPIANRTHIAFFGRRNAGKSSLLNAIAGQPVAVTSDVPGTTT
FT                   DPVHKTMEILPLGPVLLTDTAGLDDTGELGGLRVEKAYEELRRTDLAVLVADAADGVGN
FT                   FETAFIGELRKRRVPFVVVLNKCDTHAVSTDELDALKAAAAAPTAAVSAKTGEGVPALR
FT                   ELLARTVLPDTEELGLTSGLVGEGQTAVLVTPIDKAAPKGRLILPQQQTIRDILERDAI
FT                   AVVTKEQELRYTLENLRQKPAAVITDSQAFLKVSADTPADIPLTSFSILFARQKGDLAA
FT                   LTKGVRRIASLKPGERVLIAEGCTHHRQSDDIGKVKIPRWIRRLVGGDVQFDWTSGLDF
FT                   PRNMEQYAVVVHCGGCMLTRREMQYRIHYAQAHGVDVTNYGMLIAYVQGILERALGPFP
FT                   AAALAFAKQDPETAS"
FT   gene            complement(53306..53782)
FT                   /locus_tag="Ethha_0047"
FT   CDS_pept        complement(53306..53782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0047"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   str:Sterm_1331 cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25638"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H1"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADU25638.1"
FT                   /translation="MEKIVIANREHTPARHEEHGAYTFDKHLIVPKRAENRCTVAIMEV
FT                   PPHKAAFPYHYHMNITEVFYIISGCGRLETPDGEKTVAAGDVLVFPCGESGAHRLWNTS
FT                   DTEPLVYLDCDTTAAADVAFYPHSGKAGLLLEGQPGTFFPLSGAVNYYQNDPDA"
FT   gene            complement(53813..55195)
FT                   /locus_tag="Ethha_0048"
FT   CDS_pept        complement(53813..55195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0048"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; Fumarase C-like; KEGG:
FT                   tpd:Teth39_0244 aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25639"
FT                   /db_xref="GOA:E6U5H2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H2"
FT                   /inference="protein motif:PFAM:PF00206"
FT                   /protein_id="ADU25639.1"
FT                   /translation="MRTERDLLGSYQIDDDAYYGVHSARARENFPLSGRRLHPELVKAL
FT                   AMVKQAAARANRDAGLLPPEKAEAIEKACAEIAAGGFSDQFITDALQGGAGTSANMNAN
FT                   EVIANRAIELLGGKKGDYTLVHPIDDVNRSQSTNDVFPTAVRVAAIRMLKPVSEGFARL
FT                   QTALQEKEEAFSCVLKIGRTELQDAVPITLGQEFGAWAQAVARDRWRLYKVEERLRQVN
FT                   LGGTAVGTGLNAPRAYVFAAAEHLRELTGLGLARAEDPIDPTQNCDVFAEVSGLLKAAA
FT                   VNLAKIAGDLRLLSSGPRAGFGEIHLPAMQAGSSIMPGKVNPVIPEAVTQAAYQIMADD
FT                   LAVTLAAQAGNLELNAFLPLIAKNLLEMLDLMRQAVFIFTKKCVAGIEPDRARCAALAE
FT                   QSPSLAAALIDHIGYDAASRIAKDCLHTGKTVRQALLEDGRFTPEEIDRLLDPIAMTSG
FT                   RG"
FT   gene            complement(55192..56262)
FT                   /locus_tag="Ethha_0049"
FT   CDS_pept        complement(55192..56262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0049"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: ere:EUBREC_0234 biotin synthase; PFAM: Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25640"
FT                   /db_xref="GOA:E6U5H3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H3"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU25640.1"
FT                   /translation="MLHAAECTDIVRHGDKPALAALIAKARLAGETERAALFNAADAAR
FT                   RPYYGKNVYFRGLIEFTSYCKNDCYYCGIRAGNRNARHYRLTAEEIWACAAKGYALGFR
FT                   TFVLQGGEDPWYTDARICEIVSGLKERHADCAVTLSIGEKSFESYKRYYDAGADRFLLR
FT                   HETANDAHYRLLHPPELSLAHRKQCLYDLRAIGYQVGAGFMVESPGQTDETLAEDFLFL
FT                   RELQPHMVGIGPFVPHHDTRYAGLPTPTADFTLVLLSLLRLMLPKVLLPATTALGTVDP
FT                   LGREKGLRAGANVVMPNLSPVTHRKDYMLYDNKICTGEEAAECLQCLSRRIASAGFIPD
FT                   FGRGDHADRVEKAARA"
FT   gene            56509..57843
FT                   /locus_tag="Ethha_0050"
FT   CDS_pept        56509..57843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0050"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: DHHA2 domain protein; CBS domain containing
FT                   protein; KEGG: mta:Moth_2414 putative manganese-dependent
FT                   inorganic pyrophosphatase; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25641"
FT                   /db_xref="GOA:E6U5H4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H4"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADU25641.1"
FT                   /translation="MSQTVYVTGHRNPDTDSICSSLSYAALKRALGMNAVAARLGKVNR
FT                   ETAFILSHFEVDPPELLASVRGQVEDITLEEIKPLSPSTALQTALEALYAEKSGPLPVA
FT                   DADGRLAGLVSAGDIAALALTYLSGGEADGTAAGLRQKFQGLPVSDAMRTSGYDVLHPA
FT                   DYISDARATLEADSAGRVPVVDETGSYLGFCTLALLETYRRKQVILVDHSERTQTVDGL
FT                   DEADLLEIIDHHRIGDIQTPGPIYFRNEPVGCSATIVTKLYDENGVVPEPKIAGLLCSA
FT                   ILSDTVKFKSPTCTPVDKATALRLADIAGIDIDGYAKQMFEAGASLEGMSPDEIIHNDY
FT                   KEYIISGKKLGISQVTMATLSSFAGYREPVLFRSAEMLEQEGYAAVMVIVTAILDEQTE
FT                   VLFKETEPGLVALAFGDTKDDCSFLMEGVVSRKKQIVPRLTRALS"
FT   gene            58571..59740
FT                   /locus_tag="Ethha_0051"
FT   CDS_pept        58571..59740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0051"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   brm:Bmur_1385 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25642"
FT                   /db_xref="GOA:E6U5H5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H5"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADU25642.1"
FT                   /translation="MARFTLPRDIYFGNNAIEELSNLKGHKKAFVVTGGHSMQKFGFLD
FT                   KLEDVLKKAGLEVQLFAGVEPDPSVETVYKGAEAMRAFQPDVIVAIGGGSPIDAAKAMW
FT                   VFYEYPEKKFDDIKDPFSLPKLRQKAIFVAVPSTSGTATEVTAFSVITDYSTKVKYPLA
FT                   DFEITPDVAVLDYALAQTMPPKLTAHTGMDALTHAIEAYVAVARSPFSDPLAIKAIQWV
FT                   FDNLSDSYNGNKKARERMHVAQCLAGMAFSNALLGICHSLAHKIGAQFDLPHGLCNAIL
FT                   LPYVIKYNSVVSMKDYADIARSLGLPGGTDKQLTHSLIEAVKTLNARVGILPTLRENGV
FT                   TDELFNAHIDFIAEQAQLDPCTGANPRGTTPGELKKVLECALDGSPLNF"
FT   gene            60145..61866
FT                   /locus_tag="Ethha_0052"
FT   CDS_pept        60145..61866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0052"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: cce:Ccel_2300 putative PAS/PAC sensor protein;
FT                   PFAM: Fe-S cluster domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25643"
FT                   /db_xref="GOA:E6U5H6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H6"
FT                   /inference="protein motif:PFAM:PF04060"
FT                   /protein_id="ADU25643.1"
FT                   /translation="MNTIMGLSRADCRGCYKCIRACPVKSLSCLDEQVRVVDGECIYCG
FT                   RCLLICPQNAKYIRDDLEKVRSAIAAGEKLYASVEPSCQAAFPGVDMGKMASALSALGF
FT                   VHAEPVTVGAAQVTRAYDAASVSWKAPNLITTACPSIYLLVQRHYPELVEQLAPTVSFA
FT                   VAHARIIRQIYGPRARVVSIGPCISQKHDAQDGESGNALYASLTFSELAAWFASAGIDP
FT                   REMKRKPMGTVAYDYFARPGGVIHHLAKETRRKWECVAVDGVDRCAEVLESVRRDGLSG
FT                   YFLELTACAGGCLGGPILRMMNVPYLTAKDALVHGPRQETPGPRLLTQGVEADLSRSFR
FT                   KLAPRRSPIREEEIASVLARMGKTSVKQELNCGCCGYSTCREKAVAVIHGKADISMCVP
FT                   YMRELAESMSATVVENIPTGVLILNEKLQVEHINPAAVALLHVRGEICGRSVGALLPSN
FT                   DFYQVLSTGENILHHKVRYEKPGIVVSQSVVRVQSARTVIVLLEDITHKELESEKHRVM
FT                   TEETAQFAREVVEKQMRVVQQIAGLLGETAMETKLALSKLTNTLVEQAGEEHDASH"
FT   gene            61850..62515
FT                   /locus_tag="Ethha_0053"
FT   CDS_pept        61850..62515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cce:Ccel_2299 protein serine/threonine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25644"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H7"
FT                   /inference="similar to AA sequence:KEGG:Ccel_2299"
FT                   /protein_id="ADU25644.1"
FT                   /translation="MTQAIDACAQSIARFGESQIGDAAKLFYGQDCVTAVLVDGGETMS
FT                   GCVLSGMVTSMFGSALSHPVAVDEAVATVAGMLPVSGGREPVLLTVAQMRADGAAYLAR
FT                   LAMPQAVFLRRGRVLPLVFTPRRCGPVVLEEARLQLKSRDTLVCFGHGVARAGEGVPYA
FT                   AGWENVLLPAYLQAAYTPSVPAGKLVELLLGISCSLCGEKPRSDLSAAVLRYRAVREG"
FT   gene            62518..64056
FT                   /locus_tag="Ethha_0054"
FT   CDS_pept        62518..64056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0054"
FT                   /product="transposase IS605 OrfB"
FT                   /note="PFAM: transposase IS605 OrfB; KEGG: cce:Ccel_2298
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25645"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H8"
FT                   /inference="protein motif:PFAM:PF07282"
FT                   /protein_id="ADU25645.1"
FT                   /translation="MPCYKTLSLEIREPGRRKRELMDTALLSYTRALEQLLRQCREPVQ
FT                   ALARGGRRVTRAQVQALADKDMLRALNVYGVQPFKDSLKQDFATILLSFAARWQKSGGQ
FT                   AGYPCVRLEPEEADARIRALTDAYDAGMLSAAEMRGRLAVVLAHSGRVHPLYFGRYAAA
FT                   RDYCLLYDPGTGRFFAKLHLLNAKSRLPPAPFGRELRVVAPGLPSAQATDGPRRFIVVP
FT                   LSFGKAQQEVLRQALDHPQILRTARLVRHGDAYRLVLSVEVSCNACVVPQATMGVARAA
FT                   AALACTVCGRDGAVQGNAMLSARGGQMLFCLAKEITARALEARAQVVLEANGGRGDGFL
FT                   LRDGGRFQPEVFPAGQYMRLEHILRYKLVEAGLPPPVCVSGSGLNITCPRCGAVTRKNR
FT                   LSPQMFACVACGYAAPFPFVGSRNLAVRLQKYAGNKVPVYVREENGMRHYFNDALGFSC
FT                   TVPAEDGETVVFYELSLMAKGRQEDWCEGKKYAMLCKLRAAEDIRNAVRWVPVK"
FT   gene            64609..64827
FT                   /locus_tag="Ethha_0055"
FT   CDS_pept        64609..64827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0055"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: dhd:Dhaf_0513 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25646"
FT                   /db_xref="GOA:E6U5H9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU25646.1"
FT                   /translation="MYKRIRDLREDKSLSQTRMAEILHCSQRVYSNYERGEVDIPTGIL
FT                   IRLADFHQTSTDYLLGRTSVSKPYPKG"
FT   gene            complement(65205..66371)
FT                   /locus_tag="Ethha_0056"
FT   CDS_pept        complement(65205..66371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0056"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   tjr:TherJR_2632 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25647"
FT                   /db_xref="GOA:E6U5I0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I0"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU25647.1"
FT                   /translation="MNFSQAMRMAWLSVFSNKMRSFLTMLGIIIGVLAVTMLVSIGQGA
FT                   TAQITGQIQGLGANLLTAAVTGQKPVYISLNDVENLQDTGGLSLVAPLVSTQYVAKSGT
FT                   RTINTSIEGTTPGYDAIRDLSVQSGRFLIQADVDNRSSVAVIGTDVADTLFGGRNVVGQ
FT                   TVQVAGRSFDIVGVLTHKGSSAMGSNDNRIIIPVTTAQRMLHQTQILQVFATAKDGDSV
FT                   QQGVQTLETFMYHKTKDTSAYTIFSQSDLLSTLNTITGTLTAMLGALAGISLLVGGIGI
FT                   MNIMLVSVTERTREIGIRKAIGAGRGSILVQFLIESMLISLTGGVIGLVLGGVGTAIVG
FT                   KVMDVPMSVTPGVAILALAFAVSVGVIFGLYPANKASKMRPIDALRYE"
FT   sig_peptide     complement(66228..66371)
FT                   /locus_tag="Ethha_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.849) with cleavage site probability 0.687 at
FT                   residue 48"
FT   gene            complement(66368..67054)
FT                   /locus_tag="Ethha_0057"
FT   CDS_pept        complement(66368..67054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0057"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tit:Thit_0218 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25648"
FT                   /db_xref="GOA:E6U5I1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU25648.1"
FT                   /translation="MIELKNVKKVYKMGDNEVAALGGVSISIADGEFTAIIGPSGSGKS
FT                   TLMNILGCLDTPDEGDYFLDGTDMTKVSEKNLSRIRSRKIGFIFQQFNLLQKLTALENV
FT                   ELPMIYQGVPAKERRRRAMESLERVGLGERIHHKPKELSGGQQQRVAIARAFAAKPSII
FT                   LADEPTGNLDSKSGAEVMTILHQLHESGNTIVLITHDSKVAAEATRRVRIADGLITSDD
FT                   RNGGAA"
FT   gene            complement(67051..68019)
FT                   /locus_tag="Ethha_0058"
FT   CDS_pept        complement(67051..68019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0058"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: gct:GC56T3_2852 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25649"
FT                   /db_xref="GOA:E6U5I2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I2"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ADU25649.1"
FT                   /translation="MKKQNIHRLRIAAILLACAAMAAALGGCGIRKASTSTQTRTAKVT
FT                   RGAISVTVHGTGTIQPTSVQAVSSTVTGKVTQIFKQNGDPVNDGDNIAEVTATGTGATT
FT                   DITAPMDGVVALSQLTVGTPVQPGMTVCQVQSAASFNAVVNVDELDIAGVKAGQKADVS
FT                   VDAISGKLFSGTVQKISQVGVATNGVTDFSVTLSMDDSTGLMSNMSASADIHTGENQNA
FT                   LLVPVEALQTKGADRYLTVRTTSGKTTKDTQVKVSVGLISDTQAEITSGVNEGDTVVLP
FT                   SLAPTNGTSINGLNRNSSDSSSSSGAAASGASSTASGGKAS"
FT   sig_peptide     complement(67918..68019)
FT                   /locus_tag="Ethha_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.512 at
FT                   residue 34"
FT   gene            68376..68870
FT                   /locus_tag="Ethha_0059"
FT   CDS_pept        68376..68870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_4477 molybdenum ABC transporter,
FT                   periplasmic molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25650"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I3"
FT                   /inference="similar to AA sequence:KEGG:Mext_4477"
FT                   /protein_id="ADU25650.1"
FT                   /translation="MRTARIGLLFALLAAWMLAATGCVSIHREKQVTVFADTSLKPVLD
FT                   ATAAELQKEDGLTLHIRYDGTAALQAAVDAGARTDLLALGGVSASPRGSYTFGSNAVRA
FT                   LMSAHKVDNYVNIAVGADGSAYSVTKPLSSKNYAAAQMVVDFLLSKKGVHLLEQSGFVM
FT                   E"
FT   sig_peptide     68376..68444
FT                   /locus_tag="Ethha_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.982 at
FT                   residue 23"
FT   gene            complement(68860..69834)
FT                   /locus_tag="Ethha_0060"
FT   CDS_pept        complement(68860..69834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0060"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="KEGG: ere:EUBREC_0699 putative lipid kinase; PFAM:
FT                   diacylglycerol kinase catalytic region; SMART:
FT                   diacylglycerol kinase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25651"
FT                   /db_xref="GOA:E6U5I4"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I4"
FT                   /inference="protein motif:PFAM:PF00781"
FT                   /protein_id="ADU25651.1"
FT                   /translation="MLSERTGKNILFILNPNAGKQHIGRKSDELVTLFEESGCRVDART
FT                   TTRPGDAAELAEQLASAYDLVVCCGGDGTLHEVVNGMLRASAQVPLGYLPTGTTNDMAR
FT                   TLRLPGDVRKAAGVVLQGHTAAQDLGLFNGTQYFSYIASFGAFTSIPYSTPQWLKNLLG
FT                   YPAYLLQVLRCLPEMHPYALEMETNDGLHAKGRFLFGSVSNARSVSGIFRFKPEDVSLD
FT                   DGLFELMLIRHPENPLEFFRIAHNLIRRKADDHFVIFRHVRTVSFRFETETSWTVDGEY
FT                   GGTTRSVEIRTLHRALPFISGRPQRIRARRSRFSHSRSPHLTP"
FT   gene            70201..71709
FT                   /locus_tag="Ethha_0061"
FT   CDS_pept        70201..71709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0061"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: ckr:CKR_2284 hypothetical protein; PFAM:
FT                   Radical SAM domain protein; cobalamin B12-binding domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25652"
FT                   /db_xref="GOA:E6U5I5"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025274"
FT                   /db_xref="InterPro:IPR034530"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I5"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU25652.1"
FT                   /translation="MNILLVYPEYPVTYWGFQYALRFVAKKAAFPPLGLLTVAAMIPDE
FT                   TYHKKLVDMNVQRLRDADLRWADLVLISAMVVQRTSVKEVIARCKRLGVKTAAGGPLFT
FT                   AEKDDYDDVDYLILGEGEITMPMFLADWEAGHAKHLYLPDRFPELSETPVPQWNLIHVK
FT                   KYASMNIQYSRGCPFDCEFCDITSLYGRTPRTKNAEQVVAEMQALYETGWSNGVFFVDD
FT                   NFIGNKKKLKEEILPAITEWMDAHGRPFQFITETSINIVDDEQLMNDMVRAGFHQVFIG
FT                   IETPDEASLAECHKNQNKNRDLLACIRKIQRFGLEVQAGFIVGFDSDTSTIFDRMVKFI
FT                   QASGITTAMVGLLNAPKGTKLYQRLVREGRMTEHFSGSNTDFSLNFVPKMDKNMLVQGY
FT                   QKIISTIYSPKYYYARVKDFLTGYAPGGKSSEKICSANVRAFLRSVVRLGIFGKERRYY
FT                   WNLLFWALRERPEMFPSAVRLSIYGFHFRKVFQLSLAKPQMQIS"
FT   gene            complement(71769..71936)
FT                   /pseudo
FT                   /locus_tag="Ethha_0062"
FT   gene            72091..72858
FT                   /locus_tag="Ethha_0063"
FT   CDS_pept        72091..72858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0063"
FT                   /product="protein of unknown function DUF88"
FT                   /note="KEGG: cpi:Cpin_0806 protein of unknown function
FT                   DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25653"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I6"
FT                   /inference="similar to AA sequence:KEGG:Cpin_0806"
FT                   /protein_id="ADU25653.1"
FT                   /translation="MEVQQDMRLAVLIDAENVPYSNVTGMLEEITRYGTPTVKRIYGDW
FT                   TTQNMSGWKNVLVPNAIVPVQQYCYTSGKNSSDSAMIIDAMDILYAGKIDGFCLVSSDS
FT                   DFTRLATRLRESGKKVYGFGEKKTPDAFIAACDKFIYLEIIASAEQDTDTTGTPGDNAP
FT                   KRREISKVDRQVIQLIANSVSDLANEDGWAFLGEVGSLILKKKPDFDSRNYGFSKLSLL
FT                   VESTKRFELDIRERGHKGHNVYIRNREKSKGGN"
FT   gene            73223..76324
FT                   /locus_tag="Ethha_0064"
FT   CDS_pept        73223..76324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0064"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   slp:Slip_1139 diguanylate cyclase/phosphodiesterase with
FT                   GAF sensor; SMART: EAL domain protein; GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25654"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADU25654.1"
FT                   /translation="MQGPILLGTVFLAAGGAALACALFTVQGNYKPKINREFLAEAGSL
FT                   VIWNFGRALFGAGADVGVRSIGAHFSAVGYTLSFFFLLRCLLLLTGRQDLFHKSYIRVL
FT                   LYLPFLVLLCGFVALPLFHPSGITWFYSRWGWIEISKPGLWDFFFCGYYGVFLAVSGRL
FT                   LLRWVRSSSVMRRRAGWLMGSFIFAAVGGMTDILLPLLQVPCPRMAAVCWVLPVLVTGH
FT                   SVRRFHLTQDLEDGGMILTDKARHVIYRLFACYLISGGLVNALLQKIFCIEKEIALAYL
FT                   FSAVLVLIGMILLFLGGFRKTRIPQEFLLAVMAALLIPVILLCFYADGGITVWAFVFPL
FT                   IVIGLLFNKRVLLVTAVVCASQAQLFLWGICPHAGATVNMTDYITRVILIVATSSVCLS
FT                   ANGIYLNRLRENAMHSAGQLLVSEISRSFLAANEETIEEKIRDMLRKTGAFIQCDQAYI
FT                   ALLNKADRQARFSCEWLAEGAAPARKQLDENIQKLCRVMQTPSNNGHPVIFLDLEDILP
FT                   EAECLRYSPGGTGAHRLVCLPIQKKEETVGLLLFAGVNSAQLWKSFVFLSIISNIVADT
FT                   ANRLDGMRKIRMMAYHDQLTGLPNRVLFKKQLKQAIADARREETILGIVFIDLDSFKVI
FT                   NDTLGHEAGDRLLKAVAGIFLGQVWGGDIVCRFGGDEFVFLFEQVPHIDVLLRRLETIL
FT                   DALRRPVRVDDQEICIMGSAGVAVFPRDGDTAGTLIKNADMAMYHAKGMGKNRYALCSS
FT                   EMKDEMARQGEMINLLYRAQEKEQLFLCYQPQVDLKTRRVVGVEALMRWDLPGQGIITP
FT                   GAFIPLAEQTGLIQPIGEWALLTACRQAARWREMELPPLRMAVNISVQQLASPHFSQRV
FT                   ADILQKTGLPPRYLELEVTESVAYRDIADFPMRLNQLKKLGVSISIDDFGTGYSSFGRI
FT                   KLLPVDRIKLDIQFVRGIEISAYDRAVADAVIEMAKGLKMKVIAEGMETTAQLEFLSRR
FT                   MCDEVQGYYYFKPMPAAKIEKLLRENCPVRPAMPEPLNNGVGME"
FT   gene            76321..79395
FT                   /locus_tag="Ethha_0065"
FT   CDS_pept        76321..79395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0065"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; GAF domain
FT                   protein; KEGG: slp:Slip_1139 diguanylate
FT                   cyclase/phosphodiesterase with GAF sensor; SMART: EAL
FT                   domain protein; GGDEF domain containing protein; GAF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25655"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADU25655.1"
FT                   /translation="MTAVDWINVCLLTVCGFAFAGGLYATHGEYRPLLHKLMMLASAAL
FT                   VLGAFGLVLLAAAHTDQIRDSGCRLVCIGWTLTSAVTFHCVLLLTGRTVLFRNWRGYAL
FT                   LYLPAAVVVAADTFRACGMAAGSTRFLVVPVPMPAGTVWSVVSALYSISVAAIGAALLL
FT                   QWARHRTGQGKSASFRALTGTAAVADALFAGFTVRSAFCNLCVPVPTVFFGLLLVLALS
FT                   GLTHRCHAVQMRRKGHNDVILSQASRSHMYLCVSLVLIGEGFLTILGRNFYYRQAPVVS
FT                   VAMCSANLILLGLILAVVNRLRLNESLKEMLMSVIFSFGIPATALWFVYFQCYATWAYI
FT                   FPVMIISMLFNRRILLGTVMVESILTQLLLWVAFPQLSMWVEGPDYVVRLTVMGLSVIL
FT                   VFYVSHVYISRLYKNIYDTQAQALMAELSQEFISAEEYNLDQKLYAALQRCGRFIQCDR
FT                   AFLVLVDARTRTFRHSCEWMEEGHPSLIHGFEAIWKDIPKEVLRTLEGGMHVEMADVPR
FT                   LPQTAARLRTTLLSWGVRSYAVLPIQRNKRPIGALAFSAGRPLRRWNLRSGAFLEIIAA
FT                   VLSDAIVKVEREKEAGFLAYHDQLTRLPNRTLFKKKLDRAIRLAGQVGEMVGIVFLDLD
FT                   SFKAVNDTMGHDLGDRLLSKVARQIQNAVREVDTVSRFGGDEFVLLLDHISDVQDVLQM
FT                   AENILNDIQQPVAVNQQELFVTASMGIALFPQDGREPEALIQNADDAMYHAKSMGKNRC
FT                   VLCSQMIKDHVLKKMELTNLLYHAQEKGQLELYYQPQFDMAAQAIVGVEALLRWRLPEK
FT                   GMVEPAQFIPLAEQSGMIYSIGEWVLETACQQNKVWQDSGLPRMRVMVNLSANQLTSPK
FT                   LVQCVVRVLKKTRLPPEYLELEITETAASTNLPLVLDTLRRLKAMGVSLAIDDFGSAQS
FT                   LLSRLKMLPVDRIKIDAQFVQGIEKSDKDQTVLKAMVRLIRSLGLRVVAEGVETPRQFD
FT                   FLAGVMCDEVQVFFCCRPMEAAAIQAVLSEYAGLR"
FT   gene            79690..80523
FT                   /locus_tag="Ethha_0066"
FT   CDS_pept        79690..80523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0066"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; KEGG: cbe:Cbei_2610
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; PFAM:
FT                   Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25656"
FT                   /db_xref="GOA:E6U5I9"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I9"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ADU25656.1"
FT                   /translation="MSRTVTTQSFLDAKQNRRKIAMLTAYDYAMAKIVDGSGIDAVLVG
FT                   DSLGMVVQGHDSTLEVTMDDMAYHCACVARGLQHALLVCDMPFLSCHVGLEEAVRNAGR
FT                   LVQQSKADAVKLEGGIGMADTVKAIVRAQIPVMGHIGLTPQSVRLIGGYKVQGKDEAKA
FT                   RGLIEDALALEDAGVFSIVLEAVPEGLAKIITEKVSVPTIGIGAGRYCDGQVLVVHDLL
FT                   GMYDAFVPKFVKQYAHLGGLIAEAVSAYARDVREGRFPEQKHTFSAGESFLEKLY"
FT   gene            80548..81423
FT                   /locus_tag="Ethha_0067"
FT   CDS_pept        80548..81423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0067"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /note="KEGG: hmo:HM1_0668 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25657"
FT                   /db_xref="GOA:E6U5J0"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J0"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ADU25657.1"
FT                   /translation="MSLIGTAREWDAFCTRHNRKNETLGFVPTLGCLHEGHLSLIRKAK
FT                   EQNDLVAVSVFVNPTQFGPGEDYEAYPRDIERDHRLATEAGADVVFHPAAEEIYPRGAS
FT                   TEVEVKGPLTQKLCGASRPIHFKGVATVVSILFHIIGPDRAYFGQKDAQQVAVLKKMVR
FT                   DLHIPVELVVCPIVREADGLAKSSRNRYLSPAERQQAAALYRGLQQARGYLASVAGGCA
FT                   DAAWLKEMIRAEIQAQPLAEVEYVEILDSDTLDDIHTVGPEKNALAAVAVRFGKTRLID
FT                   NMILTPEIGR"
FT   gene            81439..82014
FT                   /locus_tag="Ethha_0068"
FT   CDS_pept        81439..82014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0068"
FT                   /product="HymD protein"
FT                   /note="KEGG: cpo:COPRO5265_0171 HymD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25658"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J1"
FT                   /inference="similar to AA sequence:KEGG:COPRO5265_0171"
FT                   /protein_id="ADU25658.1"
FT                   /translation="MPEMKKKRNSIFWVAQAGLLIALLVVVQLLTFLMPKSVPLIGQLF
FT                   TGTLVNLVLIVGAGSVGFAGTAAAAVLSPVLAFAFGQMVFPPMIPVVAIGNLVIVAVTW
FT                   AVFVHETRRPPKNSSVFRMAGIVCGAAAKTAFLWLATVLLVVPVLFGGKPAVAQVLSLM
FT                   FSWPQLVTAMVGGALALVVLRFIQGYQE"
FT   gene            82249..82689
FT                   /locus_tag="Ethha_0069"
FT   CDS_pept        82249..82689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_1264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25659"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J2"
FT                   /inference="similar to AA sequence:KEGG:Clos_1264"
FT                   /protein_id="ADU25659.1"
FT                   /translation="MDPCRLPMQTAAMANSLYHSLQGQYFVGYADNMFFEKDKNAWAAL
FT                   VNPNNSGINLFVNVWTVSDLYEPPIRLQFWINSTLPGDPIESRLVAPSNTALYPLPTPR
FT                   VRLLQASNVIGFPAGGIKGFVRRTVPGETVAEEEDGKFIVPL"
FT   gene            complement(83105..83521)
FT                   /locus_tag="Ethha_0070"
FT   CDS_pept        complement(83105..83521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0070"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   clj:CLJU_c31730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25660"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J3"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADU25660.1"
FT                   /translation="MTPLEYFLQKAADNGISVYELSLENIQSMIADLKDMDPAICLSSS
FT                   GIFSSQEAAESMAHELGHFFTGTYYDSPYCANNRGKMEHQANIWMVKELLPVASIRKAL
FT                   KDGCREYWEIAEYCNCTEHLLETAIQIYRQKGLL"
FT   gene            complement(83508..83930)
FT                   /locus_tag="Ethha_0071"
FT   CDS_pept        complement(83508..83930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0071"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="manually curated; PFAM: helix-turn-helix domain
FT                   protein; KEGG: efa:EF2852 Cro/CI family transcriptional
FT                   regulator; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25661"
FT                   /db_xref="GOA:E6U5J4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU25661.1"
FT                   /translation="MSKASDCAKRIKLLAKNTGISVNKLLIDCKISKSLIYDMEKRSAM
FT                   PSADKLLKIADYFKVSVDYLLSGEDTPKAPPARDPEEAEIDSQITGIKYALSSLDRDAI
FT                   GDLTMGEKKDVLKFINFLKSQRPDAKKKEGESGDAP"
FT   gene            84084..84263
FT                   /locus_tag="Ethha_0072"
FT   CDS_pept        84084..84263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25662"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU25662.1"
FT                   /translation="MQIAKTRARGTPTKPVTVRYELGVYDSIKKYADENSMSIALATES
FT                   LVIKGLKRASRQAS"
FT   gene            84280..84624
FT                   /locus_tag="Ethha_0073"
FT   CDS_pept        84280..84624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppe:PEPE_1019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25663"
FT                   /db_xref="InterPro:IPR011741"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J6"
FT                   /inference="similar to AA sequence:KEGG:PEPE_1019"
FT                   /protein_id="ADU25663.1"
FT                   /translation="MDKQEEQAVIGRVIAHLNEKTGAHYRADAAANKRHVLARLADGFS
FT                   EQDLLDVIDGMSATWADSDFARYLRPETLFRSQGKTESYLQEARRRQKKKAAPAASPGR
FT                   FRSADDLLEG"
FT   gene            84626..85459
FT                   /locus_tag="Ethha_0074"
FT   CDS_pept        84626..85459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0074"
FT                   /product="IstB ATP binding domain-containing protein"
FT                   /note="KEGG: amt:Amet_2601 IstB ATP binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25664"
FT                   /db_xref="GOA:E6U5J7"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J7"
FT                   /inference="similar to AA sequence:KEGG:Amet_2601"
FT                   /protein_id="ADU25664.1"
FT                   /translation="MEQAMKTGLESWFQPLPDKQCPFCGHMLRQLTHTVASGETYLLGI
FT                   YETCTCAAAQSEQAAAMAAKAEAERKRVEDTRASTVHALMAASGIRGRYASRTLQTYAV
FT                   PPGDERALKVALNYVLKFEEQREKGMGLYLYGTCGVGKTHLAYGVAHALIEQLHSVICR
FT                   SATDILLELRGQMDGTANGTEYETMLRYLTCDLLVIDDLGKQQVTDWSMAQLSTIFDGR
FT                   CQDMLPVIVTTNYSDAELIERLALRSDKKTAASIVSRLHEMTYDVPMSGQDYRSR"
FT   gene            85554..87506
FT                   /locus_tag="Ethha_0075"
FT   CDS_pept        85554..87506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0075"
FT                   /product="Transposase-like Mu"
FT                   /note="PFAM: Transposase-like Mu ; Integrase catalytic
FT                   region; KEGG: dae:Dtox_4214 transposase-like Mu"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25665"
FT                   /db_xref="GOA:E6U5J8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009004"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J8"
FT                   /inference="protein motif:PFAM:PF09299"
FT                   /protein_id="ADU25665.1"
FT                   /translation="MLTVAQVAQVKGCTERYVRTMIAKGKLEHVLDDDPRNHMRQYLVP
FT                   VAALPEKLQAKYYGRVAPTKTAAIAAPQEPPKPLDAYSEEERREIELWIGIVQEWKTYR
FT                   IGRDRKAADGAFVAQMRQRHPELSISTDVLYRRWKAWRDQHYDGLIDRRGKWRKGRYAM
FT                   DETVWECFLSYWFDLRKYPMKQCIHYTQLWCEQEHPELLAGIPSYSAFYRRWKAEIPEA
FT                   LNVLGREGDKVFDDRCGPYLPRIYDDMASNDFWIADNHTFDIISEGENGTRHRLYLTAF
FT                   MDARSGIITGFHITDNPSSEATIYALRAGILQYGIPKYIYVDNGREFLTYDVGGLGHRR
FT                   KKKSADTFSPPPIFARLGITMINAQVRNARAKIIERRFLDFKNQISRLFMTFTGGNVLE
FT                   KPANLKHVLKAGHVPADHRLREVVGQLLEGYFNEQPYNGSVAADKGKNRKDVYYDHLEE
FT                   KRVASADDLTLMLMRSTRLQKVGRMGVHLTIGGFRIDYRDDAFCLRYQGEQVYVRYDPE
FT                   NISSVRVYDEQDRFIAVLQANSNIISGYVTSKEVAKESISKIKSAKKLARQEIKSRVLA
FT                   SMDQVDALDLVLGDAQRNIAARMENGEPDRSVLQIHRVSEEPLMPPRVVNGALPLDTML
FT                   KNAENAQRASQHKDI"
FT   gene            87522..88472
FT                   /locus_tag="Ethha_0076"
FT   CDS_pept        87522..88472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0076"
FT                   /product="putative ATPase, transposase-like protein"
FT                   /note="KEGG: dae:Dtox_4216 putative ATPase,
FT                   transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25666"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Y7"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4216"
FT                   /protein_id="ADU25666.1"
FT                   /translation="MAQTYDVKLQARVEELIKQCGSQAKASRILGWSDGVISQYRRSDY
FT                   ERGRVDEVEASLREYFRLQDEAAAQAQRAEPFQPVLDTYIPISVSEDIRKAIRFGQLKK
FT                   GITILHGDAGIGKTMAAEKYLRDNPNTAVLITVTPLTGTVGNVMKLICRALHIPEGRSK
FT                   LDMIIDLKERLYNTDKVLIIDEAQHLQVRALDEIRPLSEPHIDGKKGIGIVLIGNSEIY
FT                   DRMEGRRQSCFAQLYSRKRLTRKYTTKQVTPEDIALLFPALEGKKRELNFLRGICQGRY
FT                   GIRGGVNVYNNAVDAENIGIDMLTLQAREMGIGLN"
FT   gene            88483..88674
FT                   /locus_tag="Ethha_0077"
FT   CDS_pept        88483..88674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0077"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tml:GSTUM_00006441001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25667"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Y8"
FT                   /inference="similar to AA sequence:KEGG:GSTUM_00006441001"
FT                   /protein_id="ADU25667.1"
FT                   /translation="MQLWYFSAAESAVFRNRLRQADTRELRMAKEALESYRTQGYHVAD
FT                   RYRAVKKELDKRMTYGRR"
FT   gene            88681..89157
FT                   /locus_tag="Ethha_0078"
FT   CDS_pept        88681..89157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA2988 phosphoribosylanthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25668"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Y9"
FT                   /inference="similar to AA sequence:KEGG:MA2988"
FT                   /protein_id="ADU25668.1"
FT                   /translation="MDFVSAVKEMWNCGSTCVSLPIGNERKIVIRPRPFPKMMEKAVFG
FT                   RDKRLSEVYQGASLTLNELLANDWEVFDPAEFALAGAAPAKMDKLLELPAALSGAKKIT
FT                   SVEAAVRKLSDEELYTAADVYEERVAQGKREKTRLRFVLEEIRHRERKRGQAHA"
FT   gene            89150..89458
FT                   /locus_tag="Ethha_0079"
FT   CDS_pept        89150..89458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kcr:Kcr_0525 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25669"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z0"
FT                   /inference="similar to AA sequence:KEGG:Kcr_0525"
FT                   /protein_id="ADU25669.1"
FT                   /translation="MRKTAWLLAGILLGGMAGAGGALAASDAGMTISAWAAELAVLVLV
FT                   LALGILLGYEFGRHKAYARGYRRGFEAGKNAPPDHPSCRHSFALYCEERPGRISNWN"
FT   sig_peptide     89150..89224
FT                   /locus_tag="Ethha_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 25"
FT   gene            89560..90000
FT                   /locus_tag="Ethha_0080"
FT   CDS_pept        89560..90000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lif:LinJ36.6870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25670"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z1"
FT                   /inference="similar to AA sequence:KEGG:LinJ36.6870"
FT                   /protein_id="ADU25670.1"
FT                   /translation="MELKDAIRQAMTDGSGCIARQIGVMKARYVLLTGGKLLRTESYGP
FT                   LGGLSPLVPWEPDIDDFNGTDWTPVPAAKVAGAPLAPAKPEERGPCTMQDARESVCRAI
FT                   CEMTARGVDLESDGRCASYLADALCKLAEAEANLNTIQKEAD"
FT   gene            90002..90274
FT                   /locus_tag="Ethha_0081"
FT   CDS_pept        90002..90274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0081"
FT                   /product="SpoVT/AbrB domain-containing protein"
FT                   /note="PFAM: SpoVT/AbrB domain-containing protein; KEGG:
FT                   cby:CLM_2558 transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25671"
FT                   /db_xref="GOA:E6U5Z2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z2"
FT                   /inference="protein motif:PFAM:PF04014"
FT                   /protein_id="ADU25671.1"
FT                   /translation="MTVSKRLGGKGGLTIPQAVRHAAGLAPGAPIDIEDAGDGILIRKH
FT                   VPSCIFCGGTTEVVTVAGKEICLACARELAALAAEKLEDFVHDGE"
FT   gene            90261..90926
FT                   /locus_tag="Ethha_0082"
FT   CDS_pept        90261..90926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_4388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25672"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z3"
FT                   /inference="similar to AA sequence:KEGG:Amet_4388"
FT                   /protein_id="ADU25672.1"
FT                   /translation="MMENEPLFSTEETVLRVGRLVALKAQESKIKAEIGDLQGYFERLG
FT                   IDALENTKEKTVAWWSAAGRVEVGTSEKVDILSETALKTLLQGVFGDLFKEQPVTYQPT
FT                   AACKQLLAAIAAGNYLEGSLDDIVARVADDDKTNKTLRKKLCGNFKRDKKALIDVAGLS
FT                   KTDAEEYAYMAAEIVAYTRFRQLLQAAGYTGTFEAARDIVKAAVVVEEGTKVTVEASK"
FT   gene            90957..91457
FT                   /locus_tag="Ethha_0083"
FT   CDS_pept        90957..91457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_4217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25673"
FT                   /db_xref="InterPro:IPR009363"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z4"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4217"
FT                   /protein_id="ADU25673.1"
FT                   /translation="MNITKQQIKSIYALGAGLHIVGRGHDDELHALVDGLTGKESITAL
FT                   DRDEAQRVIAELMRRMRGTPPVPPARKKPRHYEEAPGGITADQQRKVWALMYELKKFDV
FT                   KPVDAALGDRLCGIIRRQFGMDCTAKKPMQFLDQAAGGELIEFLKNYCYNAEKRHIREV
FT                   GGG"
FT   gene            91454..91777
FT                   /locus_tag="Ethha_0084"
FT   CDS_pept        91454..91777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0084"
FT                   /product="Mor transcription activator domain protein"
FT                   /note="PFAM: Mor transcription activator domain protein;
FT                   KEGG: amt:Amet_4373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25674"
FT                   /db_xref="GOA:E6U5Z5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z5"
FT                   /inference="protein motif:PFAM:PF08765"
FT                   /protein_id="ADU25674.1"
FT                   /translation="MNLERVTLEDLDGDQRELAELIGMEAYRALATHHGGTYVYVQAPN
FT                   SLLRKDRNEQIRRKFDGKNYKELALEYQISESTVRLIVEDDARRMRYGPISGQINLFDK
FT                   KMF"
FT   gene            91948..92286
FT                   /locus_tag="Ethha_0085"
FT   CDS_pept        91948..92286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_4223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25675"
FT                   /db_xref="GOA:E6U5Z6"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z6"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4223"
FT                   /protein_id="ADU25675.1"
FT                   /translation="MNASNWLNAIPPLILSVLVGIIGFFLKRTIGLVDRHETEISAIKD
FT                   QYVTKEEMDCLQDDLKSGLGKLSEGIDALKDNYMRKDDFVRAIADVNRRQDRIFDVLLE
FT                   MKGDKNRG"
FT   gene            92279..92605
FT                   /locus_tag="Ethha_0086"
FT   CDS_pept        92279..92605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_4224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25676"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z7"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4224"
FT                   /protein_id="ADU25676.1"
FT                   /translation="MDKKELERRIEGGAFAANNGRLLRTINILSGRDIKMRSLQYALPD
FT                   VSKGELAESLYYLQEAGYLHARHAAYGADVDVAEADQDDTEVRLTAKGIQLLKGYAADP
FT                   AVSI"
FT   gene            92627..93199
FT                   /locus_tag="Ethha_0087"
FT   CDS_pept        92627..93199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_4225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25677"
FT                   /db_xref="InterPro:IPR021874"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z8"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4225"
FT                   /protein_id="ADU25677.1"
FT                   /translation="MANRAHGIIDGLNPALRSTVEQMLLSGKSTYADVIDYLARHDVAI
FT                   SAASVCRYAQRYNANAALLNVAQENFSRMMQEMDKYPDLDTTEAIIRLASQNVFAALAN
FT                   TNEDQWNNLDKDKLLDSALGLARAASYKKRTDAAVRAEADNGLDAVKSIVFQAMSKERP
FT                   DLYKQVAAFLSEKKKDGSLRPKKEKAP"
FT   gene            93196..93690
FT                   /locus_tag="Ethha_0088"
FT   CDS_pept        93196..93690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0088"
FT                   /product="NGN domain-containing protein"
FT                   /note="PFAM: NGN domain-containing protein; KEGG:
FT                   dae:Dtox_4226 NusG antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25678"
FT                   /db_xref="GOA:E6U5Z9"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z9"
FT                   /inference="protein motif:PFAM:PF02357"
FT                   /protein_id="ADU25678.1"
FT                   /translation="MSMYVLQVLSGAEKDVCAALLDQGIPAYTPEENRQIRSGGLWRAR
FT                   PYLLFRGYVFVVVRDVRASYYQIRRIPGVLRWLELHAGQATALTPGEEDRIRRMGGQLL
FT                   ESHVLQLADDLFEPVDGPLKEYADAGVRILYNRHLRRAYVFEPLSVMHNRCLRMSFTLI
FT                   K"
FT   gene            93922..95373
FT                   /locus_tag="Ethha_0089"
FT   CDS_pept        93922..95373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0089"
FT                   /product="phage uncharacterized protein"
FT                   /note="TIGRFAM: phage uncharacterized protein; KEGG:
FT                   cpy:Cphy_2971 phage uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25679"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="UniProtKB/TrEMBL:E6U600"
FT                   /inference="protein motif:TFAM:TIGR01630"
FT                   /protein_id="ADU25679.1"
FT                   /translation="MENKQDRSIRLLDEMVRLGKRTRRKRGTVTTAEIRRAQRDFFTFC
FT                   RVCAPEFYKPDRAYLVRLCAELQDFYNSDDELLVINLPPRHGKSRTAGLFAQWIFGGHP
FT                   SEKIMTGSYNERLSTQFAKSVRNGIAEQKTDPGMLVYSDIFPGVRIQRGDAAANLWALE
FT                   GQYASYLATSPTGTATGFGCGLLIIDDVIKNAYEANNAPLLDNLWHWFTDTMLSRVEEN
FT                   GKIIIIMTRWATKDLAGQAVKTFTEQGRPFRVLSMKALQDDGAMLCPEVLSRRSYENKT
FT                   RTMAREIAAANYQQEPIDIKGRLYSGFKTYAEIPAAGGHPLFDGIYSYTDTADEGSDYL
FT                   CSIIFGVYRHEAYVLDVYYTKEPMEVTEPEVGRRQKEHGVGMARIESNNGGKGFARAIK
FT                   QILENKLNWYSTSVRWFAQSKNKVARILTAAPWILEHVYYPVNWRDRWPAYYNAMAEYQ
FT                   REGKNAHDDAPDATTGMAETVQAIR"
FT   gene            95391..96818
FT                   /locus_tag="Ethha_0090"
FT   CDS_pept        95391..96818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spf:SpyM50506 putative minor capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25680"
FT                   /db_xref="UniProtKB/TrEMBL:E6U601"
FT                   /inference="similar to AA sequence:KEGG:SpyM50506"
FT                   /protein_id="ADU25680.1"
FT                   /translation="MFEKLLRWLRSMLSQMFAQGADADIVLSDKMTSAIAMWARMYEDG
FT                   GAWCNPKSGIHSLRLAAAIASEIARLVTIEMGVSVTGSARADFLQAQLAPFLDGLRRHV
FT                   EVGCALGGEVFKPYVDDGRVCIDAVQGDCFFPTTVDTSGRMLGAIFVAQIKRRDTIYTR
FT                   AEHHEFQSGTHTIENRAFASKSSYSFGTPIDLTAVPEWADIQPQVTIEHVDRPLFAYFR
FT                   IPRANKQDRQSPLGVSVYADAMETIRDADEQYGRMLWEYEGGQLAVEMEESLLKHGPNG
FT                   SVSSPRLEERLYRRRAGDIDAGNNFYQIFAPTLRDDAYARGLNTILKKIEYQSGLAYGT
FT                   LSDPIETDKTATEINASKQRSYSTVRDIQKALQSALDDLLYSMDALATLYNLAPAGSYT
FT                   AAYDWDDSIVNDPSQRKSMFWSYVMAGKYPMWRYLVEFEGYTEDEAREIADETQADFNN
FT                   PFGFTQPAAGGGGNADA"
FT   gene            96805..98472
FT                   /locus_tag="Ethha_0091"
FT   CDS_pept        96805..98472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0091"
FT                   /product="minor capsid 2 protein"
FT                   /note="PFAM: minor capsid 2 protein; KEGG: ere:EUBREC_1286
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25681"
FT                   /db_xref="GOA:E6U602"
FT                   /db_xref="InterPro:IPR009319"
FT                   /db_xref="UniProtKB/TrEMBL:E6U602"
FT                   /inference="protein motif:PFAM:PF06152"
FT                   /protein_id="ADU25681.1"
FT                   /translation="MLTPEWFDGAADDILELYGQLDESILQDFVRRIIKSGGILTQTAR
FT                   WQAQSLQDGGMLYEDIIRAVASMTSASTAQVRTLFEDGGVEALKYDFSIYEAAGLSPLP
FT                   LKQSPVAAQVLRAGMQKTAGHLRNLTMTTAAGTEQAYKNAARLAEMQVESGAFDYISAI
FT                   RNAVRTAAQSGTTVLYPSGHTDDLDVAVRRAVLTGMSQTAAQVSLRYADDMGCDLVETT
FT                   AHPGARWSHAIWQGRVFCRNGKRGKYPDFVSSTGYGSGDGLCGWNCRHSFFPYFEGLST
FT                   PAYPHTKLAEYAQKTVTYNGDTMTYYAATQKQRAMERAIRATKRELAGYYTGLQAEDEG
FT                   IRNAMREEYTKTSVKLKGQEARLADFTDKAGVDRQREREQSLGFGRGPAQQARQSAEKH
FT                   YRKWAQGIGADDAAPKTLAKYYQEKYNNSPAHELLAGYNKAVKRGDVSPLVGFEQYTRT
FT                   AKDADAQIVGVTTANGVKIESYTTHFIDRLIGQTSTPHTGMRTGVSIADAKDALVRPMQ
FT                   ISNPYAAEDGDLRQQFFGENASVVISLRDKKVIQTNPL"
FT   gene            98485..98706
FT                   /locus_tag="Ethha_0092"
FT   CDS_pept        98485..98706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aca:ACP_3325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25682"
FT                   /db_xref="UniProtKB/TrEMBL:E6U603"
FT                   /inference="similar to AA sequence:KEGG:ACP_3325"
FT                   /protein_id="ADU25682.1"
FT                   /translation="MLNYTENDRQFIEKNFENAAQLLASSSRREVLLTIENLIEQKGFA
FT                   PPHYYDYNDFGRKAQTVYDSIYQNNEKS"
FT   gene            98871..99410
FT                   /locus_tag="Ethha_0093"
FT   CDS_pept        98871..99410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0093"
FT                   /product="minor structural GP20 protein"
FT                   /note="PFAM: minor structural GP20 protein; KEGG:
FT                   lmh:LMHCC_2983 putative scaffolding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25683"
FT                   /db_xref="UniProtKB/TrEMBL:E6U604"
FT                   /inference="protein motif:PFAM:PF06810"
FT                   /protein_id="ADU25683.1"
FT                   /translation="MKREDITALGISDEAAVNKIMELHGADIEKQKNTIATLTTERDGL
FT                   KTQLGEANGKLAGYDPEWKAKSDAAQEAADGKVAALQYEFAANTAVNGMKFTSESAKKA
FT                   FLSDLVAKKLPLQDGKLLGYDDFTKSYKEMDPGAFASDAAAPKFSASTPGPAGGALTGN
FT                   DKANAALREAFGRVSQ"
FT   gene            99423..100598
FT                   /locus_tag="Ethha_0094"
FT   CDS_pept        99423..100598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0094"
FT                   /product="PEGA domain protein"
FT                   /note="PFAM: PEGA domain protein; KEGG: jde:Jden_2169 major
FT                   capsid protein HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25684"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:E6U605"
FT                   /inference="protein motif:PFAM:PF08308"
FT                   /protein_id="ADU25684.1"
FT                   /translation="MPIDRQAAEALIQDQIVNTIFEDVPKQSAVLSLMRKLPNMTSKQT
FT                   RIPVLDALPLAYWVNGDTGFKQTTRQAWDNVWLVAAELATIVPIPEAVLDDSSYDIMGE
FT                   VTPRVNEAMGAVIDGAIVFGVNRPSEWQNDIVTLARQAGNNVAASGGITYDNIMGQDGL
FT                   ISKVEESGYMVDGILASIKTRAGLRGIKDSNNRPIFVPEMQSGTTYTLDGTPITFQQNG
FT                   AFNATVAQMIAGAWSQAVYAMRQDVTVKILDQGVIQDPNSKEIIYNLAQQDMIALRVVM
FT                   RLGWALPNPATAVNSDRTNVPFAYIEAATPYTDYSVTFTVKDNDTDPIAGVRVNVNGAN
FT                   KKTAADGTAVFNLRAGTYPVTIKADDYATQSATVTVTNAPVPVAITLQAAQ"
FT   gene            100612..100983
FT                   /locus_tag="Ethha_0095"
FT   CDS_pept        100612..100983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lin:lin0111 protein gp8"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25685"
FT                   /db_xref="UniProtKB/TrEMBL:E6U606"
FT                   /inference="similar to AA sequence:KEGG:lin0111"
FT                   /protein_id="ADU25685.1"
FT                   /translation="MYADYAFYSGTYAGTAVSESDFPALARDASNFIDRITFGRLKTGT
FT                   PVTEDVQLATCAVIDRMHAARQSGALEVNVAVKTENNDGFSQTFAAPGDVRAELQADYT
FT                   DAAAAYLLYTGLMDRSVST"
FT   gene            100980..101402
FT                   /locus_tag="Ethha_0096"
FT   CDS_pept        100980..101402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0096"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25686"
FT                   /db_xref="UniProtKB/TrEMBL:E6U607"
FT                   /inference="similar to AA sequence:KEGG:CLK_1330"
FT                   /protein_id="ADU25686.1"
FT                   /translation="MTTNADITLYNQWYNRVTRLIEWKRVQIPGVSWHGGIVTDVTGNG
FT                   LQAANAYIVRIPLDAAPAGRTFACPEDWAATESDDLGALWTIQPGDILINGLLADDIAK
FT                   ASDLTAKYGSRCCTVIGWKDNRRGSAALQHWRIDGK"
FT   gene            101407..101820
FT                   /locus_tag="Ethha_0097"
FT   CDS_pept        101407..101820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ere:EUBREC_1294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25687"
FT                   /db_xref="InterPro:IPR021080"
FT                   /db_xref="UniProtKB/TrEMBL:E6U608"
FT                   /inference="similar to AA sequence:KEGG:EUBREC_1294"
FT                   /protein_id="ADU25687.1"
FT                   /translation="MSGQNKKLIVKTPRGEVVQVTTKSGKVTAKLTWNPDFGDRKTGDF
FT                   SRAQKFLDSEVLRTTTPFVPIKTGALIKSGQLGTVIGSGQVTWHAPYARYQYYSTSLSR
FT                   TYDAQRGGKWFERSKATNKPAWIAGVKKIAGGR"
FT   gene            101820..102245
FT                   /locus_tag="Ethha_0098"
FT   CDS_pept        101820..102245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0098"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25688"
FT                   /db_xref="UniProtKB/TrEMBL:E6U609"
FT                   /inference="similar to AA sequence:KEGG:CLK_1328"
FT                   /protein_id="ADU25688.1"
FT                   /translation="MSIINSLYEYFKSCPLLGDEKINVDYLPETAREYTIDTITGDPII
FT                   KRYARGATLRQYLFAFGSRDFYGPDVLQNLSNSGFYEDFAAWLDEQNKAKNFPVLPPNC
FT                   VPQKVEVQTSGYLFGADAETARYQIQCRVVYYQEGII"
FT   gene            102242..102745
FT                   /locus_tag="Ethha_0099"
FT   CDS_pept        102242..102745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpr:Vpar_0046 hemagluttinin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25689"
FT                   /db_xref="UniProtKB/TrEMBL:E6U610"
FT                   /inference="similar to AA sequence:KEGG:Vpar_0046"
FT                   /protein_id="ADU25689.1"
FT                   /translation="MKLSDLMQGKTPSPTYAGFATNDDFVLAVDTGTGSTQTADGDYAI
FT                   VEAGITKSEASADAETKDNQYIRTGKKTTKTGTQRKFSIEGDRCDGDAFQDFCLSNAIV
FT                   FGVGAAVERKYIYFNMLTGVGERGTVTIVVSDTQTGNAGDNATFKVDMTSTATPTDYTY
FT                   SSES"
FT   gene            102758..103114
FT                   /locus_tag="Ethha_0100"
FT   CDS_pept        102758..103114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbb:CLD_2456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25690"
FT                   /db_xref="UniProtKB/TrEMBL:E6U611"
FT                   /inference="similar to AA sequence:KEGG:CLD_2456"
FT                   /protein_id="ADU25690.1"
FT                   /translation="MEINGVTLDLDLDDMDKAEQVQKVIEGMQSKIEQVKETDDYVTGG
FT                   RKVCRIVNDCFNQIFGTGTSEKIFEGMKLTPHIDAFVALGDAIKEQKEQQNAHMQSVCH
FT                   KYSPNRTERRARKK"
FT   gene            103111..103710
FT                   /locus_tag="Ethha_0101"
FT   CDS_pept        103111..103710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0101"
FT                   /product="putative protein GP15"
FT                   /note="KEGG: cbb:CLD_2457 putative protein GP15"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25691"
FT                   /db_xref="InterPro:IPR009660"
FT                   /db_xref="UniProtKB/TrEMBL:E6U612"
FT                   /inference="similar to AA sequence:KEGG:CLD_2457"
FT                   /protein_id="ADU25691.1"
FT                   /translation="MNILLDILPEEIDGIPIRSDFRIMVQFELMMTDLTVPQDARIPLA
FT                   INLLYQQPVHDLKQAIDGLLRFYRCGAPLKQGGAGGGGKHERAYDFEQDAPDIYAAFMQ
FT                   TYGIDLNDVDMHWWKFHALMFALPEDCKFSRIMRYRTMDLSDFKGKERKFYADKQVQYR
FT                   LRPLGTEKLTAAAAEQVAKERVAKRFAEAERWAKSH"
FT   gene            104009..106339
FT                   /locus_tag="Ethha_0102"
FT   CDS_pept        104009..106339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0102"
FT                   /product="phage tape measure protein"
FT                   /note="TIGRFAM: phage tape measure protein; KEGG:
FT                   mcu:HMPREF0573_11227 TP901 family phage tail tape measure
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25692"
FT                   /db_xref="GOA:E6U613"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E6U613"
FT                   /inference="protein motif:TFAM:TIGR02675"
FT                   /protein_id="ADU25692.1"
FT                   /translation="MGFDGSINIDSSIDGTGFSKGIEKLGGVAKASLGAITGLISGAAT
FT                   ALGGAAAEGIKYNNQMEQYQTSFAVMLGSAAKAQEMINNLQNFSMKTPFQMANLADATK
FT                   TLMGYGISVQDIMPDLEMLGDVSQGNSQKLQNLALVFGQVQAAGKLQGQDLLQLIDNGF
FT                   NPLQTISQQTGKSMAELRTEMENGQISAQDVTNAFKSATSAGGLFYNDLEEQSKTFNGQ
FT                   LSTLKDHVLIFLGSITGALTNSLKDTALPMVNGWLEQLQSAFNAGGVNGVVGAFGNVLS
FT                   QAVNAVAAQAPQLISLAVMLTTTLLNGLNANAGQLASSGASVVTGLAKGIISVAQSLGA
FT                   VGINLIQNIIEGITSSLPSIAVSAVQVATRIVEALLNALPSVVTAAWALTAGVAQGLTS
FT                   ALPTLIMTIVQIIPQIINAIAVQMPALMAALTAMIPQVINALSTALVTGIPLILQAAIQ
FT                   LLMAIVQAIPQIIVAVVTALPTLIQSIVTTLVQALPILITGAVQLLMAIVQAIPQILPP
FT                   LIAAIPQIITTLITGLVQALPELINGAVQLLMAIIDAIPIIIQTLIPMIPEIVHAIVDA
FT                   LIRAMPVLIEGSIELFFAILKAIPMIVVELIKDMPQIIQAILQGLAAGGGELKNAGGDL
FT                   IRGLWQGIQDVSGWLWNKVSGFFGTLTDKIKNFFGIHSPSRLMRDEIGKMLPPGIALGF
FT                   EASMPDAISDMQAEMDAMTAKMQASVAAQQSAVFVGTSGTGAQTIDNSVTKSPIINING
FT                   PVNVTDQGNQRQTLQQLQFLAAI"
FT   gene            106352..106897
FT                   /locus_tag="Ethha_0103"
FT   CDS_pept        106352..106897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rcp:RCAP_rcc00108 ferrichrome ABC transporter
FT                   periplasmic ferrichrome-binding protein FhuD"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25693"
FT                   /db_xref="UniProtKB/TrEMBL:E6U614"
FT                   /inference="similar to AA sequence:KEGG:RCAP_rcc00108"
FT                   /protein_id="ADU25693.1"
FT                   /translation="MISPISFNGVALNDGFFSSDLRGVFDSDKVLTLNDILGDGQVFGR
FT                   SKAAERKLVLNITAAAQDLSRIAALNQMMAGNALKMLIIATDIGRLYGYGEVTTFAWAS
FT                   DTPLMQSVQITMPDPHWQALQPDTLSLEPSIANGVIFGDPVRIALDAGGSDNAARTILD
FT                   ADNSDSAARTQLDAGGSN"
FT   gene            106897..107802
FT                   /locus_tag="Ethha_0104"
FT   CDS_pept        106897..107802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppw:PputW619_0675 pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25694"
FT                   /db_xref="UniProtKB/TrEMBL:E6U615"
FT                   /inference="similar to AA sequence:KEGG:PputW619_0675"
FT                   /protein_id="ADU25694.1"
FT                   /translation="MAALYDLLNRRDTWANWQNNNIILPDGVLGVITDSPADELWLLMG
FT                   DGTTHVKDLKIWKLYQVDMSSLAQSVITLQQTVAALQQVVSTDGTATLSQLTLKSDGVH
FT                   DPLTVEGVDGVSVGSIDKDGYTYIGKASTIMAEDDDHMILSNVGYLGGAQAQGGVNLDN
FT                   VSGLFGMVDENGNGINVTGITMLEFNGAANMNLPSTGLNVNGGPLTSNEKFTSNGGAQI
FT                   NGNTTINGDTSVYGEVASVAPSSLATMSGPTSSRPTQIMDNVPVIPGYQYFDTTLGKPI
FT                   WVKSNVNGTVTWVDSTGAVV"
FT   gene            107802..109079
FT                   /locus_tag="Ethha_0105"
FT   CDS_pept        107802..109079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_5636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25695"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:E6U616"
FT                   /inference="similar to AA sequence:KEGG:Amir_5636"
FT                   /protein_id="ADU25695.1"
FT                   /translation="MLHDVIFGAPKNLLRLLSSAQSANGVTAQVDANGLVTLSGTATAD
FT                   TTFTLPANAVTLGTGAYTASLTVKNGYATGTVTAAITQTAQATQVITNGNFATSSNNLA
FT                   TGFAVGHGVAVSCTNNTQTFRATAQSGQLDMYNYPYLSGHKYFIRCYVQATSTGVVLYA
FT                   QNGTAVTHPGDGKYEPLSCIVTATVSNFYAAIVDRRTSGWDNISVQSFMAIDMGTDASN
FT                   PLYNLTSAQMAALFPSYFDGAKTVTLPNPFATVSVGSPATFTAQSGQSIPSVQISIPAG
FT                   AACSQYAVGLQVESGSTATGWVSPGTQGVIFYPAEGETGTITNTGNVDAYPVITITGAC
FT                   ANPSVTNDTTGESISVNLALGSTDTLVIDCRPATRGCYLNGTLAFGIKQELGWIHCPPG
FT                   DNVLTFARNGYDTKRHCTVSLQGRYL"
FT   gene            109079..110134
FT                   /locus_tag="Ethha_0106"
FT   CDS_pept        109079..110134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0106"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tps:THAPS_6956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25696"
FT                   /db_xref="UniProtKB/TrEMBL:E6U617"
FT                   /inference="similar to AA sequence:KEGG:THAPS_6956"
FT                   /protein_id="ADU25696.1"
FT                   /translation="MYVKLFDRSHIQLDELYQFSPPKYGWTLNDIDTLTLDIALADPKC
FT                   TPANTRLGNHIEYAADDGTTIWGGYIAGHSFNDAKLTLNCVDYNALLKYRRLRAKQYGT
FT                   MDYGSLVRQMIADCQAARSDDPIGLTGYDIAPGAIQTTREVKATDMLLAKIKDFCADAN
FT                   YDYWVDAARVFHFALRRGADKPQYVLEYGGEADNITAAPTLARDILNLANDVYAESTVT
FT                   DDSNNSTTITSEQQDASSQSTYGLYEGTFSPNDGVTDQSTLDTQTQAALALDSAPADSI
FT                   TLTCTDGTLCPFDDLAIGDRVTLHLAPYFDYTASVRVLRMVQDDDKQTREITVGSVVYK
FT                   PQGPQRRAYAG"
FT   gene            110148..110876
FT                   /locus_tag="Ethha_0107"
FT   CDS_pept        110148..110876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckr:CKR_2328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25697"
FT                   /db_xref="UniProtKB/TrEMBL:E6U618"
FT                   /inference="similar to AA sequence:KEGG:CKR_2328"
FT                   /protein_id="ADU25697.1"
FT                   /translation="MANHTQFFSDGTTVYGASDFIAPMNALTTSGIIGGYQVTAPSSGM
FT                   TVNVAAGSAILNGVLTTDDTTQAVPVPTNTGGNARTDAIVLQIDATAMTTTVVDVPGAT
FT                   TEAANQILLAVVTVPAGASSIVAGNIDGSGRVYAGLDNPFAAVASASLGSNGYVLLGNG
FT                   LALQWGTLSLGAFPAYTDVSFPQAFSAVPFTIVATMEDSAPYAVSTAVWTATKFTAIQA
FT                   DSVAHLMHWFAVGPMAVVRT"
FT   gene            110949..111866
FT                   /locus_tag="Ethha_0108"
FT   CDS_pept        110949..111866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0108"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="PFAM: glycoside hydrolase family 25; SH3 type 3
FT                   domain protein; KEGG: bcg:BCG9842_B1529
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25698"
FT                   /db_xref="GOA:E6U619"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6U619"
FT                   /inference="protein motif:PFAM:PF01183"
FT                   /protein_id="ADU25698.1"
FT                   /translation="MHKIIRCAAVWLLTAALLCATVVPAMAVTPPGGAVSYHGVDIYHG
FT                   TSDNGQINWNRLAQTQNFVYIKTDEGISYVDRMWTINRTAAAAHGMAWGPYHFLRLNSD
FT                   PVKQADSFWARIRGTGYSLVPAVDVESYDGQQSAASMRQIIRAFITELQRVSGITPVLY
FT                   TYTAYANDILRGQFTDCPLWLADYRGYAGDVVGWGAWDAWQYSEHGQIEAISNNEVDLD
FT                   YATAGIYVGGAHTPANPYPYIISVQRGNYQRRTVRTSASWSARVIGHISVGDNYEIMGP
FT                   TNSEGWVQIGLCGHAIGYVPAYCF"
FT   sig_peptide     110949..111032
FT                   /locus_tag="Ethha_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            111884..112231
FT                   /locus_tag="Ethha_0109"
FT   CDS_pept        111884..112231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ere:EUBREC_2081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25699"
FT                   /db_xref="GOA:E6U620"
FT                   /db_xref="UniProtKB/TrEMBL:E6U620"
FT                   /inference="similar to AA sequence:KEGG:EUBREC_2081"
FT                   /protein_id="ADU25699.1"
FT                   /translation="MSNLKKLLSDKSFWAAVIALSTSILISFNVPQGSVEQITAIIAAG
FT                   GTFIAYIVSTGIQSAAQIKADAQIKTAQIAVQARTSEQALTVLNVQNRAADDSQGVPTP
FT                   LRAGDGTKEDK"
FT   sig_peptide     111884..111973
FT                   /locus_tag="Ethha_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.412 at
FT                   residue 30"
FT   gene            112231..113013
FT                   /locus_tag="Ethha_0110"
FT   CDS_pept        112231..113013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0110"
FT                   /product="papain cysteine protease family protein"
FT                   /note="KEGG: psp:PSPPH_2358 papain cysteine protease family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25700"
FT                   /db_xref="GOA:E6U621"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6U621"
FT                   /inference="similar to AA sequence:KEGG:PSPPH_2358"
FT                   /protein_id="ADU25700.1"
FT                   /translation="MRHKYLLRPDAPDARDYRFSALAPVPVLHDTDYTAKFPPVWDQGQ
FT                   LSSCQSHAIDAIDAYVKGYAFTPSHLFEYYNVRALMGTVSEDSGGDLRTTCQALSNNGV
FT                   CDAAVWPYNISRFADKPPQVAYDNANLDNDKIYTYYRVSGIDQIRQALSAGHTPLIGIR
FT                   IYENFESQTTLQSGIIPAPGGALLGGHALVIVAHHDEPSTGCKAKDFMGHVVLRHSAGF
FT                   FKIRNSWGTGIGLNGSGYFTATYEVLEKLLMDTWVIVQ"
FT   gene            113308..113874
FT                   /locus_tag="Ethha_0111"
FT   CDS_pept        113308..113874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0111"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: mmz:MmarC7_0041 resolvase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25701"
FT                   /db_xref="GOA:E6U622"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:E6U622"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ADU25701.1"
FT                   /translation="MLLGYARVSTGEQLLDRQIDALELAGVEKIYHEKVTGAKVDRPKL
FT                   NELLNHLRSGDVIVVSDLTRLSRSTKDLFSIVDRIQLAGADIKSLKESWIDTTTPQGKL
FT                   LFTIFAGISQFERDLISQRTREGIAAAASRGRHGGRPSKRNPKADTALKMYDSQEYTIP
FT                   EICSATGLSKSTLYRYVASRNQLRD"
FT   gene            complement(114240..114595)
FT                   /pseudo
FT                   /locus_tag="Ethha_0112"
FT   gene            complement(114816..115244)
FT                   /locus_tag="Ethha_0113"
FT   CDS_pept        complement(114816..115244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mla:Mlab_1106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25702"
FT                   /db_xref="UniProtKB/TrEMBL:E6U623"
FT                   /inference="similar to AA sequence:KEGG:Mlab_1106"
FT                   /protein_id="ADU25702.1"
FT                   /translation="MKTSHFFTKIAAISGTILVWIPVLFTVITSVIGTLTSGRLRFDFL
FT                   MPAELFPFALGGAILLVFTALRTRFYRKYVVIGFTLAILCLFGGQGIAVVSGLASGAIA
FT                   PAGLVWAAVVVSIVIYSLSVVELGIVGILIALKLYRSK"
FT   gene            complement(115374..116183)
FT                   /locus_tag="Ethha_0114"
FT   CDS_pept        complement(115374..116183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cce:Ccel_2649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25703"
FT                   /db_xref="UniProtKB/TrEMBL:E6U624"
FT                   /inference="similar to AA sequence:KEGG:Ccel_2649"
FT                   /protein_id="ADU25703.1"
FT                   /translation="MEHIKKNGLRILIISIACGTLDFVLQGATASLHVNNLNTIEPSMF
FT                   VRIGLIYPLLIAYYWADYLIMAIIFVWIEQGLPGNRWLEGLTYGLCIGGLYLIGMYEGI
FT                   LILNDTVINATWVGLCDGLPIVFMGVLAGIFTGTPGVQGRYRRRLYQVPIISMLYVGGR
FT                   YFSYGVLHIHSAYVAMPLGTFVWTLCQGAWIGVLYVLLRPGIKRVAPITKALFFGTVIF
FT                   GLNWLMYHFFIPMMFETSIADILIRVGVDSLSVTIGAYICERRAHTA"
FT   gene            117016..117366
FT                   /locus_tag="Ethha_0115"
FT   CDS_pept        117016..117366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_1896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25704"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:E6U625"
FT                   /inference="similar to AA sequence:KEGG:Clos_1896"
FT                   /protein_id="ADU25704.1"
FT                   /translation="MDPRVVFHIDETQKWNLIINSVHNLLLSYEGIFPNAIVEVLANSE
FT                   AVKGYLLDGGIADSHTMEALSQKGVRFVACNHALQGMKITKEQICQFVKIVPAGVRELV
FT                   DRQMEGYAYIKP"
FT   gene            117635..118819
FT                   /locus_tag="Ethha_0116"
FT   CDS_pept        117635..118819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0116"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: clj:CLJU_c36050 putative
FT                   membrane-bound protein; SMART: GGDEF domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25705"
FT                   /db_xref="GOA:E6U626"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E6U626"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADU25705.1"
FT                   /translation="MASKEFKNDLILQNIQRGKLLAIVIIVFETVYLLIDVICSFQKIS
FT                   NTFSFYSYSIMYFMMISINLVYLFLTHCFTLKCIHTSATNALFTFYLTLIMAWGSVISL
FT                   MDQRLYGQLMSFMVNMIVCSIIYLMDAKMMRIPYLISIIILTVGLPFFQRSSNVLIGHY
FT                   VNLLVFVVISWMASRIVYRNYCDNYVIEKLMNQSKILLEKGMEENRIINRELAIANMQL
FT                   KKLTLMDELTELPNRRSFREFVDKTFQMHSTVSVIMIDIDYFKQYNDSYGHDAGDAALT
FT                   TVAKQIGSIVENTYQIAVRWGGEEFIYAAFNITKENIIEIANALRLRILNLKIPNRNSL
FT                   ACPYITISLGICTGTVANIKNFDSIIKIADQALYQAKNNGRNRVTILDYEEETL"
FT   gene            119068..119253
FT                   /pseudo
FT                   /locus_tag="Ethha_0117"
FT   gene            119574..121397
FT                   /locus_tag="Ethha_0118"
FT   CDS_pept        119574..121397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0118"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pjd:Pjdr2_1913 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25706"
FT                   /db_xref="GOA:E6U627"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6U627"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU25706.1"
FT                   /translation="MVRHGSRGSRFYHQTDEKPHITKALVFRIVAYFKPYWKIMAVILL
FT                   LIVLTSAMEIVPPLLTKNIIDIALPQKNIRLLLLYIVLSFALLLLVNLISVGQSYLNTL
FT                   VSKNIIRNLREDMYQHLLHMSIRFFSNVQAGEISSRINNDIGGIESVFSNTFIQILQGI
FT                   LVFVTTTVILLYINWKLAIISLLTLPLFLLPTRRVGRARWKIAADMQSKLAELTTLITE
FT                   TLNVSGMMLIKLFTKEKEEEKEFQNINDTVTKLGIRETVVGRWFIMTIQTFVAIGPMLI
FT                   YLFGGLILIQYHDITIGGIVMFVTLVTRLYGPVNTFANIHVDIVRSMALFERIFQYLDL
FT                   KNEIKEKPDACNIGRADGEIRFKHVFFSYKETNAPTLTDINMEIKSGQMAAFVGPSGAG
FT                   KTTITYLVPRLYEVQSGAVLLDGIDIREIALHSLRNQIGMVTQDTYLFNTTIRENLLFA
FT                   RPNAKEAELVQACTTANIHDFIKSLPQGYDTVVGDRGIKLSGGEKQRISIARALLKDPR
FT                   IVIFDEATSALDSNSETLIQQAIDPLLKTRTSLVIAHRLSTVLSADIIFVVENGHIVES
FT                   GRHLDLIKLNGLYKDLYDKQFHSADESHSMQ"
FT   gene            complement(121715..122914)
FT                   /locus_tag="Ethha_0119"
FT   CDS_pept        complement(121715..122914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0119"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: pjd:Pjdr2_0311
FT                   YibE/F family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25707"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:E6U628"
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /protein_id="ADU25707.1"
FT                   /translation="MLSKWFPDTFTAIRRVVLAALLVLYVVFLVFFNQIPKTTIVDYSG
FT                   RTFARASVVEIVKDNLASNGQRYGNQIVNLQVLEGKYKGRVMTATSSDGFLVGAVCKVG
FT                   MEVVAMISVSGDTSVVTVYSPNRQVALYGFVGAFLLVLWMVGGKKGIRSAIALLFTFSS
FT                   IIFLYLPMIYRGFSPFWGAVLISVFTTIVSLYIIGGYTVKVLSGILGTIFGIVIAGVAA
FT                   ALFGQVAGISGYNVSNIDTLVLIGQNTHIQIGDLLFAGILFSSLGAVMDVGYSIASAID
FT                   EISEQNATISPKQLFMSGIHVGRDMTGTMCNTLILAFAGGMLSTLVTLYAYNQPFLQTI
FT                   NSYDVGIDIMESLSGSFGVILAVPMVALVSSRLIPILRTRRLKKQMLQKTSGTPTDLVH
FT                   "
FT   gene            complement(123009..124886)
FT                   /locus_tag="Ethha_0120"
FT   CDS_pept        complement(123009..124886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0120"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: eel:EUBELI_20557
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25708"
FT                   /db_xref="GOA:E6U629"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E6U629"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU25708.1"
FT                   /translation="MNIRKKACIGTVAVLLALSAGMTAMAKTANFQDASAKGGNEWAVF
FT                   NSNWASIRDNTGLITLTPGTDSSQMNFAWYSNAQEAPVIHVSAKSDMSSSQIFSGTSTS
FT                   FTSSNGTTYFSNKVTVTGLTASATYYYTYNDGSTPTAFTTGNPSNFSFLWAGDPQIGSS
FT                   QGDVTDSGATLSESDADINDSFNWAATLTTALQAHPGFNFILSAGDQCQYSSSGTNALP
FT                   EQEYAGFASPSLLRSLPVATTIGNHDSKHPDLQYHYNNPNAVTASAPSAAGNDYYYSYG
FT                   NALFIVLDTNNMNMADHENTLKAATQAYPNDKWRIVSFHQDVYGSGNDHSDSDGIILRT
FT                   QITPLMKTYGIDVVLNGHDHSYSRSYDLVDNGQTHTTFSSTDKTSDGTAVSHDDYLSAN
FT                   NCYTILNPKNADGSYIDQTTSIDPQGTYYFTSDSATGSKYYNLITPQQNYVAKRWQSFI
FT                   PTYSIVNVTETGFTINTYETDTGSKIDDTFTIVKSADKTSLQALIQTAQAVDKSKYTDT
FT                   SYTVLQTAIANAQAVVNNPAATSADISNAYGQLQQAYSNLVLTSSPSATQTGLTTGGTT
FT                   SSTTSTTSNSTVSNPNTGEVGNMYSELAFLGLIGAGVVLITSKLKKRFK"
FT   sig_peptide     complement(124806..124886)
FT                   /locus_tag="Ethha_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 27"
FT   gene            125285..126691
FT                   /locus_tag="Ethha_0121"
FT   CDS_pept        125285..126691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0121"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2;
FT                   Methyltransferase type 12; KEGG: cdl:CDR20291_0242 glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25709"
FT                   /db_xref="GOA:E6U630"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6U630"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADU25709.1"
FT                   /translation="MTVKKTSIILLTYNNLDDTALCVESIRSNTPADSYELIVVDNHST
FT                   DGTPDWIQEQTDIRFIRNESNRGFPAGCNQGIQTAQEGNDILLLNNDTMVMPNWLQNLQ
FT                   RCLYSREDVGAVGPVTNCCSNDQQIQIDRSKESSLLSFARKFNRAKPNYERKIKLVGFC
FT                   LLIRRTVVQKIGLLDERFYPGNYEDDDYSFRIQRAGYQLLLSKNTFIYHKGSASFGKDP
FT                   KAYQTALEVNAKKFEGKWGFNATYSTFVRYDILSFMQPKQNSPLRVLEVGCACGATLLK
FT                   IKEQFPNAEIYGIECNAASAAIASRFADIQSVDIEQVQLDYDTQTFDYILFADVLEHLR
FT                   DPERALRNVRQYLKTGGAVLASIPNIMHYSVLSGLLNGNFTYQDAGILDRTHLRFFTLA
FT                   EIIRLFAVCGYTLPVIQSKQLPRSSQSNEWVDRLVAVSGEEKRQQFETYQYLLKAQMGP
FT                   QTSEKGAAFG"
FT   gene            complement(126848..127225)
FT                   /locus_tag="Ethha_0122"
FT   CDS_pept        complement(126848..127225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: adg:Adeg_1127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25710"
FT                   /db_xref="UniProtKB/TrEMBL:E6U631"
FT                   /inference="similar to AA sequence:KEGG:Adeg_1127"
FT                   /protein_id="ADU25710.1"
FT                   /translation="MDISFPNYADSFKCDGSKMDMPPKGRFFERMVFLKTNPYAYTYTP
FT                   VIGIWDARILTVFVYNTGEAPIKVHIQNTPDGRHFVNDTQILSLDPDEIGSLVPCIFSK
FT                   GLRIAGIGGPGTAQIWAQMQM"
FT   gene            complement(127273..129090)
FT                   /locus_tag="Ethha_0123"
FT   CDS_pept        complement(127273..129090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0123"
FT                   /product="glycosyl transferase family 2"
FT                   /note="KEGG: clj:CLJU_c04550 putative glycosyltransferase;
FT                   PFAM: glycosyl transferase family 2; Tetratricopeptide
FT                   TPR_1 repeat-containing protein; SMART: Tetratricopeptide
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25711"
FT                   /db_xref="GOA:E6U632"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6U632"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADU25711.1"
FT                   /translation="MQEQTLSLCIITKNEENNLSRCLDSVKHLVNEIILVDTGSTDHTI
FT                   TIAKQYGAHVYQEKWQNDFSKARNACLDKATGDWILILDADEALDPNDRDKLQQWISTT
FT                   TLDGAHFTIRNYLGGDAAGDFTVHNGFRLLRNTGEYCFAGEIHEQIVRKDGKPIGNRFS
FT                   IEPIHIDHYGYLEEEIRKKGKRKRNIPLLEKQLRRDPQNAFTLFNMGNEYLALGDYGKA
FT                   LSYYQKAYVHMNPEQAYVPHLFFRIANCLQNANRMDEADRYLQEALSIYPNGTDFLFLQ
FT                   AFGRHKCGKDTMAVRGYETCLEMGEPPSALQFVEGCGTYRAACQLAELYFELEDYEMAV
FT                   LYYNRTLAYNPRLTNLLYRIGTALHKLYNSADEVHGKLRAYFADPEYLPNKIVLIDILL
FT                   NEHCMAPARMELTNWKSTGEFERERLYLHARAAFLDRRFEDASDWFGRILSQTRSPKQI
FT                   LAGMERESACYLYALLQLMETAEHSGQLRLIRSSAGDLFYRICLQMDAISRQAPDVYLH
FT                   DADNGDAVAAGCMLIFDKLLMAGAYDLFERLLPIINYANTPKVLLYLAGLYQKRGFSSM
FT                   AVKNVLRSVKEMDTLDAFGAALLYHSIHA"
FT   gene            complement(129197..130089)
FT                   /pseudo
FT                   /locus_tag="Ethha_0124"
FT   gene            130553..131230
FT                   /locus_tag="Ethha_0125"
FT   CDS_pept        130553..131230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0125"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="KEGG: ere:EUBREC_1222 putative transcriptional
FT                   regulator; PFAM: cyclic nucleotide-binding; regulatory
FT                   protein Crp; SMART: regulatory protein Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25712"
FT                   /db_xref="GOA:E6U633"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6U633"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADU25712.1"
FT                   /translation="MLYPHDMEFLAQHLPFLARLSENDRRLIAAAGLKSSFEKGETILS
FT                   REKECNGLIVVESGQLRAFFELEDGKELTLYRLLAGDICILSASCVLKNITFEVTLEVE
FT                   KAGSVYFIPAALLGSLSERESAVKQFTMELVSERFSEVMWVMEQMVTKNMGQRVAAFLL
FT                   EQTNLEGSQILTITHDTIAKNLGTAREVVSRVLKYMENDGVIELSRGKITITQAKKLQE
FT                   ISH"
FT   gene            complement(131356..131679)
FT                   /locus_tag="Ethha_0126"
FT   CDS_pept        complement(131356..131679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0126"
FT                   /product="thioredoxin"
FT                   /note="KEGG: saf:SULAZ_0121 thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25713"
FT                   /db_xref="GOA:E6U634"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6U634"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADU25713.1"
FT                   /translation="MSAISLNRSNFEDVVLNTDKPVLIDFWASWCGPCRMQSPVIEELA
FT                   EKLEGAAVVAKLNVDENPELAAQFSVMSIPTLVFVKDGRIVGRRTGVTSGAELLSILRT
FT                   VSV"
FT   gene            131803..132378
FT                   /locus_tag="Ethha_0127"
FT   CDS_pept        131803..132378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0127"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: hmo:HM1_1722
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25714"
FT                   /db_xref="GOA:E6U635"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6U635"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADU25714.1"
FT                   /translation="MAHKFDPSHLKKLDSEERRNLLSPAQTLVALGFSPDQTLADIGCG
FT                   TGLFTLPAAEINRGKGTVYAVDIAREMLDEIGKRAAAAGLSNITTVQADEYGTNLPDAA
FT                   ADFLLVCTVLHEVDDKVRWLQEAARICRKGGSIAVIEFDPSFTGFGPPAAHRLPKDRTM
FT                   EALRAAGFTPVQEINLHGAFYVIKAARK"
FT   gene            132618..135074
FT                   /locus_tag="Ethha_0128"
FT   CDS_pept        132618..135074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0128"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="KEGG: cce:Ccel_1144 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   Rhodanese domain protein; SirA-like domain-containing
FT                   protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25715"
FT                   /db_xref="GOA:E6U636"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6U636"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADU25715.1"
FT                   /translation="MLKVLIVGGVAGGASAAARLRRNDEHAQIVLFERGDYISFANCGL
FT                   PYYIGDVIQEKSKLTLQTPESFRERFRVDVRVGSEVTAIDPKNKQVTVRRTSDGSTYQE
FT                   GYDKLLLSPGAEPLRPRLPGFDSKKVFTLRNIPDTYAIKDFCDTAKPKRAVIIGGGYIG
FT                   IEVAENLHHLGIHVTIIQMTDHILPPADADMAAQLHNHLREKGVALRLNTSVQEIKETK
FT                   DGLTFSLSDNTTLCADFAILSAGVKPESKLAKDAGLKTGLRDAILVDDTLKTSNNDIYA
FT                   VGDAIQVTDWASGTPAYIPLASPANKQGRIAADNICGGNLKYEGSQGSSVLKVFDLSFA
FT                   STGLSEERLKATATPYLKSYTYSSSNASYYPGGLPISIKLLFAPDTGRILGAQAIGYTG
FT                   VDKRIDVIATVLRLGGTVNDLTRLELCYAPPFSSAKDPVNMAGYTAENILQKRVRPFYA
FT                   ENVADIDLKKATLLDVRTKEEFEGGSIPGAVNIPLDSLREELGQLRKDQPVYLFCQIGL
FT                   RGYLASRILMQSGFGHVENLSGGYRLWNEIQKDHTAPAESQDCGCPDEAAATCAPCKPS
FT                   GKTIVVDACGLSCPGPILEVNKALKEACDGEVLAVKATDPAFFSDIQGFCKRTGNLLID
FT                   SHFDGRQFCATLQKHSAAPACEAPADSGNDKSIIVFSGDLDKAIAAFIIANGAAAMGRK
FT                   VHMFFTFWGLNILRKPEKTSVRKDFISSMFGRMMPRGSRRLGLSKLNMGGMGPKLIRSV
FT                   MQNKNISSLEDLMKEAIKNGVEITACTMSMDVMGIKQEELIDGIKSGGVATFLANAEES
FT                   DTNLFI"
FT   gene            complement(135293..136684)
FT                   /locus_tag="Ethha_0129"
FT   CDS_pept        complement(135293..136684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_495790 surface antigen BspA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25716"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E6U637"
FT                   /inference="similar to AA sequence:KEGG:TVAG_495790"
FT                   /protein_id="ADU25716.1"
FT                   /translation="MAFEIENGIIRRYVGAEEEVRVPEGVTAIFDNAFSESKHVKRIIL
FT                   PAGLKSVGHWAFNRCQLLESVALPEGLESIGRSAFRSCIRLRDIALPPTLTTLGGKAFE
FT                   FCKSIKRLELPSGIREIGDKTFSNCSALCAVTIPDGVVRIGGWAFEGCVGLETITLPDS
FT                   VASIGEGAFLDCTGLETVTVGKGVQTVGGDAFAGAPWLEDDPGDFFAINGNLLRYTGRA
FT                   KWVMVPTSITAVCAEVFERCREMEGVVLPDSVTRIGDGSFEGCPALRRAELHSRITELG
FT                   NGVFELCKALDYVVVRGLLAGVNRTAPAWRAHTALYGNTCTALTVYLPVSCGASFRTVF
FT                   HADGQGVHALFSRYFSLFQKIDDTDAKVLMALERLVSPYLPESGEMEAYRSFLTEHLRE
FT                   AMRLFLARADLLPVRALGALGLIGEDAIGDLTQMAAEAKHTEISAYLLAYKREHFGFHA
FT                   PTFDL"
FT   gene            complement(136721..138259)
FT                   /locus_tag="Ethha_0130"
FT   CDS_pept        complement(136721..138259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0130"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="KEGG: ele:Elen_2494 ATPase associated with various
FT                   cellular activities AAA_5; PFAM: ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25717"
FT                   /db_xref="GOA:E6U638"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U638"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADU25717.1"
FT                   /translation="MNIKEAKQQIQNAVRAYLTKDAFGDYCISAEKQRPILLIGAPGIG
FT                   KTAVMEQVAREMGINLVAYSMTHHTRQSAVGLPFIEHRTYDGTEYTVSEYTMSEIIASV
FT                   YETAEKSGIREGLLFLDEINCVSETLAPAMLQFLQYKVFGRHRIPDGWVVVAAGNPPEY
FT                   NNSVREFDVATLDRLKKVIVEPDYTVWKEYAYQSGVHGAVLSYLDIKKDHFYAVQSTVE
FT                   GKSFVTARGWEDLSQMMTLYERLGIPVDEALTAQYIQHPDIARDFAVYYELYKKYKQEY
FT                   GVETILKGKAEEALARTAGEARFDEKLSLIGMLVDAVSGDIRRCLRTEDVVTAVYGVLK
FT                   TVKPALTETPERYAEVFEQCIAEQRQAVETARRANTLLREKKQVAGAVVDALEDLRDAV
FT                   ARAGCGTDCFGVVRAGFEERARGLKTQSETVRGRLDALFAFAEQAYGEGQEMLILVTNL
FT                   TLSPDAARFIATYGCERYYAHNKEALLFERQNDILLKMQKLREEFHTPENEETL"
FT   gene            complement(138256..140010)
FT                   /locus_tag="Ethha_0131"
FT   CDS_pept        complement(138256..140010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_2493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25718"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="UniProtKB/TrEMBL:E6U639"
FT                   /inference="similar to AA sequence:KEGG:Elen_2493"
FT                   /protein_id="ADU25718.1"
FT                   /translation="MKDEKDASFLDRADPLAREILGLTRSAMFVKLRFLDAALGHLPFA
FT                   RQDDIGRIATDGKHLFYNPRFILQRYEESADRLARDCLHLVFHCVLRHPFFLGQVRPAW
FT                   WNLAVDIAVENTLNELDVFPTGRVHETAAEQVLTELRGPVRSLSAEGLYRYFAREGLDD
FT                   DSASRLRQLFYHDDHIGWYARDEREEHTRTGDQNVVEQGQASEQDAGSGGESDAKSENR
FT                   REKEGAGGGEPGQDKPQPGDGNNADTPSDKTETPSGQAPPSPGGGDPSGDANQSQTENT
FT                   PGQESGGTGEGNDGQAGGKDGGEEESPMKLPAPREDGLFALWKQISRRMQTDLETTSRR
FT                   WGEESGSLLQSIRGANRDKCDYSAFLRRFSTRGEQMKVNDDEFDYIFYTHGLERYGNMP
FT                   LIEPLEYKEVRKVREFVIAIDTSASCSGELVQGFVRKTYSILKQQECFFRRLNIHIIQC
FT                   DAEIQSDVLITCEADLERYIAEQKLHGFGGTDFRPVFAYIDDLLAKHAFFDLRGLVYFS
FT                   DGYGVFPLKKPPYDTAFVFLGDDEERKVPSWVIPVRMTEEELYDLVEQPETDAQQNARG
FT                   GDEKEAAI"
FT   gene            complement(140155..140340)
FT                   /locus_tag="Ethha_0132"
FT   CDS_pept        complement(140155..140340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25719"
FT                   /db_xref="UniProtKB/TrEMBL:E6U640"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU25719.1"
FT                   /translation="MWPFILRVWNVLVQCMWIEMVFAVIGVFIMMRGRLFLQPFWIVKE
FT                   LCTRPRKEPGNPPNDR"
FT   gene            complement(140422..141885)
FT                   /locus_tag="Ethha_0133"
FT   CDS_pept        complement(140422..141885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0133"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="KEGG: cth:Cthe_2689 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH;
FT                   aminotransferase class I and II; SMART: regulatory protein
FT                   GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25720"
FT                   /db_xref="GOA:E6U641"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6U641"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADU25720.1"
FT                   /translation="MLEIVSIQFKKTGKPLYHALADTIENRLRESGAPGGERLPSVRAL
FT                   AGRLGVNNATVVAAYRVLEEKGVAYTRPGSGTYLLPPTVPPPKEDEVADLFGDYTDLSN
FT                   GRLTLSGEMIDLAGNSPTAEVFPVAEFKEAVNTVLDTDGGYAFSYQESEGYYPLREILA
FT                   SFSQTQYGIRCRPEEILVTSGAQQALDLLSKATLHAGDTVFAEMPSYIGMRSVFTLQGA
FT                   KLFGIPMEADGLNLDILAYYAQRYRPRLLYTMPVYQTPTGVSLSVEKRRRLLRLAEQYD
FT                   FYIIEDDLFSDVNLKGERLFPLKAEDTAGRVVYVKSFSKLLMPGIRTGYVIAPAKLLER
FT                   LSAVKYATDISGSGLIQRALAAYFQSGCWGKNIGQITGAYRKRAAAALARVAAWKPFGV
FT                   RAGEVKGGFGIWLTLPGDITDREIFYRCKEQHVLVAPGSLFYISPMAGFERHLRISFAS
FT                   AKELDKGLHIVGDCIRATVNQKSGHTIYI"
FT   gene            141977..142855
FT                   /locus_tag="Ethha_0134"
FT   CDS_pept        141977..142855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0134"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="KEGG: tjr:TherJR_0010 pyridoxine biosynthesis
FT                   protein; TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25721"
FT                   /db_xref="GOA:E6U642"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:E6U642"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ADU25721.1"
FT                   /translation="MSDRYELNKNLAQMLKGGVIMDVTTAKEAEIAQAAGAVAVMALER
FT                   VPSDIRKEGGVARMSDPRIIKEIKNAVTIPVMAKCRIGHLVEAQVLQALGIDYIDESEV
FT                   LTPADDRFHIDKHAFNIPFVCGARNLGEALRRIGEGAAMIRTKGEAGTGNVVEAVRHMR
FT                   TITADIRRLQNLPADELMTAAKELGAPYDLVEELAETGKLPVVNFAAGGIATPADAALM
FT                   MQLGSEGVFVGSGIFKSADPEKRARAIVKATTYYNKPEIIAEVSEDLGEPMKGIDLNTI
FT                   PEEERLATRGW"
FT   gene            142857..143432
FT                   /locus_tag="Ethha_0135"
FT   CDS_pept        142857..143432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0135"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="KEGG: cbl:CLK_2186 glutamine amidotransferase
FT                   subunit PdxT; TIGRFAM: SNO glutamine amidotransferase;
FT                   PFAM: SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25722"
FT                   /db_xref="GOA:E6U643"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6U643"
FT                   /inference="protein motif:TFAM:TIGR03800"
FT                   /protein_id="ADU25722.1"
FT                   /translation="MKTVGVLALQGSFREHLAMLAKLNDVTPLAVKNTDDLARVDGLIL
FT                   PGGESTAQGKLLRDFKLLEPLRVRIRDGLPVWGTCAGLILLAKQIEGGEPTHLGVMDIA
FT                   VRRNAYGGQLDSFTAAAVLPGISPEPFSLVFIRAPWIEQAGAGVEVLARYGEHIIAAKE
FT                   RNMLVTSFHPELTGDMRFHAYFVRQIAG"
FT   gene            complement(143528..143953)
FT                   /locus_tag="Ethha_0136"
FT   CDS_pept        complement(143528..143953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0136"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: cce:Ccel_2938
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25723"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:E6U644"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADU25723.1"
FT                   /translation="MLGFSNHRGMVPYEGKGSLFDSFFGEPFFSTVMSGEMKTDIKETD
FT                   TEYAVSVDIPGVQKQDIAIHYAESGTLTVSVSRSEENKVEKDGYLRHERRVGQSSRAFY
FT                   LPGVKREGISAKYADGVLNVVLPKSGEQGGDTGIEIQ"
FT   gene            complement(144312..145001)
FT                   /locus_tag="Ethha_0137"
FT   CDS_pept        complement(144312..145001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_1395 YVTN beta-propeller
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25724"
FT                   /db_xref="UniProtKB/TrEMBL:E6U645"
FT                   /inference="similar to AA sequence:KEGG:AMED_1395"
FT                   /protein_id="ADU25724.1"
FT                   /translation="MARLHAVRRRRRRGRSSAGMLGLVVVAAGAVMLVLAFAAAGGGGA
FT                   GAASGSTASAQASSAGAASALETYLAPLVAQDPKPFASLARADRDWMLKTAVWVAAEQD
FT                   HYAYTSDDRQSVPADRVRSAYRTFFGSDAAPSFRTFASDGVEYVYHADTQRYDVPVTAK
FT                   KDVYTPRVTAVRQDGDTLAVTVGYVPSTGWTQRADGSVVPPASVKTMRYTLRHDGTGYA
FT                   VSAVENA"
FT   sig_peptide     complement(144885..145001)
FT                   /locus_tag="Ethha_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.289 at
FT                   residue 39"
FT   gene            complement(145012..146256)
FT                   /locus_tag="Ethha_0138"
FT   CDS_pept        complement(145012..146256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0138"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   slp:Slip_1685 gamma-glutamyl phosphate reductase; PFAM:
FT                   Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25725"
FT                   /db_xref="GOA:E6U646"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E6U646"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ADU25725.1"
FT                   /translation="MTIQEMGKRAKDAARVLAAVSSGQKDRALLAIAAALRAKEADILQ
FT                   ANAEDVQAGRQNGLTDALIDRLTLTPARIEGIATGMEQVAGLPDPVGKLDAGWTRPNGL
FT                   RIFKTRVPLGVVGIIFESRPNVTVDAASLCLKAGNACILRGGKEAIRSNLAFARVMRGA
FT                   LKESGLPEDAIQVVEDTTRDSAAALMRLNGYLDVLIPRGGAGLIQSVVQNATVPVIETG
FT                   VGNCHVFVDESANTEMAAQIIFNAKAQRPSVCNAAETLLVHKNIAVAFLPRAKALLDTK
FT                   QVELRGDETVRAILGGDVQPAVEDDWATEFLDYILAVKVVDSLDEAIAHIARYGSGHSE
FT                   CIVTENYTNSEHFLREVDAAAVYVNASTRFTDGGEFGFGAEIGISTQKLHARGPMGLAE
FT                   LTTVKYQIYGSGQIR"
FT   gene            complement(146253..147068)
FT                   /locus_tag="Ethha_0139"
FT   CDS_pept        complement(146253..147068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0139"
FT                   /product="glutamate 5-kinase"
FT                   /note="KEGG: cth:Cthe_1766 gamma-glutamyl kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25726"
FT                   /db_xref="GOA:E6U647"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:E6U647"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ADU25726.1"
FT                   /translation="MALQDAKRIVCKVGTSTLTYPNGRLHIRRIEKLVRVLSDFKNSGK
FT                   DVILVTSGAIGVGATRLGLDERPRDTRMMQAAAAVGQVELMYLYDKLFLSYGQVVAQIL
FT                   MTRILTDHDSTRQNLVNTFETLLSLGVIPVVNENDSVAVEELEEEAMAFGGNDTLSAVV
FT                   AVLVQADALVLLSDIEGLFDKNPREAPDACLIPVVESVDERVRASAGGAGSTLGTGGMV
FT                   TKLEAAEMVTKNGIDMVIMDGSDPEKLYALFDGKQVGTYFPANPKGERT"
FT   gene            147356..149614
FT                   /locus_tag="Ethha_0140"
FT   CDS_pept        147356..149614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0140"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   cac:CA_C0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25727"
FT                   /db_xref="GOA:E6U648"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:E6U648"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ADU25727.1"
FT                   /translation="MIHSLRPKWGRTEILQVILAGLAVLLAFFLSFYNFAQDGYGNLYY
FT                   SAAVKSMTTSWHNFFFLSFDPSGFVNVDKPPLAFWMEAAFVKAFGFHSWTLLLPEALEA
FT                   AGSVLILYHLVKRRFGFAAGWIAAVLLAVTPIFIAAARSNNPDAMLVLMMLFAAWAATL
FT                   AAETGRFRYLVLTAVCVGLAFNTKMLAAFLVLPACALAYLFARGMRWRRKFLHLAAAAA
FT                   VLIVVSFCWVEAVDLTPAADRPFVGSSADNSEMNLVLGYNGLNRVFAKEHAPADTAADR
FT                   RVNTRTATLPKRRSSATDSRVVDSRAAVRGTGAQRDAPGATRLLDLYTGEQISWFLPLA
FT                   AVGAAAAVVYVLGLEKERRRGKITALLLWGGWSAVMVVFFSFCGNLTHRYYLNVIAPGL
FT                   AALGGIGMVCMVRLALQKGSAWWKALFLPAGLVLSAVFHLSLLTNYPDWFHALWPLDAV
FT                   CIVLAAVLLLLRFHPVWMRPRVFTGIAGAALVCLLATPFCWSFTAVLGHVSGSDAAAGP
FT                   VLLRGKNGEMFPSLSYIVKRLKDATSDPAPSSDDMKLETYLEQHRDGAVYLAAVPGAPL
FT                   AESLIVDTGEPVMAIGGFNGSNPILTLGDLQQLVAEGKLRYFLSTSPVAAETEAPGTTD
FT                   APGNAAARLNQSSPYDSSHSERLRDGVNTSDGQLPENLRNAYHADEDGRLWATGRNEAN
FT                   GAELRSTRGQNPNAPIYAWAEANSQIVPSDTYLGNGRPDDPHATLYLLSQAKAKAALS"
FT   gene            complement(149686..151134)
FT                   /locus_tag="Ethha_0141"
FT   CDS_pept        complement(149686..151134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0141"
FT                   /product="biotin and thiamin synthesis associated"
FT                   /note="KEGG: dau:Daud_0163 thiamine biosynthesis protein
FT                   ThiH; PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25728"
FT                   /db_xref="GOA:E6U649"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:E6U649"
FT                   /inference="protein motif:PFAM:PF06968"
FT                   /protein_id="ADU25728.1"
FT                   /translation="MDYLKQYEDEMAAYDRQDHDFIDDDKIWSQLKAAENPSREAVRAV
FT                   LQKAEKTVRLEPEETAILLQNSDPETITEMYELANRLKQEVYGDRIVFFAPLYISDECA
FT                   NDCKYCGFRRSNHMMHRKTLSMDEIDKEVRTMIREGQKRTVLVYGEAPSTGIDFLCKSI
FT                   EKVYSVKEGNGEIRRANINAAPLSVPELRRLKEIGIGTFQVFQETYHHETYRHLHPANT
FT                   VKGNYRWRLYAMDRALEAGLGDVGIGALFGLYDWRFEVMGLLYHTIHLEETFNGVGPHT
FT                   ISFPRITPATGTPFSDHPEYAVSDEDFKKLVAVLRLSVPYTGMICTARETKEVRDSVLP
FT                   LGVSQIDGGTRIGVGGYGVKDANALPDKEQFSLGDTRSLDDVVLETGEMGNIPSFCTAC
FT                   YRMGRVGEEFMGLAKSKFVHHFCIPNAIFTFKEYLLDYAGPETREKGEQIIAKHVARFA
FT                   GEPIYDTIRENLRRLENGERDLRV"
FT   gene            complement(151139..151417)
FT                   /locus_tag="Ethha_0142"
FT   CDS_pept        complement(151139..151417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_0931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25729"
FT                   /db_xref="InterPro:IPR023860"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:E6U650"
FT                   /inference="similar to AA sequence:KEGG:Clos_0931"
FT                   /protein_id="ADU25729.1"
FT                   /translation="MEDKRLGVVGIVVEDLGSAAQINAVLHEFAALVVGRMGIPCRERG
FT                   VSVISLIVDGENDHISAMTGRLGRIPHVTVKTALTKNQGGAHATEGV"
FT   gene            complement(151759..152661)
FT                   /locus_tag="Ethha_0143"
FT   CDS_pept        complement(151759..152661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0143"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; KEGG:
FT                   cbe:Cbei_4521 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25730"
FT                   /db_xref="GOA:E6U651"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E6U651"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ADU25730.1"
FT                   /translation="MKHLLKLLDLSTQEILDILNLGDQLKYELKHGIPHPRLAGKSLGM
FT                   IFEKASTRTRVSFETGMYQLGGHALFLSSKESQIGRGEPIQDTARVLSRYLSGIMIRTF
FT                   EQAEVQALADHASIPIINGLTDFAHPCQVLADLMTVREHKGRLEGLKLCFIGDGNNMAN
FT                   SLIVGGLKVGMQVAVATPENYEPDASVLDFAQKQGGFSLVRSPLEAAAGADVVITDVWA
FT                   SMGQEEEAAKRRKAFAGYQVNKELMAVAKPDAMVQHCLPAHRGEEITADVFEAHADEIF
FT                   EEAENRLHAQKAVMVQLMG"
FT   gene            complement(152692..153882)
FT                   /locus_tag="Ethha_0144"
FT   CDS_pept        complement(152692..153882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0144"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /note="KEGG: apa:APP7_0245 acetylornithine
FT                   aminotransferase; TIGRFAM: acetylornithine and
FT                   succinylornithine aminotransferase; PFAM: aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25731"
FT                   /db_xref="GOA:E6U652"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6U652"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ADU25731.1"
FT                   /translation="MDFKETKAAYDQYVMHSYGRFDVALVSGKGATATGVDGKTYIDFG
FT                   SGIGVNALGYADDGWVKAVSEQAAKLAHISNLYYSPVQAACARLFCERTGFSRVFFANS
FT                   GAESNEGLIKLARKYSFDKYGKGRGTVVCLNNSFHGRTVTTLSATGQDVFHNYFFPFTD
FT                   GFRFVTANDTAGLEAAVQDDVCAILMEAVQGEGGVYPLEQAFVEKAAQLAAEKDVLLCF
FT                   DEVQCGIGRTGHIFGFEEFGVKPDIVSCAKALAGGLPMGAVLCGEKCKDVFTPGTHATT
FT                   FGGTPICCAAAIEVLSRVTEPAFLQAVRDKAAYIRAGLEKLPGVHSIRGLGLMIGFEIE
FT                   GVDSGKVAVEAAKEGLLILTAKTAMRMLPPLVITKEEIDKGLAILSGVIEQLRAGA"
FT   gene            complement(153929..154450)
FT                   /locus_tag="Ethha_0145"
FT   CDS_pept        complement(153929..154450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0145"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: ckr:CKR_0293
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25732"
FT                   /db_xref="GOA:E6U653"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E6U653"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADU25732.1"
FT                   /translation="MEFQQVIRTRYSVRKFKDTPIPSEVLTRILKAGQLAPSACNRQPQ
FT                   RILVAQSAEALEKIRPCTPCHFGAPVVLLACCDRSTGEEIVGSERDFGRVDVSIALTQI
FT                   MLAATDLGVGSLWVGMFEPQKLRKAFRIPEQYEIVSLMPLGYPADDAVPNPRMHDVREP
FT                   LDHTVFYDTF"
FT   gene            complement(154481..155341)
FT                   /locus_tag="Ethha_0146"
FT   CDS_pept        complement(154481..155341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0146"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase; KEGG: cbt:CLH_2869
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25733"
FT                   /db_xref="GOA:E6U654"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:E6U654"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ADU25733.1"
FT                   /translation="MGISENETAQVLVHALPYIQQYNNKTIVVKYGGNAMVSGELKDAV
FT                   MTDLVLLSLVGIRVVLVHGGGPEITDMLKKVGKESRFVGGLRYTDRETMDIVQMVLGGK
FT                   VNKDLVLSLQHKGGRALGLCGLDGGMIEAERMFADGTDLGQVGQVTNVDVTPINDALEH
FT                   GYIPVVATMGAGRDGKVYNINADTAAARIAAALGAEKLILLTDIRGLLRDKNDENTLIP
FT                   VVNVSEVPNLIRQGIISGGMIPKIDCCVEAVRRGVNRAHIIDGRRPHSILVEMFSDGGI
FT                   GTMFL"
FT   gene            complement(155365..156585)
FT                   /locus_tag="Ethha_0147"
FT   CDS_pept        complement(155365..156585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0147"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: arginine biosynthesis bifunctional protein
FT                   ArgJ; KEGG: ere:EUBREC_1176 arginine biosynthesis
FT                   bifunctional protein ArgJ; PFAM: arginine biosynthesis
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25734"
FT                   /db_xref="GOA:E6U655"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:E6U655"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ADU25734.1"
FT                   /translation="MEIQEIPGGVTAPKGFTAAGVHCGIRKNKSKKDLALVFAEKPCDA
FT                   AAVYTQNKVKGAPILVTKRHLADGKARAIICNSGNANTCNADGEEKAREMCRLAADALH
FT                   IAPEDVVVASTGVIGQVLPIEPIRDHVGTLAAHLSVDGADAAEEAIMTTDTRPKQAVVE
FT                   CKLGGKTCRIGGMAKGSGMIHPNMATMLSFVTTDADIDAAMLQKALRAAADKSFNMVTV
FT                   DGDTSTNDTLAILASGLAGNARITEEDADYLLFEQALENVLIRLARMVAGDGEGATKLL
FT                   TCVVEGAADEHTARVVAKEVVGSSLVKAAMFGSDANWGRVLCAIGYAPVDVDVKKVDVS
FT                   FSSVAGKVDVCRRGAGIDFSEDDASSVLMRNEVVIHIALHMGEATATAWGCDLTYDYVK
FT                   INGDYRT"
FT   gene            complement(156769..157734)
FT                   /locus_tag="Ethha_0148"
FT   CDS_pept        complement(156769..157734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0148"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; KEGG: scl:sce4967
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25735"
FT                   /db_xref="GOA:E6U656"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6U656"
FT                   /inference="protein motif:TFAM:TIGR01851"
FT                   /protein_id="ADU25735.1"
FT                   /translation="MKHRIFVDGRHGTTGLELGARLAARDDVEQIVIDPEKHRDPAARK
FT                   ACLNEAEIVFLCLPDAAAREAVALIENPAVRVIDASTAHRTASGWIYGFPELDKAQRGK
FT                   IRTASRVAVPGCHATGFNAAVHPLRAEGVLTADYPLTAQSISGYSGAGKAMIAQYEDTR
FT                   KDDPALKSPRLYALGLHHKHLPEMQAINALEKPPLFTPMVGPYRQGMLVLLPLRRELLA
FT                   KDLDAAAVRELYAAYYQGEPFIRVIPFDDQSGFDGGYFGADGANGTNRLDLFVFGHDEE
FT                   ILVVSRLDNLGKGASGAAVQCMNLMLGIDERTALVGAAHF"
FT   gene            complement(157731..159113)
FT                   /locus_tag="Ethha_0149"
FT   CDS_pept        complement(157731..159113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0149"
FT                   /product="argininosuccinate lyase"
FT                   /note="KEGG: hmo:HM1_1460 argininosuccinate lyase; TIGRFAM:
FT                   argininosuccinate lyase; PFAM: fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25736"
FT                   /db_xref="GOA:E6U657"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:E6U657"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ADU25736.1"
FT                   /translation="MKLWAGRFAKETDSRVNDFNSSISFDARMYREDIQGSVAHATMLG
FT                   EQGILTKEETASIIEGLGGILADIESGALPFDPEAEDIHMFIEAELTRRIGDAGKRLHT
FT                   ARSRNDQVALDVRLYLRREITAVRGLVTELLSALEKQARANKCTVMPGYTHLQRAQPIT
FT                   FGHHLLAYAQMFMRDDSRLADCARRMNECPLGSGALAGTTHPINRARTAELLDFDRPTA
FT                   NSLDGVADRDACIELLSALSLIMLHLSRFSEEIVLWCSWEFKFVELDDAYATGSSIMPQ
FT                   KKNPDVAELVRGKTGRVYGDLMALLTAMKGLPLAYNKDMQEDKEAVFDAIDTVKLCLST
FT                   FAPMLATMRVLSANMRRAASGGFINATDCADYLTKKGMPFRDAYKITGTLVAYCIGHGK
FT                   TLEALTLDEFQAHSPLFENDVFDAIALDTCVNGRVSQGGPGLSSVEAQLAQLHAFLQGA
FT                   EK"
FT   gene            complement(159141..160355)
FT                   /locus_tag="Ethha_0150"
FT   CDS_pept        complement(159141..160355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0150"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="TIGRFAM: argininosuccinate synthase; KEGG:
FT                   cth:Cthe_0179 argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25737"
FT                   /db_xref="GOA:E6U658"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:E6U658"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ADU25737.1"
FT                   /translation="MKKTYKKVVLAYSGGLDTSIIIPWLKENYGCEVIAMSADVGQGEE
FT                   LSGLEEKAKKTGASKLYIEDLRKEFVEDCIWPTLKAGAKYEKYLLGTSFARPIIAKRLV
FT                   EIARKEGADAIAHGATGKGNDQVRFELTVKAFAPDIPIIAPWREWDIKSRDEEIDYAEA
FT                   HHIPLRITRETSYSKDKNLWHLSHEGLDLEDPANEPKYNEMLEMGVSPEKAPDAPTYVT
FT                   LHFEQGIPTAVDGETLDAVSMVEKLNKLGGANGIGLLDIVENRLVGMKSRGVYETPGGT
FT                   ILYHAHEALETITLDRDTAHYKSLVAQKFAELVYDGKWYTPLREALSAFVDETQKTVTG
FT                   DVKMKLYKGNITNASVTSPWSLYDEDLVTFGEDHVYNQDDATGFINLFGLPLSVRAKLN
FT                   QKHGK"
FT   gene            complement(160555..161247)
FT                   /locus_tag="Ethha_0151"
FT   CDS_pept        complement(160555..161247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0151"
FT                   /product="dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase"
FT                   /note="KEGG: cbt:CLH_3041 dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25738"
FT                   /db_xref="GOA:E6U659"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6U659"
FT                   /inference="similar to AA sequence:KEGG:CLH_3041"
FT                   /protein_id="ADU25738.1"
FT                   /translation="MEPFIPEFEGNLRRHMLKVPESIRQASGIKIFGKLLKSFVFTTDV
FT                   SVIRNVNADAVIAVYPFTPQPIITQAIMLSADIPVFCGIGGGITMGKRVINNALNAEFQ
FT                   GAMGVVVNAPTANDIIALLCETVDLPVVVTVVSDEDISSRVEAGASIINVSGGPHTADI
FT                   VASIRSQYPKLPIIATGGPTDESISKTIRAGANAVTWTPPSSAEILAGIMRRYRTHPED
FT                   LQSRRLEN"
FT   gene            161498..162004
FT                   /locus_tag="Ethha_0152"
FT   CDS_pept        161498..162004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0152"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: cbe:Cbei_1958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25739"
FT                   /db_xref="GOA:E6U660"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E6U660"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADU25739.1"
FT                   /translation="MAALHEIPPEEISGNVFDLIGKQWTLITAGTESRFNTMTASWGGL
FT                   GVLWGGPAAFIFVRPQRYTLEFLHQNPKFTLSFYDESHRKALNLLGSKSGRDGDKVAEA
FT                   GLTPVFADGTTYFEEAGLVLFCEKWYESKMQPSGIKKPTAINPFYPQKDYHHMLVGKIT
FT                   KVLQA"
FT   gene            complement(162739..164400)
FT                   /locus_tag="Ethha_0153"
FT   CDS_pept        complement(162739..164400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0153"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; KEGG:
FT                   mta:Moth_2259 dihydroxyacid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25740"
FT                   /db_xref="GOA:E6U661"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:E6U661"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ADU25740.1"
FT                   /translation="MRSDLIKKGPTRASHRALLKALGLTDREIKRPFVAVVCAASDYIP
FT                   GHMHLQNIADAVKAGIQAGGGVPFEFNTIGVCDGIAMNHQGMKYSLCSRELIADSIEVM
FT                   LTAHPLDAVVFIPNCDKIVPGMVLAALRLNLPSIFISGGPMYAGHHNGERIGFNDVCEA
FT                   VGTHAAGKMSDEELCEIENEVCPGCGSCSGMYTANSMNCLTEAIGLSLPKAGTIPAVKS
FT                   ARIRLAKESGERIMELLNENLRPRDIINKDAVENAIRSDMALGCSTNTVLHLTAIANEA
FT                   GVEIDMGIFDELGKTTPQICKLSPATREFYIEDLDEVGGIAAVMKELAKAGIIHTDAVT
FT                   VQGMVGDRIAKAPAADGKCIRTLDNPYRKDGGIAVLRGNLAPEGSVVKQGAVLPDMMVH
FT                   EGPARVFNSEEEACDAIFGGKIEAGDVVVIRYEGPKGGPGMREMLTPTSALAGYGLDNS
FT                   VALITDGRFSGASKGAAIGHVSPEAAAGGLLAFVQEGDRISVDIPNRKLELLVPDEEIE
FT                   KRRQAGFHAPDRQLTGYLKRYAAMVTSGARGAVFEK"
FT   gene            complement(164471..165988)
FT                   /locus_tag="Ethha_0154"
FT   CDS_pept        complement(164471..165988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0154"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="KEGG: cce:Ccel_0396 lysyl-tRNA synthetase; TIGRFAM:
FT                   lysyl-tRNA synthetase; PFAM: tRNA synthetase class II (D K
FT                   and N); nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25741"
FT                   /db_xref="GOA:E6U662"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:E6U662"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADU25741.1"
FT                   /translation="MADVSSQQAEQETARQEEADLSEILRIRREKLSELQQAGQDPFAV
FT                   TTYDRDVFNKEIVERFDELEGKEVSIAGRLMSRRDMGKANFIDVHDATGRMQVYVRVND
FT                   VGEESFASFKKWDIGDIVGVKGKVFRTRRGEISIHATAVTLLSKSLLPLPEKFHGLKDT
FT                   ELRYRQRYLDLIMNPEVKETFVRRSRIIAFIRSFLEQKGFIEVETPILNVIPGGAAARP
FT                   FITHHNTLDMDLYLRIAPELYLKRLIVGGMEKVFEIGRLFRNEGIDVKHNPEFTSIEIY
FT                   QAYTDYNGMMRLTEELVAGAAQTVLGTMKITCGGEEIDLTPPWRRLTMVEAVKTYTGID
FT                   FDVLRGDDAAAVAAAKGLGVEIEKGKSWGDALYQTFDEKVEEQLVQPTFILDYPIEVSP
FT                   LTKRKADRPELTERFEFFILRREMGNAYSELNDPIDQRERFLRQVELRNAGDLEAGMMD
FT                   EDFVTALEYGMPPTGGLGIGIDRLVMLLTDSPSIRDVLLFPTMKPKE"
FT   gene            complement(166046..166519)
FT                   /locus_tag="Ethha_0155"
FT   CDS_pept        complement(166046..166519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0155"
FT                   /product="transcription elongation factor GreA"
FT                   /note="KEGG: cth:Cthe_2897 transcription elongation factor
FT                   GreA; TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25742"
FT                   /db_xref="GOA:E6U6K9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6K9"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ADU25742.1"
FT                   /translation="MAKQYVLTDAGLKKLEQELEQLKTEKRKEIAEKIKVALSFGDLSE
FT                   NSEYDEAKNEQAMVESRIATIEAMLKNVKLIDDDQLDTEAVNLGSKVQVFDVEFDETVE
FT                   YQIVGSTEADPDQNLISDESPVGRALLGHKVGDEVEAETPAGVLKFKVLNITK"
FT   gene            complement(166889..167773)
FT                   /locus_tag="Ethha_0156"
FT   CDS_pept        complement(166889..167773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0156"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ctc:CTC02509 cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25743"
FT                   /db_xref="GOA:E6U6L0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L0"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU25743.1"
FT                   /translation="MIEKIRYFVREGFKNIWVNRIMSIASICILTICLLLLGTSVLISI
FT                   NVHNLMNSVEQQNQIGVFLKDDADQAAIDQIGQDLRKLPDVAKVEFVSKAQALENEKKQ
FT                   LGKDQDLLSGVDKDNFFPNSYKVTLSNMQHYNLVVQKIHALPHIESVNEHSGVAEKLNS
FT                   ISSTVGWVGFWLFVLLAAVSLFIIVYTIKLAVYVRRREVNIMKFVGATDWFIRWPFFVE
FT                   GLLIGLLSGVIGSILQWYLYGGLIKRLFSSLRIIHPIAYSSVGVLLSLGFILSGILLGV
FT                   VGSLISVHRYLRV"
FT   gene            complement(167770..168450)
FT                   /locus_tag="Ethha_0157"
FT   CDS_pept        complement(167770..168450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0157"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="TIGRFAM: cell division ATP-binding protein FtsE;
FT                   PFAM: ABC transporter related; KEGG: tte:TTE1977 cell
FT                   division ATPase; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25744"
FT                   /db_xref="GOA:E6U6L1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L1"
FT                   /inference="protein motif:TFAM:TIGR02673"
FT                   /protein_id="ADU25744.1"
FT                   /translation="MIEFIDTVKIYDNGTKALRGINLTINDGEFVFVRGASGAGKSTLI
FT                   KLLMHEEVPTSGDVNINGFSVANMKRRDVPFLRRTMGVVFQDFRLIPNMCVYENVAFAM
FT                   RVIGARPQDIRRRVPYILSLVGLSKKAHSQPSELSGGEQQRVSLARALVNNPSFLIADE
FT                   PTGNVDPDMSVEIMELFDEINRRGTTIVMVTHDATLVERYGYHRVITIEAGQVVQDIPG
FT                   SASV"
FT   gene            complement(168535..169617)
FT                   /locus_tag="Ethha_0158"
FT   CDS_pept        complement(168535..169617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0158"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="KEGG: cth:Cthe_1861 CdaR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25745"
FT                   /db_xref="GOA:E6U6L2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L2"
FT                   /inference="similar to AA sequence:KEGG:Cthe_1861"
FT                   /protein_id="ADU25745.1"
FT                   /translation="MSNRLFQGVIQQMKETLDRVVGVIDENGTAIACSELGRIGEVHEN
FT                   VMTELAGAPLLLRGGWTYKPFGSRPRPDYAIFVEGSDPVAAKYAGILAVALTSIKQYYD
FT                   ERYDRGNFIKNVILDNILPGDIYLKARELHLSAEVLRVVLLIRVADKNDVSVYDVVQNL
FT                   FPDRQKDFIINISENEIALVKEVRQGIETSDLDKLAHSVVDTLSSEFYTHASVGIGTIV
FT                   TGVKDLARSFKEAQVALEVGKVFDIEKNIISYDNLGIARLIYQLPTTLCEMFLDEVFKK
FT                   GSIDSLDQETLFTIQRFFENNLNVSETSRKLFVHRNTLVYRLEKIKKLTGLDLREFDHA
FT                   IIFKVALMVKKYLVTNPERF"
FT   gene            complement(170004..170717)
FT                   /locus_tag="Ethha_0159"
FT   CDS_pept        complement(170004..170717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0159"
FT                   /product="pseudouridine synthase"
FT                   /note="KEGG: sth:STH1527 ribosomal small subunit
FT                   pseudouridine synthase A; PFAM: pseudouridine synthase;
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25746"
FT                   /db_xref="GOA:E6U6L3"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L3"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ADU25746.1"
FT                   /translation="MPLLRLDKLLAGQGQGSRKEVHTLLRGGRVQVDGQTVTDAGQKVD
FT                   PDRQRVTLDGHALLWRAHLYLMMNKPAGVISASRDPKARTVLDLLPADLCRPGLFPAGR
FT                   LDKDTEGFLLITDDGAFAHDILAPRRHVEKIYLATLDRPADTADTDAFATGLTLEDGLH
FT                   CLPARLWLGEGTDAYAAVREGKFHQVRRMFAARGKQVVHLRRIQIGGLALDESLAPGEA
FT                   RELTPAERDRIGLRL"
FT   gene            complement(170961..171503)
FT                   /locus_tag="Ethha_0160"
FT   CDS_pept        complement(170961..171503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3285 putative glutathione
FT                   S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25747"
FT                   /db_xref="InterPro:IPR032257"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L4"
FT                   /inference="similar to AA sequence:KEGG:Mpe_A3285"
FT                   /protein_id="ADU25747.1"
FT                   /translation="MLVASVKVSALRAAVVVFALAVLAGAALWPSRGVVTVWSGQSYRG
FT                   VSDNAKRVAFLEKFGWTVDPTPTEVVEVVIPQTFDQVYRNYNKLQKKQGLDLTPYKGAR
FT                   VKRWTYRVTNYPNYDGEVFADLLIQNNDTVVAGDVRTVAVSGFIQGLARPNPQTGVPTL
FT                   SPAAADITAGMFPNRAV"
FT   sig_peptide     complement(171429..171503)
FT                   /locus_tag="Ethha_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.624 at
FT                   residue 25"
FT   gene            complement(171601..171957)
FT                   /locus_tag="Ethha_0161"
FT   CDS_pept        complement(171601..171957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_13060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25748"
FT                   /db_xref="GOA:E6U6L5"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L5"
FT                   /inference="similar to AA sequence:KEGG:RER_13060"
FT                   /protein_id="ADU25748.1"
FT                   /translation="MNRMVLESWAIVIIMGVAAYMFGRARRKAWSFRVLPLILAPLANI
FT                   VYTPFAKELADRGSDAGAVRILVYIAAFAVTAVWVVFCARKLSPRVAKWGYISCTLAFT
FT                   AIELIIFAVKLIRF"
FT   gene            172166..172756
FT                   /locus_tag="Ethha_0162"
FT   CDS_pept        172166..172756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0162"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="KEGG: cbl:CLK_0308 TetR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25749"
FT                   /db_xref="GOA:E6U6L6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L6"
FT                   /inference="similar to AA sequence:KEGG:CLK_0308"
FT                   /protein_id="ADU25749.1"
FT                   /translation="MQKQAMRARLMETVRHLLSQGSDPATLTSRGIGAAANVSPAMINY
FT                   CWGGKDALVSAAIEEQIAEAAERFRSAPPDGTPPLERLRTMLWELSELVVQYRQYTKTT
FT                   IPYALLHGEIEAPRYILPLIRARFEGKKNETECRILAHALISSVTLAYFREDAFERYAG
FT                   LDLRDREARRRLLDMLLDLLLGGNTHGTDRLPE"
FT   gene            172731..173810
FT                   /locus_tag="Ethha_0163"
FT   CDS_pept        172731..173810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0163"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mla:Mlab_1187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25750"
FT                   /db_xref="GOA:E6U6L7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU25750.1"
FT                   /translation="MELTAYLNKNIDYLFRRALSAAMRNPRESTFLLRQAHRQARAAAK
FT                   RRRSEQTGQAVPAFLIASVASACNLRCAGCYARADGACNTEEACLLPAARWAELFEEAA
FT                   AMGISFILLAGGEPLTRVDVLEAAARVPSAVFPVLTNGTLFDAAVLRLFDRHRNLVPVC
FT                   SIEGGQTETDARRGAGVYHLLEQTWRAFRARGILFGVSVTVTAENHLRVTEAAFLGGLR
FT                   AKGCGVVLFVEYVPADANASLHPPDDAQRAAYSARLLTLQTVYPDLILIAFPGDEAKTG
FT                   GCLAAGRGFFHISASGGAEPCPFAPVSDVDLHTGSLADALRSPLFCALRENGMLAMAHD
FT                   GGCALFGKKAELESLAGTE"
FT   gene            173981..174316
FT                   /locus_tag="Ethha_0164"
FT   CDS_pept        173981..174316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xla:734406 hypothetical protein MGC115024"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25751"
FT                   /db_xref="GOA:E6U6L8"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L8"
FT                   /inference="similar to AA sequence:KEGG:734406"
FT                   /protein_id="ADU25751.1"
FT                   /translation="MTKFKENWNRFSTARKILTVLVWVIGCVVLLLSVFGLLNFLPLEQ
FT                   TNPVVLLLLGISFSINGILQKENKAVRILLILVSVFILLSLAVVFVPKMLHEYPKQAFC
FT                   LAFGTRM"
FT   sig_peptide     173981..174115
FT                   /locus_tag="Ethha_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.751) with cleavage site probability 0.256 at
FT                   residue 45"
FT   gene            174390..174493
FT                   /gene="ffs"
FT                   /locus_tag="Ethha_R0001"
FT   ncRNA           174390..174493
FT                   /gene="ffs"
FT                   /locus_tag="Ethha_R0001"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            174536..176215
FT                   /locus_tag="Ethha_0165"
FT   CDS_pept        174536..176215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0165"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; KEGG:
FT                   cth:Cthe_2144 DNA polymerase III subunits gamma and tau;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25752"
FT                   /db_xref="GOA:E6U6L9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L9"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADU25752.1"
FT                   /translation="MYQALYRKWRPRTFEDVAGQPQIVATLLGELRAGRVAHAYLFTGS
FT                   RGTGKTTCAKILAKAVNCLHPQNGDPCGECAVCRGIDDGSLTDVVEIDAASNNGVDSIR
FT                   ALREETVYTPAAAKYRVYIIDEAHMLSAGAFNALLKTLEEPPAYVLFILATTEAHKIPA
FT                   TILSRCQRFDFRRIPPADIAARLLYVAEQEHIPLTQDGAEAIARLADGALRDALSLLDT
FT                   CANGGGDAVDEEAVARAAGLAGRDYLYALSDAVHAGDAPQALRTLDELYASAKDADRLC
FT                   EELIGHFRAIMLTQAGSIPPVSASEAGRLQDAARDFDPETVLHALDTLQHTAETLRRAP
FT                   VKRVEMEMGLLRLCNPALDTSPAALLRRIAALETQVKAGGLRAEATAAGLHMPPGAPAR
FT                   GGAPKADAALPWTEPPAAPETPAATSRRAAQKQAQPENDAPPADSSEESAEPLACWPEV
FT                   LEELGRIDPPLRGVLDKSKAVVRGAYVLVDAGNVMFADLIRQPLHQKPLVEAVRTATGK
FT                   PYKVGVFKSSLHAAQKEKSDDPFDALLRTAMDGGVPIREKEQ"
FT   gene            176253..176600
FT                   /locus_tag="Ethha_0166"
FT   CDS_pept        176253..176600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0166"
FT                   /product="Uncharacterized protein family UPF0133"
FT                   /note="PFAM: Uncharacterised protein family UPF0133; KEGG:
FT                   amt:Amet_4780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25753"
FT                   /db_xref="GOA:E6U6M0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M0"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADU25753.1"
FT                   /translation="MKARLPKGYGGGSSDMNSMIKQAQKMQEAIGKVQAELDEREYTVT
FT                   SGGGMVEVQITGKREIKQIHIKPEAVDPDDIEMLQDLIVAGVNEAIRKVDETAEQEMGK
FT                   VTGGLNMPGLI"
FT   gene            176606..177127
FT                   /locus_tag="Ethha_0167"
FT   CDS_pept        176606..177127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0167"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: cdl:CDR20291_2264
FT                   NUDIX-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25754"
FT                   /db_xref="GOA:E6U6M1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M1"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADU25754.1"
FT                   /translation="MEWMDLRDGTGRPTGRLVPREHALQNGEFMLAVHVFIYRDDGRFL
FT                   LQKRSLRKRLYPGKWDITGGGVRAGESSLEAACREVEEEVGLTLPPRRMQKLARLKRPP
FT                   CFFDVWACRHAFEMDELVLQAEEVDAVRLVTPQEMLTVLFEEEYPDGGYRRVLADFLAN
FT                   AADAPLFRNG"
FT   gene            177164..177763
FT                   /locus_tag="Ethha_0168"
FT   CDS_pept        177164..177763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0168"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: TOPRIM
FT                   domain-containing protein; Zinc finger C4-type, RecR; KEGG:
FT                   cth:Cthe_2142 recombination protein RecR; SMART: Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25755"
FT                   /db_xref="GOA:E6U6M2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M2"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADU25755.1"
FT                   /translation="MAYYAAPLSRLIEQFERLPGIGRKTAQRLAFFVLDGTNEQAKAFA
FT                   QAILDAKGQMHTCKVCQNLTDGEICTICGNPARDHTTICVVEDPRDVVAFERTRDYNGL
FT                   YHVLHGVISPMDGIGPEQLHIKELLARAADGVQEIILATNPDVEGEATALYISRLIRPL
FT                   GVKVTRIAYGIPVGGELEYADEITLSRALEGRSELH"
FT   gene            complement(177866..178477)
FT                   /locus_tag="Ethha_0169"
FT   CDS_pept        complement(177866..178477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0169"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cbk:CLL_A1977
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25756"
FT                   /db_xref="GOA:E6U6M3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU25756.1"
FT                   /translation="MNKVTNRRGHAAQTQQDIFRVALELFRTTGYELTTIQDICEKANV
FT                   SVGAFYYYYKSKEDVLNDSYRQIDYTLNEKYAHVQFEDPVCGITEILCSLAGYVQEQGF
FT                   RIPAQIYKKQITATDRFMLDPNREYCILVSRLVAQACAGGRFSADYSEQTVTETILRMM
FT                   RGILYDWCLHDGSYDLVQQARADMRIILHHFEQANDLQPA"
FT   gene            complement(178774..179688)
FT                   /locus_tag="Ethha_0170"
FT   CDS_pept        complement(178774..179688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0170"
FT                   /product="PHP domain protein"
FT                   /note="KEGG: rsk:RSKD131_1254 PHP C-terminal domain
FT                   protein; PFAM: PHP domain protein; SMART: phosphoesterase
FT                   PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25757"
FT                   /db_xref="GOA:E6U6M4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M4"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADU25757.1"
FT                   /translation="MRSLYDTGGAWYKGNLHTHTTRSDGRLPAGEAIGFYREAGYDFIA
FT                   LTDHWRQSEPLEEPGFLQLAGCEFDTGNMTDLVRQPVFHIVGVGMERAVALPKAHDHPP
FT                   QVLIDAIREAGGLAILAHPAWSLTDPALVPPLSGLSAAEIFNTFSGLPHSNARPESSLY
FT                   FDIWALQGFLLPCTAADDCHWYEGEQGRSFMMVNASALTAQAIRAAIAAGNFYASQGPR
FT                   FEQIRYDGETVEISCSEVQTVIFYSNTLYSADRLTLAESGGTVTAARYAVKPSDRYIRV
FT                   ELIDREGRHAWSAPFAAEKTRNR"
FT   gene            complement(179738..181096)
FT                   /locus_tag="Ethha_0171"
FT   CDS_pept        complement(179738..181096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0171"
FT                   /product="Bleomycin hydrolase"
FT                   /EC_number="3.4.22.40"
FT                   /note="KEGG: lmh:LMHCC_0267 aminopeptidase C (bleomycin
FT                   hydrolase); PFAM: peptidase C1B bleomycin hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25758"
FT                   /db_xref="GOA:E6U6M5"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M5"
FT                   /inference="protein motif:PRIAM:3.4.22.40"
FT                   /protein_id="ADU25758.1"
FT                   /translation="MNMDHASGISAELAARASQAFAASPAHALADSIAKNGIDNTVYHR
FT                   AAAVRMNHLFSHEIEPMTITNQQKSGRCWLFAGTNVLRYHLRNTLHVKNADFELSQSYL
FT                   MFWDKLEKGNYFLEGVLDTADQPKDSRTVMWLFQNPLNDGGQWDMLVALVEKYGVVPKL
FT                   AMPESFHSGNSAKLNAVLARKLRRDGIELRALQAKGQSAETLRTRKEEMVAEFYVLLCC
FT                   FLGEPPKTFDFTWRDKDGAFHRDAGQTPRGFYETYFGKDFLAGYVSVINAPTDEKPYDR
FT                   TYTVKYLGNVVGGRPVRYLNLPNEELVRAASRQIRDGRPVWFGSDVGKVSDRQAGILDT
FT                   ALYPYAEALHTTLDIDKGDMLDYGESCLTHAMMLLGVDVTEAGVQKWKVENSWGKDVGE
FT                   KGFFVMSADWFADYVCQVVVDQAYLTEAQHKALEQPPIELEPWDPIGALARLG"
FT   gene            181566..181850
FT                   /locus_tag="Ethha_0172"
FT   CDS_pept        181566..181850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgo:TGME49_118710 ATP-binding cassette
FT                   sub-family F member 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25759"
FT                   /db_xref="GOA:E6U6M6"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M6"
FT                   /inference="similar to AA sequence:KEGG:TGME49_118710"
FT                   /protein_id="ADU25759.1"
FT                   /translation="MVKGVERKIIEIRDNGSGCFERALFFVRADVPSPLAEPTLAGEAA
FT                   RIIERFCRAKKGGRRPFRALFLMAMRYAACAAGGAGAATLFWLLGGGHF"
FT   gene            complement(181859..182818)
FT                   /locus_tag="Ethha_0173"
FT   CDS_pept        complement(181859..182818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0173"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: eel:EUBELI_01673 hypothetical protein;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25760"
FT                   /db_xref="GOA:E6U6M7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M7"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADU25760.1"
FT                   /translation="MFIGNVEIKGHTALAPMAGVADTAFRTVCKAHGAAYVVGEMASAK
FT                   GFVMQATKTAELLGVTDAERPMAIQLFGSEPDVMAEAARRALAFSPDIIDINMGCPAPK
FT                   VAGNGGGSALLKDPALAGRIVRAVANAVPVPVTVKIRKGWDAAHVNAVEIARIAEENGA
FT                   AAVAVHGRTRAQQYAPPADWDIIAAVRRAVRIPVIGNGDVDSPQAAAHMLAQTGCDLVM
FT                   IGRAALGRPWLFGQVETYLRTGELLPEPNPARRMAVLLDHVRLLCALKGEHIGMREARK
FT                   HAAWYMKGLHGAALLRGEANKLDTFADLERLAAAAAKE"
FT   gene            complement(182924..184825)
FT                   /locus_tag="Ethha_0174"
FT   CDS_pept        complement(182924..184825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0174"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   ckr:CKR_1659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25761"
FT                   /db_xref="GOA:E6U6M8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M8"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADU25761.1"
FT                   /translation="MNMKDFLLGKPLKNSDIKDQKLSRGWGLPLMASDAVSSVAYAGEE
FT                   ILLVLVPVIGLGAFHFVPWITLAIILLLLILIFSYSQIIDHYPNGGGAYIVSSENLGKY
FT                   PALLAAASLVVDYIMTVAVSVSSASDAIVAAFPGTAPAKVWIAIVFVLLITFGNLRGIR
FT                   ESARLFGTPTYIFIGCLGLLIIVGFVRVLTGTIHPVAYTQQMTQSLSTSMAGLSIALIL
FT                   RAFASGCSALTGVEAVSNSIPNFKEPSQRNAKHILFMLGGVIVFLFGGSTLLELKLRVI
FT                   PVSGGTILSQLGTAVFGNSILFYILQLFTAIILILAANTAYNGLPLLLYILAHDGYVPR
FT                   QFAHRGTKLSFSNGIMFICIAAVLLILVFQAKTTNLIPLYSVGVFISFTLSQYGMFRKW
FT                   HKTRDKGWQYKMWINGVGAVLTLIGVGVEVSTKFTQGAYMIVIAIPVLMLLMVYVQKHY
FT                   SKVGSELKLNRFHPYYDQATAHSTQVIVLMQSVNKSLLKSLNYANSISDDVTVLHICRH
FT                   PEHAAQLREEWNRLDIPVKLEIVLTPYQDIIAPLDKYICKREAALKHGETLSVIIIKFV
FT                   SEHWYDAVLHNQTTYFLERVLSRHKNVSSIILPFHYNPESTKVKAATRDEETPGEKG"
FT   gene            complement(185055..186302)
FT                   /locus_tag="Ethha_0175"
FT   CDS_pept        complement(185055..186302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0175"
FT                   /product="ABC-type Na+ efflux pump permease component-like
FT                   protein"
FT                   /note="KEGG: cce:Ccel_1178 ABC-type Na+ efflux pump
FT                   permease component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25762"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M9"
FT                   /inference="similar to AA sequence:KEGG:Ccel_1178"
FT                   /protein_id="ADU25762.1"
FT                   /translation="MKNIGTIFRFTFREQARKKSYVIVTVLLMLVAAALVALPVLIPQW
FT                   QSGKANGKASRSVVYFDDKTTATIDPAALQQALPAYTVKTVPDGQLDALRKNILAGKEE
FT                   SGAVMAVYQETDDTNRASLSYYERSRDSGPGADELAEIIRNLRMEHLLRRAGLGPQEAD
FT                   YILQAVPATTQTGDHSDNMTGFIPAIAVCILLFIAIFTYGIWVATSIASEKTSRVLEVL
FT                   ITSTKPSAIIVGKSLAMGALGLLQLLLILGAGAVSYMAVGGASKLAVLSFASFTPGAFA
FT                   LLFVYFVLGFSLYAMLSAVAGASVSNADDLRSAMQPITILGMLSFYLAYGSFMAPGTPL
FT                   SLVASFIPFSAPFAMPARLMMAGVPWWQIVLSLLLLAGTTWGMGALSIRLYASAVLHYG
FT                   KQLKLKDLFRMAGHAK"
FT   sig_peptide     complement(186189..186302)
FT                   /locus_tag="Ethha_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.522 at
FT                   residue 38"
FT   gene            complement(186299..187195)
FT                   /locus_tag="Ethha_0176"
FT   CDS_pept        complement(186299..187195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0176"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cce:Ccel_1177 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25763"
FT                   /db_xref="GOA:E6U6N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU25763.1"
FT                   /translation="MGLHVEHVRKQYGGKTAVQNLSFTMDSPGVFGLLGTNGAGKTTTI
FT                   RMLLGILEQDAGTITWDGRPVTRENVSFGYLPEERGLYPKIRVGEQLFYFASLRGMNAQ
FT                   AARQSIRRWYERLEIGKYDRMTADQLSKGNQQKVQLAAALLHDPDLVVLDEPISGLDPV
FT                   NADLFADVMREQAAEGKYIVLSSHQMESVEAFCRDILMLKDGQTVLQGNLRAIKDGYGR
FT                   TNLSVECGKDVHARAETAGLTVLEQDARGLECRIRDEADAYRFLRGLLDDGVRIDRFEI
FT                   RTPSLHEIFVEKAGARA"
FT   gene            complement(187246..187686)
FT                   /locus_tag="Ethha_0177"
FT   CDS_pept        complement(187246..187686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CA_C3323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25764"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N1"
FT                   /inference="similar to AA sequence:KEGG:CA_C3323"
FT                   /protein_id="ADU25764.1"
FT                   /translation="MRIGKMEFNKRMHLRVNWSAACVAAGLALLIGSMAAGHLDDLGGS
FT                   FLAGAGAGLLAAGVVLLVKTLHTLRDPEKQRVARIEEEDERNLLIDMRSSQWTLFVGIL
FT                   VLAVAAGVTAFFNRDMMHALSAVLLLLIAVKWISMVVLRRWG"
FT   sig_peptide     complement(187573..187686)
FT                   /locus_tag="Ethha_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.708 at
FT                   residue 38"
FT   gene            complement(187691..187885)
FT                   /locus_tag="Ethha_0178"
FT   CDS_pept        complement(187691..187885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0178"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: slp:Slip_1330 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25765"
FT                   /db_xref="GOA:E6U6N2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU25765.1"
FT                   /translation="MENRLRELRRLRGMTQQALADAADISRQTVIAIEAGRFNPSVLLA
FT                   FRLAKALGVTIEDIFLFER"
FT   gene            188053..188126
FT                   /locus_tag="Ethha_R0002"
FT                   /note="tRNA-Gly1"
FT   tRNA            188053..188126
FT                   /locus_tag="Ethha_R0002"
FT                   /product="tRNA-Gly"
FT   gene            188214..188786
FT                   /locus_tag="Ethha_0179"
FT   CDS_pept        188214..188786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ske:Sked_06170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25766"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N3"
FT                   /inference="similar to AA sequence:KEGG:Sked_06170"
FT                   /protein_id="ADU25766.1"
FT                   /translation="MEQQHDKRTWNLSRAAAITALCSLGILVCLGELRQRNIFFYFFGL
FT                   QTKLVLRITGGVLLSAVCGLIMVNLKNVVLTTIAAILYIIALMLYFICNVWTSGEEKYY
FT                   EFQSPDHKRTIVVEECSWLLAGGSNVYQKTSPFTITKLKSDISTDDGYRPFENKDFAIT
FT                   WSARTVTIAYGFGNGGDTRPFTTVQLQ"
FT   gene            complement(188859..190121)
FT                   /locus_tag="Ethha_0180"
FT   CDS_pept        complement(188859..190121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0180"
FT                   /product="protein of unknown function DUF815"
FT                   /note="KEGG: clj:CLJU_c26700 hypothetical protein; PFAM:
FT                   protein of unknown function DUF815; AAA ATPase central
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25767"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N4"
FT                   /inference="protein motif:PFAM:PF05673"
FT                   /protein_id="ADU25767.1"
FT                   /translation="MDTVQKARLALSSLGLYRPLLEKPVVAAFAKVLETAHGAELRGFL
FT                   DAYGAFISLLAPARATAGVLDFSGALHTLVQQNDSLFARQAAAGRVEEAVRAAAARDLE
FT                   ALSMALDLSPREIKAAASASFDDDDSVAFIDSLPDFITGGSFSTEETKQFHATHGCGVF
FT                   ASFGAFKWQRGVSGDSSLFGISSPDPVRLAQLKGYEYERNIVLENTANFLDGISANNML
FT                   LYGDRGTGKSSTVKAVFNEFRGRGLRIIEVSKDCIVEFARIIERIGSVPLKFIIFIDDL
FT                   SFSDDDDNYSALKAVLEGGVAARPRNTVIYATSNRRHFVKESFSERDSEIHAGDAMQEK
FT                   LSLADRFGITVTFTSPDQRLYFDIVRALAADRGLDVDGAQLERGAAQWALRYNGRSPRT
FT                   ATQYIDWVAGRIKKGLPLDDF"
FT   gene            190543..192165
FT                   /locus_tag="Ethha_0181"
FT   CDS_pept        190543..192165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0181"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="KEGG: cth:Cthe_2516 acetolactate synthase, large
FT                   subunit; TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; thiamine pyrophosphate central
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25768"
FT                   /db_xref="GOA:E6U6N5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N5"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ADU25768.1"
FT                   /translation="MPNGAQAMVTALEAEGVRTLFGYPGAAICPFLDALAASDITYHLV
FT                   RHEQSAGHAASGYARVSGSPGVCFATSGPGATNLITALATAYMDSIPLVAITGQVQSGL
FT                   IGRDVFQEADITGAAEPFCKHSYLVRDANDLPRVMKEAFYIARSGRPGPVLVDVPSDIQ
FT                   EQPVTSPAHHEKVDIRGYKPRTKGHALQIKRVAERVARAQKPVICAGGGIFSAHAQAVL
FT                   AAFAEKCRIPVVNTLMGIGALPAAHPLAFGMLGTHGRAVANHALHNCDLLIIAGGRVGD
FT                   RSVAEPDQIAARTCVVHIDVDPAEIGKNMDAELPLVGDLRLVLEALTEQTVPGDTAAWV
FT                   ASLESLRDAPEPARPPHSGCIEPRAFFRTLAAQMEDDAVVVADVGQSQIWAANHLAMRH
FT                   GRFLTTGGMGTMGYSLPAAVGAAVALPERQIVAVCGDGAFHMSMMELATIRQYRLDIKL
FT                   VVMHNDCLGMVHELQTKHYGGRYVATSLGCGDPDFQLLAKAYGLESRRVENDADVPDAV
FT                   ARMLHAPGPYLLECRIDPDEPTL"
FT   gene            192195..192719
FT                   /locus_tag="Ethha_0182"
FT   CDS_pept        192195..192719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0182"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="KEGG: cce:Ccel_3436 acetolactate synthase, small
FT                   subunit; TIGRFAM: acetolactate synthase, small subunit;
FT                   PFAM: Acetolactate synthase, small subunit-like; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25769"
FT                   /db_xref="GOA:E6U6N6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N6"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ADU25769.1"
FT                   /translation="MKHTLSVLVENRPGVLSKVAGLFSRRAFNIDSLAVGVTQDPSVSR
FT                   ITIVVDGDEYTTEQVEKQLNKLIDVIKVKTLPHGQFISRELVLLKVACMAANRSEVVQI
FT                   ADIFDARIVDVTRTTLTLEISGTASRIASLESLLAPYGIRETVRTGTIALEKGAQDITA
FT                   GRKPAEEPSVS"
FT   gene            192812..193804
FT                   /locus_tag="Ethha_0183"
FT   CDS_pept        192812..193804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0183"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; KEGG:
FT                   cpy:Cphy_3020 ketol-acid reductoisomerase; PFAM:
FT                   Acetohydroxy acid isomeroreductase catalytic
FT                   domain-containing protein; acetohydroxy acid
FT                   isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25770"
FT                   /db_xref="GOA:E6U6N7"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N7"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ADU25770.1"
FT                   /translation="MAKMYYESDCNISLLKGKKIAIIGYGSQGHAHALNLNESGIDVIV
FT                   GLYKGSRSWHVAEAAGLTVMTAAEAAAEADIIMILINDEKQAAMYEKDIAPNLTEGKAL
FT                   AFAHGFNIHFGQIVPPKNVDVFMVAPKAPGHTVRSEYLRGAGTPCLIAVEQDHSGKTKE
FT                   IALAYAAGIGGARAGILETTFRVETETDLFGEQAVLCGGVTALMQAGFETLVEAGYAPE
FT                   NAYFECIHEMKLIVDLIYAGGFEAMRKSISDTAEYGDYITGPKIITDETRKAMKDVLKD
FT                   IQEGKFAREWILENRVGRPNFNALRRKGAEAQLVEVGQQLRSQMTFLKK"
FT   gene            complement(193879..194502)
FT                   /locus_tag="Ethha_0184"
FT   CDS_pept        complement(193879..194502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0184"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: kol:Kole_1528
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25771"
FT                   /db_xref="GOA:E6U6N8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N8"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADU25771.1"
FT                   /translation="MQGQSGCPVQRRPLCCLDGRLPVGGCILTCQTGRSGLYYKEMQHP
FT                   AHGIARRAGQERGVALEKPHKETRNTKQKQLILDCMKNAGGAHMTAEEIYNRIRQESQT
FT                   ISIATVYRNLRLLEENGTVKKVYVADDSLAYYEMSDAQSPHAHHHLVCRKCGAILDFEA
FT                   DLLDGLERLIESTKHFQIEDHRVVFYGVCEACRRRDGENAQPRK"
FT   gene            complement(194789..196726)
FT                   /locus_tag="Ethha_0185"
FT   CDS_pept        complement(194789..196726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0185"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="KEGG: cce:Ccel_1373 threonyl-tRNA synthetase;
FT                   TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); Threonyl/alanyl tRNA synthetase
FT                   SAD; TGS domain-containing protein; Anticodon-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25772"
FT                   /db_xref="GOA:E6U6N9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N9"
FT                   /inference="protein motif:TFAM:TIGR00418"
FT                   /protein_id="ADU25772.1"
FT                   /translation="MPNITLKDGSIRAVEPGATALALAKELGAGLYKAVCAARIGGKVV
FT                   DLRTQLQDGDTLELLTFDDPDGKKAFNHTASHILAQAVKRLYPEVKLTIGPAIEDGFYY
FT                   DFDSDLSFTQEELAKIEAEMKKIVKEDLPIERFTLPAPEAVKLMEEKSEPYKVELINEH
FT                   AGKGEPISFYKQGEFTELCAGPHLPDTGRVKAFKLTSSTGAYWRGDAKNKMLRRVYGTA
FT                   FPKKAELDAHITMLEEARKRDHNKLGRELGFFTTVDYIGQGLPVMLPKGSRVLQLLQRF
FT                   VEDEEEKRGYLLTKTPLLAKSDLYKISGHWDHYRDGMFVLGDEEKDDEVFALRPMTCPF
FT                   QFQVYLNKKRSYRDLPMRLGETSTLFRNEASGEMHGLIRVRQFTISEGHIACRPDQLEE
FT                   EFKGCVDLANFMLKTVGLDEDVSYRFSKWDENDRDKYIGTSEQWEEVQDRMRNILDDLG
FT                   IQYTEASGEAAFYGPKLDIQIRNVFGKEDTLITVQIDFQLAKRFEMKYTDTDGQEKYPY
FT                   VIHRTSIGCYERTLALLIEKYAGAMPTWLAPEQVRVLPISEKHEAYAQPVLEKLRAAGL
FT                   RATVDQRNEKIGYRIREAQLEKVPYMLVAGDREAEEGTVSVRARVGEGGTQTVDAFLKD
FT                   ILQEIAEKRH"
FT   gene            197351..197785
FT                   /locus_tag="Ethha_0186"
FT   CDS_pept        197351..197785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0186"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   cpy:Cphy_2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25773"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P0"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ADU25773.1"
FT                   /translation="MSGILLFWLIVVIVLVVIELATIQLVAIWPAIGGVFAMLAASFGQ
FT                   SLLIQFLLFVGISAVLLFFTRPFLKRFIKTPPRTSTNADRLIGREAVVCERIDNLAETG
FT                   AVVVSGVTWMARSGTGAPIPAGEKVRIERIEGVKLIVSVE"
FT   gene            197825..198787
FT                   /locus_tag="Ethha_0187"
FT   CDS_pept        197825..198787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0187"
FT                   /product="band 7 protein"
FT                   /note="KEGG: ere:EUBREC_3261 membrane protease subunits,
FT                   stomatin/prohibitin-like protein; PFAM: band 7 protein;
FT                   SMART: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25774"
FT                   /db_xref="GOA:E6U6P1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P1"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADU25774.1"
FT                   /translation="MDVTILIWIVLAIVIIGVLISCFRIVPQASAFVVERLGAYYTTWS
FT                   SGSIKFKAPFIDRIAKIISLKEQVVDFPPQPVITKDNVTMQIDTIVFFQVTDPKLYTYG
FT                   VERPIQAIENLTATTLRNIIGDLELDHTLTSRDVINTKIRTILDVASDPWGIKVNRVEL
FT                   KNIVPPREIQDAMEKQMKAERERRQAVLRAEGEKASQVLVSEGQKQAQILQAEAAKESA
FT                   ILHAEGVKQSKIIEAEGEAEAIIKVQQALADSLKLLNAAAPTDKVIALKSLDALAKVAD
FT                   GKATKIIIPSELQSLASLAVSVKELVTGDPAPAQPVEKA"
FT   gene            199244..199750
FT                   /locus_tag="Ethha_0188"
FT   CDS_pept        199244..199750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0188"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; KEGG: cce:Ccel_2185
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25775"
FT                   /db_xref="GOA:E6U6P2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P2"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ADU25775.1"
FT                   /translation="MQELKKVAVIMGSDSDLPVVKGCLTTLKEFGVPFEVHVCSAHRTP
FT                   GKAAAFAKSAAENGFGVLIAAAGMAAHLAGAMAAQSVLPVIGIPVKSAAFGGLDALLST
FT                   VQMPSGIPVATVAVDGAKNAAFLSIQILALGNAELTQKLLDYKQSMADGVEKKDMALQT
FT                   EVEKL"
FT   gene            199747..200463
FT                   /locus_tag="Ethha_0189"
FT   CDS_pept        199747..200463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0189"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   KEGG: cpy:Cphy_3045
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25776"
FT                   /db_xref="GOA:E6U6P3"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P3"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADU25776.1"
FT                   /translation="MSTKLEQIYEGKAKKVYKTDDPELFIVDYKDDATAFNGKKKGTIS
FT                   GKGVINNRVTNFLMEKLEKEAGVPTHFVKELSERETLVKKVTIVPLEVIIRNIAAGSMS
FT                   KRLGIPEGTVLPIPTLEFSYKNDDLDDPLINDYHALAMGLATREDIDTITTLAFKVNDY
FT                   LKTFFAGIGIELVDFKLEFGKTTDGTIILADEISPDTCRFWDSKTHEKLDKDRFRRDLG
FT                   NVEGAYQEILHRLFGE"
FT   gene            200576..202072
FT                   /locus_tag="Ethha_0190"
FT   CDS_pept        200576..202072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0190"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="KEGG: cth:Cthe_1249 amidophosphoribosyltransferase;
FT                   TIGRFAM: amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25777"
FT                   /db_xref="GOA:E6U6P4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P4"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ADU25777.1"
FT                   /translation="MQDKPHEECGVFGIYDYEGLDVAHTAYTALYALQHRGQESCGIAV
FT                   NDDGIIRAHKDLGLVPDVFQETELNKLGAGQMAVGHVRYSTTGGNTRENAQPLVMKYAK
FT                   GTIALAHNGNLVNAFELRKQLEQSGAIFQSTNDTEVMAYIVARNRLHTPSIEQAFLETM
FT                   KTIRGAYSVVLMSPRKLIAARDPQGYRPLCVGQVGKSVVFASETCALDAIGADYVRDVE
FT                   PGEIVVAEGGRITSIRELCGQKPSQCIFEFIYFARPDSFIGGASVHLARKEAGRCLAKE
FT                   YPVEADLVVGVPDSGIDAALGYAEESGIPYGLGFIKNRYVGRTFIQPTQIQRARAVRIK
FT                   LNALRSAVAGKRVVMVDDSIVRGTTSARIVALLREAGATEVHVRISSPPFTNPCYFGTD
FT                   IDSRDNLIACRMSIPEIRDTISADSLGYLRVEDLAHIVPGLKDGYCAGCFTGRYAVEVP
FT                   DDVPKDRFERKLSEKKNAVDFRIIKNENGDSDAWPAAGGA"
FT   gene            202073..203107
FT                   /locus_tag="Ethha_0191"
FT   CDS_pept        202073..203107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0191"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; KEGG: cce:Ccel_2183
FT                   phosphoribosylaminoimidazole synthetase; PFAM: AIR synthase
FT                   related protein domain protein; AIR synthase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25778"
FT                   /db_xref="GOA:E6U6P5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P5"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ADU25778.1"
FT                   /translation="MKSFSESYKAAGVDVTAGYKAVELMKAHVARTMVPGVMEGLGGFG
FT                   GLFDLGELNLRHPVLVSGTDGVGTKLKLAFLLDRHDTVGIDCVAMCVNDVVCVGAKPLF
FT                   FLDYIATGKNTPEKIAAVVSGVAEGCVQAGAALVGGETAEMPGFYPEDEYDLAGFCVGA
FT                   VEKDAMLSKENVREGDALIGLASSGVHSNGFSLVRKIFGIDREKLNVYVDELGATLGET
FT                   LLTPTKIYVKPLLALLAAVPVHGVSHITGGGFYENIPRMLPEGLQAVIRKENFPVPPIF
FT                   PLIRETGSISERDMFNTFNMGLGMVAAVPAERADEALRVLKDAGEDAYLVGEVARGGDG
FT                   VAIW"
FT   gene            203101..203742
FT                   /locus_tag="Ethha_0192"
FT   CDS_pept        203101..203742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0192"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="KEGG: cth:Cthe_1247 phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25779"
FT                   /db_xref="GOA:E6U6P6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P6"
FT                   /inference="protein motif:TFAM:TIGR00639"
FT                   /protein_id="ADU25779.1"
FT                   /translation="MVNIAVLVSGGGTNLQALIDAVETGKIHGRIVLVAASKPGVFALE
FT                   RARKHGIPSCVARRADYADPAAFEQALLAQLDAVGADLVVLAGYLSILGRAVTDAYKGR
FT                   MINVHPSLIPSFCGPGYYGLRVHEAALAYGVKVTGATVHFVNEVTDGGAIILQKAVEVR
FT                   QGDTAEALQQRVMRQAEWEILPRAVALFCDGRLEWTDDGKVIIKEQGEQE"
FT   gene            203739..204908
FT                   /locus_tag="Ethha_0193"
FT   CDS_pept        203739..204908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0193"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /note="KEGG: cpy:Cphy_0104 phosphoribosylpyrophosphate
FT                   synthetase; TIGRFAM: ribose-phosphate pyrophosphokinase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25780"
FT                   /db_xref="GOA:E6U6P7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P7"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADU25780.1"
FT                   /translation="MSGEELKMPMPVGELGIVGMNGCEDTAMAVNDWLTHWRGSRNEHG
FT                   FKIEVECPRFGTGEGKSIIRQSVRGHDLFIITDMFNYGITYDMYGMQVPMSPDDHFQDL
FT                   TRIIAAAGGKARRINVIMPMLYEGRQHRRTSRESLDCAVMLQQLQRLGVENIITFDAHD
FT                   PRVQNAIPLIGFENIHPTYQMLKALVREEPDIRIDRSHVAVISPDEGGLNRCIYYSSVL
FT                   ELELGMFYKRRDYTRIVGGRNPIISHEYLGGNLEGKDVIIVDDIISSGDSMLDIAEQLR
FT                   AKKVGRIFMFASFGLFCNGLKKFDEAYAAGLFDRVFTTNLVYRTEALKARPWYAEVDMS
FT                   KYIALVIDTLNFDRSMSELLNPVGRIHRLMARLEQSHQAADKKAAKSLA"
FT   gene            complement(205071..205439)
FT                   /locus_tag="Ethha_0194"
FT   CDS_pept        complement(205071..205439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0194"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: str:Sterm_0307
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25781"
FT                   /db_xref="GOA:E6U6P8"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P8"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADU25781.1"
FT                   /translation="MKNYDNFFLGVNDLSQAKNYYETVLNLKLKFDFSKNGMIAFNIGN
FT                   EEPAIILKDTNIFKNMKPTIWFEVENVQEEYKKLSLKGVQFLSEPFEIRTGMAVEFEDP
FT                   FGNRLGITDYTGIQRGTD"
FT   gene            complement(205616..206509)
FT                   /locus_tag="Ethha_0195"
FT   CDS_pept        complement(205616..206509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0195"
FT                   /product="band 7 protein"
FT                   /note="KEGG: cce:Ccel_1361 band 7 protein; PFAM: band 7
FT                   protein; SMART: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25782"
FT                   /db_xref="GOA:E6U6P9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P9"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADU25782.1"
FT                   /translation="MSEKPVQEKEFTAAPGFAMLLLAIVSIVAAVLLFGLAAAANSGAS
FT                   PLFVLAGILLIVAFIIISAGFFNLAPNQAAVLSLFGDYKGTSHQKGLLWTNPFYSKKKL
FT                   SLRARSLNGENLKVNDAAGNPIEIAAVVVWHIGDSFRASYDVENYESFVKVQSESAVRH
FT                   LANLYPYDTSGEEGAKTLRGNTEEVAQALRQELQERTEKAGIIIEEARISHLAYAPEIA
FT                   AVMLQRQQASAVIAARQMIVEGAVGMVQMAIDRLGEKGVIELDEERKAAMVSNLLVVLC
FT                   AEKAAAPIVNTGTMGR"
FT   sig_peptide     complement(206390..206509)
FT                   /locus_tag="Ethha_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.441 at
FT                   residue 40"
FT   gene            complement(206618..207163)
FT                   /locus_tag="Ethha_0196"
FT   CDS_pept        complement(206618..207163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0196"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cbe:Cbei_3824 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25783"
FT                   /db_xref="GOA:E6U6Q0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU25783.1"
FT                   /translation="MNMEVNEITLRDGRSCTLRSPTPEDAEAMLAHLRGTRAETDFLAR
FT                   GPQDPVPTVEEERAMLQKQLDHPRSGFLAAFVDGEIVGSTGLHSQDIVRFLHRAGIGIS
FT                   VCKAYWHLGVGSALLGEVLAQARRMSIEQVELEVVAKNTRAIALYQKMGFVSYGLREHA
FT                   SKLEDGTYQSEYLMVLRF"
FT   gene            207457..209007
FT                   /locus_tag="Ethha_0197"
FT   CDS_pept        207457..209007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0197"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="SMART: AICARFT/IMPCHase bienzyme formylation region;
FT                   TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; KEGG: cth:Cthe_1246
FT                   bifunctional phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25784"
FT                   /db_xref="GOA:E6U6Q1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q1"
FT                   /inference="protein motif:TFAM:TIGR00355"
FT                   /protein_id="ADU25784.1"
FT                   /translation="MKKRALISVSDKTGVADFAKALEELGYEVVSTGGTARALADAGVN
FT                   VTGISDITGFPECLDGRVKTLHPKVHAGILAIRGNAEHMRQLEELGVTPIDIVAINLYP
FT                   FKETILKPGVTLEEAIENIDIGGPSMIRGAAKNWQDVAVVIDPADYAVVLEELRQIGEV
FT                   SRPTKFRLAAKVFEHTAQYDALIADYLRKARGDASLPDALTLTFEKRQEMRYGENPHQP
FT                   AAFYTEIGAPSNTLAAARQLHGKELSYNNINDANGALDLLKEFGEAVPTAVAVKHANPC
FT                   GVAIGRTLLEAYQRAYAADPVSIYGGIVALNRVVDGATAAELAKIFLEILIAPGFAPEA
FT                   LEILEKKKNIRLLELPDLAKPNDPKTLDMRKVVGGLLVQKLDTFLLDESALKCVTKRQP
FT                   TPEELDELHFVWKVVKHTKSNGIALSKSHQTVGIGPGQTNRITALELAIKYGGDKVNGS
FT                   VMGSDAYFPFSDCVEAAQKAGITAIIQPGGSIRDEDSIKAADAAGIAMVFTGYRHFKH"
FT   gene            209090..210349
FT                   /locus_tag="Ethha_0198"
FT   CDS_pept        209090..210349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0198"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; KEGG:
FT                   cth:Cthe_1245 phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25785"
FT                   /db_xref="GOA:E6U6Q2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q2"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADU25785.1"
FT                   /translation="MDILVIGGGGREHAVIKKLKESPRAGAIYCAPGNGGIAADARCVP
FT                   IKATDVDGVVRFAKDNRIGFVVVTPDDPLALGMVDALEAAGIKAFGPNQAAAAIESSKV
FT                   FSKNLMKKYGIPTAAYDVFESPIEALAHIVKEGRYPAVIKADGLALGKGVVIAQNEDEA
FT                   RAALHAIMEDKIFGASGNRVVVEEFLTGPEVSVLAFTDGKTIRPMVSSKDHKRALDGDK
FT                   GPNTGGMGTISPNPHYTDTIADQCMETIFLPTVHAMNAEGRPFKGCLYFGLMLTPDGPK
FT                   VIEYNARFGDPETQVVLLRLQSDLLDILEAVADERLAGMDIEWDSRAAACVVAASGGYP
FT                   GKYASGKAITGIAAAETHPDVTVFHAGTRLEDGTLVTAGGRVLGVTALGATLEQALGIA
FT                   YAALREIHFDGMQFRTDIGR"
FT   gene            complement(210455..211159)
FT                   /locus_tag="Ethha_0199"
FT   CDS_pept        complement(210455..211159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0199"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: ate:Athe_1027 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25786"
FT                   /db_xref="GOA:E6U6Q3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q3"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU25786.1"
FT                   /translation="MNKDFPRILTLLRKEKGISQKNAAEELGISQALLSHYEKGIRECG
FT                   LEFVVRAAGYYNVSCDYLLGRSPDRNGTMLSVEDLPEPDAAGKENVFKGSLLPTLNKKL
FT                   IENSINIIYDLLQHAGSRDLTVEVSNYLSFAVYKVFRSLYHANEKNPSGLFSVPKEQYG
FT                   ALSSASMVLTEMRLRGALLGKELPGGAAPFKDKEKLALSPEKIAQDYPLFATSLTNLVK
FT                   NAESTMEKHLRP"
FT   gene            211311..211991
FT                   /locus_tag="Ethha_0200"
FT   CDS_pept        211311..211991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0200"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG:
FT                   eel:EUBELI_20176 alpha-ribazole phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25787"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q4"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADU25787.1"
FT                   /translation="MKAYHIYLIRHGITQGNDEGRYIGSTDQPLSARGEQELKKLAGSY
FT                   RYPDAEAFYTSPLQRCARTLEILYPDVSPRVVPDLRECDFGDYENKSMDDLKDDPGYQK
FT                   WVAAKGGITPPNGESVEIFQKRCCAAFAGIVNELLRAGTTRAVVCAHGGTIMFILAAFG
FT                   YPKYPFYRWMTGNGLGYEIVITPQLWMSAQAFDIAAPIPENAPDTGLSGLQSVMDALKQ
FT                   NSEN"
FT   gene            complement(212089..212256)
FT                   /locus_tag="Ethha_0201"
FT   CDS_pept        complement(212089..212256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25788"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU25788.1"
FT                   /translation="MEARPFRGDGTEFQSRSSTQDNTAHPHGTQNRQLKTFHNMVQKAK
FT                   QAIDDHGVKS"
FT   gene            complement(212436..214499)
FT                   /locus_tag="Ethha_0202"
FT   CDS_pept        complement(212436..214499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0202"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   DEAD/DEAH box helicase domain protein; nucleic acid binding
FT                   OB-fold tRNA/helicase-type; helicase domain protein; KEGG:
FT                   aoe:Clos_1441 ATP-dependent DNA helicase RecG; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25789"
FT                   /db_xref="GOA:E6U6Q6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q6"
FT                   /inference="protein motif:TFAM:TIGR00643"
FT                   /protein_id="ADU25789.1"
FT                   /translation="MEELARNVRTLRGVGPKRAALFAKLGVHTVRDLLYTFPRSYEDFT
FT                   RPVSISQAAPGEVCCIRAVVSAPIRVTRASGGMLLCKTRVADDSGILEVVFFNNKYAAE
FT                   LLKEGAAYFLYGRVSGTLFRKTMTAPECLPAGCNPGLRPVYATTAGLSSRAVGAAVQAA
FT                   LSLFATRTIPELLPDTLRAEYQLCRVGCALQNIHFPRDGQALAAARRRLVFDELLALLL
FT                   GMGLLRHRQADGHAPRCLPDFDFAPFFASLPYTPTGAQLRAVAEAAADMARAVPMNRLI
FT                   EGDVGSGKTTVAAALCVLAHAGGLQSALMAPTEILAAQHARNLERLLAPSGLRVGLLTG
FT                   GLPAAKKREVKAAIADGSVGLVVGTHALLQEDVAFHRLGLVITDEQHRFGVAQRAALAA
FT                   KGSTDAVDSSSPHMLIMSATPIPRTLSLMIYGDLDVSVLNELPAGRRPVRTYLVGSGLR
FT                   ARVHRFLRTQVEQGQQAYIVCPLVEADESELAAAVQLRDGLAETSLAGIPVGLLHGRMP
FT                   AREKEKVMQAFAAGDLKLLVSTTVIEVGVDVPAATVMVVENAERFGLSQLHQLRGRVGR
FT                   GAAQSHCILISDAEDAATRERLQTLCKTADGFAIAEQDLKLRGPGDFFGKRQHGLPALA
FT                   IADLMGDMDILQEARRAADTLLRQDPALSLKEHAGLRNAVDALFAGNGIVFN"
FT   gene            complement(214610..216220)
FT                   /locus_tag="Ethha_0203"
FT   CDS_pept        complement(214610..216220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0203"
FT                   /product="DAK2 domain fusion protein YloV"
FT                   /note="KEGG: gct:GC56T3_2371 DAK2 domain fusion protein
FT                   YloV; TIGRFAM: DAK2 domain fusion protein YloV; PFAM: Dak
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25790"
FT                   /db_xref="GOA:E6U6Q7"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q7"
FT                   /inference="protein motif:TFAM:TIGR03599"
FT                   /protein_id="ADU25790.1"
FT                   /translation="MENPTITGVMLNQMFQAAAQAIETQAAQVNALNVFPVPDGDTGSN
FT                   MSRTMGACAHALAAVDADAGAGEVARAAATALLRGARGNSGVILSLLVRGMALALRGKE
FT                   AATAADWAGALQSGVDAAYKAVMKPAEGTILTVAREAAVAAAFGANNGEDMHAVFLATV
FT                   EQAKDTLARTPDMLPVLKKAGVVDSGGQGLVIILSAMLDVLEGKAAAAEPEQDVPPEHD
FT                   AAASAEDESAYAYCTEFIINKRKNVATKDSLALRAFLESLGDCVLVADDEDFIKVHCHT
FT                   DHPGKAIEEALTFGFLTDLKIDNMHEQHREKADSEPLKAIGFVAVASGKGVAAVFRDLG
FT                   VDAVVEGGQTMNPSTEDILKAVEGVAAQTVFILPNNKNILMAAEQAAALSAGKARVLHT
FT                   KTIPQGMTAMLAYLPDADAEQNLLAMESAYGKVHTGLVTYAVRDTEFDGKRIHKGEILA
FT                   LEEGHISFTDGDTMRAAVRLLRDLADKSTAFITILYGEGVNAAQAETVRAEIAGRFPQA
FT                   EVNVINGGQPIYSFILSVE"
FT   gene            complement(216302..216652)
FT                   /locus_tag="Ethha_0204"
FT   CDS_pept        complement(216302..216652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0204"
FT                   /product="protein of unknown function DUF322"
FT                   /note="PFAM: protein of unknown function DUF322; KEGG:
FT                   tjr:TherJR_2102 protein of unknown function DUF322"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25791"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q8"
FT                   /inference="protein motif:PFAM:PF03780"
FT                   /protein_id="ADU25791.1"
FT                   /translation="MIILETPNGIVDVSNEYYSTLIGSAVSSCYGVAGMAPGNAAQGIA
FT                   SFFGRKKIDHGVLVTANGRELVVDLHIIVTYGVNIAEIVKSIIKKVRYTIEEATGLTVE
FT                   SVNVYVDGMRAD"
FT   gene            complement(216716..218278)
FT                   /locus_tag="Ethha_0205"
FT   CDS_pept        complement(216716..218278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0205"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: afo:Afer_0171 extracellular solute-binding protein
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25792"
FT                   /db_xref="GOA:E6U6Q9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q9"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADU25792.1"
FT                   /translation="MKQNHRWVLGLLALLLAFALAGCAASSGASSSKPSSSSQTSSAKV
FT                   SSQTATKPTTFSLPVVFAQDMNPLTSGCMINVTLWPLLYDSLTQPDTTFTARQGLAASI
FT                   TNSGTTMMVQLRGGVKFSDGSALTAQDVAYSYNLVKSTPSSYFYGNVGNIASVTPQGSG
FT                   TVVFTLSAPDTLAQNLLDIPIIKTGSVAAARTPPVGSGPYTFSTNQFSGTLSVNKNWYG
FT                   GGTFGFQTIALVNMPSSDAVLGSLKIGEINYLYTDYGNGAVPAANLDSKTVNLNRMVFM
FT                   GVNSGHSLTADAHVRRAISFALDRQSLSDDAFSAQALPTDLPYNPDWADGVKPASTELR
FT                   AQLDKAATELTAAGYTAQNIGGVATKAGGASPLQLTLLVNSGDQQMTAAANQIKVSLAK
FT                   AGIGITINAQPFAAYVAALQAGSYDLYLGNLSLTADMDLSPLLAPGGAAAYGVPANSAT
FT                   LAAFNTWRTGGALSALTTAYTSEMPFIALCFKTGSVTFTPGLSGTVNPTVQNVLYGIAG
FT                   WHY"
FT   sig_peptide     complement(218180..218278)
FT                   /locus_tag="Ethha_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.374 at
FT                   residue 33"
FT   gene            complement(218464..218724)
FT                   /locus_tag="Ethha_0206"
FT   CDS_pept        complement(218464..218724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0206"
FT                   /product="Stage V sporulation protein S"
FT                   /note="PFAM: Stage V sporulation protein S; KEGG:
FT                   kol:Kole_0336 stage V sporulation protein S"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25793"
FT                   /db_xref="GOA:E6U6R0"
FT                   /db_xref="InterPro:IPR007347"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6R0"
FT                   /inference="protein motif:PFAM:PF04232"
FT                   /protein_id="ADU25793.1"
FT                   /translation="MEIIKVSSKSAPHAVAGAIANVIRDKSAAEIQSVGAGATNQAIKS
FT                   IAIARGYLAPSGIDIVCVPGFANVEVAGENRTAIRLIVKTV"
FT   gene            complement(218910..219689)
FT                   /locus_tag="Ethha_0207"
FT   CDS_pept        complement(218910..219689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE1371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25794"
FT                   /db_xref="GOA:E6U6R1"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6R1"
FT                   /inference="similar to AA sequence:KEGG:TTE1371"
FT                   /protein_id="ADU25794.1"
FT                   /translation="MVVLAVGDVVGSGGCGFLREHLPALKKLYGVDVTIVNGENSADGN
FT                   GITPGSAQHIFTSGADVITTGNHVYRRRELHDMLEENPFLLRPANYPARDPGHGWCVVD
FT                   TGRVQVCVVNLMGTVFLDSLDNPFYAADAILKEIERTVGKAVILVDFHAEATSEKRALG
FT                   FYLDGRVSAVYGTHTHVQTADEEILSKQTGYITDIGMTGPVRSILGVEPHLVLERYLTK
FT                   MPVRFANAGAPYQLSGVIFDIDHFTQKTNFVKRVQIK"
FT   gene            complement(219806..221365)
FT                   /locus_tag="Ethha_0208"
FT   CDS_pept        complement(219806..221365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0208"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: YmdA/YtgF protein; metal dependent
FT                   phophohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; K Homology, type 1, subgroup; KEGG:
FT                   cth:Cthe_1091 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region; KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25795"
FT                   /db_xref="GOA:E6U6R2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6R2"
FT                   /inference="protein motif:TFAM:TIGR03319"
FT                   /protein_id="ADU25795.1"
FT                   /translation="MSGMGTIEVVIAVILIVVCAVVGFFLGIAYRRRIAEAEIKSAEDE
FT                   ARRIVGDALKEAENKKKEALLEAKDEMHKLRADAEKEIRDRRSEVTRQERRLIQKEESI
FT                   DRKLEQLEQKDETLNKRNKAAQERLDEAEAVKSQQLETLERISGFTTEQAKDYLLSRLE
FT                   NELAYEKSVRVKDYEQQLKDESDARAREIITTAVQRCAADHVAEATVSVVPLPNDEMKG
FT                   RIIGREGRNIRTLETLTGVDLIIDDTPEAITLSSFDPVRREVARIALERLITDGRIHPA
FT                   RIEEMVEKAKKEVENTIRQEGEQAIIEMGIHGMHHELVKLLGRLRYRTSYGQNVLNHSL
FT                   EVAQLAGFMAAELHADATTARRAGLLHDIGKSVDREVEGSHVDIGVDIAKKYKEHADII
FT                   HAIEAHHGDVEARTVVACLVQAADAISAARPGARRENLENYIHRLEKLETIANSFEGVE
FT                   KSFAIQAGREVRIMVRPEALDDRQIVLVARDIVAKIEHEMEYPGQIKVHVIRESRAIEY
FT                   AK"
FT   gene            complement(221801..224278)
FT                   /locus_tag="Ethha_0209"
FT   CDS_pept        complement(221801..224278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0209"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: cth:Cthe_1789 ATPase AAA-2; PFAM: ATPase AAA-2
FT                   domain protein; AAA ATPase central domain protein; Clp
FT                   domain protein; UvrB/UvrC protein; Clp ATPase-like; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25796"
FT                   /db_xref="GOA:E6U6R3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6R3"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADU25796.1"
FT                   /translation="MFDKFTEKAAAALNLALESARDLGHTYVGTEHILIGLLREGSGVA
FT                   AKVLEQHGVQADAVEKLVAESVGRGAHPSHVTAQSLTPRGKHIIELAYMEAQNLGHGYV
FT                   GTEHLLMALLREADSVAVAVMVRLGCEPKELYAEIIRAIGGNTNQPNDKGASPAPGGAQ
FT                   PARRPGSNTPTLDQFGRDLTEQAKAARLDPVIGRAKEIERVIQILSRRTKNNPCLIGEP
FT                   GVGKTAIAEGLAEKIVEGRLPETLKDKRVVSLDLTGMIAGTKYRGEFEERIKKALEEVR
FT                   KAGNVILFIDELHTIIGAGAAEGAIDAANILKPMLARGEIQVIGATTLNEYRKHIEKDA
FT                   ALERRFQPVTVGEPSQEEALLILKGLRDKYEAHHKVRITDGALGAAVTLSARYISDRFL
FT                   PDKAIDLMDEAASRVRLNAFTAPPDLRDLEEKLKKLAEEKEAAVKAQDFERAAKLRDEE
FT                   KHVNEQMENTKKEWMADNARSVKEVTEEDIADIVAGWTGVPVKKLAEEESERLLHMEDV
FT                   LHKRVVGQNEAVAAVAKAIRRGRVGLKDPKRPVGSFIFLGPTGVGKTELSKALAEALFG
FT                   DENAMIRVDMSEYMEKHTVSRMVGSPPGYVGYDEGGQLTEKVRRKPYSVLLFDEIEKAH
FT                   PDVFNILLQILEDGILTDAQGRKVDFKNTVIIMTSNVGARMITDNRRLGFANADNAIAS
FT                   DKEIKSDVMGELRRTFRPEFLNRVDDIIVFHQLTSADIQQIAGRMLETVAKRIQAMEIG
FT                   ITFSDEVVTHIAKEGFDPVYGARPLRRAIQSKVEDKFSEEMLEGKIKTGDTVHTVLKDD
FT                   TIVFETAAAPQQV"
FT   gene            complement(224294..225340)
FT                   /locus_tag="Ethha_0210"
FT   CDS_pept        complement(224294..225340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0210"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   cth:Cthe_1790 ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25797"
FT                   /db_xref="GOA:E6U6R4"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6R4"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ADU25797.1"
FT                   /translation="MKWYLETGPEGDAVISTRVRLARNISDMLFPCKMNLEQAHEVEEA
FT                   TRAALFSDEQMARDFEYIDMEKLGPARSVSYAEKHLISPEFAKERAGRALLLKKDESVS
FT                   IMINEEDHIRIQALASGFRLEDAMETANHIDDLFDRHLQYAFDEDFGYLTECPTNLGTG
FT                   MRASLMLHLPGLTRSRSLPSLAQAITKLGFTIRGLYGEGSKGTGSFYQISNQVTLGISE
FT                   AEVLRSLTGVVSQIIAQERSIREEFKKLGPVFEDRIFRSYGILANARMLTSEEFMNLIS
FT                   DVRFGITMDIITDVPLEAVNALLGEVQPATLQTQTNHPMDEQERDILRAKIVRETLTHL
FT                   GSRENGNA"
FT   gene            complement(225337..225879)
FT                   /locus_tag="Ethha_0211"
FT   CDS_pept        complement(225337..225879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0211"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: bts:Btus_0120
FT                   UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25798"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6R5"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ADU25798.1"
FT                   /translation="MLCDHCGKNEATVHFHEAANGQIHEVHLCSACANEMGYNKLLSGN
FT                   TPFTGMTPDWQDFLGSLFSQAMPSHGPAGKSCSFCGTTFQEFAKNAMAGCPHCYRTFYQ
FT                   ELLPSIERIHGKTHHVGKIPRSASREILARREQAIRLQQVDELKHQLEEAVDKQEYEQA
FT                   AKLRDRIKAIEQGGEVK"
FT   gene            complement(225896..226351)
FT                   /locus_tag="Ethha_0212"
FT   CDS_pept        complement(225896..226351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0212"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: cth:Cthe_1792 firmicute
FT                   transcriptional repressor of class III stress genes"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25799"
FT                   /db_xref="GOA:E6U6R6"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6R6"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ADU25799.1"
FT                   /translation="MKLSDMITDIIRQMLRDAENGIAEIQRNELASRVGCVPSQINYVI
FT                   TSRFTPEQGYIVESRRGGGGYIRISRVRLDKGQSIMHAINAVGERLDAETARIFLSNLR
FT                   DGGVLAAQAAELIGAALSDAVLRAAPQETRDALRAAVFKQMLAVLLK"
FT   gene            226710..226832
FT                   /locus_tag="Ethha_0213"
FT   CDS_pept        226710..226832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cce:Ccel_0359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25800"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6R7"
FT                   /inference="similar to AA sequence:KEGG:Ccel_0359"
FT                   /protein_id="ADU25800.1"
FT                   /translation="MSGFFGGFNNSCLWIILIIIVLCCCCGGERGFGGCGGCDD"
FT   gene            226972..227232
FT                   /locus_tag="Ethha_0214"
FT   CDS_pept        226972..227232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_41690 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25801"
FT                   /db_xref="GOA:E6U6R8"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6R8"
FT                   /inference="similar to AA sequence:KEGG:ROP_41690"
FT                   /protein_id="ADU25801.1"
FT                   /translation="MKILITKDKWVRYLAAAVILIFWQCIGYLVPLPFSPIWHATATSY
FT                   SMSIVGVLIAFFSAFIADFFITRWQKAHSHPSAPKSGRRKR"
FT   gene            complement(227236..228003)
FT                   /locus_tag="Ethha_0215"
FT   CDS_pept        complement(227236..228003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0215"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   cce:Ccel_2459 protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25802"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6R9"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADU25802.1"
FT                   /translation="MKPGHIAAGIARTLVGVLLMATALPPMQLHVMNTFVLLPVLLGVA
FT                   IIFLPALLWVLRRLCGRYARVVLRLLAAACIAGLGWLLLSFGVILAHSFPGQPPQDATV
FT                   VVLGAKVQGRTPSIDLMGRIDAAGTYLKAHPQAFCIASGGKGPEEDITEAESIRDTLVQ
FT                   RHGIAPARIALDDTSTNTVQNLRNARTIIRQRGLPVHVALVSDGFHLFRAGIIAKRQGL
FT                   EPFGVPADTDWRLNGYLYLREIFALPKTLLFDH"
FT   gene            complement(228134..228583)
FT                   /locus_tag="Ethha_0216"
FT   CDS_pept        complement(228134..228583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_1623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25803"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S0"
FT                   /inference="similar to AA sequence:KEGG:Clos_1623"
FT                   /protein_id="ADU25803.1"
FT                   /translation="MTITEKVAYLKGLVEGLGVDETSKEGRIIKAIVEVLDDVALTVSE
FT                   VEDSISEVTEQVDAIDEDLEDLEKDFYGDDEDEDDEGDDSDYYELTCPKCGEKVYLDDD
FT                   LLSDGEMTCPKCGEKLEFDFSTDDEDDICDGCVGHDDDEEDSEKH"
FT   gene            complement(228717..229274)
FT                   /locus_tag="Ethha_0217"
FT   CDS_pept        complement(228717..229274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0217"
FT                   /product="translation elongation factor P"
FT                   /note="KEGG: cth:Cthe_0847 elongation factor P; TIGRFAM:
FT                   translation elongation factor P; PFAM: Elongation factor P
FT                   ; Elongation factor KOW-like domain-containing protein;
FT                   Elongation factor P/YeiP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25804"
FT                   /db_xref="GOA:E6U6S1"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S1"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ADU25804.1"
FT                   /translation="MLSAGDFRNGLTFDMDGNVFSIVEFQHVKPGKGAAFVRTKLKNVI
FT                   TGAVVEKTFNPTDKFPTAYIERKDMQYLYNDGDIYYLMDKESFEQLPINASDVGDSFKF
FT                   VKENMDVKVLSYKGKVFGIEPPTFVELEITETEPGLKGDTATNVTKPAKLETGTEIRVP
FT                   LFINEGDRIRVDTRTGEYMERA"
FT   gene            complement(229487..230554)
FT                   /locus_tag="Ethha_0218"
FT   CDS_pept        complement(229487..230554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0218"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; creatinase; KEGG: hmo:HM1_0270
FT                   xaa-pro dipeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25805"
FT                   /db_xref="GOA:E6U6S2"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S2"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ADU25805.1"
FT                   /translation="MEHCTALMQALPEGIDAGLVLSEHNRRYLTGFAATDGILLVGRAR
FT                   AVLLADSRYIEAAREGAKGCEVELLKDAAMQMGAFFKAEGVRTAGIEAKELPVADLNRF
FT                   RKLFPDITFDEGNAFNDAILRLRMIKSPEELDVIRRAQQITDDAYKHILPFLKPGAAEH
FT                   DIALEIEYFMRQNGASGPSFGLIVVSGENSSRPHGVPGARRLQPGDFITMDTGAIVDGY
FT                   CSDMTRTVALGFVTDEMRKVYETVLAAQLAAEQELAPGKTGSEVDQIARGIIYGAGYEG
FT                   CFGHGLGHSVGLQIHEEPRLSPACHETLQAGMMMTIEPGIYLEGRFGVRIEDLAVLTDG
FT                   GCEILTQSPKELLVL"
FT   gene            complement(230593..231030)
FT                   /locus_tag="Ethha_0219"
FT   CDS_pept        complement(230593..231030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0219"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   KEGG: cce:Ccel_1924 3-dehydroquinate dehydratase; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25806"
FT                   /db_xref="GOA:E6U6S3"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S3"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ADU25806.1"
FT                   /translation="MPKHRVLLLHGPNLNLLGERETGIYGKDTIEHINAEIQAAADALG
FT                   ITCEIRQSNHEGTLIDLLHAARGQFDGVVINAGALTHYSIALRDAIAAIRIPTIEVHMS
FT                   NIHAREEFRHKSVIAPVCAGSVIGFGKYSYVLALQGLVDLF"
FT   gene            complement(231086..231943)
FT                   /locus_tag="Ethha_0220"
FT   CDS_pept        complement(231086..231943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0220"
FT                   /product="Xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /note="KEGG: dau:Daud_1981 xylose isomerase
FT                   domain-containing protein; PFAM: Xylose isomerase
FT                   domain-containing protein TIM barrel; SMART: AP
FT                   endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25807"
FT                   /db_xref="GOA:E6U6S4"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADU25807.1"
FT                   /translation="MTARFGAAGNEDAFFAAGLRHTAQAPAYVASLGLDAYEYQCGHGV
FT                   RVSEPGAKQVGKSAGEAGIALSLHAPYYISMASEDADIRARSVDYILQSARAADWMGAR
FT                   RVVVHPGACGKRPRADVLALACETFRQALAELDAAGLGHIRICPETMGKIGQLGTLDEV
FT                   LAICGLDERLLPCIDFGHLNARTGGGLVTRADYAAVLDAIGRALGDERLRVFHAHFSQI
FT                   EYTAAGEKRHLTFADGHGYGPPFSPLAEELAARGLAPTIICESAGTQAADARRMKDMYL
FT                   ACLR"
FT   gene            complement(231940..232449)
FT                   /locus_tag="Ethha_0221"
FT   CDS_pept        complement(231940..232449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0221"
FT                   /product="HAD superfamily (subfamily IIIA) phosphatase,
FT                   TIGR01668"
FT                   /note="KEGG: gtn:GTNG_2462 hypothetical protein; TIGRFAM:
FT                   HAD superfamily (subfamily IIIA) phosphatase, TIGR01668;
FT                   hydrolase, HAD-superfamily, subfamily IIIA; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25808"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S5"
FT                   /inference="protein motif:TFAM:TIGR01668"
FT                   /protein_id="ADU25808.1"
FT                   /translation="MLFVPDKRFLHIAAISAELLEGEGVKGLVLDIDYTLADRYAPLPD
FT                   DEIRTFISNLKEAEIRLYVLSNNYHNRVSRFAAALDLPYRSNGLKPLPHAFSRAVQSMD
FT                   LPKDRVVAVGDQIYTDVVGGHLAGLRVWMVSPYGGGGHSLFYRLRRRLEMPFIRACPAE
FT                   GREEQP"
FT   gene            complement(232546..232722)
FT                   /locus_tag="Ethha_0222"
FT   CDS_pept        complement(232546..232722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0222"
FT                   /product="ribosomal protein S21"
FT                   /note="KEGG: clo:HMPREF0868_1339 ribosomal protein S21;
FT                   TIGRFAM: ribosomal protein S21; PFAM: ribosomal protein
FT                   S21"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25809"
FT                   /db_xref="GOA:E6U6S6"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S6"
FT                   /inference="protein motif:TFAM:TIGR00030"
FT                   /protein_id="ADU25809.1"
FT                   /translation="MAEIRIKDNESLDSALRRFKKQCARSGVLAEVRKREHYEKPSVKR
FT                   KKKSEAARKRKHR"
FT   gene            233262..234578
FT                   /locus_tag="Ethha_0223"
FT   CDS_pept        233262..234578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0223"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: shi:Shel_22870 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25810"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S7"
FT                   /inference="protein motif:PFAM:PF04169"
FT                   /protein_id="ADU25810.1"
FT                   /translation="MDNQVLYEQAGQVNHALERYGVKFGVYKNGEFHEQLFPFDALPRV
FT                   IPADQFARLERGLIQRVCALNLFLSDIYSKRCILRDGVIPPEFIYSSKGFLLACQGIRP
FT                   PQDVYAHISGIDLVEAPDGWYVLEDNLRVPSGASYPMIAREIVRRVTPSLFEKNRVHEN
FT                   RNYAGLLAGMFREVQRPGIVVVLTPGRYNSAFFEHAYLAEKTGATLAFPEDLEVEGDVV
FT                   YYKSFDGKKQRVGAIYRRVSDEFLDPLLFDERSVIGVPHLMEAYRKGNVALINAPGNGV
FT                   ADDKGTYYFVPKMIRYYLGEEPILQNAPTYVPYYEEDKAYILAHLDKLVIKDVSEAGGY
FT                   GVVFGRDLAAAKREELRQAILAKPRRFIAQEIINFNDLNICLDGKPVPRKADFRAFVVH
FT                   GQDIRVWHSGLTRYALQAGSFVVNSSQGGGFKDTWVLYR"
FT   gene            234560..235216
FT                   /locus_tag="Ethha_0224"
FT   CDS_pept        234560..235216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bll:BLJ_1723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25811"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S8"
FT                   /inference="similar to AA sequence:KEGG:BLJ_1723"
FT                   /protein_id="ADU25811.1"
FT                   /translation="MGTVSITQAEKLYWLGRYAERAYTLTGLLARYYDRMLDADADAYR
FT                   EYCMRLGIPDIYRDKTDFLCRILGDAGSQASIAYALGQANINAMLLRDRLATETASYIQ
FT                   SACNAVPQDFQESVSITLRNVTGLLLAFWGAVDDLILADDVRDFIKAGKYTERVDLYTR
FT                   FELGEPSLGAAKRRLSRSLAHIDDAGVCKDLADMLTEGRSVTTRQIDEGIIDMLQ"
FT   gene            235279..236100
FT                   /locus_tag="Ethha_0225"
FT   CDS_pept        235279..236100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0225"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: bln:Blon_2207 transglutaminase, N-terminal
FT                   domain protein; PFAM: transglutaminase domain-containing
FT                   protein; SMART: transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25812"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S9"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADU25812.1"
FT                   /translation="MKRFSFEYRSSIRFSQPVKAHHFRLKCLPGRFAFQHIYHECCAFA
FT                   GGITPLEGADAFGNRTLAGTIAEPHDLFAFTVSGEALQSFYLLREPLDDLFLYESPLTH
FT                   MSGAMEAFAQTIPGGGTAAKQASAVCKALQARLTYLPASTDVDMPAADAFAQGKGVCQD
FT                   YAQIAVALLRGRGIPARYCAGLMPGEGETHAWVEYYDGGAWHGIDPTNDRAIDYGYIKL
FT                   SHGRDSADCRVDRGCFVGPAEQVEQTLEIHVKVGEQCDQESGNGQPDLPAR"
FT   gene            236054..237037
FT                   /locus_tag="Ethha_0226"
FT   CDS_pept        236054..237037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0226"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: shi:Shel_22840
FT                   predicted deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25813"
FT                   /db_xref="GOA:E6U6T0"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6T0"
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /protein_id="ADU25813.1"
FT                   /translation="MIKKVETVSRTCLPVDEMLCIRRCRYLPGNLTEDAIAGLPRISLV
FT                   TGVHGDELEGQFTCYELGSQLAQHPEGLTGVVDIYPAINPLGIESIRRGVPGFNVEMNR
FT                   LFPGNPDGFIVEKVAGEVLESLVGSDLVVDIHASNIFLRELPQARINENDAETLTPLAS
FT                   RLNLDFLWIHPSATVLESTLAHSLNARDTRCIVVEMGVGMRITRTYGHQLVRGIFNVMR
FT                   ALGIWNIPDAGMDTPHKTLCSLERGVYFLNAEASGIFVPRVEHCAIMEKGEEIGRILDP
FT                   LTCTVQERIIAPCSGLVFTLREYPVVYTGSLIARMIEGVEDYQLRI"
FT   gene            237034..237990
FT                   /locus_tag="Ethha_0227"
FT   CDS_pept        237034..237990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0227"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: cbe:Cbei_4345
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25814"
FT                   /db_xref="GOA:E6U6T1"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6T1"
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /protein_id="ADU25814.1"
FT                   /translation="MKKKTIFQLNAPYREPMRVTAFLFGDADPAARETGCAVMGATRGN
FT                   EAQQIYTCAHLVERLQELEQQGGIAPGRQIAVIPTVNPYSANTAHRFWPMDDTDINRMF
FT                   PGYSLGETTQRIAWHVFEYVRPYRYGVHLSSYYMPGEFMPHVRMMQTGYEDTDAAALFG
FT                   MPYVYVRKTRPYDTTTLNYNWQIFGTHAFSLYAGKTDELDEAATARSVRAVLRFLKGMG
FT                   LLTDKVEIPSRPGHAPTQVITGENLTPVLAKTGGIMRRVRHAGDMVRRGSELGYIHDPY
FT                   DNRIRQTLLSPKDGRVFFVHRNPFVYENTTAYRILSI"
FT   gene            238085..238798
FT                   /locus_tag="Ethha_0228"
FT   CDS_pept        238085..238798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0228"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   ckr:CKR_3028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25815"
FT                   /db_xref="GOA:E6U6T2"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6T2"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /protein_id="ADU25815.1"
FT                   /translation="MPVLISLSALTPFLTAAAFVLLNELGDKSQLLTIAFASRMRVGKV
FT                   LFGVLIATLANHGLAVAVGTLLAHVPGWDGWVRFLAAVLFLFFGLAALRPDISAEKRSP
FT                   PQSRLGDVATVAFAFFFAEMGDKTQLATVALAARFPDAPLLVLAGAAAGMLLADGIGIT
FT                   AGVLLHRKLSANVCRVVAAVTFVLFGLFGIYEGLTGLLGFSGAGAAVVTVLAAACTLTA
FT                   GICLRKPGRKRTGRA"
FT   sig_peptide     238085..238153
FT                   /locus_tag="Ethha_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.653) with cleavage site probability 0.260 at
FT                   residue 23"
FT   gene            239021..241309
FT                   /locus_tag="Ethha_0229"
FT   CDS_pept        239021..241309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0229"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /EC_number="1.17.4.1"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; KEGG: tex:Teth514_0821
FT                   ribonucleotide-diphosphate reductase subunit alpha; PFAM:
FT                   ribonucleotide reductase large subunit; Ribonucleotide
FT                   reductase large subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25816"
FT                   /db_xref="GOA:E6U6T3"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6T3"
FT                   /inference="protein motif:TFAM:TIGR02504"
FT                   /protein_id="ADU25816.1"
FT                   /translation="MDITPNARTVLEKRYLIRDADGRPTETIEELFHRVADAIAAPDRT
FT                   YNPDADIKALADRFYARMTKLEFLPNSPTLMNAGRPLGQLAACFVLPVEDSMEAIFEAI
FT                   KQAALIHKSGGGTGFSFSRLRPKGSTVNTTGGVASGPVSFMRVFNMATEAVKQGGTRRG
FT                   ANMGILRVDHPDILEFIDCKKNNADITNFNISVGITEAFMRAVEADEEYDLIDPNTKES
FT                   TGRLSAREVFEKIVDAAWRNGEPGIIFLDRLNRDNMVPSVGAIESTNPCGEQPLLPYEA
FT                   CNLGSVNLHRMLRRQEDGASVINWDKLADVVRDAVHFLDNVIDANRYPLAQIDHMTKQT
FT                   RKIGLGVMGWADLLLELGIPYNSDEAVALGEKVMGFITDTARSASAGLAQVRGAFPLFE
FT                   ESTLKNGTPVRNATMTTIAPTGTLSIIAGCSSGVEPVFAYVFIRNVMDGTELVEANPVL
FT                   RQLLEERGLYSEDLMRQIAQEGSLAHIDALPEDIRRVFVCAHDISPEYHIKMQAAFQRR
FT                   TDNAVSKTVNFAHDATIADVRRVYMLAYELGCKGVTIYRDGSRDAQVLNIGKVNAEKPA
FT                   ATEAAPSVSGTARAAGLQPRPRPNVTTGFTERCRIGCGNLYITVNYDENGICEVFTNTG
FT                   RAGGCPSQSEATARLVSIGLRAGLDVDSIIEQLKGIRCPSTIRRPGMQATSCPDAIARV
FT                   IEKVKNIQAGEPAQVSAVVVQAENEAVLHRWAPPENTPAMKYCPDCGAKMEHEGGCVIC
FT                   RNCGYSKCG"
FT   gene            241350..241880
FT                   /locus_tag="Ethha_0230"
FT   CDS_pept        241350..241880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce1587 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25817"
FT                   /db_xref="UniProtKB/TrEMBL:E6U782"
FT                   /inference="similar to AA sequence:KEGG:sce1587"
FT                   /protein_id="ADU25817.1"
FT                   /translation="MHTQPEQAAAGRIQVQENFFRTKSAQPERAAKPSHLFALLWHEKR
FT                   ARYTAKVQKKSAKMQRGRGDRRRAALPLCMAGMSGAGRPAAVCGGKMPPLFERGRVWRR
FT                   FQGDSFYCVTYFGQSGLARRKAFFASFLSPHKKDGPRGRAEPANRFKQVFSGWYAHGLK
FT                   GRRTHAAFQFRKV"
FT   gene            complement(242022..242630)
FT                   /locus_tag="Ethha_0231"
FT   CDS_pept        complement(242022..242630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0231"
FT                   /product="Pyruvate/ketoisovalerate oxidoreductase,
FT                   catalytic domain"
FT                   /note="PFAM: Pyruvate/ketoisovalerate oxidoreductase,
FT                   catalytic domain; KEGG: ccu:Ccur_07880 2-oxoacid:ferredoxin
FT                   oxidoreductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25818"
FT                   /db_xref="GOA:E6U783"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E6U783"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ADU25818.1"
FT                   /translation="MMATTTSERVDTPVTAGNGAQAKPYSMTTLFAGFGGQGILFSGKV
FT                   MAYAGLLEGREVSWLPSYGPEMRGGTANCGVCISSNPVGSPLVTDPDAFVVMNLPSFLK
FT                   YIDHVRPGGVAVLDSFLIDRKVERNDIRAFYIPATRLASENKIDGLANMIMLGKLLRET
FT                   QFAAYDSVIAGLRKSVPARKAALVDANIKAIGIGMEYNK"
FT   gene            complement(242627..243412)
FT                   /locus_tag="Ethha_0232"
FT   CDS_pept        complement(242627..243412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0232"
FT                   /product="thiamine pyrophosphate TPP-binding
FT                   domain-containing protein"
FT                   /note="PFAM: thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; KEGG: cbl:CLK_2865 putative
FT                   2-oxoacid:acceptor oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25819"
FT                   /db_xref="GOA:E6U784"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E6U784"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADU25819.1"
FT                   /translation="MAVVFQKPKGLTDTPLHYCPGCTHGIIHRLVAEAMDAFDIGGRTI
FT                   GVCPVGCAVMAYDYFSCDMVEAAHGRAPAVATGIKRALPESVVFTYQGDGDLAAIGTAE
FT                   TVHSATRGENITVIFVNNAIYGMTGGQMAPTTLPNQVTQTTPYGRDTQTAGYPVRICEM
FT                   LSTLDGAAYIERVAVDSPAHVRAAQKAIHKAFRYQIEGRGFTLVEVLSTCPTNWGLSPV
FT                   ESLDWLRENMMPYYPLGVYKDKHAETADETVKQKAEVHA"
FT   gene            complement(243412..244476)
FT                   /locus_tag="Ethha_0233"
FT   CDS_pept        complement(243412..244476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0233"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: ele:Elen_1705 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25820"
FT                   /db_xref="GOA:E6U785"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:E6U785"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ADU25820.1"
FT                   /translation="MPEKVLMKGNEALAQAAIGAGCRHFFGYPITPQTEVSAYMAKRMP
FT                   KIGGTYLQAESEVAAINMVYGAACAGVRAMTSSSSPGISLKSEGISYIAACDLPCLIVN
FT                   VQRGGPGLGGIQPSQSDYWQATRAAGHGDFHLLVFAPDSVQEMVDHVFMAFDRSDHYRV
FT                   PAMILSDGMLGQMMEPVLVQEPQKADLPPKTWATNGHGGKRPHNIINSLYLQPEELEEL
FT                   NFERFKKYDTIIANEQRSERFHIEDADLVVTAFGASARVAKSAVMAARAKGLNVGLLRP
FT                   ITLWPFPTDAFAEAAKTAKAFLSVEMNMGQMADDVRLAISCSRPVHFYGRTGGVIPTPA
FT                   QVLAEIERILGGDR"
FT   gene            complement(244486..244692)
FT                   /locus_tag="Ethha_0234"
FT   CDS_pept        complement(244486..244692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0234"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /note="KEGG: ccu:Ccur_07910 2-oxoglutarate ferredoxin
FT                   oxidoreductase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25821"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6U786"
FT                   /inference="similar to AA sequence:KEGG:Ccur_07910"
FT                   /protein_id="ADU25821.1"
FT                   /translation="MPRIIVDEERCKGCGLCATACPKGIVALSSETLNSKGYHPAHVAE
FT                   MTLCIGCAMCALMCPDVAIVVER"
FT   gene            complement(244758..245420)
FT                   /locus_tag="Ethha_0235"
FT   CDS_pept        complement(244758..245420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_1707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25822"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U787"
FT                   /inference="similar to AA sequence:KEGG:Elen_1707"
FT                   /protein_id="ADU25822.1"
FT                   /translation="MLQSRLQIITGHYGSGKTTFAVNLAMENARAGRKTCLVDMDIVNP
FT                   YFRAADSKGPLEAAGVRVIRPIYAGTNLDLPALPGELAAVFDDTSYTVVLDVGGDDAGA
FT                   AALGAYAHRILAADYAHLYVFNARRPLTSTPEEAVQILREIEAVSRVPATGLVNNTNLG
FT                   NETDTDVPAASAAFAEQTAALTGLPLIYTGVRQELADAARSRLPSVYPLTMWVVPPW"
FT   misc_binding    245615..245713
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 60.10"
FT   gene            245793..247091
FT                   /locus_tag="Ethha_0236"
FT   CDS_pept        245793..247091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0236"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="KEGG: ckr:CKR_1649 thiamine biosynthesis protein
FT                   ThiC; TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25823"
FT                   /db_xref="GOA:E6U788"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:E6U788"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ADU25823.1"
FT                   /translation="MAYTTQMDAAAKGILTEQMRAVAEKEGMDPDLLLARVAAGRIAVP
FT                   ANKNHKSLVPEGIGEGMRTKINVNLGVSKDCCNLDAELDKVKEAINLKAEAIMDLSSYG
FT                   KTGEFRRRLVEMSTASIGTVPVYDAVGFYDKDLADITADEFIRVFEQHAKDGVDFMTVH
FT                   AGINRNTAATFARSGRKLNIVSRGGSLLYAWMQLKGEENPFYERFDELLDICAEYDVTL
FT                   SLGDACRPGCIADSTDASQIHELITLGELTKRAWARHVQVMIEGPGHMRLNEIAANVQL
FT                   EKRLCHGAPFYVLGPLVTDIAPGYDHITSAIGGAVAGAAGADFLCYVTPAEHLRLPTYD
FT                   DMREGIFAAKIAAHAADLAKGTDDGKWDDAMADARRALDWEKMFELAIDPEKARRYRKE
FT                   SFPEDSSTCTMCGKMCSVRNMNSVMDGKDVNII"
FT   gene            247360..247896
FT                   /locus_tag="Ethha_0237"
FT   CDS_pept        247360..247896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0237"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gau:GAU_1075 putative diamine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25824"
FT                   /db_xref="GOA:E6U789"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6U789"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU25824.1"
FT                   /translation="MRQKISLIKGEPRAMPQEFSDEIGLRPATAADVPLIWSLIGELAE
FT                   YEHLRDQMDATEQGLQDALFDKQAAHALLLEWQGRTAGYAIYFYSFSTFTGLSGIYLED
FT                   LYVRPAFRGKGIGRAVFTRLARKACEEGCGRLEWECLTWNAPSIAFYEKMGARAKNDWR
FT                   GYRLSGDALRTAAGL"
FT   gene            247991..251236
FT                   /locus_tag="Ethha_0238"
FT   CDS_pept        247991..251236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0238"
FT                   /product="SNF2-related protein"
FT                   /note="KEGG: amt:Amet_0594 non-specific serine/threonine
FT                   protein kinase; PFAM: SNF2-related protein; SNF2 helicase
FT                   associated domain protein ; helicase domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25825"
FT                   /db_xref="GOA:E6U790"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:E6U790"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="ADU25825.1"
FT                   /translation="MNIEMKDIAAAAANRAAFERGVEYYNQRRVSKLKRAKDEQDTGEK
FT                   VTAEVRGGKYNYEVEVSFDQNGEMKESWCDCPAFYEYEGCCKHIVAVLLCCYALQKTDA
FT                   GGERGENENKTDRYAGRMLGHYSKKALSEAMAHTIVKKARLVPSLEYDYNGRLNLSFTV
FT                   GHERQYILRDLSKFFFEMRQGGTVEYGAKLTLTHDISAFEEASRPLVRFFMSRYADYMQ
FT                   FAGDAGGYKAGKRSLTLSSSAFDELFGLLVGQKVAMRVDFRNEKHVLFTDENPVLSLQV
FT                   QEAGDAFLLSLSELPVFLYMGEKNAYVMLGERLFRCAEDYTAATREFLRAFTDKGGELT
FT                   INRKEMPAFCANVLDVICSHIEVENADMLDCFRPAPLKAKLYLDMPSSMMVTGTLKYCY
FT                   EATEINAMDEQPTPSVQRDVRGEYIARSLVDKYLPSYNLQHRLLYVDDEERIYALLSEG
FT                   IAELSTVASVYATDRLGKVTIRKPPAVSVGVRLKSDLLNVTFDTGDFPRDELLDLLKSY
FT                   RQHKKYHKLSDGSFVTLEDDTLGEVSELAQSLDLSDDQIKNGEADVHRYRAMVLDNILR
FT                   DSALIQSDRDPGFKSMLRELRSMDDADIQPPESLRHILRNYQKKAFRWLKTMARYGLGG
FT                   ILADDMGLGKTLETIAFLLHNHEESTENKRISLVVCPTSLVLNWVSEIARFAPGLQSLA
FT                   IMGSAAQRAELVAQIPQYDIIITSYELLKRDIDLYKPYTFDCEIIDEAQYVKNASTQNA
FT                   RAVKQIRSEHRFALTGTPVENSLAELWSIFDFLMPGYLYSHAKFRETFELPVVKGGDEQ
FT                   ALDRLRRMLSPFILRRLKSSVLRELPPKTETVLYAPLDGEQKKLYMANLASIRQELTGS
FT                   LQNSNKLIVLAMLTRLRQLCCDPSLYYEDYTGGSAKLELCMELLRSVTESGHKVLLFSQ
FT                   FTSMLSIIADRLTGDGIGYYVLKGSTSKEERARLTTRFNNDDTPVFLISLKAGGTGLNL
FT                   TAADIVIHYDPWWNVSAQNQATDRAHRIGQKSSVQVYKLIAKDTIEEKILKLQQDKLKL
FT                   ADSVISEGDGIISRMSPQELLALFDPSAEEAVG"
FT   gene            251288..252049
FT                   /locus_tag="Ethha_0239"
FT   CDS_pept        251288..252049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0239"
FT                   /product="alpha/beta fold family hydrolase"
FT                   /note="KEGG: cac:CA_C2472 alpha/beta fold family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25826"
FT                   /db_xref="GOA:E6U791"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6U791"
FT                   /inference="similar to AA sequence:KEGG:CA_C2472"
FT                   /protein_id="ADU25826.1"
FT                   /translation="MRFHLFGKADHPPIVLLHGGGLSWWSWQPIVDGLQDQYRLIVPTL
FT                   DGHDDDGDTTFRSIADSAAQCLAYLDANYGGSVYAIAGLSIGAQIVVEMLARRQKLARY
FT                   AIIESALVYPLAGSGLMAALTPLFYGLIQNKRIARKQAQVLQIPDSLFERYYASSVRMT
FT                   CQSLANITRSNGHFPLPASISETQANVLIVVGGAELGIMKRSASRLHEAIPSSTLRVFP
FT                   GWKHGAASLAHPDIYLQMVRTLRDSPVIPKI"
FT   gene            complement(252133..253410)
FT                   /locus_tag="Ethha_0240"
FT   CDS_pept        complement(252133..253410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0240"
FT                   /product="Glycosyl transferase, family 4, conserved region"
FT                   /note="PFAM: Glycosyl transferase, family 4, conserved
FT                   region; KEGG: cce:Ccel_0262 UDP-N-acetylglucosamine
FT                   2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25827"
FT                   /db_xref="GOA:E6U792"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:E6U792"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ADU25827.1"
FT                   /translation="MSLKTYGAIALTLVLAIAISYVCTPFVIRLANRIGWMDIPKDKRR
FT                   MHKKAIPLLGGLSIIAGFLFSSLIILLVLGHFSDYYPPRILLLMLQILPGAAIIAVVAF
FT                   FDDRFNLPPLPRLAVQCVAAGIAVAMGVRIQFISGSVRLFGTQTFNLGWLSIPVTIIWI
FT                   AGMTNAMNWIDGLDGLAAGISSIASGTVLILATLQGRPQLAVAILTAALAGGCLGLLPY
FT                   NKNPAKVFMGDTGAMFLGYTLGVISVQGLFKFYAAISFLVPILILALPILDTASAILRR
FT                   LAEGKSPFTPDRSHIHHKLIDMGLSQKQAVGFLYAVSGTLSVIAILFTVFGKVIGWRFL
FT                   LLTLLVVLGASLVALKLCRKYNAQCKCKNESILHGCAAGKEPEKQPPEPDGQKSPAVDE
FT                   KSTNTPARPDTPDAAEPNKKDKQGGE"
FT   gene            complement(253466..254473)
FT                   /locus_tag="Ethha_0241"
FT   CDS_pept        complement(253466..254473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0241"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; KEGG:
FT                   cce:Ccel_1411 tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25828"
FT                   /db_xref="GOA:E6U793"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:E6U793"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ADU25828.1"
FT                   /translation="MENEKKNVFSGIQPTGIPTLGNYLGAMRNWPLLQEEYHCIYSVVD
FT                   LHSLTVRQEPANLRRQTLSLVALLLACGINPEKSLLFIQSHVPAHAELAWLLNCYTQFG
FT                   ELSRMTQFKDKSAKHPDNINAGLFCYPVLMAADILLYQADLVPVGADQKQHMELARDVA
FT                   GRFNGIYGDVFRIPEPYIPKDGARVMSLQEPAKKMSKSDENPNAYILLLDDADTILRKF
FT                   RRAVTDSEAEVVCREGKDGINNLISIYSIVTGKTVPEVEHEFAGKGYGDFKTAVGEAVA
FT                   EALRPVRETYADLLKNKDYLADVYTKGAEKARAIAGRTYAKACKKLGLVLPQRP"
FT   gene            complement(254516..255697)
FT                   /locus_tag="Ethha_0242"
FT   CDS_pept        complement(254516..255697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0242"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   eel:EUBELI_00180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25829"
FT                   /db_xref="GOA:E6U794"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6U794"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADU25829.1"
FT                   /translation="MEYRISNRLAALKPSAIREIFKATDNPSIVPFALGNPAPESFPVE
FT                   VIRTFTKEILDENPAVALQYGITEGYAPLCALLRERMRDVYHCGREGDDLIVVSGAQQG
FT                   AELAAKALCDEGDTVLCENPSFIGVLNAFRSLRVNLKGIPLHEDGLDIEALEQALRTEQ
FT                   RVRMLYIIPNFQNPSGITTSLEKRRAVYALARKYNIIILEDNPYGELRFAGEDLPHIKS
FT                   MDEDGRVIYLGTFSKILSAGLRVGYVLGPAPVLQKMVVAKQGEDVHTAMLSQMIAARFL
FT                   AWNGFAAHLERVRTLYREKCGRMLDGIRRYFDPRITHTTPQGGLFLWCTLPEGMQLMDY
FT                   CKAAIAKGVAVVPGTAFLPDTQGQSQSFRLTFAAPSEEQIEQGLRLLGGIPLQ"
FT   gene            255939..257399
FT                   /locus_tag="Ethha_0243"
FT   CDS_pept        255939..257399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0243"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="KEGG: cbf:CLI_1183 glutamyl-tRNA synthetase;
FT                   TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25830"
FT                   /db_xref="GOA:E6U795"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E6U795"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADU25830.1"
FT                   /translation="MGQTEVRTRFAPSPTGYMHVGNLRTALYTYLIAKSQGGKFILRIE
FT                   DTDQERYVEGAVEIIYKTLRETGLLWDEGPDVGGPVGPYVQSERRDIYARYAKELIEKG
FT                   GAYYCFCGKERLDELRKIHEASGVPHKYDGHCRDLAPEEVQRLLAEGVPHVVRQKIPTE
FT                   GSTTFHDVIFGDITVENDTLDDNVLLKTDGLPTYNFANVIDDHLMGITHVVRGIEYLSS
FT                   APKYNLLYEAFGWDIPTYIHCPPVMRDATHKLSKRHGDPSYEDLVADGYLKEAVLNYVA
FT                   LLGWSPGGEQEIFSLEELVKAFSIDGISKSPAIFDTAKLKWINSAYIRALPPEAFHELA
FT                   LPYIRKAVRREVDTRLIAEVLQPRCEKLTDIPEKLDFIDELPAYDTALYVSKKMKTNPE
FT                   NSLETLRDALPVLEALDDWSAAGLHAALFGLVEQKGVKNGVVLWPVRVAVSGKQFTPGG
FT                   AVELCTLLGKEESLARVRKGMELLAARV"
FT   gene            257596..258519
FT                   /locus_tag="Ethha_0244"
FT   CDS_pept        257596..258519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0244"
FT                   /product="phosphate binding protein"
FT                   /note="KEGG: mcu:HMPREF0573_11375 phosphate ABC transporter
FT                   ATP-binding protein; TIGRFAM: phosphate binding protein;
FT                   PFAM: extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25831"
FT                   /db_xref="GOA:E6U796"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E6U796"
FT                   /inference="protein motif:TFAM:TIGR02136"
FT                   /protein_id="ADU25831.1"
FT                   /translation="MKKLLAAVASVAMLGVLFTACSNGTSSSSSSSSSTVSGTVTAAGS
FT                   SALKPLVDAAKTAFQQKNPDVSITVSAGGSGVGLQQVAAGTVDIGDSDVTAESKLPADQ
FT                   AKTLVDHQVAVIGVAVITSTDVKVSNLTTEQLTNIFTGKTKNWSEVGGPNEAITLVTRP
FT                   SNSGTRALFKQYALNNVEESTSALNTDDSGVLLQDVAGNKGAIGYVALSYLVTSPNVST
FT                   VSIDNVAPTLDNIYSGKYKVWGTEHMYTKGEAKGAAAAFIKYMQSADFATRCETLGYGI
FT                   ASKVKVPHADTSSASSSASSSATSSK"
FT   sig_peptide     257596..257724
FT                   /locus_tag="Ethha_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.356 at
FT                   residue 43"
FT   gene            258654..259622
FT                   /locus_tag="Ethha_0245"
FT   CDS_pept        258654..259622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0245"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="KEGG: mcu:HMPREF0573_11374 phosphate ABC transporter
FT                   permease; TIGRFAM: phosphate ABC transporter, inner
FT                   membrane subunit PstC; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25832"
FT                   /db_xref="GOA:E6U797"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6U797"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ADU25832.1"
FT                   /translation="MEKVLSKEQQTVQKSAGRRPVFRFDYFRKETLGRSVVTTLGIFTA
FT                   VITLLIGIFLIFSGIRTFTVYHHSLVEFLFSSKWSPIDGPVTNGQYGHVGAAIFIFGSI
FT                   TICFLALAIATPFSLAAAIFMVQISPKLGKNFLQPAIEIFVGIPSVVYGWTGLTVLVPF
FT                   IRDIFHLQIGFSVLAGAIVLAIMIFPTITSISADAIRHTPKMFTEASYGLGSTRWQLIT
FT                   KVILPYALPGVLTGVILGLARAFGEALAVAMVIGPSNTFPKNILSPTSNLTTVIAGAMG
FT                   NAAQGGELQSALWSMALLLLVISFVFIMVVRIISKKGATHL"
FT   gene            259619..260518
FT                   /locus_tag="Ethha_0246"
FT   CDS_pept        259619..260518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0246"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="KEGG: mcu:HMPREF0573_11373 phosphate ABC transporter
FT                   permease; TIGRFAM: phosphate ABC transporter, inner
FT                   membrane subunit PstA; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25833"
FT                   /db_xref="GOA:E6U798"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6U798"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ADU25833.1"
FT                   /translation="MSTSAAKVKSATKAQRADHVATGVLYGVAGFFLLLLGAFTIYILF
FT                   RGGRAAMILTAAHSTGIGAQLFNTVYLVILSLLISTPIGICAGIYMAEYMQEGRLSSFI
FT                   RTCIETLSSLPSIVVGLFGYLVFLVMTHSSYNLVAGALAVSILNLPLVTTTTEDALRAI
FT                   PKYYKEGSLGIGATHWQTIARVLLPASIPRIITGVILAGGRAFGEAAALLYIVGTGTDI
FT                   RFGNWNITSPMSPLNPFRSGETLSMHIWDMNTNPSVPHAGEQADVSAAILTIMVFVFSL
FT                   GARFIGNALERKMTGNKQ"
FT   gene            260537..261292
FT                   /locus_tag="Ethha_0247"
FT   CDS_pept        260537..261292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0247"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: phosphate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; KEGG: tjr:TherJR_2127
FT                   phosphate ABC transporter, ATPase subunit; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25834"
FT                   /db_xref="GOA:E6U799"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U799"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ADU25834.1"
FT                   /translation="MNVKMAAKNVNLHYGEVHALKSVNLNAYENHVTALIGPSGCGKST
FT                   FIKTLNRMNDLIQSVRVEGEITLDGEDIYSRDMDVTLLRKRVGMVFQQPNPFPMSIYDN
FT                   IAYGPRIHGMKNHAKLDEIVEKSLRGAALWDEVHDRLKKSALGLSGGQQQRLCIARALA
FT                   VEPEVLLMDEPTSALDPISTMKIEELAGELKKQYTIIIVTHNMQQAARISDFTAFFLHG
FT                   EIVEFSETNTLFSMPKDKRTEDYITGRFG"
FT   gene            261406..262068
FT                   /locus_tag="Ethha_0248"
FT   CDS_pept        261406..262068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0248"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="KEGG: cce:Ccel_2105 phosphate uptake regulator,
FT                   PhoU; TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25835"
FT                   /db_xref="GOA:E6U7A0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A0"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ADU25835.1"
FT                   /translation="MNVRTEFQKELEQLHLHLIRMGGLVEEAIDRSIQAFEKHDSDLAQ
FT                   SVVDNDKQIDDLEREIETQCLRLLLRQQPVAKDLRAISTALKIVTDMERIGDHAVGIAD
FT                   ILLRFGEHPRTQTIEHIPLMAHIASSMVKDSVNAFVHSDMKVSREVIERDDEVDHLFHT
FT                   IQQEIISLLVQSPENADEAIDLLLITKYIERIGDHAENIAQWVIFYVTGSLKDKQII"
FT   gene            262243..262929
FT                   /locus_tag="Ethha_0249"
FT   CDS_pept        262243..262929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0249"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: cth:Cthe_1600 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25836"
FT                   /db_xref="GOA:E6U7A1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU25836.1"
FT                   /translation="MSKTAFVVEDEENIREVIKCALESCGLRVKGFEEAELLFEEMEKV
FT                   LPDLILLDIMLPGMDGLSALRQIKAGPAAHVPVILLTAKSSEIDKVTGLDLGADDYVTK
FT                   PFGVLELMARVRAALRHAGQAGSDRSVLIARGIRLDKERHEVTLHEKAVELTLKEFELL
FT                   KLLMENEGKAMTRNILLDNVWGYGYAGETRTLDMHVRSLRQKLGIDETGGHYITTVRGV
FT                   GYKFDS"
FT   gene            263036..264418
FT                   /locus_tag="Ethha_0250"
FT   CDS_pept        263036..264418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0250"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: pth:PTH_1830 signal transduction histidine
FT                   kinase; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25837"
FT                   /db_xref="GOA:E6U7A2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADU25837.1"
FT                   /translation="MLKRSVWGAALITVLVTVLICGLGWAAADALGQAQNRLLPPCILA
FT                   AGLLVGTLTAWVTCSRVQKRAEKCMDHITQVLGQLQQGVLDSAHVTIQDAFLPGQKRVQ
FT                   ELLMQISRESERARSERERADDMLNNMSEGLVALDNALTIVVMNKRAGEFFQSGNANML
FT                   GQNLLHLTHMPKLIEAATKTAETGKPDVFDWEDTERGLTLQISVSAVNGLDEGNRNGVV
FT                   LLISDVTAVRRTEQIRSEFVANASHELKTPLTAIKGFVELMEADIITEPDQIKSYLGRI
FT                   RKETERMIELINDILHLSELESVNADTGFTAVSMKLTAQRAAESVALSAHKRNVSVQVE
FT                   GDVGTVRANPDRMMQLALNLIDNAVKYNKPDGNVRVTIISKDGNVHFCVNDTGVGIPPE
FT                   ARQRVFERFYRVDKGRSRRQGGTGLGLSIVKHIVGLYKGRIEIESIVGEGTSITVILPA
FT                   NL"
FT   sig_peptide     263036..263116
FT                   /locus_tag="Ethha_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.908 at
FT                   residue 27"
FT   gene            264581..264853
FT                   /locus_tag="Ethha_0251"
FT   CDS_pept        264581..264853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0251"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: bld:BLi00788 YflL"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25838"
FT                   /db_xref="GOA:E6U7A3"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A3"
FT                   /inference="protein motif:PFAM:PF00708"
FT                   /protein_id="ADU25838.1"
FT                   /translation="MVLRYHMLVSGLVQGVGFRYFVWQNALRLHLTGWVKNLDSGDVEL
FT                   EAEGPADQLDTFIKQVEKGSRFSRVEFVKVDAIEPTHSHSFEILN"
FT   gene            complement(264956..266242)
FT                   /locus_tag="Ethha_0252"
FT   CDS_pept        complement(264956..266242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0252"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /EC_number="2.5.1.47"
FT                   /note="TIGRFAM: O-acetylhomoserine/O-acetylserine
FT                   sulfhydrylase; KEGG: cth:Cthe_1842
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25839"
FT                   /db_xref="GOA:E6U7A4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A4"
FT                   /inference="protein motif:TFAM:TIGR01326"
FT                   /protein_id="ADU25839.1"
FT                   /translation="MSERKFKFDTLQVHAGQESPDSATGARAVPVYQTTSYVFKDTDEA
FT                   EGRFALKLPGNIYSRLTNPTTDVFEQRIAALEGGTGALATASGAAAITYAILNVAGTGD
FT                   HIVSASTLYGGTYNLFATTLPRYGITTTFVDPDEPENFRKAINDKTKAVYIETLGNPGI
FT                   NVIDFDAVAAIAHEAGVPLIVDNTFATPYLFRPLEHGADVVVHSATKFIGGHGSAIGGV
FT                   IVDGGSFDWAANGKFPGFTEPDASYHGIRYVDLGGVAFVMKVRAQLLRDLGASLAPWHS
FT                   WLFIQSLETLSLRVARHVSNTEKIVKFLEEHPKVASVNYPGLPSNKYYALAQKYLPKGA
FT                   GSIFSFDVKGDERIARKFIDSLEIFSQLANVADAKSLVIHPSSTTHQQLTPEEQKAAGF
FT                   GPETVRLSIGIEDPDDLIADLDQALNKTV"
FT   gene            complement(266559..267377)
FT                   /locus_tag="Ethha_0253"
FT   CDS_pept        complement(266559..267377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0253"
FT                   /product="asparagine synthase"
FT                   /note="PFAM: asparagine synthase; KEGG: ckr:CKR_2212
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25840"
FT                   /db_xref="GOA:E6U7A5"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A5"
FT                   /inference="protein motif:PFAM:PF00733"
FT                   /protein_id="ADU25840.1"
FT                   /translation="MDSVLQQKREILLRYLQGLGSVAVAFSGGVDSSFLLRSACDALGV
FT                   SHVLAVTARSATYPERELREAVALAKAFGVQHEVIRSEELDVAGFENNPTDRCYLCKNE
FT                   LFHKIRAVADRHGVAEIAEGSNLDDIGDFRPGMKAVAEQGIHSPLRAAKLAKAEIRALS
FT                   RELGLPTWDKPSFACLSSRIPYGEKITREKLRAIDEAEQLLLDMGFRQVRVRHHGDIAR
FT                   IELPPAEMPRMLESWNAARVNAAFRRLGFTYVALDLGGYRTGSMNAVLGK"
FT   gene            complement(267414..268514)
FT                   /locus_tag="Ethha_0254"
FT   CDS_pept        complement(267414..268514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0254"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bwe:BcerKBAB4_1797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25841"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A6"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADU25841.1"
FT                   /translation="MEVLLAFFKKPYVRRILIFIVMVALLALLRSMLSIFLLTFMLVYI
FT                   GNSAEKAVSQLFLKVFRRKADPRVVVAVLYALVILALVMLLWIYIPVIVRQISDLITNM
FT                   TDYFTSVSKTKASAGGRFSLESITAFVSSHVDVSKYLESGGTSIAQFLTNLGTASFNIF
FT                   MSLILSLFFLLGKPSVVAFGRQFKNSKLSWMYEDMRYFVRKFSNSFGAVIQTQLLISCI
FT                   NTTISTVALLIMGFPSVIGLAAMIFVLGLVPVAGVFISLVPLCIIGYVQGGITKVIWVL
FT                   VLIAVLHALEGYVLNPKLMSNKTQLPVFITFLVLLIAEHLIGLWGLVIGLPLAVFILDV
FT                   LEVLPQGGRQETRRPLSRFVVPKRRE"
FT   gene            268842..269027
FT                   /locus_tag="Ethha_0255"
FT   CDS_pept        268842..269027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25842"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A7"
FT                   /inference="similar to AA sequence:KEGG:Dhaf_0015"
FT                   /protein_id="ADU25842.1"
FT                   /translation="MSQLNQMELQNLRHMIGEHESAYQKLQDYAQQATDPQIKAFFQKS
FT                   AQSAQSTKQKLLSFLN"
FT   gene            269041..269289
FT                   /locus_tag="Ethha_0256"
FT   CDS_pept        269041..269289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0256"
FT                   /product="Coat F domain protein"
FT                   /note="PFAM: Coat F domain protein; KEGG: dhd:Dhaf_0016
FT                   coat F domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25843"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A8"
FT                   /inference="protein motif:PFAM:PF07875"
FT                   /protein_id="ADU25843.1"
FT                   /translation="MLQEKTMVNDALADEKNGLTFYANAISECANPQLRSTIQQIRNNC
FT                   ETSQYELFQLAQAKGYYKPAQQANESDIQQVRSQLQG"
FT   gene            269470..269910
FT                   /locus_tag="Ethha_0257"
FT   CDS_pept        269470..269910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0257"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: dae:Dtox_4132 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25844"
FT                   /db_xref="GOA:E6U7A9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A9"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADU25844.1"
FT                   /translation="MASFKKIVSAFRKRYPTLYQLAGFCAVGASGLLVMMAAYYLFLAF
FT                   HADKQVANLAGFSASTAYAYLMNFVFVFQAKTVPPKRAAVKFFALYIALYFFSAYMVHV
FT                   FTDLLHISVLLIPILNSILITPPSFLGSKYWVFREKEKSLGA"
FT   gene            270012..270088
FT                   /locus_tag="Ethha_R0003"
FT                   /note="tRNA-Arg1"
FT   tRNA            270012..270088
FT                   /locus_tag="Ethha_R0003"
FT                   /product="tRNA-Arg"
FT   gene            270453..270629
FT                   /pseudo
FT                   /locus_tag="Ethha_0258"
FT   gene            complement(271262..272332)
FT                   /locus_tag="Ethha_0259"
FT   CDS_pept        complement(271262..272332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0259"
FT                   /product="FkbH like protein"
FT                   /note="TIGRFAM: FkbH like protein; HAD-superfamily
FT                   phosphatase, subfamily IIIC; KEGG: cce:Ccel_0989 FkbH like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25845"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010037"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B0"
FT                   /inference="protein motif:TFAM:TIGR01686"
FT                   /protein_id="ADU25845.1"
FT                   /translation="MPEAAKKVKCVVWDLDNTVWNGTLLEDEEVRLNQDAVSTIKELDR
FT                   RGILNSVCSKNDGDFAMEKLRQFGIAEYFLYPQIGWDAKSESVRKIAQQINIGIDTIAF
FT                   IDDQPYELDEVSFHCPEVRCFSADRIHGLLEQPEFTPDFITVDAQHRRQMYLSNIRRQK
FT                   SEDSFSGPKEGFLKSLDMVFSIKEADYSDLKRVEELAARTHQLNTTGYTYAFDELCAMM
FT                   ESPRYKLWVAGLDDKFGTYGKIGIALAECMDDRWIIKLFLMSCRVMSRGVGSVFINYLI
FT                   NCAKEAGKSVYAEFLPTDRNRMMLITYRFMGFQEDHTTGDLMYLKYDFGTVHEYPAYIR
FT                   LVLPDQNAAPLCEQQG"
FT   gene            complement(272348..273196)
FT                   /locus_tag="Ethha_0260"
FT   CDS_pept        complement(272348..273196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0260"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain-containing protein;
FT                   KEGG: cce:Ccel_0986 3-hydroxyacyl-CoA dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25846"
FT                   /db_xref="GOA:E6U7B1"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B1"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADU25846.1"
FT                   /translation="MSPIYIIGAGVMGTGVAQCLAEAKLAVVLIEKEPDALQRAGELIA
FT                   KNIKYQRMFRHGDQEPLEETTARIRYADDLQLIKDAAFVIENITESVELKSELYRQMDE
FT                   LCAGDCIFMVNTSCVSITRIASLVKHPERVIGTHFMNPVPMIAAVEVIRGFYTSDETVQ
FT                   KVTGLLKSLKKRSIVIQDMPGFVSNRISHLMMNEAAFIVQDGVAEAKQVDDIFKSCYGH
FT                   KMGPLETADLIGLDTVVNSLKVLYESYQDPKFRCCPLLRKMVDAGLWGRKTNKGFYTYS
FT                   F"
FT   gene            complement(273224..274360)
FT                   /locus_tag="Ethha_0261"
FT   CDS_pept        complement(273224..274360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0261"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: cce:Ccel_0988 acyl-CoA dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25847"
FT                   /db_xref="GOA:E6U7B2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B2"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADU25847.1"
FT                   /translation="MSKLFAEDKAKRKKISAFVREQIKPFAAFVDQQEAIPEQLLANIK
FT                   RSGYLGATVSPAYGGLGYSNSALFSLNEISGTGCSSFRSMLTVHGMVSIAIEKWGNDAL
FT                   KNKYLPLLASGEKLASFALSEPDAGSDLKQIKTAAVYEDGSYILNGLKKWITFGQISDL
FT                   FLVFAQVGDKPTALLVDRNTPGFSIKPIKGLLGARGSMLAELTFEQCRVPADNLVGKEG
FT                   LGLSHVAQYCLDYGRFSVASGCVGLAQACLDESIGYSKKRICSGKLLRKHPLIQKKIAE
FT                   MAVNIEAARLLCQKAAALKDAGDPQSILATWHAKYFCAKMVVQVASEAVQIHGANGCTN
FT                   EYPVERYYRDAKINEIIEGSNEIHELLIGINSYFNSRS"
FT   gene            complement(274353..274616)
FT                   /locus_tag="Ethha_0262"
FT   CDS_pept        complement(274353..274616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cce:Ccel_0987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25848"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B3"
FT                   /inference="similar to AA sequence:KEGG:Ccel_0987"
FT                   /protein_id="ADU25848.1"
FT                   /translation="MQENEKIKETLKEFLGRFFDLESVSDDEDLYQQGYVNSLFSVQLV
FT                   MFLENDFHFSIDQEDLNLENFNSINHILHFIDTKASTMKEGV"
FT   gene            complement(274642..275313)
FT                   /locus_tag="Ethha_0263"
FT   CDS_pept        complement(274642..275313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0263"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /note="KEGG: bay:RBAM_016900 BaeB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25849"
FT                   /db_xref="GOA:E6U7B4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B4"
FT                   /inference="similar to AA sequence:KEGG:RBAM_016900"
FT                   /protein_id="ADU25849.1"
FT                   /translation="MPLTVSPLYVKSHHIANYCYLIVNEENREAVLIDPAWDLSKIRRQ
FT                   LKQSGANLSAILLTHSHYDHTNLVEKLVKLYNPDVYMSQRETAYYKFQCPNLIELEDGQ
FT                   ELDLHGINVKCTLTPGHTAGSMCFGIENRLFTGDTVFIEGCGICADDGADAGELYESLS
FT                   RLRDSFPPKTIIYPGHSFGEKPGVPFESVLKINIYFQIDDKEQFITFRTRGNQKGLFQF
FT                   K"
FT   gene            complement(275341..276102)
FT                   /locus_tag="Ethha_0264"
FT   CDS_pept        complement(275341..276102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0264"
FT                   /product="ABC transporter related protein"
FT                   /note="manually curated; PFAM: ABC transporter related;
FT                   KEGG: gym:GYMC10_4797 ABC transporter related protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25850"
FT                   /db_xref="GOA:E6U7B5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU25850.1"
FT                   /translation="MISIEAIIQTHGLCKAYNSSEGNVLKDLDLEIYKGDFTVIMGRSG
FT                   SGKSTLLYLLSVMDYCTAGNINLLGKDMTKESQKSLAKIHRESISFVFQGINLLPDLTL
FT                   FENIVFCGYAVNKDKAAVAQKAEELLKLFELWDKRKSYPSEVSGGQQQMVAIARALIND
FT                   PEIIFADEPTGALNGAVGQDVLDTLSRLNAEGRSIIMVTHDLNAAARASRMLYLRDGSI
FT                   SGELRLEPYQATGDLKERTTRIFDFVENLGW"
FT   gene            complement(276117..278432)
FT                   /locus_tag="Ethha_0265"
FT   CDS_pept        complement(276117..278432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0265"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   lgs:LEGAS_0445 ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25851"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B6"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU25851.1"
FT                   /translation="MYLMKARSLKVKLVMIGAIVFVASTIFTTCLTFISGVNGYVSQYY
FT                   SGHQTADLFFNTADPQKAKTILDSCTDTDYVSAYKQYQGYRVSNAVTVNGNSIDPGYLY
FT                   AFSFQDTKDLPWQMEVLQANGSTTAPPKGDIWISQLFADQYHVKLNDTIQLYPGHSVQL
FT                   KVAAIVNNALTPSALLGIDYFYLNRDDMTQLGSFRAVNLIAVQAKASVSKTKKHLLSTV
FT                   DNQVGGILLDKGTLIQSATMLSSIVGGVGLLASVLILISVLFSIAFILKSILKKEYKQL
FT                   GVLKSLGRTNREVRRIYYLPFLLVNTAAVLVGCGVSVIISNTLIHIILRYIGDYTFSAI
FT                   AVFVTALCFLALAAIIAVFTILVTRPVNKIIPAEAFRNTNTAAVDSKLTVVKSSSSAFA
FT                   MAINDMFKYSHVSLLLVIVFCISFYLTFLFFNINYSVSRINENASKWFSTPQSDLVITG
FT                   NLFSSDGKDEVLQTIQNSSDVKSYIYGDIITGANVGLNKQKYDLKSSNMSITVMNDFNS
FT                   QFQFSILAGHNPEHVDEVAVGNNILRDTGLHVGDRISLLFNNQEHDMKIVGSYITLLNN
FT                   GYNIKILHDTLSKYDVPANETAICVRLKNTADFDRVKQSILQTYPGVSVNAALPDISNT
FT                   VSTVSDIVTPVTLILIVAILFFSLLNVVMITIITNTDQRKNFGIMKALGFSSGYIMARN
FT                   LARIAVLSAAGLVFAFLFNAFFSAKLFAFALGGVDGFLNSIAGTLILSGAIIASILAAG
FT                   FFSGLSVFSVSPRELFDE"
FT   gene            complement(278423..279694)
FT                   /locus_tag="Ethha_0266"
FT   CDS_pept        complement(278423..279694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0266"
FT                   /product="Acyl transferase"
FT                   /note="PFAM: Acyl transferase; KEGG: cce:Ccel_0975 acyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25852"
FT                   /db_xref="GOA:E6U7B7"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B7"
FT                   /inference="protein motif:PFAM:PF00698"
FT                   /protein_id="ADU25852.1"
FT                   /translation="MEKIAFVFPGQGVQFVGMSKKLCEEYRVADETFSMANSVLGKDIR
FT                   KICFEGSLTALNDLENLFPIILTNGVATYNAFMQDIGIRPQFCVGHSLGEITALVCAGV
FT                   LDFSDALALTALRGRLAKQVADNGKTGMTILDKVPYETIEAECAKIRESGFYAAVSCYN
FT                   TPQQTAVSGETEALKQLEKFAIKRHGTVNPIYGGAPLHSTLMNGVAEDFAADLEGRPVH
FT                   PFLYPVVFNTTAQPSVDPAGVRGLMVRQLYSPVLWQNSLELLVRYGINVLIEMGPKPVW
FT                   QNDIKLFYPDVHTFCFGQQKDREEFRRFLNGKPHLLKEKGNLITRCLAAAVSTPNANWD
FT                   NEAYREGVVRPYEEICKIDLEVEKCGGTPTPTQTNDAMAYIRQILDTKKVAPDEKTYCL
FT                   GGILNQAGYCGLARTAFGKESQCI"
FT   gene            complement(279724..291444)
FT                   /locus_tag="Ethha_0267"
FT   CDS_pept        complement(279724..291444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0267"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="KEGG: cbe:Cbei_0250 amino acid adenylation
FT                   domain-containing protein; TIGRFAM: amino acid adenylation
FT                   domain protein; SagB-type dehydrogenase domain; PFAM:
FT                   AMP-dependent synthetase and ligase; Beta-ketoacyl synthase
FT                   ; KR domain protein; phosphopantetheine-binding;
FT                   condensation domain protein; Non-ribosomal peptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25853"
FT                   /db_xref="GOA:E6U7B8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B8"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ADU25853.1"
FT                   /translation="MKEIYKQIAQMIKDGKIDKGSAALLLKQLRTEEKIRSRAIAVIGM
FT                   ALHFPHADTPDAFWNVLQNGMDCITAFPKNREAQISHYVSSVFHLDEPDYQSGGFLGHI
FT                   DRFDDSFFHISPREAELMDPNQRLLLQTAVEAMEDAGYGGTQLDNTKTGVYIGYANVLK
FT                   DSYQNIIFHERPDLIPQSIINNLSAELPSRIAYLLNLKGPTMVIDTACSSSLVCIHTAC
FT                   RAILNGDCEQALAGGIKLQLVPVNHESYRVGVETESGRTRTFDDQADGACMGEGVAVVF
FT                   LKPLEKAVSDGDHVYAVVKGSAINQDGSTIGITAPNPEAQAEVLAAAWQNAGINPEALD
FT                   YIVSHGTGTRLGDPVELKGIRAAFRRYTDKKQFCAIGSVKPNVGHLFECSGVANLIAGI
FT                   LALRHQQIPPSLHFQHPNRTVGFCGGPVYVNTKLRDWNVETGEKRLCGINSFGLSGTNC
FT                   HVVLEEAPEPVAVACGATEGPRVFTLSAKSRASLSALLDSYRRFFADGTAPFDAACYTS
FT                   NVGRGHYGYRIALLADDMRDLLRKMDRISAGAPGSVPDSGLFYGYHQLVPAGVHDAGTV
FT                   TEAEIARQDELGRVLVERLAAEPGQENGAVLYRQLCELYVQGAHIDWRPLYPEDARRKI
FT                   PLPAYCFDGRPCWIPANPQAKSHSDGFFSVRWTPKPIAPTAQAGSAVLVFAREESPAAQ
FT                   QIVRDLSDAGKTVTLIVRGDGAQQAEKTSANHLFAAPGDRARYETIFRETAPSHILLLL
FT                   SPPEDDTAQAAGLSVLLSLVQAIGREAAVQLLLLGDYVYPVTGDEPYRHPQNAPLFGFL
FT                   KGVEREYRNIRCRAIDADTDFDTTRLLEEMAAPDELPVIAYRGGRRYAEQLTESAPERY
FT                   PASGMQIRDGGVYLITGGTGGIGLEMARFLAEKKRIVLILAGRTALPNRSEWDALAEHP
FT                   DTGAPGEKIRRIRALERTGAHVLTECMDVSDPAAVRACLSRVKSAFGRLDGVIHAAGIA
FT                   GNALLEDETLHNTLSVLKPKVSGAMNLLHAVQDEPLDFCLFFSSIATVLPAPGQAGYIA
FT                   ANAFLDACAGMKAGKSAVVKVINWSTWKETGMAFRHHVNMDTIFESLPTETALAYFDAV
FT                   WDRAFDRLLIGRPNPKLMFLMEKEPILLSETIDRGHVNREAAAAVQTVRPVLARANVQG
FT                   APELLGKSSDAYTPTEQKLAGYLYSTLGFDRVNVYDNFFEMGMDSISIVRLTDEIKKDF
FT                   QISLAFSVFLDNPTIYNVAKAIDVGAGVRTEKPDTVVPPSGHGDHFQAFPLSKVQASYL
FT                   FGREKKYELGGIATHAYMEIRTERDIPRLNRALRKLIERHDMLRAVILPDGTQKFLESC
FT                   PDYSIRCDDLSGLGAEEAGRHVQALRDRMSHRVYLAGEWPLFEIRACRMDHNTNLLFIS
FT                   IDMLIADAVSLEIIINELTEYYEDETLSLPQLQYSFRDYQITLARQADSPEYARDKAYW
FT                   LERLELFPDAPRLPYRTALSAISHVRFRRLEHLFSKQETDRVNELAHRHGVTLSAALCC
FT                   AYAFILSLYCNQRSLAINLATFNRKQLHPEVDQLVGDFTSVILLATELDFDRDFWANAQ
FT                   RLQSTMMEGLEHRLYEGVEFIGELAQKNGTPNAAVMPVVFTSMLYQGAGSSIGKLGQIT
FT                   YAISQTSQVVLDNQVREVDGALQFNWDYVESAFEPQEIEKIFDGYISYIQSVAAGRIDA
FT                   PVLNEDDRRLIEAYNHTEWACAPASPAELFEKQAAARPEATAVICEGERITYGDLDARS
FT                   NRLANYLKSHGVSRGNTVGILSARQIETIVNILAVLKCRAAYVPIDPGYPKSRCDYILE
FT                   NSCADLLIETDFYKEHDVGQYPADRLPEACVPDDVAYLIYTSGSTGKPKGVIISNKSAC
FT                   NTVLDMNRRFHVTERDIFLGISSLCFDLSVYDVFGALSCGGALVMVPDQHDIGHLIETV
FT                   AQQRVTIWNSVPAIMNLAVEFCENDPDARLSSLRLVLLSGDWIPLKLPDRIRRHAPDAQ
FT                   TISLGGATEGSIWSIYYPIDAVDAGWRSIPYGMPLANQTIYIVSGDGRLCPVATPGEIC
FT                   IGGIGVANGYANNEAQTTASFIAHPQLGRLYKTGDFGILTSAGYVEFLGRRDAQVKING
FT                   YRVELSEVEKCIEGLAGVEAAKAVVLQGKGGSHVIGAFVKAGRDVTAQAVQQHAAAHLP
FT                   RYMVPTTISILEAFPLTFNGKVDVKKLSATVEPEQQTVRETGASNQTEERLIRIFKETL
FT                   HLEAVGIHTSFFDMGVNSIQIIQIANKIHTVFNKKIAFKDFIDKENISELASLLQDTEQ
FT                   AAEDEVTYRSVAPDLANLNEPFPLTQVQTAYLMGREKIFELGGVSTHGYAEMENALEPD
FT                   RLNAALEKLIARHPMMRMVILENGMQQILKYVPKYRIEVVDLRGLPDEEKQQRLMDERA
FT                   RMSHYIFDPGKWPLFDLRIYRLENAKNAMFVGYDLLMADGMSIQVISRELMAYYEHPDT
FT                   DLHPIFFSFRDYVLALEDFKQNSKTYQSDRAYWLEKLEDFPFSPALPLKMPPSEVEQPH
FT                   FRRLSKVFGQRDWSRIKEFAASQSVTPSSLICSIYAKVLAFWSNSNRFALNLTVFNRYP
FT                   FHEDVNAVIGDFTSVLLLDISLNPGHTLVETAQQTQKTIMSALQHRHYEGVDFIRDIAK
FT                   RYNLERKAIMPVVFTSMIFGEMDHPEPYRSKLGKIEMSVSQTSQVYLDNQVSDSGNQLT
FT                   ITWDYVEELFDPDVVAKMFDQYTGMLTQILEGPVTGSIGVDQDAFRQILDYNQTQKPMT
FT                   ETTLAELMERQAALHAEQIAVMCEGISVSYGELSRKSNRIARYLKSKGIARGAFVGVLT
FT                   ARRIESVANILGVLKAGAAYVPINPDYPQKRREYMYDNCGCSLLLVPDTYEEEQLERLD
FT                   DSAMLDGRPEDVAYVIHTSGSTGNPKGVVISNQAACNTILDINEKFGVSGQDRILGISS
FT                   MCFDLSVYDLFGAFAAGATLVIVPDQRDIAHLLELVEREKITVWNSVPAIMELAVGQLN
FT                   RETGAEPPRMVQAAARPSAMAPRENELYYWSPAVHWTERDGHIMAGDYVCPDEMAKLMP
FT                   AFYFRAQAGATLAELAQLYGAQSDSFPHFLKELTEHRVLVNSILPPDEIFAQQNKMFVN
FT                   PYAEDIIYNYEANLRFKEEQLNRTVVRGGKPVTFPNRYQYPPSIANRRSVRDYDTERPV
FT                   PFDTLCAFLSVMHQNVEDRHYQYYYASAGGLYPIDIYLHVKPGRVENLEQGIYYYNPVA
FT                   NSLQLVEPNPTLTEAAHYYTNKKIFKSSAFSVFFLYNAGANMPKYAGKGYFYAILDAGI
FT                   LAATLTHTAELIHLGTCSIGDMMFRKVEADFHLNCNQVWVHTMEVGLKKAENGTAPEMI
FT                   ETITVNRLESGPAEQTVEQKTEETPSFRAGQWDAASLRLVLLSGDWIPLHLAGQIKTAC
FT                   PNAQIISLGGATEASIWSIYYPIRAVKTEWSSIPYGMPLANQTIYIMGLDEELCPIGTP
FT                   GEIMIGGAGVAEAYINDEQKTQAAFVVHPKLGRLYKTGDYGIFRPEGYVEFLGRKDSQI
FT                   EIGGHRIELGEITANLEQNPNTAKCVSVPYTDTNGIEQICSYVVLKNAVLISELRAYLK
FT                   ERLPDYMVPARILEVNEIPLTDNGKLNTKALPDPRLFGRETASYEGPSTEIEQKLEAIV
FT                   AQYVGTGKVSVTDDIFEAVGNSVILIQMHQEIDRMYPGIVKVVDLFNRPTIRQIAAFIQ
FT                   ETSAQRHKRRYPPICLPENWFVPKNVAKPCQADIAIRESQYAALARAARHFSTPIGTLV
FT                   FISFAYALAGMTAQETLHLPGVINRTNQMELFEIDFSGKSSFSELLEDQQAVKIVQTGP
FT                   FTNRADDWVDKGKYAIVPLVYNKSLLNSNVALSEQYDLCLAFDENSGTRELSAEIRSSR
FT                   LAPEKLRSLVGVLGKTLELLTKETAL"
FT   gene            complement(291535..295242)
FT                   /locus_tag="Ethha_0268"
FT   CDS_pept        complement(291535..295242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0268"
FT                   /product="6-deoxyerythronolide-B synthase"
FT                   /EC_number="2.3.1.94"
FT                   /note="KEGG: cce:Ccel_0976 beta-ketoacyl synthase; PFAM:
FT                   Beta-ketoacyl synthase ; KR domain protein;
FT                   phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25854"
FT                   /db_xref="GOA:E6U7B9"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B9"
FT                   /inference="protein motif:PRIAM:2.3.1.94"
FT                   /protein_id="ADU25854.1"
FT                   /translation="MNIKQLRMLNPGGTRPAGPENRADDGIAVIGIGLNMPFADTPDTF
FT                   WDHIENGIDCNRPISSYRKKLCPPVHQAKPADAFHYASYLEEIDGFDGAFFGLTPREAM
FT                   LMNPAERLFLETVQHTLEDAGCVVGSENRSVGVFVGLSSDIEWAKYRELVRQTEPEYMS
FT                   SGIEGLYAPMVAGYASYYFDLHGPSQITDTACSSSLVALHNACTAIRGGECDMALAGGL
FT                   RVMTLPVIDPNYRFGIESSDGFTRSFDAGADGSGTGEGVAAVLLKRQSDAVRDRDHIYA
FT                   VIRGSGVNHNGRSMGVTVTSPEAQGTLLSEIWRKAGIDPEQIGFLETHGTGTPLGDPIE
FT                   IDGIANAFARFTDRKQFCAISSVKTMLGHLYDCAGITSLIEAVLALSRRKLPPLVHFNR
FT                   PNRALDLMDSPVYINTKCRAWESDHPRLCGVNSFGVSGTNCHVLLEEATPSPAPAAVPA
FT                   ALRLFVLSAKTECTLKRYCDDYLAFLRAHRNISVDNLCYTAAVGRKAYACRFAACVDSV
FT                   SALSAALDRFRSGRADGSFFCNTPGIAGPTGLDGGGSELERIGKLYCSGRTINWTDVFS
FT                   GGSFQKLSLPVYPFEHVPLWPKLMSGDHREFYFRFAWRERALARQETAQKQPVLFCSDG
FT                   SAQAEAIRTALVERGVHAISTRFCKRFEKRANSEYSLGSSAEDSTAFLREMQEGRWKKI
FT                   VFFRASEKSRMARETLDALKETVENGLYRMLSLVKAIEKQDVSQKAEFIVVTDRAEEVT
FT                   GEETELHPENAMYSSLGKTVNQECCRVKCRVIDLDEHTSPAAAVDEILFGKDQAVALRN
FT                   DRRLIQRLEPVHLHKTENGNDPFREGGVYVITGGSGALAAHVAKWIAARRGTHLILIGR
FT                   SPIDPGHPAAGGSQAARTLETMEAIRALGSSAEYIQADVADERAAAEAFDRIRRTYGRL
FT                   NGVIHMAGITGNRMIVNMERSDFETVLAPKVFGTWNIDRLTQGDDLDFFLLFSSGVSFI
FT                   GETGLAAYAAANQFLNSFAQCRRRTRSVQAFDWVVWENQRMMDGYSRNVDGWFEQIRPN
FT                   DALACMRELMPRRESGLLIGRLNRKNRYEKSMFSHLPFEVSEEVQRMVRITERAAAPDH
FT                   TETGRRAASPHPADPRTIEGTLTGIFREVLGYQEIDIHDNFFDLGGNSILLKKLHQKVD
FT                   EAFPGQVEVADFFAYTTVSKMAAHLAQTAGPATATMQEAEKPDDKLLELIDSIDSDSDV
FT                   DAIVAQIENM"
FT   gene            complement(295232..297763)
FT                   /locus_tag="Ethha_0269"
FT   CDS_pept        complement(295232..297763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0269"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase;
FT                   phosphopantetheine-binding; KEGG: ckr:CKR_2077 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25855"
FT                   /db_xref="GOA:E6U7C0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADU25855.1"
FT                   /translation="MHHIDSYLLNHKDSQQSMSFLYGHGETVCLTYRDLYLRSVRLLHY
FT                   LQEHRLMKGSRLIFQLEDPCAFVQAFWACVLGGVVPVPIPVAKSSLDFSRLFNIWRQTG
FT                   RPLILTDKAAQRFIHTASATAGKAAWREEMEAVWMTLPEELPDKTGELNTPDDEDIAYI
FT                   QFSSGSTGDPKGVLLSHKNMCTNVEAVKKAGRIGGTDLALSWLPLTFNIGLIGFHLIPV
FT                   ELGIDHTILSPELFIRDPLIWMDQANQRRTTILSSPNFGLEYFLRRFLTADRRFDWDLS
FT                   CVRLIFNGGEPISRSACTKFLQALKPYGLQEVAMRDVYGMSEATLGVSFAPCGEAPIFA
FT                   AVDRRQLSVGQHVREAESPNDEGTSLFCDLGYALDGCAIKVCDADYRPLADGTVGYVYV
FT                   KGDSVSNGYLDRALDGVFRPDGWLYTGDIGFLRRNRLVLTGRAKDMLIVRGHNYYCNDL
FT                   ERLVLETVGVKCAIVILQDQDSKNDELAVFVQVPEPYEKYASAFQRVEHLFLQNIGQRP
FT                   KSVLPVERLPVTGSGKVDKETLKSHYLRGAFQTLEANVALMREQTPSTLTEGFNDTEKQ
FT                   LAEICAQILQTTDIDKDTSLFDLGGNSTQLVEIQREIEYAFPGLSRLTDLFTYPTISKM
FT                   AAFLDRQHADPIGRVHAPRLTRTAPSAPTAPRMFSVDWTEQECAGHQQYCSLHRLSLEA
FT                   FRVGLFVCMLPLETDCETAGLNVMRPDKRIRPVHIKLYESRDVLDALQSIAAQLSEEDG
FT                   ACALPEDAALRRFPSDDLSLLFLPDGAAPTPPEELLDTFDVVAVSGPSSIRFFCNASKV
FT                   DCDAFNALTDGYRDAICQLQPDGFMRVSHEY"
FT   gene            complement(297789..299666)
FT                   /locus_tag="Ethha_0270"
FT   CDS_pept        complement(297789..299666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0270"
FT                   /product="6-deoxyerythronolide-B synthase"
FT                   /EC_number="2.3.1.94"
FT                   /note="KEGG: cce:Ccel_2377 beta-ketoacyl synthase; PFAM:
FT                   Beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25856"
FT                   /db_xref="GOA:E6U7C1"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C1"
FT                   /inference="protein motif:PRIAM:2.3.1.94"
FT                   /protein_id="ADU25856.1"
FT                   /translation="MNSLFELIDFDDIETKKPEADKSAPGENHSADEIAIIGAAVKLPR
FT                   ADNLRELWNNLLFGISACSDFPDQRYRDIENWFKCRNIRLTPQMFKKGNYLTDIDKFDY
FT                   DFFGLSADDANMMDPLHRLLLETFWNCLEDGGYCMQKVSGTCTGIYVGFNNDDIERYSR
FT                   MLQEKRVRFTMATMENNLSSILASRLSYLLNLKGPAMLIDTACSSSLCALHIACQGLKN
FT                   EDCEMALVGGINIGMVPIKYEGFRVESESDTLSPFDDSADGTVWGEGVVSLLLKPLRYA
FT                   VRDRDHVYAVIISSAINQDGMSVGISAPNAVAQRNVMVNAWEKAGINPEEISYMEAHGT
FT                   GTKLGDVIEMEGIRQAFERYTDRKQFCGIGSVKANIGHIEGASGLAGVVKLMLSLQNRV
FT                   IPKTIAFNRPNHSIAFEDSPVFLVDRLTPWESTGGRRTCGISSFGLSGTNCHAVLREFS
FT                   KDAPVSPEPAESAPYLLAVSAKSAYSFQQLLRAYAELLVENPAIDLESMCYTAGYGRDH
FT                   HRYRAAFVFTQKRELLDALKSAWNGDAARFDTNGLLRSEEKEALDREADRLVLDASQKR
FT                   GGECHQSYLDISRLYCRGAAVNWKLLYKNRAVKTLSLPVYPFERHRCWI"
FT   gene            complement(299685..300524)
FT                   /locus_tag="Ethha_0271"
FT   CDS_pept        complement(299685..300524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0271"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   cce:Ccel_0974 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25857"
FT                   /db_xref="GOA:E6U7C2"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C2"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ADU25857.1"
FT                   /translation="MFGVNKKGTGTLPVGDSETQDDILKILRQFLGIPKIKATDNFFQI
FT                   GLDSMALMDVFNQLKPQIPELKLTDLFNYPSVENLSRFLDSRRSLGAEPSARAVSLPAA
FT                   FLETPGHRGWKQWSIPLDAAAYTGAQHSLGTIAVSAFGFALAKMIGAPKINLQTATSHT
FT                   NRLTEIELDFDGIASFGALHQTVAEKLSGKEEYPASALRLKCAENPPAAIFPLVYDTAL
FT                   LEIDGEQLDFFALRLGYTETGSQVTLDLEYNTNVLNSAIMEKFYLAFEKTMTKMLLH"
FT   gene            300631..300816
FT                   /locus_tag="Ethha_0272"
FT   CDS_pept        300631..300816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25858"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU25858.1"
FT                   /translation="MYHDIIKITIYYKNLYFMYCIIDFHMLEFDMEMDGMRSFFIYGLA
FT                   GKRLCKPLGNDNQGLL"
FT   gene            300936..301883
FT                   /locus_tag="Ethha_0273"
FT   CDS_pept        300936..301883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0273"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: btk:BT9727_1639 multidrug ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25859"
FT                   /db_xref="GOA:E6U7C4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU25859.1"
FT                   /translation="MDLLNSVDLIKYYGKKMALDHLTFSIRENEVFSLLGQNGAGKSTT
FT                   INILTGLIRSDSGTFLFDGHDLKKEPAYFKRNIGFVPQDIAFYGRLTALENTKFFGSLF
FT                   NLSGRKLHQQAMEALDFVGLSEVANEFPGRFSGGMKRRLNIACSIVHKPRLIIMDEPTV
FT                   GIDPSSRNHILQSILTMKQGDSTIIYTTHYMEEVEKIADRILILDHGRKVAEGTQKELE
FT                   RKITARHTYTFFLSSTERVDPGALLRLESVCDVTVSKNKVVVSTNIFSRNINDIIAYFT
FT                   NNRIEILDIENQSISLESTFLALTEDGGKGEGTA"
FT   gene            301880..302965
FT                   /locus_tag="Ethha_0274"
FT   CDS_pept        301880..302965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0274"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bbe:BBR47_07540
FT                   probable ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25860"
FT                   /db_xref="GOA:E6U7C5"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C5"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADU25860.1"
FT                   /translation="MNVVWSVTAATFKMMIRNTKNMIHMVLIPLLLIVVLSAVFSNFFA
FT                   NRTLSTATGTIAYYSSGQGDFVDRFVQAETQAASPARFVRVRSLSDIYGADGYMKYAAA
FT                   VVYRNGQVYYYENENPAYSGVSDRIRPALLLFAARGGTETSSAANGNAAIQTVSLPART
FT                   SIDYYAVGILVMIIFNGAFSAMYSLKNDGRFNVVLRLRSAPSSLYLTLFGKIAGCLLIS
FT                   AVQSGLLLVLSAFMGADWGGNLPFLLFVLLTETVGATAFGFFVGAYTKQDTNVTAILTA
FT                   LVLVLSFLGGCFIPVRYFGGGMLTLCRLTPLYWTMQGLFQIIAGSGVNAAAVAVAFNLA
FT                   LGLLFLVSVYLKTGKMSISLE"
FT   gene            302979..304073
FT                   /locus_tag="Ethha_0275"
FT   CDS_pept        302979..304073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0275"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bld:BLi04003
FT                   YfiN"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25861"
FT                   /db_xref="GOA:E6U7C6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C6"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADU25861.1"
FT                   /translation="MKRIFLVGMNMFRILFRKKSSFVLYLLLPVLIAGAAFFLTHFFST
FT                   TVTVGVVNEDDGSYGKAFVNLLGQVGNAKIVSDTPSQLRQALDTGTVDYGIAVGRDFSR
FT                   QIQSGTVPQVTFYQYGSSASSGMEELVSATLKSEVGRAAGESGESVSVKTVSVPKTTSN
FT                   GNKNISTMGLFIMFLLFSASFVSELIIEDKAGGAFYRVISTPVSEPEYVLGNILVNLVI
FT                   VSAQILIALAAILFLFHIEVYVAFWKLFLTLLLFGCTATAFGILIASFCKEHEQANSLQ
FT                   TLIILPTSMISGCLMNISIMPDAVQNAARLTPQYWTLEAITSLQKGERFLNTLPDLLIL
FT                   AGFASLFFLVAIFVFKRNRDLNAP"
FT   sig_peptide     302979..303128
FT                   /locus_tag="Ethha_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.598 at
FT                   residue 50"
FT   gene            304098..304817
FT                   /locus_tag="Ethha_0276"
FT   CDS_pept        304098..304817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mcl:MCCL_1735 holo-(acyl-carrier-protein)
FT                   synthase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25862"
FT                   /db_xref="GOA:E6U7C7"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C7"
FT                   /inference="similar to AA sequence:KEGG:MCCL_1735"
FT                   /protein_id="ADU25862.1"
FT                   /translation="MDWGNRMEKSYEFVCISFGDVRMEQSVYQKHLHPLEQKLIEHAID
FT                   KRKAEFLSGRFCVRLAYARLCGGLSTEPCVLNDCYGAPFLTANGAYSVSITHDDGLAAA
FT                   LVSDKHRLRAALDVQRVSSRYTDAIYRFLRPSERELVDRHSGAYGRDFMVAAMWVAKEA
FT                   MSKLFQFGFSIYDILEISDFEKGGQFAVRFARLPYFQVMLRTSRDYLFGFAAPAKQMEA
FT                   FGENSLQIAPISLEHFI"
FT   gene            complement(305558..305634)
FT                   /locus_tag="Ethha_R0004"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(305558..305634)
FT                   /locus_tag="Ethha_R0004"
FT                   /product="tRNA-Val"
FT   gene            complement(305670..305744)
FT                   /locus_tag="Ethha_R0005"
FT                   /note="tRNA-Glu5"
FT   tRNA            complement(305670..305744)
FT                   /locus_tag="Ethha_R0005"
FT                   /product="tRNA-Glu"
FT   gene            complement(305794..305870)
FT                   /locus_tag="Ethha_R0006"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(305794..305870)
FT                   /locus_tag="Ethha_R0006"
FT                   /product="tRNA-Met"
FT   gene            complement(306016..307491)
FT                   /locus_tag="Ethha_0277"
FT   CDS_pept        complement(306016..307491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0277"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="SMART: CBS domain containing protein; TIGRFAM:
FT                   inosine-5'-monophosphate dehydrogenase; KEGG: ate:Athe_1639
FT                   inosine-5'-monophosphate dehydrogenase; PFAM: IMP
FT                   dehydrogenase/GMP reductase; CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25863"
FT                   /db_xref="GOA:E6U7C8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C8"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ADU25863.1"
FT                   /translation="MVLNTNAGEKFLKEGLTFDDVLLIPAKSDVLPPQIDVRTRLTKKI
FT                   RLNVPILTAAMDTVTESKMAIAIAREGGIGIIHKNMTIEQQAEEVDKVKRSENGVIANP
FT                   FYLSPDHLVRDADALMGKYRISGVPICENGKLVGIITNRDLRFITDFDTKVSDVMTKEH
FT                   LVTAPVGTTPEQAKSILMKHKIEKLLIVDDEGRLKGLITIKDIEKSVQYPNSARDEKGR
FT                   LLCGAAIGVTRDVLERAEALVKAQADVLVLDSAHGHSKNILNCLHKVKEHFPDVQVIAG
FT                   NIATAQAAEELIEAGADAVKVGIGPGSICTTRIVSGIGVPQITAIYDCACAAAKYGVPV
FT                   IADGGVKYSGDVVKALAAGAESVMMGSLFAGCEESPGESEIFQGRSFKVYRGMGSLGAM
FT                   NAGSKDRYFQENAKKLVPEGVEGRVPYKGPVSDTVFQMVGGVKSGMGYCGCRTIPELQA
FT                   NSQFVRITGAGLKESHPHDIYITKEAPNYSLNP"
FT   gene            307979..308422
FT                   /locus_tag="Ethha_0278"
FT   CDS_pept        307979..308422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0278"
FT                   /product="stage V sporulation protein AC"
FT                   /note="KEGG: adg:Adeg_1248 stage V sporulation protein AC;
FT                   TIGRFAM: stage V sporulation protein AC; PFAM: SpoVA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25864"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="InterPro:IPR014203"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C9"
FT                   /inference="protein motif:TFAM:TIGR02838"
FT                   /protein_id="ADU25864.1"
FT                   /translation="MAVTKKQYAQMANVQSPNSPIVKNCVWAFCTGGAICTVGQSMTNI
FT                   YQQFGLKELDASNAATITLVFLGAFLTGLHVYDKLAKYAGAGSLVPITGFANAVVSPAL
FT                   EYKSEGFVLGLGAKMFTIAGPVLVYGITASILYGLVLWIFKLF"
FT   gene            308531..309544
FT                   /locus_tag="Ethha_0279"
FT   CDS_pept        308531..309544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0279"
FT                   /product="stage V sporulation protein AD"
FT                   /note="KEGG: cth:Cthe_0123 stage V sporulation protein AD;
FT                   TIGRFAM: stage V sporulation protein AD; PFAM: Stage V
FT                   sporulation AD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25865"
FT                   /db_xref="GOA:E6U7D0"
FT                   /db_xref="InterPro:IPR010894"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR038369"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D0"
FT                   /inference="protein motif:TFAM:TIGR02845"
FT                   /protein_id="ADU25865.1"
FT                   /translation="MATRVGRYTIRLDQPPSVMGYASVVGKKEGEGPLADEFDQIEEDT
FT                   TFGEKTWEKAESRLQNTTLNKALGKADITPGTVDIIFAGDLLNQCIGTSYGLREFGIPF
FT                   AGLYGACSTMAESLAMAAVFVEGGFANVAAALTSSHFCSAERQYRLPLEYGGQRAPSAQ
FT                   WTVTGSGAVILGREGDGPYARELTFGRMVDLGIKDQSNMGAAMAPAAADTLQHYFDDTG
FT                   VSPDRFDLIVTGDLGAVGSNLLRELLQKEGVTLGENYNDCGLMIYDRDRQDVHAGGSGC
FT                   GCAASVLCSHILNNMKSGHLHEVLFMATGVLMSPLSVQQGQSIPSVAHAVHLSTSR"
FT   gene            309563..309919
FT                   /locus_tag="Ethha_0280"
FT   CDS_pept        309563..309919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0280"
FT                   /product="stage V sporulation protein AE"
FT                   /note="KEGG: amt:Amet_2221 sporulation stage V, protein AE;
FT                   TIGRFAM: stage V sporulation protein AE; PFAM: SpoVA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25866"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="InterPro:IPR014204"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D1"
FT                   /inference="protein motif:TFAM:TIGR02839"
FT                   /protein_id="ADU25866.1"
FT                   /translation="MEYIQAFLVGGILCVIGQLLIDKTKLTPARILVTYVTAGVVLTAV
FT                   GLYRPLVEFGGAGATVPLTGFGFALANGVREAVRQKGFLGVFTGGVMATAGGIAAAIFF
FT                   GYLVALVFKPGDKS"
FT   gene            complement(309977..310426)
FT                   /locus_tag="Ethha_0281"
FT   CDS_pept        complement(309977..310426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0281"
FT                   /product="TM2 domain containing protein"
FT                   /note="KEGG: slp:Slip_1317 TM2 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25867"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D2"
FT                   /inference="similar to AA sequence:KEGG:Slip_1317"
FT                   /protein_id="ADU25867.1"
FT                   /translation="MYCRNCGAAMDPSAVVCIKCGVPKGSGRNYCMNCGAQTAPEAVVC
FT                   VKCGVSLGAPNNSAPTAAGGQKSKIAAGILGIFLGGLGIHNFYLGYTTKAVIQLCLTIL
FT                   GWILAIPTLGIGFLLSSAMSIWGLVEGILILVGNIKQDGKGIPLQ"
FT   gene            complement(310617..312038)
FT                   /locus_tag="Ethha_0282"
FT   CDS_pept        complement(310617..312038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cce:Ccel_0298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25868"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D3"
FT                   /inference="similar to AA sequence:KEGG:Ccel_0298"
FT                   /protein_id="ADU25868.1"
FT                   /translation="MTRQVRNLVIVVCVAVALGAGVLLLNVLPGNKKTGSSSSSSSSGS
FT                   ISLLSIKSSAFHSLHVTNAAGSYTVTLTGGTYTVDTLKDAPSNQSAIQSKVNDVLGLKA
FT                   TTLIQKDATDLAQYGLTTPAATLDVATADGKTSTVKIGSQAPSGSGVYILKPGTNDVYL
FT                   SSTMMNDNFSQSAMQYASTTVSALGTSANISAYKFGGTARSTPFTVAVKTQSSAASSGS
FT                   SATATYTYALTQPYAYDGNDTNLGKITTALQSLSATSVVSVDVSPQSLAQYGLQNPAYT
FT                   LTYTVDGKDTTLSFGNADSSSNTVYMTISDKKAVYQVDTSSAAAFYNYQLSDVLSTALV
FT                   TSDISTVKTLTIQSGSETHTFNLSGSSDKLAVTDANGKKIDATSFRNYYQTILAITTRG
FT                   GADRPAGVSSSLTLTFTYNDGTAQRTVSFLPDGSDKSFVDINGSGGLYVYNSQISNLLT
FT                   LAQNLEAGKTVSASS"
FT   gene            complement(312035..313546)
FT                   /locus_tag="Ethha_0283"
FT   CDS_pept        complement(312035..313546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0283"
FT                   /product="ABC-type uncharacterized transport system"
FT                   /note="PFAM: ABC-type uncharacterised transport system;
FT                   KEGG: csc:Csac_0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25869"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D4"
FT                   /inference="protein motif:PFAM:PF09822"
FT                   /protein_id="ADU25869.1"
FT                   /translation="MANQTQKNDPHKNKPRRKLPDFMRQRSFRYGSTATAFTVIFIVAV
FT                   ILVNVLVTSLSSRFPLSVDMTANHKNQLSTQSVSFVKKINQDINIDILADESTYSNAQN
FT                   YNSCLLIMQQYAQHNSHIHISFVNLDKNPTYASKYPKETLSQADIIVSCGSIYKHIVSS
FT                   DLLTTSTDSTTGSSTVTGNNTEQVIDSAIAYVTAKTLPTVLVTSGHNETDSSALTSLLQ
FT                   KNNYQIETKNLATDGLDQNAKMILINAPTADFSADDIAKLDTFLNNGGKYGKTVFLIFD
FT                   PQQASAPNLESFAKKWGISVGTGVVYDTTNRYQDSPFSVLEGQTNSTYVGTLQSGLHAY
FT                   LSVCRPLTLSSSDSSITTASIVATESTSKLWNPGTINSSTAASFQASNSDKTGPFDVFG
FT                   VATKTATSGSESVKSNVLVLGSTNFFNSQVLAQPSLTNSTILLNTVGNVIGFNPGITVE
FT                   AKDLTTQSLTITAGQAIGIIVVFAFLIPLAVLIAGLVNWIRRRHQ"
FT   gene            complement(313562..314266)
FT                   /locus_tag="Ethha_0284"
FT   CDS_pept        complement(313562..314266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25870"
FT                   /db_xref="GOA:E6U7D5"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D5"
FT                   /inference="similar to AA sequence:KEGG:Athe_2367"
FT                   /protein_id="ADU25870.1"
FT                   /translation="MSAIYKREFQTYFTTATGYVFLAVFYAFSAFFFFAVNLQGSTTDL
FT                   GGLFSTLLLIWVLLIPILTMRLLSEDRRQKTDQLLLTAPVRLFDIVFGKFLAALTLFGM
FT                   AIGIVVIYALVLAGLGHVDFWATVGSFVGIVLLGAALIAIGLFISGLTENQVVSAVSSI
FT                   FIMLMLYLIDSISSAVSNAVISAIVTHISIFSRFKNFSLGVFNLGDTVFYISVAAVFLF
FT                   LTVRLLEKRRWA"
FT   sig_peptide     complement(314144..314266)
FT                   /locus_tag="Ethha_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.607) with cleavage site probability 0.565 at
FT                   residue 41"
FT   gene            complement(314263..315309)
FT                   /locus_tag="Ethha_0285"
FT   CDS_pept        complement(314263..315309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0285"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: csc:Csac_0366 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25871"
FT                   /db_xref="GOA:E6U7D6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU25871.1"
FT                   /translation="MIEVSHLTKRYGEKYAVQDISFDVKDGEILGFLGPNGAGKSTTMN
FT                   ILTGYLSSNEGTVKIDGVDVLERPLEAKKNIGYLPEQPPLYPDMTVDEYLKFVFGLKQC
FT                   KLGREAHINEICGLVRIQNVRGRLIRNLSKGFKQRVGIAQALIGNPDVLILDEPTVGLD
FT                   PKQIIEIRTLIKHLSRKHTVILSSHILPEVQSVCERIIIINQGQIVANGTTSELSSQLS
FT                   SEHRLIARIAGPEADVREAISDLSGVRKCVSLGMHETGSSDWQIECETGQDIRRALFTI
FT                   LSAKDWPLLALDTGELTLEDIFLRLTTDGAVLPQSKPAAPPAEPPAADAEPTEPAENAG
FT                   EQEEDDNP"
FT   gene            complement(315574..317361)
FT                   /locus_tag="Ethha_0286"
FT   CDS_pept        complement(315574..317361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0286"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="KEGG: cce:Ccel_1946 aspartyl-tRNA synthetase;
FT                   TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type; GAD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25872"
FT                   /db_xref="GOA:E6U7D7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D7"
FT                   /inference="protein motif:TFAM:TIGR00459"
FT                   /protein_id="ADU25872.1"
FT                   /translation="MADTMQGLKRTDYCAAFSEKDAGREVVVCGWAAKRRDLGALLFID
FT                   LRDRSGILQLAFDDTTGRAVLEKAQTVRSEFVLAAKGTIRLRETPNDKLPTGRIEMAVS
FT                   ELRILAKSDTPPFEVAEGGAVKEEMQLRYRYLDLRRPEMQNHLFLRHRIVKAAHDYFDR
FT                   NGFIEIETPNLIKSTPEGARDYLVPSRLHAGKFYALPQSPQLYKQILMLSGFDRYMQIA
FT                   RCFRDEDLRADRQPEFTQIDLELSFVDEEDIMALNEGYIRHVFKEVLGKDVQTPFQRLP
FT                   YDEAMARYGSDKPDVRFGMELRDLSETVKGCGFGVFEGALAGGGSVRAVTAEGGADNLS
FT                   RKDLDKLAAFVKDYGAKGLAWLKLGDTPNASFGKFVSEDTLLAVAAAAGAGPGDAVLIV
FT                   ADTNSTVACTALGALRLHLAERFGLIPKDEFAFLWVTHFPLFEYSEEEGRYMAMHHPFT
FT                   APTEESLDKLESDPGTCYARAYDMVLNGVELGGGSIRINDPALQKRMFKALGLSDDVVR
FT                   QRFGFLTEAFRYGAPPHGGMAYGLDRLVMLMLGCESIKQVIAFPKVQNASELMTGSPDL
FT                   VEEKQLRELHLSPIREKDI"
FT   gene            complement(317365..318654)
FT                   /locus_tag="Ethha_0287"
FT   CDS_pept        complement(317365..318654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0287"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="TIGRFAM: histidyl-tRNA synthetase; KEGG:
FT                   cth:Cthe_1332 histidyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25873"
FT                   /db_xref="GOA:E6U7D8"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D8"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ADU25873.1"
FT                   /translation="MANLLHAPRGTLDVTPDQVYKWQYVEQTARRTAATFGFEEIRFPT
FT                   FEYTELFSRGVGDTTDVVQKEMYTFEDRGGRSITLRPEGTASTVRALLQNGLAGGPLPL
FT                   KLFYLISCFRGERPQAGRLREFHQFGAELFGAAGAAADVELIELAGAALKALGVKDLRL
FT                   ELNSIGCPTCRKDYHAALKAYFKARETELCDDCKNRLERNPMRLLDCKVPTCKAIAKDA
FT                   PVVTDYLCDDCKAHFEDVKARLTDAGQTFVLNPRIVRGLDYYTRTVFEFVDEAQGLTVC
FT                   GGGRYDGLVSELGGPSLPGLGFGMGLERLLILMESQGCAFPPAPKGLVYIGAIGGPASQ
FT                   KAAALARTLRAAGIAAGTDLAGRSVKAQMKYADKQGFAYAVMLGDAELENGEAALKALR
FT                   GDGARTVPLEPETFLAAVRDAAAQSTIKEG"
FT   gene            complement(318781..319188)
FT                   /locus_tag="Ethha_0288"
FT   CDS_pept        complement(318781..319188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0288"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="TIGRFAM: methylglyoxal synthase; KEGG: csc:Csac_1874
FT                   methylglyoxal synthase; PFAM: MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25874"
FT                   /db_xref="GOA:E6U7D9"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D9"
FT                   /inference="protein motif:TFAM:TIGR00160"
FT                   /protein_id="ADU25874.1"
FT                   /translation="MNIALIAHDAKKELIVQFCIAYCGILSRHSLCATGTTGKLIADAT
FT                   GLDIQRFLGGSQGGDQQISARIACNEIDLLLFFRDPLTPKPTEPKEMSMLRLCDVHNIP
FT                   VATNIATAEVLVRALDRGDFDWRDIVNPKSK"
FT   gene            complement(319280..320023)
FT                   /locus_tag="Ethha_0289"
FT   CDS_pept        complement(319280..320023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0289"
FT                   /product="septum site-determining protein MinD"
FT                   /note="KEGG: tro:trd_1925 septum site-determining protein
FT                   MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25875"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E0"
FT                   /inference="similar to AA sequence:KEGG:trd_1925"
FT                   /protein_id="ADU25875.1"
FT                   /translation="MGTVISVTSGKGGTGKSTFTVNCGAALALSGKTVLLVDADAGLRS
FT                   LDIMLRVSDQVVYDLADILQGRCEPAKAIVKTPWNRLSMIPAPAADEETGCADALQKLC
FT                   RGLCQYYDFILLDSPAGMGTWAKATAAAADLAILVVTPDPVCIRDADRMAGRVLSGLVP
FT                   EIRLVINRVQPQLLRKKLDGGLDVIIDAAAVQLLGVVPEDRRIALAAYDGDPIVHTPDA
FT                   HGGAAEAYCNIARRLLGEDIPLMHF"
FT   gene            complement(320179..322353)
FT                   /locus_tag="Ethha_0290"
FT   CDS_pept        complement(320179..322353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0290"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   cth:Cthe_0091 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25876"
FT                   /db_xref="GOA:E6U7E1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E1"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ADU25876.1"
FT                   /translation="MNIRNARLYVLYGLIIAIFAGFVFRLMRYQITDGASYRAQSEKTT
FT                   IQSTEVMAPRGEILDRYGRVLATNTVGYSVTLQKAAWSSSNQNQNILKITDILAQDGET
FT                   WTDTLPIGQTKPWAFNPNSDSQIKTLRKFMEQTVDNIPTSTKLNKVTLTAKQKAKYDAD
FT                   EKATADEIMARLIKRYKITGNYTPAQIRTIVGVRYQMEQAGFSYTYTYTFAQNVSLNTV
FT                   NRLSENGGSIPGILITQQYTRSYTSDSFAPYLIGKVSPISADQWNNTSDPSASLKNQGY
FT                   SMDDMIGSGGIESTMEKYLRGESGTQNVLINKAKEIVGTEPVKAAKPGDNVVLTIDENL
FT                   QQIVQDELPVVINQVRAASGGSTLNGADADAGSAVVLNIKTGEILAMASYPTYTRTQYS
FT                   QEYSTLANDATSPLMNRAIQGAYRPGSTFKPVTATAGMMNGIITPTEKIDKPATFSKYA
FT                   PSYVGHDDVGAGYIDVETALAESSNVFFNMVADWMYTRGIYSKLESTAAAYGLGKKTGV
FT                   ELPGEHSGSVSGPTWAKANGITWQAADAAQSGIGQSYNEYTPLQLAQYVGAVSTGGTYY
FT                   KAHIVKEVKSYDNTQTVMENTPQAVSDIKVPSDVLNAIKTGMLRVTESADGTAASVFQN
FT                   FPVQLGGKTGTAQINNGKNYDGVFISFAPFNDPEIAVAVVVEKGHNGYQTAPVARSAFN
FT                   YYFVDDQQFTTDPLPSVSSPLPASANTLLP"
FT   gene            complement(322444..322956)
FT                   /locus_tag="Ethha_0291"
FT   CDS_pept        complement(322444..322956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0291"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; KEGG:
FT                   cth:Cthe_0090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25877"
FT                   /db_xref="GOA:E6U7E2"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E2"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ADU25877.1"
FT                   /translation="MHIFYRKNTWKWLAYALTLLVVDTLQNTPHLFPVISNARPVLLLP
FT                   FVIAVASIESAGAGGAFGAAAGLFWDLSGGAPFGFHGVFLMMVGIFTGLLVREVFHASP
FT                   LSALLFGLCFTFLMELISWFFLDYMTGGQDFVYSFFQIILPTTFYSFAFVVPFYFWVKH
FT                   LHLRLTE"
FT   gene            complement(322996..323862)
FT                   /locus_tag="Ethha_0292"
FT   CDS_pept        complement(322996..323862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0292"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="KEGG: tmt:Tmath_0874 rod shape-determining protein
FT                   MreC; TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25878"
FT                   /db_xref="GOA:E6U7E3"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E3"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ADU25878.1"
FT                   /translation="MREFFRSLQFKIFAAIALVLIGLMLRSALSGGSSTITASVFGTVV
FT                   SPFQQLSSTVSDFFYGAFSNIASAGQLRAENDTLKKQLSDLRSQLVNYNQMQQENEQYQ
FT                   KMYSISKENPDLKLAPARVISRDPGQWYSAFTINKGSVDGIQPYEPVITPDGLVGETTQ
FT                   VMATTTVVTTILDPTVKVSIVVSETGDLGLAHGDRDLSAKGLLAIDYLPKDSAVAGGNI
FT                   IVTAGRAGVFPPNLKVGLVQQVKTQNSGITLYAVCKPLADPTTVKDVTVVTNFTGKNVD
FT                   TSAASSK"
FT   sig_peptide     complement(323770..323862)
FT                   /locus_tag="Ethha_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.695 at
FT                   residue 31"
FT   gene            complement(324129..325148)
FT                   /locus_tag="Ethha_0293"
FT   CDS_pept        complement(324129..325148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0293"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: cth:Cthe_0088 rod shape-determining protein
FT                   MreB; TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25879"
FT                   /db_xref="GOA:E6U7E4"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E4"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADU25879.1"
FT                   /translation="MSMFSHDIGIDLGTANTLIYMKGKGIVLREPSVVAVDVKTNRVLA
FT                   VGNSAKQMIGRTPGSIVAIRPLKDGVIADFDITASMLKEFIRKVTAGKFSKPRIIICIP
FT                   SGVTEVEKRAVDEAAYQAGAKDTYLVQEPMAAAIGAGLPVDEATGSMVVDIGGGTAEVA
FT                   VISLSGIVTSRSVRVAGDEFDDAIINYVKKKYNLLIGERTAEELKIALGSAYPYEEEGE
FT                   RQIKGRNLLDGLPSNVTITSAEVREALSDPVAQVVDAIRSTLERTPPELAADIIDRGIM
FT                   LTGGGALLRGLDQLISKETGIPVNVAERPLDCVVDGTGKMLEDMSGALANVLFDAKRH"
FT   gene            complement(325485..326021)
FT                   /locus_tag="Ethha_0294"
FT   CDS_pept        complement(325485..326021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0294"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: cth:Cthe_2655 AbrB family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25880"
FT                   /db_xref="GOA:E6U7E5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E5"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADU25880.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTMRIREGDPLEIYTDNDGEVI
FT                   FKKYSPIGELSNFAAQFAEVLGKSSGYPVLISDRDRIISSFGIPRKEVLERRVSEELEA
FT                   LLEQRRPYICEDGHHLTAVDGLEKSVAVAVPILAAGDMAGAVILLDTEENAKPGDVELK
FT                   LAQTAANFLAKQMEE"
FT   gene            326279..326464
FT                   /locus_tag="Ethha_0295"
FT   CDS_pept        326279..326464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25881"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU25881.1"
FT                   /translation="MYYNCLNVWCFARRAAGGFGSAAAQNDDSPFFVRMADDDRVQMET
FT                   ENREGQTVWAKKTESN"
FT   gene            326437..326802
FT                   /locus_tag="Ethha_0296"
FT   CDS_pept        326437..326802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0296"
FT                   /product="protein of unknown function DUF710"
FT                   /note="PFAM: protein of unknown function DUF710; KEGG:
FT                   cth:Cthe_2088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25882"
FT                   /db_xref="GOA:E6U7E7"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E7"
FT                   /inference="protein motif:PFAM:PF05164"
FT                   /protein_id="ADU25882.1"
FT                   /translation="MGEKNRVKLKICGNEFYVVSHDSEEYIRAVAEKVEHYLQNLMDRS
FT                   PTMSTTMAAVFAALEFCDEAAKATESADNLRAQIKDYLEEAAAAKSEATELRRREIELE
FT                   RENITLRAKVSKLEGGK"
FT   gene            326799..328976
FT                   /locus_tag="Ethha_0297"
FT   CDS_pept        326799..328976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0297"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: ere:EUBREC_1659
FT                   peptidase, U32 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25883"
FT                   /db_xref="GOA:E6U7E8"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E8"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ADU25883.1"
FT                   /translation="MNRPEVLAPAGSWETLRAAAFAGADAVYFGGQSFNARRGAANFDD
FT                   AALEEAIGWLHARGVKAYITFNTLLFENEWNGALAFLERLCQMGPDALIVQDTGVLRLV
FT                   RAAAPDLRLHASTQMAVHNIEGVRALAGLGVSRVVLARELSAREMEEITGALRSPGGAC
FT                   APEIEVFVHGALCMSVSGQCYFSAMLGGRSGNRGLCAQVCRLPFAAPGGTGHDLSLKDL
FT                   SLIRQVPRLARMGVSSLKIEGRMKRPEYVTAAVRACAAAARGEPVPEEQLEELRAVFSR
FT                   AGFTQGYFEGRRGREMFGFRGHEDVLASGQALARMHAETAEQPCVPVDLTVSIRAGSPA
FT                   ALRVEDDDGHAAHSAGPTPEPALHRALDEQTVREKLDKTGGTPFFVRNIRMELGGGLSL
FT                   PVRELNALRRDALDELLTLRQQPRPIPFARPAFPTAIPKTVEKQVRVRLLSAAQLETAD
FT                   FSGIERVYLPLRAYAEAPAPLRRAAADGLPLGVELPRTFFGSAQSLAPALDAAKALGVG
FT                   HALCGNIGALPVAEAAGFVAHGDFSLNCANRMALEAYAEMGAADCVLSFELALPQARRA
FT                   ADARAGLLAYGRLPLMLTHNCPLRNGGPCAGRTCAVGAPHVVKAEQSVHQAVGKARVIQ
FT                   PAQPAALTDRTGACFPVVCGAAGDCVEVLNDRPLWMCDRKEELWETGVSFLQLYFTIET
FT                   PGETAAVLQAFRRGDAPSAAFTRGLYRRGVR"
FT   gene            329020..329478
FT                   /locus_tag="Ethha_0298"
FT   CDS_pept        329020..329478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0298"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /EC_number="3.6.1.23"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; KEGG: aac:Aaci_1445 deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase Dut; PFAM: deoxyUTP
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25884"
FT                   /db_xref="GOA:E6U7E9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E9"
FT                   /inference="protein motif:TFAM:TIGR00576"
FT                   /protein_id="ADU25884.1"
FT                   /translation="MSKIILKVKTVPHDGVEVQYPRRATGGSAGMDLHAALRGPVKIAP
FT                   RGLVSIPTGIAIQMPGDGYAAFIYARSGLATRHGIALSNGVGVIDSDYTGELIVGLCNL
FT                   SDRAYVVMPGERIAQLVISPVCAPELFEVEELEETARAGSGFGSTGRY"
FT   gene            329591..329863
FT                   /locus_tag="Ethha_0299"
FT   CDS_pept        329591..329863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_2377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25885"
FT                   /db_xref="InterPro:IPR025470"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7F0"
FT                   /inference="similar to AA sequence:KEGG:Cphy_2377"
FT                   /protein_id="ADU25885.1"
FT                   /translation="MRSAGKNGSWLLLVVLLIVAVVAGGALATVLQQFSWAGFLTYTKS
FT                   FGIGDAQPVTLDLSVLRISFGFGLRINLTQVLCILAAVLIYRRFR"
FT   sig_peptide     329591..329677
FT                   /locus_tag="Ethha_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 29"
FT   gene            complement(329961..330527)
FT                   /locus_tag="Ethha_0300"
FT   CDS_pept        complement(329961..330527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0300"
FT                   /product="peroxiredoxin"
FT                   /note="KEGG: cpf:CPF_0784 alkyl hydroperoxide reductase, C
FT                   subunit; TIGRFAM: peroxiredoxin; PFAM: alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Peroxiredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25886"
FT                   /db_xref="GOA:E6U7F1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7F1"
FT                   /inference="protein motif:TFAM:TIGR03137"
FT                   /protein_id="ADU25886.1"
FT                   /translation="MGNLIGTELPEFKVHAYHNGDFEEITKAAVLGKWGVFFFYPADFT
FT                   FVCPTELGDLSDHYAAFQSIGCEIYAVSTDSHFVHKQWAETSDTIKKVTFPMLADPAGR
FT                   LARFFGILVEEEWQALRGTFVVNPQGVIKLYEVHDMGIGRNAEELLRSVQAAQFVAEHG
FT                   DQVCPAKWKPGTATLKPGLDLVGRI"
FT   gene            330812..332821
FT                   /locus_tag="Ethha_0301"
FT   CDS_pept        330812..332821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0301"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cbe:Cbei_3739
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25887"
FT                   /db_xref="GOA:E6U7F2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7F2"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU25887.1"
FT                   /translation="MINHRKAGKIALSVLLAATVSMGTGSMLVAQADTSAISDFTLPSI
FT                   TGPYNINACFGTDATKLNFNWFSQSSNKTTGTTSQIQYTLAGNYTNGTWPTTGVTTVNA
FT                   TQKTVTATENISANAPGFVLPGTNGSADGYGDGVTNGTAPQNKVTGEYQNMATATGLAA
FT                   NTKYAYRVSDGTNWSPVYTISTAPTDSIQFAAFGDPQMGAYDNASKTKPSNATNGHQNI
FT                   VDDGNGWANMLNVVSQNKGLNFLLSLGDQINDYNYLGENVSGDTMGGGQWDQYLTYFGI
FT                   KPANNNGGTYGTYSNVIQSYPLVAFSGNHDHQMGEYYGYHYNHPNQNQLGGTQYGNDGD
FT                   YWFTAGPVLFYVLNANNYATADHDEFMSDVDAAVKAQGLNVKWKVAVWHQSAYSEGNHD
FT                   SQNNATDPVLTIRNTWPAMMQKYGVDAVFQGHDHYYTRTAQMLDGVALDPNNNYAAESA
FT                   SWLTPTTSVNIPQAATQTSGSSNAAPATTNPNATYAAKAYPTTVTNPKGIVYFTLDSGS
FT                   GSKYYNYDGISGTEQTTSLPTDHSFSVVGWQGYLPSYSLVTATSTSFSVNTYALASTTD
FT                   TNIADQKQIDTYTINKTSASNTSSGTGSTVSTGSTTSTGSTTSTTSTTSTTSVSNPHTG
FT                   VDAQGNLASNVLSIGAIAALLGGATLVVLRKKKV"
FT   sig_peptide     330812..330910
FT                   /locus_tag="Ethha_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.976 at
FT                   residue 33"
FT   gene            332957..334195
FT                   /locus_tag="Ethha_0302"
FT   CDS_pept        332957..334195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0302"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: cbe:Cbei_3738
FT                   YibE/F family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25888"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7V6"
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /protein_id="ADU25888.1"
FT                   /translation="MQIKTGAHNAVWAIKRIVVPIIILAVYVVFAYIFSQHTPIYNPYG
FT                   SGPGGEIQYDNATVLSIDEQAITASGFPGLYTGHQIITIRMNDGRYKGKTFQINNPLNY
FT                   DTNFILHKGQKIVVTESTSTGNKSYINVYMYAPNRLAPLFVLIALFVVALCFVGGMRGF
FT                   RSLLGIIFTLTTMLFVFVPLLYRGVSAVSATLILVAVTSCVTLFLVAGVGRKSLSAILG
FT                   TVAGVVISVIVMFVFSYFLSISGYTSSDTDSLLNIAGGSHLQVHDLMFAGVIIASLGAV
FT                   MDIAISVATSINEVLEHKPDADFKVLFSAGMNVGRDMMGTMVNTLILAFVGSSVISFIL
FT                   MYSYQAQFNQLFNSSGIAIDILQAVCGSLAVILTVPIVSAISGKLLSGTGGSNRQLPPQ
FT                   NPKNAAVEENMHS"
FT   gene            complement(334286..335137)
FT                   /locus_tag="Ethha_0303"
FT   CDS_pept        complement(334286..335137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0303"
FT                   /product="sortase, SrtB family"
FT                   /note="KEGG: lin:lin2285 hypothetical protein; TIGRFAM:
FT                   sortase, SrtB family; PFAM: peptidase C60 sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25889"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7V7"
FT                   /inference="protein motif:TFAM:TIGR03064"
FT                   /protein_id="ADU25889.1"
FT                   /translation="MSKFLIGFQHAVTKVRHFVANKKILVSVVSAAVVLGCVSSVLLLP
FT                   HGQAAPIKTASKPSSSIASVSSAPTPPIPSKKADILAAQQKNSDVVGWLTVPGTSLDMP
FT                   IVHTTDNSYYLTHNLDKQTYKKGWPFLDYRNDAENLDRNSIIYGHNMGDGTLFGELKQF
FT                   ENLDFLNQHPVLYFGTADADRYWKIFAVYITDVNFYYINTSFPTDNDFTSLVSQMRAQS
FT                   LFNTNVSVSSTDKILTLSTCTYEFENARFVIEARLVQPGESYDVTPATENPNPTSPHHK
FT                   AN"
FT   gene            335182..335379
FT                   /locus_tag="Ethha_0304"
FT   CDS_pept        335182..335379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25890"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7V8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU25890.1"
FT                   /translation="MRRRVCPSLGARERARKMCAYPSAPLHMPTGPETQPKQVLPKTGE
FT                   RFSAEEHPGETGLRAKLIVC"
FT   gene            complement(335366..336811)
FT                   /locus_tag="Ethha_0305"
FT   CDS_pept        complement(335366..336811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0305"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: Pyruvate kinase barrel; Pyruvate kinase
FT                   alpha/beta; manually curated; KEGG: csc:Csac_1831 pyruvate
FT                   kinase; TIGRFAM: pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25891"
FT                   /db_xref="GOA:E6U7V9"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7V9"
FT                   /inference="protein motif:TFAM:TIGR01064"
FT                   /protein_id="ADU25891.1"
FT                   /translation="MRKTKIVCTLGPATESEEMLRKLMLAGMNVARFNFSHQTHEQHKQ
FT                   RLDFVRSIQKELGVPLTYLLDTKGPELRLGLYKDNQKVTLKTGQDYTLTTRDILGDENQ
FT                   VSISFKGLPADVKPGNHILIADGLVELEVKSTTDTDIVCLVKNAGTLSNNKNVNVPDAH
FT                   VSLPFISEKDRADLIFGCENGMDAVAASFTRSAEDVLEMRAILDSHGGSNIKIIPKIEN
FT                   IYGVNNIDEILKVADGVMVARGDMGVNIPIEEIPRIQKMIIRKANALGKISIVATQMLD
FT                   SMIQNPRPTRAEATDVANAIYDGTGATMLSGETAAGAYPIEAVTTMARIAERTEADIDY
FT                   KAAFNARPLESETDVTNAVAHAAVGTAHDTNAKAILTVTQSGYTARFVSKFRPACPIIG
FT                   CTPNEQVYRQLNLSSGVVPVLTKSASGADDMIETAVQSAIDAGLIQNGDLVVITGGIPL
FT                   GVPGTTNFIKVHVVGNSTSFSKQ"
FT   gene            337048..337845
FT                   /locus_tag="Ethha_0306"
FT   CDS_pept        337048..337845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0306"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: bwe:BcerKBAB4_3005 peptidase M15B and M15C
FT                   dd-carboxypeptidase VanY/endolysin; PFAM: peptidase M15B
FT                   and M15C DD-carboxypeptidase VanY/endolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25892"
FT                   /db_xref="GOA:E6U7W0"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7W0"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ADU25892.1"
FT                   /translation="MAKRTLRPGCCGFLAAIAVCVVGGLVFAYAIFNKHNATTSSGTST
FT                   GVSSQSVSASVSKALAPASEMKTGGLLMLINAKNPLPSDYTPTLALVDKSYYTSSDKDN
FT                   HFDSRAAPHLSQMIHDARADGVQLVIYSGYRSMAYQTDNFDRKVSEYRAQGYGPSTASS
FT                   KAATLVAPPGTSEHESGLAADIVSSDWLRKNGDLNETFEKTTAFAWLEQHAADYGFILR
FT                   YPKDKTDITGISYEPWHWRYVGKDNAEKINSAGLCLEEYDGKA"
FT   sig_peptide     337048..337134
FT                   /locus_tag="Ethha_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.940 at
FT                   residue 29"
FT   gene            337862..338119
FT                   /locus_tag="Ethha_0307"
FT   CDS_pept        337862..338119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gym:GYMC10_4270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25893"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7W1"
FT                   /inference="similar to AA sequence:KEGG:GYMC10_4270"
FT                   /protein_id="ADU25893.1"
FT                   /translation="MAENENRDEPVAESGEEKHTGTANLSVRMALGIILGAALGIAFNQ
FT                   LALGITLGLAAGILYDRYRTRKDGKPPGQGKNSGDAPKSS"
FT   gene            338447..339019
FT                   /locus_tag="Ethha_0308"
FT   CDS_pept        338447..339019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0308"
FT                   /product="translation initiation factor IF-3"
FT                   /note="KEGG: tjr:TherJR_1877 translation initiation factor
FT                   IF-3; TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   Translation initiation factor 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25894"
FT                   /db_xref="GOA:E6U7W2"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7W2"
FT                   /inference="protein motif:TFAM:TIGR00168"
FT                   /protein_id="ADU25894.1"
FT                   /translation="MEVLAISKEMLLNEEIRDREVRVIDADGAQLGILSSREALRLAEE
FT                   KNLDLVKIAPQAKPPVCRIMDYGKFRFEQAKKEKEAKKNQRVVEIKEIRMSLNIDTHDL
FT                   ETKAGHALQFLRSGDRVKVTVRFRGREMAHTELGKTLLGRFAALCEGVSSVEKQPKLEG
FT                   RSMSLFLVAKPAPKESTSKGGNQNAKA"
FT   gene            339006..339206
FT                   /locus_tag="Ethha_0309"
FT   CDS_pept        339006..339206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0309"
FT                   /product="ribosomal protein L35"
FT                   /note="KEGG: eel:EUBELI_20497 50S ribosomal protein L35;
FT                   TIGRFAM: ribosomal protein L35; PFAM: Ribosomal protein
FT                   L35"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25895"
FT                   /db_xref="GOA:E6U7W3"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7W3"
FT                   /inference="protein motif:TFAM:TIGR00001"
FT                   /protein_id="ADU25895.1"
FT                   /translation="MPKLKTHSGASKRLRFTKTGKIKRAHAFKSHILNKKDTKRKRGLR
FT                   QAAYADATNVGALKHLCPYNN"
FT   gene            339280..339633
FT                   /locus_tag="Ethha_0310"
FT   CDS_pept        339280..339633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0310"
FT                   /product="ribosomal protein L20"
FT                   /note="KEGG: tte:TTE1691 50S ribosomal protein L20;
FT                   TIGRFAM: ribosomal protein L20; PFAM: ribosomal protein
FT                   L20"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25896"
FT                   /db_xref="GOA:E6U7W4"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7W4"
FT                   /inference="protein motif:TFAM:TIGR01032"
FT                   /protein_id="ADU25896.1"
FT                   /translation="MARVKGAMMTRKRRKKILKLAKGYWGGKSRLFRTANEAVMKSLSY
FT                   AYVGRKLKKRDFRSLWITRISAACKLNGMNYSTFINGLKKAGIVLNRKILSELAVSDSA
FT                   GFAALVEKAKAAL"
FT   gene            339769..340560
FT                   /locus_tag="Ethha_0311"
FT   CDS_pept        339769..340560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0311"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   cth:Cthe_1222 RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25897"
FT                   /db_xref="GOA:E6U7W5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7W5"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ADU25897.1"
FT                   /translation="MLEITSRDNPLVRDYVRLRENRAFRRETGRFVLEGARLLGDALES
FT                   GVRMETVFFTGEACEKHPALLASARDGGARVCLVGDAVAAKLADTAAPQGVFAAAFMLD
FT                   KAFALDKINLGGAYAALENIRDPGNLGAVLRTAEALGLSGVLLSAGCADIYAPKVVRAS
FT                   MGAVFRTAFFQTEDLPAALSLLREKGLQTLAALAGGTTRLLTQLDLRGGVVAAIGNEGA
FT                   GLSDACVDACDPFTIPMKGRAESLNAAAAAAIILWEIMRSR"
FT   gene            340575..341738
FT                   /locus_tag="Ethha_0312"
FT   CDS_pept        340575..341738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0312"
FT                   /product="DNA protecting protein DprA"
FT                   /note="KEGG: mta:Moth_1025 DNA processing protein DprA,
FT                   putative; TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25898"
FT                   /db_xref="GOA:E6U7W6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7W6"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ADU25898.1"
FT                   /translation="MTDVEHWIWLAQAFSPGSPKPCALAEALGGARVVHEADEAALAAS
FT                   GICTAHDLSLLRPHSLAQAERIIEHCLARGYDIRTFADEDYPALLREIHAPPAVLYVSG
FT                   RLPAADMLCIAMVGARRVTDYGAAAAERLAMGLANAGVGVVSGLAAGVDTHAHKGALKG
FT                   GGKTYAVLGCGLDTVYPASNRELYRLVAKTGAVLSEFPPDAGPDRHHFPIRNRIIAGLC
FT                   AGTVVVEAGRKSGSLITAGQALEMGRDVFAVPGSIFSPMSEGTNQLLREGAKPACGVAD
FT                   LLEEYPEALARILPAEPAQQSLFPPAAVPPRPEPVPEKPATPARRPVQGLDDVQRAVLA
FT                   LLDASPRHVDELAVRASLPPGQVLAVLTVLEIQGLARSEPGRRFCTV"
FT   gene            341773..343890
FT                   /locus_tag="Ethha_0313"
FT   CDS_pept        341773..343890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0313"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain-containing
FT                   protein; TIGRFAM: DNA topoisomerase I; KEGG: cth:Cthe_0460
FT                   DNA topoisomerase I; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain-containing protein;
FT                   DNA topoisomerase type IA zn finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25899"
FT                   /db_xref="GOA:E6U7W7"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7W7"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ADU25899.1"
FT                   /translation="MSNLVIVESPAKAHTIKKYLGRGYTVVASMGHVRDLPKSRMGVDI
FT                   ENSFTPKYIPIRGKAPLIKSLKKEARNSTKIFLATDPDREGEAISWHLANLLGLDEKTA
FT                   LRVTFNEITKTAVKDGIKNPRSIDLDLVNAYQARRILDRIVGYQLSPFLWKKIRPGLSA
FT                   GRVQSVAVRLIVDREDEIRAFVPEEYWTIDASELLAPGSKKPFPAHFHGGLDGKKVEIK
FT                   SKEEADAILRALGATETPEGIQVSGEVPFVVRTVKKSERKKSPAPPFTTSTLQQEASRR
FT                   LGFQARRTMRAAQELYEGVDVKGYGAIGLITYMRTDSLRIAAEAQQAALAYVGETFGRE
FT                   YLPEKPRFYKSRANAQDAHEAIRPTMPELSPDQVKESLTADQYKLYKLIWERFIASQMA
FT                   NKVLDTVGVDITAGDCLFKASGNTVKFKGFSIVYEMTTDENKESGKPLPVLNEGDELQV
FT                   QKLDGNQHFTQPPPRYTEASLIKTLEENGIGRPSTYATTITTILARLYVERDGKQLVPT
FT                   PLGEVTTKLMREHFADIVDVEFTAKMENDLDKVETGEENWVQMLTDFYGGFDHTLKKAE
FT                   EELGDVHMKVPDEETDIVCELCGRKMVIKNGRYGKFLACPGYPECKNTKPIVQETGAFC
FT                   PLCGGRVLAKKSKSGKKYFGCEHNPTCGFMTWDTPLEEKCPQCGGSLFKKRGGQVYCAK
FT                   EGCGYTREEKK"
FT   gene            343887..345209
FT                   /locus_tag="Ethha_0314"
FT   CDS_pept        343887..345209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0314"
FT                   /product="gid protein"
FT                   /EC_number="2.1.1.74"
FT                   /note="TIGRFAM: gid protein; KEGG: aac:Aaci_1382 gid
FT                   protein; PFAM: glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25900"
FT                   /db_xref="GOA:E6U7W8"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7W8"
FT                   /inference="protein motif:TFAM:TIGR00137"
FT                   /protein_id="ADU25900.1"
FT                   /translation="MTGTPCPITVVGAGLAGCEAAWQAANCGAQVTLVEMKPARFSPAH
FT                   HSLDFAELVCSNSLRAEGLTNAVGLLKEEMRRLDSLILACADATRVPAGGALAVDRAGF
FT                   SRMVTEKLEAHPCITVERRELSDIPAGPCVVATGPLTDGAMAEAVVRACGGEAPLHFYD
FT                   AAAPIVTAESLDFDKVYFAARYGKGGADYINCPMTKEEYDAFYDALLTAEPAEVHGFEK
FT                   SDPHVFEGCMPVEVMAARGRDTLRFGPLKPVGLPDPRTGREPYAVVQLRHDDAAGGLYN
FT                   LVGFQTHLRFPEQKRVFSMIPGLERAEFVRYGVMHRNTFLNAPGLLDRFYRLKSDPRVF
FT                   FAGQMTGVEGYLESAASGLDAGLNCARQTMGLPLADFTEKTAIGALAHYISGADGKQFQ
FT                   PMNVNFGIIAPLEKRVKAKRARYEAVSARALETLDTIRAAW"
FT   gene            345306..346307
FT                   /locus_tag="Ethha_0315"
FT   CDS_pept        345306..346307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0315"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="KEGG: aoe:Clos_1451 putative glycerol-3-phosphate
FT                   acyltransferase PlsX; TIGRFAM: fatty acid/phospholipid
FT                   synthesis protein PlsX; PFAM: fatty acid synthesis plsX
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25901"
FT                   /db_xref="GOA:E6U7W9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7W9"
FT                   /inference="protein motif:TFAM:TIGR00182"
FT                   /protein_id="ADU25901.1"
FT                   /translation="MRIIMDGLGGDNAPDEMLEGARLAVKEYGVEILITGEKEKLRAVA
FT                   YEKSVPLDGIEILEADGALTMDDAPTEVLRGKKNCSMAVGLRALAEGRGDAFVSAGNTG
FT                   AMVVGSRSIIGCVDGLRRPALAPILPHTTGCFMLLDGGANVECRPEMLLQFGHMGAIYM
FT                   EKILSIQSPRVGLANIGAEEHKGTQLAQDAYALLKNSSLRFVGNVEGRDIPFGACDVLV
FT                   ADGFTGNIILKLMEGMGLFMGQTIKGMFTRNMLTMGAALVLKPALEGFKKKMDYTEYGG
FT                   APLMGLKKPVIKAHGSSNAHAFQNAVRQAVAFVKEDVIAEIEGTRPQASSAG"
FT   gene            346410..346640
FT                   /locus_tag="Ethha_0316"
FT   CDS_pept        346410..346640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0316"
FT                   /product="acyl carrier protein"
FT                   /note="KEGG: hmo:HM1_2166 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25902"
FT                   /db_xref="GOA:E6U7X0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X0"
FT                   /inference="similar to AA sequence:KEGG:HM1_2166"
FT                   /protein_id="ADU25902.1"
FT                   /translation="MVLERVKALAAEQFDVEEDELGAETAFEELGAEPEDVADFLLALD
FT                   DEFDIDLSDIELDRIVTIGDAVDAVKDMLGQ"
FT   gene            346689..347369
FT                   /locus_tag="Ethha_0317"
FT   CDS_pept        346689..347369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0317"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="SMART: ribonuclease III; double-stranded RNA binding
FT                   domain protein; TIGRFAM: ribonuclease III; KEGG:
FT                   ere:EUBREC_1500 ribonuclease III; PFAM: ribonuclease III;
FT                   double-stranded RNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25903"
FT                   /db_xref="GOA:E6U7X1"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X1"
FT                   /inference="protein motif:TFAM:TIGR02191"
FT                   /protein_id="ADU25903.1"
FT                   /translation="MLEELEKNLGYTFADKSLLENALTHSSYANEMKKHSCGSNERLEF
FT                   LGDAVLGIISAEYLYFHHTRVPEGELTRLRASMVCERSLQGFARTVELGRWLRLGRGEE
FT                   NTGGRERSSILADAFEAVIAAIYIDGGFPAAKRFVTRFADSFFAAHLENGRRDYKTELQ
FT                   EIVQKNHGEKLEYVLVGESGPDHDKQFLVEVHLNNNCIGAGRGGSKKEAEQMAAREALS
FT                   LMGQ"
FT   gene            347383..348387
FT                   /locus_tag="Ethha_0318"
FT   CDS_pept        347383..348387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0318"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: gem:GM21_1061 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25904"
FT                   /db_xref="GOA:E6U7X2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X2"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU25904.1"
FT                   /translation="MGKAANVAFFVPHLGCAHACSFCDQRSIAGQAAPPSPADVAGTLA
FT                   RVREQMGSRSRDAEVAFFGGSFTAIPRRQMLALLEAVAPFLGADGFSGIRVSTRPDAVD
FT                   DDVLALLRAHGVTSIELGAQSMDDAVLCRNGRGHTARQVRDAALRVGRAGFSLGLQMMT
FT                   GLPGDGPAGARRTARELAALHPDTVRIYPALVLRGTRMAAWWADGTYEPQPLDDAVLLC
FT                   AALFDYFTRRGIRVLRMGLHAEPSLEQNLLAGPWHPAFGELCESRVYYTRARRALARAP
FT                   GADCLLAPRGETGKVAGQHRRNLLALEARVDRRLHIREDPGLPPLAVRAVKCL"
FT   gene            348430..349140
FT                   /locus_tag="Ethha_0319"
FT   CDS_pept        348430..349140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0319"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bpo:BP951000_2096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25905"
FT                   /db_xref="GOA:E6U7X3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X3"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADU25905.1"
FT                   /translation="MKITVLHGQMHQGSTYHLTKMVLDRLSGPDTAIREFFMPKDMPAP
FT                   CVGCNRCFLEGEENCPQADAVRPVAEALEEADLIVLESPCYVFGMTGQLKILLDHLGYR
FT                   WMPHRPHPKMFRKVGLAVSTAAGGGADKVVKALARHLFFWGVPAIHRFSANVQAAKWDE
FT                   VKGEKRKKLEKRAVCTAAAIRRQIGRARPGVKTCFLFYIMRSMHKKGVFSPTDHAHWER
FT                   NGWLDGKTPWKDPA"
FT   gene            349180..352761
FT                   /locus_tag="Ethha_0320"
FT   CDS_pept        349180..352761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0320"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="KEGG: pjd:Pjdr2_3487 chromosome segregation protein
FT                   SMC; TIGRFAM: chromosome segregation protein SMC; PFAM: SMC
FT                   domain protein; SMCs flexible hinge domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25906"
FT                   /db_xref="GOA:E6U7X4"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X4"
FT                   /inference="protein motif:TFAM:TIGR02168"
FT                   /protein_id="ADU25906.1"
FT                   /translation="MYLKSLTIQGFKSFPDKTVLTFGPGITAVVGPNGSGKSNISDAIR
FT                   WVLGEMSVKSLRGGKMEDVIFGGTPVRRPLGYAEVSLTVDNSDHALPVESEEVTVTRRY
FT                   YRSGESEYRLGGAQVRLRDIYELFMDTGLGHDGYAVISQGRIAEIVGARSEDRREIFEE
FT                   AAGIAKFRFRKAEAERRLASTEENLVRLRDILSELEARVGPLKEQAEKAKRYLTLAEEK
FT                   RTLEVGLWLHLLDVRREELRAGENKLEIARARHDELERKLDTVERTIDEAYMQGQKAAA
FT                   EADRLRGEAAAREQEAVQCEAQAALCEGDAARADRTRAEVEEEHARNERSGSEDESGLA
FT                   ALQTELNEKQDALVGLRETLEACECDVRALTEEGDAQAAKTREASARLAQVRARLAGLG
FT                   QRKSAAQAAAESAAARVEEIGLSAADRERRREQAATMLVDAQARLVKARETVQALENAV
FT                   QGCTLKQDARRQKLAKEQERVRALSLRAGERAQRAAMLAEMEKNLEGFAHSVKLVVRES
FT                   RRGSLRGILGPVSQLLSAPAEVAVAVETALGASAQHIVVENEENAKDAIRFLQRAEGGR
FT                   ATFLPLTSVRGGLLDAREIAGCAGYVGIASELVSFEERFREVAEHLLGRTVVARDLDSA
FT                   VTMAKRFRYRFRIVTLDGQQVNAGGSLTGGSRRAGAGLVSRQAEITRLEEEARVLQAQL
FT                   AEAEQAERRAKESLAAVEAEANGARGEQARAKEAAIRLEGEEKRLAEQADLLGADMRSL
FT                   EEERRACMDKTAALRAQAQAVEEQMAACEQEAEQAEQALAACGVEGEALAAKREEQTAR
FT                   LTDIRLRQLGGEKDVQAVKQRIEALEAHRSEKKAHAETLALRMHTLEEEAREARERAQA
FT                   QTAQAEVLRAKAADCRREAEQRAGEREDLERRTVELRAGSRALAEEKENMSRELARLEE
FT                   RKVTLQNSYDALIAKLWEEYELTRSQAEKEVPRVERPDEAEKRLNTLRHDIKALGSVNL
FT                   AAIDEYREVEERYTFMKTQTDDVERSKAELETLIRGLTGEMRAQFSKKFAEINGHFASI
FT                   FVELFGGGRAWLELTDPQDVLGCGIEIHVQPPGKIIKNLASLSGGEQAFVAIALYFALL
FT                   KVRPSPFCVLDEIEAALDEQNVVRYASYLRRLCGSTQFIVITHRRGTMDEADILYGVTM
FT                   QDQGVSKLLTLHLDELMERLGLEQKRG"
FT   gene            352867..353805
FT                   /locus_tag="Ethha_0321"
FT   CDS_pept        352867..353805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0321"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="TIGRFAM: signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; KEGG: cce:Ccel_0697 signal recognition
FT                   particle-docking protein FtsY; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25907"
FT                   /db_xref="GOA:E6U7X5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X5"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ADU25907.1"
FT                   /translation="MGVFDKIRAGLAKTRASVAGRMGQVFHGRGKVDEELFEELEDVLV
FT                   SSDVGVATSTYLIEKLRGRVKKEHIVDTDGVREALKAVMTGELEGDVSLLLAPAPAVLL
FT                   VIGVNGVGKTTTIGKLAAQLKAEGKAVLLGAADTFRAAAIDQLEIWAERAGVDIVKQKE
FT                   GADPAAVVFDAVQAGKARGADVVICDTAGRLHNKKSLMDELSKISRVIDRELPGAAREN
FT                   LLVLDATTGQNAVNQAKQFKEAAGLTGIILTKLDGTARGGVVFAIRHELGVPVKYIGVG
FT                   EQIDDLQPFDPRAFVDALFQGADEEAAGQDG"
FT   gene            353832..354422
FT                   /locus_tag="Ethha_0322"
FT   CDS_pept        353832..354422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0322"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /EC_number="3.6.1.15"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; KEGG: dma:DMR_43210 putative
FT                   deoxyribonucleotide triphosphate pyrophosphatase; PFAM:
FT                   Ham1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25908"
FT                   /db_xref="GOA:E6U7X6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X6"
FT                   /inference="protein motif:TFAM:TIGR00042"
FT                   /protein_id="ADU25908.1"
FT                   /translation="MTFVAATGNAHKLTEIRRILAPLGHDVISQREAGVACDPEETGAT
FT                   FAENARIKAEAVCKAAGRPAVADDSGLCVDALDGAPGVYSARYAGAHATDDDRIAKLLA
FT                   ALSGVPEEKRTARFVSAICCLFPDGREIAVEGVCEGRVAFAKDGTDGFGYDPVFIEAES
FT                   GKTFAALSGEEKDACSHRGRALRALAEALAPQD"
FT   gene            354442..354810
FT                   /locus_tag="Ethha_0323"
FT   CDS_pept        354442..354810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0323"
FT                   /product="Carboxylesterase type B"
FT                   /note="PFAM: Carboxylesterase type B; KEGG: bsu:BSU34390
FT                   para-nitrobenzyl esterase (intracellular esterase B)"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25909"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X7"
FT                   /inference="protein motif:PFAM:PF00135"
FT                   /protein_id="ADU25909.1"
FT                   /translation="MAADLIPTRYGRVRGTEDGSVRVFHGIPYAKPPVGARRFGAPEKP
FT                   APGDSVRDATRFGSVCPQPRGFMERLAGIDRKQSADCLYLNIWSPPEPAGPLPVLVWHD
FT                   TLSVPDDPDADKRALFGL"
FT   gene            354843..355130
FT                   /locus_tag="Ethha_0324"
FT   CDS_pept        354843..355130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0324"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   csc:Csac_1573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25910"
FT                   /db_xref="GOA:E6U7X8"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X8"
FT                   /inference="protein motif:PFAM:PF01985"
FT                   /protein_id="ADU25910.1"
FT                   /translation="MLTSKQRAALRGMANTIDTLFQVGKQGVTETLQKQAEDALLAREL
FT                   IKLRVLETAPVTAKEAATLLAQALGAEVVQVIGTRFVLYRANPEHPVLQV"
FT   gene            355144..355770
FT                   /locus_tag="Ethha_0325"
FT   CDS_pept        355144..355770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0325"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="TIGRFAM: nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; KEGG: rmr:Rmar_0680 nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25911"
FT                   /db_xref="GOA:E6U7X9"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X9"
FT                   /inference="protein motif:TFAM:TIGR00482"
FT                   /protein_id="ADU25911.1"
FT                   /translation="MKKIGVFGGTFNPIHKGHLHLAGGYCRALGLDTVLLVPTCIPPHK
FT                   EVDDLLPAIDRLEMCRLAVRDMPSLAVSDVEVRRGGRSYTVDTLRELAGLYPDDELYFL
FT                   MGADMFLTIEEWNGFTEIARTAVLCTASRHEGELPSLKEHARLLERKYGARCHIEAIPV
FT                   LDISSTEVRDALAEGGDVRALVPDAVRDYIYQNGLYRPVGPDFQQ"
FT   gene            355767..356354
FT                   /locus_tag="Ethha_0326"
FT   CDS_pept        355767..356354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0326"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   ckr:CKR_0797 hypothetical protein; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25912"
FT                   /db_xref="GOA:E6U7Y0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y0"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADU25912.1"
FT                   /translation="MTKGRDQVDTQRFEKILDETLGEKRRHHSRMVSKAAAELARRYGG
FT                   DPEQAAFAGLVHDIAKEMKPDAQLQTMEKYSILLDDVERVTPKLWHAIAGYALLKYEYG
FT                   VADEDVLEAVRWHTTGRKGLSRLGKIVYLADCISEDRDYPGVEQARAAAARSLDAGYLD
FT                   SLERSIRTLLDRGALLHLGTVEARNELLLAAK"
FT   gene            356522..356926
FT                   /locus_tag="Ethha_0327"
FT   CDS_pept        356522..356926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0327"
FT                   /product="iojap-like protein"
FT                   /note="KEGG: cth:Cthe_1238 iojap-like protein; TIGRFAM:
FT                   iojap-like protein; PFAM: Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25913"
FT                   /db_xref="GOA:E6U7Y1"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y1"
FT                   /inference="protein motif:TFAM:TIGR00090"
FT                   /protein_id="ADU25913.1"
FT                   /translation="MIIKTTKTNREAVALTSKELLEKAVEILDNRKAEDLTAIEIGNIS
FT                   IIADYFLLATGNSTTQVKSLAEELEFQFSQAGVEPLRTEGVRSGTWAVLDYGGLVIHIF
FT                   HRDTRAFYNLERLWADGERVDIQQLIKQEG"
FT   gene            356930..359332
FT                   /locus_tag="Ethha_0328"
FT   CDS_pept        356930..359332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0328"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="KEGG: aoe:Clos_2587 leucyl-tRNA synthetase; TIGRFAM:
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25914"
FT                   /db_xref="GOA:E6U7Y2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y2"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADU25914.1"
FT                   /translation="MHYDFAAIEKKWQKLWEETGVFHAKNDFSLPKFYALVEFPYPSGQ
FT                   GLHVGHPRSYTALDIVSRKRRLEGYNVLYPMGWDAFGLPTENFAIKNHIHPEIVTKNNV
FT                   AHFKQQLQSLGLSFDWSREINTTDPLYYRWTQWIFLQLFKKGLAYKKEMRVNWCTSCKC
FT                   VLANEEVVNGVCERCGSEVVHKVKSQWMLKITDYAQRLIDDLDGLDYIERVKTQQKNWI
FT                   GRSTGAQVRFDTAAGDPLLIYTTRPDTIFGATYMVIAPEHPILEKWADKIENLDAVRAY
FT                   QDEAAHKSDFERTEVQKDKTGVEIKGVRAVNPATGKEIPIFLSDYVLVTYGTGAIMAVP
FT                   AHDERDFAFARTFGLPVVEVVAGGNVEQEAFTDCATGTMVNSGFLDGLTVEEAKEKIIA
FT                   WLEETGRGEAKVNYKLRDWVFSRQRYWGEPIPLVYCEKCGWVPVPEDQLPLRLPEVASY
FT                   EPTDNGESPLAAMTDWVNTVCPHCGGPARRETDTMPQWAGSSWYFLRYTDPHNGKALAS
FT                   PEALRYWLPVDWYNGGMEHTTLHLLYSRFWHKALFDLGIVPTSEPYQKRTSHGMILGEN
FT                   GEKMSKSRGNVVNPDEMVKAYGADTLRLYEMFIGDFEKAAPWSDTGIRGSKRFLERVWN
FT                   LQEKLLPGDGYRPELESDLHKTIKKVTGDIESMKFNTAIAALMTLLNRFAKEGASRGEW
FT                   RTFLLLLNPFAPHITEELWEVTGLGGRLNAQKWPTYDEAKCVDARVRIAVQVCGKLRGT
FT                   VEMDADADQQTVQTAALELPRVQANVEGKQVVKVIFIKGKLINIVAK"
FT   gene            359505..360182
FT                   /locus_tag="Ethha_0329"
FT   CDS_pept        359505..360182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tit:Thit_0903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25915"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y3"
FT                   /inference="similar to AA sequence:KEGG:Thit_0903"
FT                   /protein_id="ADU25915.1"
FT                   /translation="MVKWKWWKPAVLLVAAVVCAAALAACGSKAVSVASSSSGGSGSSA
FT                   NTLYGKVTAVNGSTITLALGTMGGGQGGPGGGRGTASGSQNGTPPDQGTASGGAGNVPA
FT                   GGGMPGLTLTGKAQTVTAADGATITKMTRPSGGQAPGSSSDTTSSTDSAASSADTSASL
FT                   SDITVGTIVKVELDSSGKASAITILGTQSDSAGTASDSTASSAASASTVAATENENNSA
FT                   VSA"
FT   sig_peptide     359505..359579
FT                   /locus_tag="Ethha_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.409 at
FT                   residue 25"
FT   gene            complement(360248..362590)
FT                   /locus_tag="Ethha_0330"
FT   CDS_pept        complement(360248..362590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0330"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cpy:Cphy_1027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25916"
FT                   /db_xref="GOA:E6U7Y4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y4"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU25916.1"
FT                   /translation="MQSVWMLAAANLRRHKSAGITLGLLTLIAALLLNLGLLNLTNLPR
FT                   IFDQKRTELHTPDFVATLPDSIGAAKQAELERFISTYKGVTGTSQETALYYRAASFPIG
FT                   GSAFSTSVAVESSGEAKHLSFVGARAAETNESIYVPYMLSTKGYRLGDTLKLTILGKTY
FT                   AFRIAGFEEDLLWGNTMTGSMRFFLPDSAYRAFATLPENAPAKSVLFNAYTKTLSDAAD
FT                   LSNAFLLQASSDNQGELPWRLSINNTKLAVSMPVMIGAALEISFAFVVALIVLLVVRFR
FT                   IVGSIEEDIRNIGALEAVGYTGRQIRAAFLLQFLLTGLAGGIAGIGLSYAVAIPHSQSL
FT                   AAQTGLNWQQGFDPAVSLLTLAILLSCVALVALVAASRIRKLPVITALRGGITTHSFRK
FT                   NHLSLETSRGPLSLLLACKSIWADARQNIALGIIFAAVSFAAVFTFLLFYNFGVDNTAV
FT                   MHLMGGEPDDISVEMKSGADIQTLQQNIRALPHVTQALTYDVPMVETDGQASYGAVTPD
FT                   FGLLKNNQTYGGRYPKHDNEVAIGGVLAGHLHKGIGDTVRITAGGRSADYLITGLTQSI
FT                   NDLGTGSYLTEDGFRRISPQFVPSYLFVYMENHTHISDTIQTINTRFGAQVTGVSNDHA
FT                   TARNILGTYGTVVAVFASLMFAVMALIVVLILVLLTGAMLVRRRQEFGIQKALGFTTGQ
FT                   LMRQVALSFLPVGIIGALAGCLLGQSFANPLVSALFRAMGLLKLDFILPAATVPTVCIL
FT                   IALLTYGISMLAARRVRRISPCVLLSD"
FT   gene            complement(362593..363351)
FT                   /locus_tag="Ethha_0331"
FT   CDS_pept        complement(362593..363351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0331"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cpy:Cphy_1026 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25917"
FT                   /db_xref="GOA:E6U7Y5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU25917.1"
FT                   /translation="MSQAIVTTQKLCKTFSQSGLQQHVLKNLDLEIREGDFTVIMGASG
FT                   AGKSTLLYALSGMDRPTLGGIRFAGQDISRMNNDQLAVFRRQNCGFVFQQVFLMDSMSV
FT                   MDNVLACGLLAGGERKAVAARAKALFEQVGLREADWKKFPSQLSGGEAQRAGMVRALIN
FT                   TPKVVFADEPTGALNSASGKAVLDVLTQVHQNGQNVVMVTHDLRSARRGNRILYLKDGV
FT                   VCGECGLGSYVGGDRTRHDKLTAFLKEMGW"
FT   gene            complement(363520..364815)
FT                   /locus_tag="Ethha_0332"
FT   CDS_pept        complement(363520..364815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0332"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: cpy:Cphy_1025 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25918"
FT                   /db_xref="GOA:E6U7Y6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU25918.1"
FT                   /translation="MNLKPLYAFMALFCAAGAILLFFILRGGENDVPVAAYNDIARSLG
FT                   EQWNRLDKHDLPGLSYHIDYAVLDLNGNVRAATHAGLDEPTVFSAVRRRDTVLDISANG
FT                   VVVGNVLFYSHAAQDRQAQRQALFFAGLLLLALPLLFCIGFSLWLRHSLIHPFRLLDAF
FT                   ARRVAAGNLDIPLAMDKENLFGPFTESFDLMRDELARAKENEYRANRSKKELVASLSHD
FT                   IKTPVASILAVTELMLVREPDAAARKNWETVHAKAEQISLLINNLFHASLEELQKLPVE
FT                   PSEENSAALGEMLRAADYNGRTAVSPIPPCLLRFDRLRLQQVFDNIIHNSYKYADSAIL
FT                   VTFIFEGAALSVTIADNGPGAPPSDLALLCNKFYRGKNAAGKSGSGLGLYLSRYLMEQM
FT                   GGTLACENRLRGETVCGFAVRLHIPFPAASVR"
FT   gene            complement(364812..365504)
FT                   /locus_tag="Ethha_0333"
FT   CDS_pept        complement(364812..365504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0333"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: cpy:Cphy_1024 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25919"
FT                   /db_xref="GOA:E6U7Y7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU25919.1"
FT                   /translation="MEYDCLIVDDEEALAQSTCDYFNLFEVSTAWVPGMPAALTFLQAN
FT                   RAEVILLDINLPDGSGFSLCKHLRQTSDTPILFISARTSDDDQILALGIGGDDYIQKPY
FT                   SLSVLLAKVRAVLKRRRAGTAARYASAFSCGDLSIEFDAGRVRKSGAPLTLKAMEYKLL
FT                   AYLVQNRGRIIPKEELFRNVWEDAVTGDGTLNVHIRRLREKIEQDPNHPVHILTVWGTG
FT                   YRFEGDAP"
FT   gene            complement(365652..366947)
FT                   /locus_tag="Ethha_0334"
FT   CDS_pept        complement(365652..366947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0334"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="KEGG: cce:Ccel_0722 putative transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25920"
FT                   /db_xref="GOA:E6U7Y8"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y8"
FT                   /inference="similar to AA sequence:KEGG:Ccel_0722"
FT                   /protein_id="ADU25920.1"
FT                   /translation="MSNLSSLSREQLLALKKQLTEQYDACRAQGLQLNMARGKPGREQL
FT                   DLSTPLLTCVSSAEACISEDGTDCRNYGGLDGLPGMKRLFADLLEVRPENVMVGGNSSL
FT                   NLMYDTIARAMLYGVLGGTPWSRLERVKFLCPVPGYDRHFTVCESLGIEMVPVEMREDG
FT                   PDMATVKDLAKHDPAVKGIWCVPKYSNPEGKTYSDAVVDAFAALRPAAADFRIFWDNAY
FT                   CVHHIRDEHDELKNILDACAAQGRPDMVYLFTSTSKITFPGAGVAAMAASETNIADIRR
FT                   HLSAQTIGPDKLNQLRHLRFFKDRAGVEAHMKKHQAILAPKFAAVQEILQAELGGLDIA
FT                   EWTHPHGGYFISFNAPDGCAARIVQLCREAGVVTTPAGATYPYGRDPRDRNIRIAPSVP
FT                   PLSELRTAISLFTLCVKLAAVEKLGTRKPVLA"
FT   gene            complement(367145..368482)
FT                   /locus_tag="Ethha_0335"
FT   CDS_pept        complement(367145..368482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0335"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   cce:Ccel_2204 protein of unknown function DUF111"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25921"
FT                   /db_xref="GOA:E6U7Y9"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y9"
FT                   /inference="protein motif:PFAM:PF01969"
FT                   /protein_id="ADU25921.1"
FT                   /translation="MKTLYIDCQAGISGDMFVAALLDLGAPEQTLRDALASLHTDDFRI
FT                   EITKKQTHGILCTDYNVILTHEEPEDGSAHHHEHDHHHAGEHDHHHEHVHATAVQDTPH
FT                   SAHHAHRNLHDIEALLDASALSPAVRELSKTIFGFVARAEAKVHGLPLEEIHFHEVGAA
FT                   DSIADIVGAAVCVDALGAQDIRFSPLTEGGGFVRCAHGLLPVPAPATAEILRAARIPYR
FT                   TKDVDGEMVTPTGAAIAAGLARGFGPMPAMRVEKTGYGGGKREFPHANILRAFLGETEQ
FT                   TADPGRDRVRVLETCIDDSTGEALGHALELLFAAGAADAYYTPVFMKKNRPAWLLTVLC
FT                   APELEETMTEIIFAHTGAIGLRTRESERIVMARGFGAVDTPYGKIRLKRSTFGGVEKIK
FT                   PEFESLHAAAERAGIPITRVDTEARARAAAGEARWEPSAHSGHPFA"
FT   gene            complement(368557..369957)
FT                   /locus_tag="Ethha_0336"
FT   CDS_pept        complement(368557..369957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0336"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="TIGRFAM: asparaginyl-tRNA synthetase; KEGG:
FT                   cth:Cthe_0070 asparaginyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25922"
FT                   /db_xref="GOA:E6U7Z0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z0"
FT                   /inference="protein motif:TFAM:TIGR00457"
FT                   /protein_id="ADU25922.1"
FT                   /translation="MHMQRTEIRDLFARADSFTAADITVAGWVRTLRHSKSIGFLELND
FT                   GSCFGHLQAVCDEQALTNFGEVMKLGVGAAVVVRGRLALTPQARQPFELHAASVEIEGT
FT                   CPPDYPLQKKRHTLEFLRTMPHLRPRANTLGAAFRIRSTAALAIHRFFHTHGFQYIHTP
FT                   IITASDAEGAGEMFRLTVLDIADPPRTPDGAVDFSKDFFGRPVSLTVSGQLEGESMALA
FT                   FGKIYTFGPTFRAENSNTTRHAAEFWMVEPEIAFADLDDDRALARDMMQAVLKTVLDEC
FT                   PDELAFLNQYVDKGLLARLEHVATSDFACVTYTEAVKLLEKENARFSYPVSWGCDLQTE
FT                   HERYLTEEIFKAPVFVVDYPKEIKAFYMRQNGDGKTVAAMDLLVPGIGEIIGGSQREER
FT                   ETVLLTRMEELGMPIEAYRWYLDLRRFGGARHAGFGLGFERLVMYLTGIGNIRDVLPFP
FT                   RTAGTAGF"
FT   gene            370173..372212
FT                   /locus_tag="Ethha_0337"
FT   CDS_pept        370173..372212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0337"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="KEGG: pjd:Pjdr2_4386 single-stranded-DNA-specific
FT                   exonuclease RecJ; TIGRFAM: single-stranded-DNA-specific
FT                   exonuclease RecJ; PFAM: phosphoesterase RecJ domain
FT                   protein; phosphoesterase DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25923"
FT                   /db_xref="GOA:E6U7Z1"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z1"
FT                   /inference="protein motif:TFAM:TIGR00644"
FT                   /protein_id="ADU25923.1"
FT                   /translation="MREWIIGAPEEQAARTLRDAGASPVLARLLALRGFADADGAQAFL
FT                   DCAGTLHDPLLLADMPRAAERVRQAIEKKETIAVYGDYDVDGVTAAALLTGYLREQGAD
FT                   AFAYLPERESEGYGLNSPALARLRACGAALCITVDTGISALEEAESAREWGLDLIVTDH
FT                   HEPHAELPGAFAVVDPKRPDCPYPFKGLAGVGVAFKLACAVEGPGSETALFARYGDLLC
FT                   LGTVADVVPLLDENRVLVKRGLDMFAQAGRPGLAALLEQAGAGGKAPNASLLAFTVAPR
FT                   INAAGRMDSALPALELLLTASPARAKTLAEHLCACNDARKREEARILEETEAVIHADGL
FT                   LQNKVLIVAGEGWADGVIGIVAARLTERFERPAMVLSFGEDGVGRASCRSFEGFALHKA
FT                   LSACAPLLEKYGGHALAAGFSIRRENLPAFRETVEAFAADCDILPVLRLDCALDAEDLT
FT                   LAAAEDCARLEPCGAENPAPLFYLEDVLVAEVRPLSGGKHLRLACRMGGRPFDALVFGA
FT                   ERMGRTFAKGDVLDLAAELSVNEWQGRRSLSVLVRAVRESAALARQRARYRRLRAGEED
FT                   GAPPGRKACALVWRTLAAHDGGVLEPKRVCGALRLQMPELDYTQFLLILDVFRETGLAA
FT                   FSRGEGGLAVRVETDMKVRLEDSPLMRRLMGAGGHSPHVSSGRV"
FT   gene            372335..374524
FT                   /locus_tag="Ethha_0338"
FT   CDS_pept        372335..374524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0338"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   TIGRFAM: RelA/SpoT family protein; KEGG: csc:Csac_1001
FT                   (p)ppGpp synthetase I, SpoT/RelA; PFAM: RelA/SpoT domain
FT                   protein; metal-dependent phosphohydrolase HD sub domain;
FT                   TGS domain-containing protein; amino acid-binding ACT
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25924"
FT                   /db_xref="GOA:E6U7Z2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z2"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ADU25924.1"
FT                   /translation="MDEMLAGLLQKIKESGMPYDVPKITAAYELAHRAHDGQFRKSGDP
FT                   YIIHPVAVATILVNLGLDTDSLCAALLHDVVEDTGVPLENIRKQFGSDVALLVDGVTKV
FT                   GRVAHYSREEQQAESIRKMLLAMAKDIRVILIKLADRLHNMRTLDAMTSQKQLDISLGT
FT                   MEVYAPIAHRLGIRTVKDELEDLSIRHLDPVAYHEIEVALKKRKDEREAILQSIQNRIA
FT                   ERLQSLHMNVHIEGRVKSIYGIYRKVYMKGRAFEQIYDIYAVRVIVDTVNECYNILGVI
FT                   HDLMKPVPGRFKDYISTPKPNMYQSLHTTVIGKEGVPIEVQIRTWDMHHTAEYGIAAHW
FT                   KYKLGIQSSKDKGSLESRLEWVRQLLEVQTDVKDAEDFIHSLKTDLAPDEVYVFTPRGD
FT                   VINLPARSTPIDFAYAIHSEVGHRMTGAKIDGKIVPLTYELQTGQIVEVLTTSATGHGP
FT                   SRDWLNIARTSEARSKIRAWFKKERREENIAEGRSEIEREFRRIGILLSGAALEEFLEG
FT                   VAKRQHFNGTDEFLAAIGYGGIVLSKVIPRIKDDYVKQVHPEKIQLPENVTPRHSAGGI
FT                   IVEGLDNCLVKLSRCCNPLPGDEIVGFITRGFGVSIHKRDCPNVVKNLKNPEYDGRFVH
FT                   AHWAEHLNTPFKAGLRILSGDRYGLLADITSALAAMHIGIHAVNARELKNGAVEILITV
FT                   DVAGTKQLENVLNRMRHIEGVQEVTRSGSAGPEAG"
FT   gene            374578..375867
FT                   /locus_tag="Ethha_0339"
FT   CDS_pept        374578..375867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0339"
FT                   /product="Uncharacterized conserved protein UCP033563"
FT                   /note="PFAM: Uncharacterised conserved protein UCP033563;
FT                   KEGG: cth:Cthe_3196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25925"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z3"
FT                   /inference="protein motif:PFAM:PF06245"
FT                   /protein_id="ADU25925.1"
FT                   /translation="MEKKLQWGAFGPADILLPRGCSMQKWSVVACDQYTSEPEYWDEVE
FT                   KFVGDAPSTLRLMFPEVYLDKEDPAARIQEIHAAMRAYLDAGRFSRLKDSFVYLERRLP
FT                   SGAVRRGLVGAVDLEQYDYSPGSASPIRPTEGTVVARIKPRMQIREGAPIELSHVMLLI
FT                   DDPDGTVIEPIARHKGALAPLYNFDLMQNGGHLSGWWLPADQAGAVRQALAALASPEAF
FT                   AKKYGLPDRPVLAYASGDGNHSLATARACYEHLKEKIGDAAKSHPARYAMVELVNIHDE
FT                   SLIFEPIHRVLTGVDAAKLRHDFITAMAADGGSLDSGDPARRVRFLHEGGDVTAYLGGD
FT                   VLPVGMVQDFLDGWMQENGGKIDYVHGDEVTARLGTQPGAASFLLPALGKSALFASVAR
FT                   DGALPRKTFSMGDANEKRFYLECRRITEDA"
FT   gene            375864..376325
FT                   /locus_tag="Ethha_0340"
FT   CDS_pept        375864..376325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0340"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="KEGG: mrb:Mrub_0170 D-tyrosyl-tRNA(Tyr) deacylase;
FT                   TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25926"
FT                   /db_xref="GOA:E6U7Z4"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z4"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ADU25926.1"
FT                   /translation="MRAVIQRVRHACVRVDGQVTGQIGTGLFVLLGVEQADTLKDAQAL
FT                   ATKTAGLRIFSDESGKMCLGASDVGGGFLVVSNFTLYGDCRKGRRPDFTRAAGAAQAQA
FT                   LYRAFVQALCEACAPAGLPVETGLFGADMRIEMDGDGPVTLVLDTAEWR"
FT   gene            376330..376965
FT                   /locus_tag="Ethha_0341"
FT   CDS_pept        376330..376965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0341"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="KEGG: adg:Adeg_0381 hydroxyacylglutathione
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25927"
FT                   /db_xref="GOA:E6U7Z5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z5"
FT                   /inference="protein motif:PRIAM:3.1.2.6"
FT                   /protein_id="ADU25927.1"
FT                   /translation="MHIQYLRVGRLETNCYIVCNDETKRCAVIDPGADAARIIDAVRRS
FT                   GCAPDMILLTHGHFDHIGAVRELLAEFGCKLAAPKAELDFLNNPHRNLHSSMSGEDFVP
FT                   FAPDILFEDGDTVEAAGLSFKALHTPGHTPGSSCLLCDDVLFTGDTLFAGSAGRTDFPG
FT                   GDPAAMRASLRKLAMLAGNYQVLPGHGPFSTLEKERVENPYLEGAADA"
FT   gene            376962..378452
FT                   /locus_tag="Ethha_0342"
FT   CDS_pept        376962..378452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0342"
FT                   /product="Coproporphyrinogen dehydrogenase"
FT                   /EC_number="1.3.99.22"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   cth:Cthe_1341 coproporphyrinogen III oxidase; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25928"
FT                   /db_xref="GOA:E6U7Z6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023995"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z6"
FT                   /inference="protein motif:PRIAM:1.3.99.22"
FT                   /protein_id="ADU25928.1"
FT                   /translation="MKLYLLGHAMRYEAGNLCFLFFPGEKIDEETDLAARGDFYAITRI
FT                   RRGRTHTRALVLLVQGGKTARAHVFFQNDAPDPVKAGEHALGRAFIEAGERLCGFRPPW
FT                   GILTGIRPVKLMRELLASGMDEEQAARRFTEELRVSPQKTALCVRTAGEETRITALSTL
FT                   RSASLYISIPFCPTRCLYCSFISHDVEKTKKLLPAYVDRLCEELAAVGALVRRLGLRLE
FT                   TIYMGGGTPTSLSAPMLAQVFDAVRAAFSLDSLREYTVEAGRPDTITPEKLAAIRAGGC
FT                   TRLCINPQTLDADILRRIGRAHTPEQFFEAFHMARGAGFSSINTDLIAGLPGDTPAGFS
FT                   RTLDALLPLAPEGVTVHTLAMKRSSRLVSEGGARYDARGGEVERMLEDAYARLDAAGLA
FT                   PYYLYRQRNTAGNLENTGFAKPGHEGLYNVFIMDETHTILAAGAGGVTKMRQPGGTRIE
FT                   RVFNFKYPYEYLARFDEVLARKQQVEAFYGGRFAKDSR"
FT   gene            378421..379446
FT                   /locus_tag="Ethha_0343"
FT   CDS_pept        378421..379446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0343"
FT                   /product="phosphoribulokinase / uridine kinase family
FT                   protein"
FT                   /note="KEGG: cpr:CPR_1347 phosphoribulokinase / uridine
FT                   kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25929"
FT                   /db_xref="GOA:E6U7Z7"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z7"
FT                   /inference="similar to AA sequence:KEGG:CPR_1347"
FT                   /protein_id="ADU25929.1"
FT                   /translation="MAAGLPKILVEDVNRRAADAKQFFQECNARYEHDLAQVVEDIAQR
FT                   AGRHRQFILLAGPSASGKTTTSLKLKAGLMARGIRAVTVSLDDFFKDRAETPLQPDGKP
FT                   DYESPAALDLDLFTQVTEELLEKEKASFPIFDFKLARRGEKMRRLELPQGSVAVVEGLH
FT                   ALNPLVASCLPDERVFRLYVSVSSEFADADGNVLLSARDIRLVRRVLRDYRFRASSAAH
FT                   TLELWEDVCRGEDAFVRPFKPLADRTLDTVFACEPCLFAGMALWHFESAWEDGPFTHEA
FT                   RRLVAAMKQFPRISQRVIPPACLLREFLGGSLYLNKKTIRRRRGYGSRPHAAGQAPATG
FT                   G"
FT   gene            379633..379989
FT                   /locus_tag="Ethha_0344"
FT   CDS_pept        379633..379989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25930"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z8"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2090"
FT                   /protein_id="ADU25930.1"
FT                   /translation="MGLLEDAVITAKGAVDFAGKKTGEIVELSRLKISAAEIEGKIKNL
FT                   YESLGRSVYNAAKSETDATTLVKEKTTQIDTLLVDLSAVQDKIGELREEKKCASCGTAN
FT                   PQDANYCKKCGTQL"
FT   gene            380329..381147
FT                   /locus_tag="Ethha_0345"
FT   CDS_pept        380329..381147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0345"
FT                   /product="inosine guanosine and xanthosine phosphorylase
FT                   family"
FT                   /note="KEGG: gtn:GTNG_2244 purine nucleoside phosphorylase;
FT                   TIGRFAM: inosine guanosine and xanthosine phosphorylase
FT                   family; purine nucleoside phosphorylase I, inosine and
FT                   guanosine-specific; PFAM: purine or other phosphorylase
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25931"
FT                   /db_xref="GOA:E6U7Z9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z9"
FT                   /inference="protein motif:TFAM:TIGR01697"
FT                   /protein_id="ADU25931.1"
FT                   /translation="MGHAEHARRAAETIRDASPLRPQTAVVLGSGLGGFVSAVRDAVEL
FT                   PYADIPHFPCATAPSHAGRLLIGTLAGRPAYVFSGRFHYYEGLSFKRAAFYVRVLHALG
FT                   VRDLLLTNAAGLINLDFAPGDLMLVRDHINFSGQSPCRGRNLDTLGERFFDMSDAYSGE
FT                   LRALAHAAAEETGVPLREGVYAYMTGPQYETPAEIRALGILGADAVGMSTVPEVIEAAH
FT                   CGLRTLCISCLTNYGAGLSPDPLRGDEVNENAAARAGDLSALLLAILARL"
FT   gene            381242..382168
FT                   /locus_tag="Ethha_0346"
FT   CDS_pept        381242..382168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0346"
FT                   /product="MazG family protein"
FT                   /note="KEGG: cth:Cthe_2656 MazG family protein; TIGRFAM:
FT                   MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25932"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:E6U800"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ADU25932.1"
FT                   /translation="MPNTWFSAISRCVAAHAGQAEAWAETRTMCIQGMNRGADAGNLVF
FT                   VLRQWCGGNMEFQLKERYRFDDLLALMVLLRSENGCPWDRAQTHASVRVNLLEEAYEAA
FT                   EALDEDDPVHLCEELGDVLLQVVFHARMEEEAHRFSMQDVVDMLCKKLVERHSHVFGDR
FT                   NAASPEQALQGWDEAKRRARGQQTQAEAMEGVSHALPAAMRSAKVWKKAVKAASPSPDV
FT                   SALLSEARRGLDRLGPVLEASDGDAAAQALGKALFALCALASSAGVEPEQALARACDGY
FT                   VRAFAKQEQMADGNAALAALREERPVL"
FT   sig_peptide     381242..381310
FT                   /locus_tag="Ethha_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.613) with cleavage site probability 0.466 at
FT                   residue 23"
FT   gene            382233..382508
FT                   /locus_tag="Ethha_0347"
FT   CDS_pept        382233..382508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0347"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="KEGG: tpd:Teth39_0249 histone family protein
FT                   DNA-binding protein; PFAM: histone family protein
FT                   DNA-binding protein; SMART: histone family protein
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25933"
FT                   /db_xref="GOA:E6U801"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:E6U801"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ADU25933.1"
FT                   /translation="MTKAELIAKVAEKSGLSKKDAEKATGALIDSIVESLVAEEKVQLV
FT                   GFGTFEVHHREARKGRNPRTKEEITIPASAYPVFKAGKPFKDAVSK"
FT   gene            382536..382781
FT                   /locus_tag="Ethha_0348"
FT   CDS_pept        382536..382781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0348"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: clj:CLJU_c41660 putative S4 domain-containing
FT                   protein; PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25934"
FT                   /db_xref="GOA:E6U802"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E6U802"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADU25934.1"
FT                   /translation="MRLDKFLKVSRIIKRRTVANEACDAGRVLVGGKPVRASYEVKPGD
FT                   VLEITLGGKPFRAEVLEVAEHVTKEGASSLYRVLDA"
FT   gene            383003..383464
FT                   /locus_tag="Ethha_0349"
FT   CDS_pept        383003..383464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA6316 multi anti extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25935"
FT                   /db_xref="UniProtKB/TrEMBL:E6U803"
FT                   /inference="similar to AA sequence:KEGG:ebA6316"
FT                   /protein_id="ADU25935.1"
FT                   /translation="MYSRNELLVIGLFVLSLLIAAGAATMLALHLLFLPFFVPLAVSLA
FT                   FGVVFAGLIIVLAAAGGRENAEHHRRVLCGCGNAYLRPAIVSAVVALVVALIFSGTPPF
FT                   IPVLSAALFGLTVLFLLFAIFLLAAFIFCVLDSTCHYCPCGDDARSEDR"
FT   sig_peptide     383003..383074
FT                   /locus_tag="Ethha_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.458 at
FT                   residue 24"
FT   gene            383625..383960
FT                   /locus_tag="Ethha_0350"
FT   CDS_pept        383625..383960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0350"
FT                   /product="sporulation protein YabP"
FT                   /note="KEGG: tmt:Tmath_2056 sporulation protein YabP;
FT                   TIGRFAM: sporulation protein YabP; PFAM: YabP family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25936"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:E6U804"
FT                   /inference="protein motif:TFAM:TIGR02892"
FT                   /protein_id="ADU25936.1"
FT                   /translation="MGNEIRLTEKCAGGKMMAVQQESQMPKKVHNIILEDRRLLTVSGV
FT                   TDVDSFDEETVVLFTELGELTVHGYNLHMNKLSVETGEVNVEGDITSLSYRDEVPRGGG
FT                   LFGRIFK"
FT   gene            383973..384509
FT                   /locus_tag="Ethha_0351"
FT   CDS_pept        383973..384509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0351"
FT                   /product="Spore cortex biosynthesis protein, YabQ-like
FT                   protein"
FT                   /note="PFAM: Spore cortex biosynthesis protein, YabQ-like;
FT                   KEGG: gtn:GTNG_0054 spore cortex biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25937"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:E6U805"
FT                   /inference="protein motif:PFAM:PF09578"
FT                   /protein_id="ADU25937.1"
FT                   /translation="MTVSVSSQMMLFLFSMGIGGAFGLVYDVLYLGRLLSPCGRVLSFL
FT                   WDCLYLLACGLFTFLFLLAGNAGEVRFFLLEGELLGFLFYRFTLGVLVSKAMRWFAART
FT                   RSAAAEAGRRLKRPVACAGRRFGLFVSQKCGQMKKRLPKDRKVVKRCLKPARKVMYNLF
FT                   HRTHYKTAGPNTPKK"
FT   gene            384528..384803
FT                   /locus_tag="Ethha_0352"
FT   CDS_pept        384528..384803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0352"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   cce:Ccel_3081 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25938"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:E6U806"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ADU25938.1"
FT                   /translation="MKKHKSIIFRMALGVFVLYIVVTLINQQVQIGQRKAVLAQLETQY
FT                   KQQQGQNAEIERALSENNDQYMAGVARDKLGYTKSNDRIYINVAGN"
FT   gene            384941..385372
FT                   /locus_tag="Ethha_0353"
FT   CDS_pept        384941..385372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0353"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   cth:Cthe_2662 RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25939"
FT                   /db_xref="GOA:E6U807"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E6U807"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADU25939.1"
FT                   /translation="MQLEVGAVLEGKVTGITKFGAFVELPGGKTGMVHISEVAPTFVKE
FT                   IRDFVQENQTVKVKVLAITDDGKVSLSMKRVEAAPAPRRPVAGGGRPGGYEWSPRRNDN
FT                   LSFEEMMNKFKQSSDEKLSDLKKYIDPKRGNVSRRVGTK"
FT   gene            385713..386615
FT                   /locus_tag="Ethha_0354"
FT   CDS_pept        385713..386615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0354"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="TIGRFAM: thioredoxin reductase; KEGG:
FT                   cdl:CDR20291_2024 thioredoxin reductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25940"
FT                   /db_xref="GOA:E6U808"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6U808"
FT                   /inference="protein motif:TFAM:TIGR01292"
FT                   /protein_id="ADU25940.1"
FT                   /translation="MVDVLIVGGGPAGITAAVYAARAGLSTMILERMGVGGQAATTYEI
FT                   ENWPGNTLISGFDFSSNLEKHAKAVGSQLVYGDVTEFELGGKVKKVHTAKETYEARAVV
FT                   LAMGAERRLLGAAGEKEFTGRGVSYCATCDGNFFRQKAVAVVGGGNSAVEDAIYLANIC
FT                   EKVSIIHRRDQFRAEGYLQRKLDGLSNVEKIFDTGVERIEGENAVTGLALKNSKTGETR
FT                   ELPVAGVFIAVGTRPRTELLADVLPLDKGGYVDADESCITPLPGVFVAGDIRQKALRQL
FT                   VTAAADGANAANAAIHYLN"
FT   gene            386719..387972
FT                   /locus_tag="Ethha_0355"
FT   CDS_pept        386719..387972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0355"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: cth:Cthe_1777
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25941"
FT                   /db_xref="GOA:E6U809"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6U809"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADU25941.1"
FT                   /translation="MVRQAHSLLVRKTCCCRAAALGGAACIHIEEKNVLIQNARIFTME
FT                   GAVIENGWLETEGGRIRALGGMETIPAAAGDVFDAKGGSLLPGLVDAHTHLGMWEDSLG
FT                   FEGDDGNEKTDPSTPHLSAVDAVNPLDRCFAEAREAGITTVVTGPGSANPVSGQLIAMK
FT                   TAGRRIDDMLLKAPVAIKFALGENPKTVYHDRDETPTTRMATAAIIREQLLKAMRYRQK
FT                   LLACRENDELEEPEFDYKCEALLPLLAREVQAHFHAHRADDIFTALRIAKEFELDAVIV
FT                   HATEGHLIAEELAAEQAKILSGPFLCDRSKPELKNQSPVSPGQMMKAGLHPAIITDHPV
FT                   VPVQYLPLCAALAVREGMEHDAALRAITIRPAEILHLENRVGSLRPGKDADLVVFDGDP
FT                   LDFYAHTVFVAVGGRRVK"
FT   gene            387984..388431
FT                   /pseudo
FT                   /locus_tag="Ethha_0356"
FT   gene            388469..389770
FT                   /locus_tag="Ethha_0357"
FT   CDS_pept        388469..389770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssa:SSA_0827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25942"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:E6U810"
FT                   /inference="similar to AA sequence:KEGG:SSA_0827"
FT                   /protein_id="ADU25942.1"
FT                   /translation="MADHQPFIVQTGQSHAVRDGCSARMDEAGAQAAETQPRPTYTQMV
FT                   IHKTLGVYFARPYSLAACSELVRRLRSLAFILLAAAGIAGLVLGAGAPAFSVVWVACGI
FT                   ALVLWGIGVFLFGFARSLLMWPAAVGCAALYTGVRFALSWAWGLSPVLFAALAAFLLAV
FT                   LAGVIFRLAKRFVIASSVTFWQYERDGILCAADLPLGEMPPVAGYTVFLRGEVPVSFDA
FT                   EQEPAEEVDILLEDCVFFCRRKRLVFCGYALDARQKRLTLYLYARGVRQSRRAFKRFLK
FT                   RRGLEASVTCSTDADWQRFHEEVYPDDTEYQQIHNRFLYDNMEADGFDFSQAVPQVYTF
FT                   YFARREDARAFAEQAVPLGYEGSRYYDREREASVDGDGPAFAHAVCVQLTGRVGLARMD
FT                   CNTGRAVELARQFHGRFYEWEVGVLEPDASTAST"
FT   gene            389999..390544
FT                   /locus_tag="Ethha_0358"
FT   CDS_pept        389999..390544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0358"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: cth:Cthe_2875 sigma 54 modulation protein /
FT                   SSU ribosomal protein S30P; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25943"
FT                   /db_xref="GOA:E6U811"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:E6U811"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADU25943.1"
FT                   /translation="MHVNITGRKTHLKDPFKEKVTKKVGKFDRFFEPDATAFVTVTVEG
FT                   DRQTVEITIKNKGIVFRSEETSLDMSASLDVAVDHILRQIHKNKSRLEKRLRVGAFDSV
FT                   PELPDIPPMEAVPTFDVVKVKSFPVKPMDVQEAILQMNLSGHLFFAFQNAKTETVNIVY
FT                   KRSKGGYGLLEPVADDEE"
FT   gene            complement(390724..391857)
FT                   /locus_tag="Ethha_0359"
FT   CDS_pept        complement(390724..391857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_0947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25944"
FT                   /db_xref="UniProtKB/TrEMBL:E6U812"
FT                   /inference="similar to AA sequence:KEGG:Cphy_0947"
FT                   /protein_id="ADU25944.1"
FT                   /translation="MKKKLLALGCGLLLLAGCSIAPHHTTPAISARISAPQSGQSAASE
FT                   GSGAPSAPVLKGPLFTAGSGPYLPPAGTVQTVDSAAADEIHLYWEKAYPLAQNPPDFAF
FT                   YDANDPVSEDAGEETALLQKYGANLYLKGLKETSYVVQWESAYALIGYCGVPSAKEQAV
FT                   PLLRELEKTSPSKNVRNACTFTLDVLDGSFSSPHISASSDRKTLAFADHFEATLGGGHR
FT                   LWTLRDGKLYLDTLSVDGYTSSIAQAAVSPDGKHVAVNLTGRKGSWGFIITLGQPDTLS
FT                   GELIGTMAAPLQKKGYTLYREGAPANPDWHGVYYSNIQNLSWTGSDTLKLDVDMQVTDH
FT                   PAPSALEGDARLSGTVLYHPSDGTFDFGGLTKSPGVR"
FT   sig_peptide     complement(391765..391857)
FT                   /locus_tag="Ethha_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.720 at
FT                   residue 31"
FT   gene            392127..393254
FT                   /locus_tag="Ethha_0360"
FT   CDS_pept        392127..393254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0360"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="KEGG: tit:Thit_0338 putative RNA methylase; PFAM:
FT                   RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25945"
FT                   /db_xref="GOA:E6U813"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6U813"
FT                   /inference="protein motif:PRIAM:2.1.1.52"
FT                   /protein_id="ADU25945.1"
FT                   /translation="MAYTVVCPCLFGLESLVAEEARALGFADAAAADGRVTFTADKDGI
FT                   ARANIGLRCAERVLVRLGEFPARSFEELFEGVRALPWEEFVGKHDAFPVKGWSLKSTLH
FT                   SVPDCQAIIKKAAVERLKTRHHVEWFEETGPLVQIRFSIHKDIVDICLDTSGDGLHKRG
FT                   YRPKSNEAPLKETLAAAIVRLSRPFADKLFCDPMCGSGTLVIEAAMLLQNIAPGLNRSF
FT                   AAERWGWLPAAVWREARAAARDAVDRKPCLIEGSDIDPAAVALARENAGRAGVGESIRF
FT                   ARRDVRDFSPEQARGEVVCNPPYGERMLEVRQAEELYAELGALYRRLPQFQFYIISPSD
FT                   RFEALFGARADKRRKLYNGMIRCELFQYFRPRVKK"
FT   gene            393437..393721
FT                   /locus_tag="Ethha_0361"
FT   CDS_pept        393437..393721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0361"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: cth:Cthe_2891
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25946"
FT                   /db_xref="GOA:E6U814"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E6U814"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADU25946.1"
FT                   /translation="MALKPLADRVVIKLVEAEETTRGGIILPDNAKEKPQVAEVVAVGP
FT                   GGLVDGKEVQMYLQPGQKVIASKYAGTEVKVDGEEYTIVRQNDILAVVE"
FT   gene            393820..395463
FT                   /locus_tag="Ethha_0362"
FT   CDS_pept        393820..395463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0362"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: cth:Cthe_2892 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25947"
FT                   /db_xref="GOA:E6U815"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E6U815"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADU25947.1"
FT                   /translation="MAKEIIYGEDARKALQKGVDQLADTVKITLGPKGRNVVLERKYGS
FT                   PLITNDGVSIAKEIELDDPFENMGAQLVKEVATKTNDVAGDGTTTATLLAQALIREGMK
FT                   NVAAGASPMAIKRGIQKAVDAAVETLKKNAKQISGPADIESAATISAGDAFIGKLIAEA
FT                   MEKVTSDGVITVEDSKTAETACDVVEGMQFDRGYITPYMATDTEKMEAVIDDALLLITD
FT                   KKLSSIQDVLPLLEEIVKAGKKLVIIAEDVEGEALSTLIVNKLRGTFTCVAVKAPGYGD
FT                   RRKDMLRDIAILTGGEVISSDLGFELKDTTMAQLGHARQVKVSKDNTTIVEGAGDAQAI
FT                   KDRVAQLRAQLAAATVEFDKEKLQERIAKLAGGVAVLRVGAATETEMKEKKLRIEDALS
FT                   ATKAAVAEGLVAGGGTALVNTLPSVKALLDTEEDADEKTGIRIVIKALEEPVRQIAANA
FT                   GLEGSVIVDKILQCGKVNYGFNAAKETYTDMFEARIVDPTKVTRSALQNAASVAAMVLT
FT                   TESLVADKKEKEAAAPAMPNPGMGGMGGMY"
FT   gene            395684..397126
FT                   /locus_tag="Ethha_0363"
FT   CDS_pept        395684..397126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0363"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; KEGG:
FT                   cno:NT01CX_0337 prolyl-tRNA synthetase; PFAM: Prolyl-tRNA
FT                   synthetase, class II-like; Anticodon-binding domain
FT                   protein; tRNA synthetase class II (G H P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25948"
FT                   /db_xref="GOA:E6U816"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E6U816"
FT                   /inference="protein motif:TFAM:TIGR00408"
FT                   /protein_id="ADU25948.1"
FT                   /translation="MAQDGGKKLVEAITPMEEDFAKWYTDIVKKAELVDYSSMRGCLFI
FT                   RPYAYAIWENIQKVLDAKFKETGHENVYMPLFIPESLLQKEKDHIEGFAPEVAWVTHGG
FT                   GEKLEERLCVRPTSETLFCEHYSHIVHSYRDLPKLYNQWCSVVRWEKTTRPFLRSLEFL
FT                   WQEGHTLHETEAEAREETTRMLNIYADFCEQVLAMPVVKGRKTEKEKFAGAVDTCSIEA
FT                   MMHDGKALQSGTSHYLGDGFTHAFDIQYTGRDNTLKYPFQTSWGVTTRLIGAIIMVHGD
FT                   DSGLVLPPRIAPTQLVIVPVAMHKPGVLEKANELLVRLQKTLRVKLDASDNSPGWKFAE
FT                   YEMKGVPLRLEIGPRDIEQNRCVVVRRDDRQKIEVSLDELETRLPAILDDVHEALYKKA
FT                   LERQNAMTYACTDWDGFVRTADEKPGFIKAMWCGDQACEEKIKTDAGLTSRNIPFEQEH
FT                   LSDTCICCGKPAKHMVYWGKAY"
FT   gene            397159..397515
FT                   /locus_tag="Ethha_0364"
FT   CDS_pept        397159..397515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_0467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25949"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:E6U817"
FT                   /inference="similar to AA sequence:KEGG:BPUM_0467"
FT                   /protein_id="ADU25949.1"
FT                   /translation="MPYPWLDEYLLSKMDVTKDYKEEWSATRYFVGGKMFAMQGGDKTG
FT                   KPVFTMKLEPMYGDFLRRTHPDIVPGYHMNKVHWNSLYLDGVVPDDVVREMADQSYQIV
FT                   LQALSRKIQKEIIG"
FT   gene            complement(397586..398059)
FT                   /locus_tag="Ethha_0365"
FT   CDS_pept        complement(397586..398059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25950"
FT                   /db_xref="UniProtKB/TrEMBL:E6U818"
FT                   /inference="similar to AA sequence:KEGG:Cbei_3647"
FT                   /protein_id="ADU25950.1"
FT                   /translation="MNPQIFIAISLFVIILMFLSVARGKVKRFNLVLIWLVPVLFLSVT
FT                   SDAFLQFPAPAPAMQVAIALATIVGGCAGFGIGLLRGKSMRFGVDARGVFYRNSYASVA
FT                   FYAAVILIKLSVQLFFVGMPFASLLSLSLLAVSCGSIFGRRIFITYKALQLAK"
FT   sig_peptide     complement(397991..398059)
FT                   /locus_tag="Ethha_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.653 at
FT                   residue 23"
FT   gene            398595..398906
FT                   /locus_tag="Ethha_0366"
FT   CDS_pept        398595..398906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0366"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: cth:Cthe_2902 30S ribosomal protein S10;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25951"
FT                   /db_xref="GOA:E6U819"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E6U819"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADU25951.1"
FT                   /translation="MAVKEKIRIRLKSYDHQLIDQSAEKIVETAKRTGARVSGPVPLPT
FT                   DREIVTILRAVHKYKDSREQFETRTHKRLIDILRPSPKTVDALMGLELPAGVEIEIKL"
FT   gene            399020..399655
FT                   /locus_tag="Ethha_0367"
FT   CDS_pept        399020..399655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0367"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: tte:TTE2293 50S ribosomal protein L3; TIGRFAM:
FT                   50S ribosomal protein L3; PFAM: ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25952"
FT                   /db_xref="GOA:E6U820"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E6U820"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADU25952.1"
FT                   /translation="MQKGIIGKKIGMTQLFDERGNVIPVTVIEAGPCVVVQKKTVEVDG
FT                   YESVQLGFEEVREKLLNKPEKGHFEKAGVASKRVLREFRLEDMSALNVGDIVKADVFAA
FT                   GDRVDVAGTSKGKGYAGVIKRWGHHRLKMTHGTGPVHREVGSMGASTNMSRVPKGKKMA
FT                   GQMGNERVTVQNLDVVKVDAENNLIALKGAIPGPKGGIVILADSVKKA"
FT   gene            399673..400296
FT                   /locus_tag="Ethha_0368"
FT   CDS_pept        399673..400296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0368"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: cce:Ccel_0759
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25953"
FT                   /db_xref="GOA:E6U821"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E6U821"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADU25953.1"
FT                   /translation="MPKATVFNIAGEQVGEIELADSVFGIEPNKTALHTVVVNYLANQR
FT                   QGTQSTLTRSEVSGGGRKPWRQKGTGHARQGSTRAPQWKHGGIALGPKPRSYTYTVNKK
FT                   VRRLALKSALSAKLAAGELVVLDAISLPEIKTKQVVTILSKFETSKKALFVTAGVNENL
FT                   VKSARNIPGVKTASTGSLNVYDLLDSNKFFISKDAVAALEEVYA"
FT   gene            400296..400589
FT                   /locus_tag="Ethha_0369"
FT   CDS_pept        400296..400589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0369"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: amt:Amet_4476
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25954"
FT                   /db_xref="GOA:E6U822"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E6U822"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADU25954.1"
FT                   /translation="MKAPQDVIIRPVITEKSMAGIANKIYTFRVASEAGKVEIAKAVEE
FT                   LFGVQVAKVNTISVRGRSRRVGRSTGYTSDWKKAIVTLKEGSKAIEFFEGLA"
FT   gene            400621..401454
FT                   /locus_tag="Ethha_0370"
FT   CDS_pept        400621..401454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0370"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: cth:Cthe_2906 50S ribosomal protein L2;
FT                   TIGRFAM: ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25955"
FT                   /db_xref="GOA:E6U823"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E6U823"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADU25955.1"
FT                   /translation="MAIRKYGPTSPARRNMTVPTFEELSKVEPEKSLLVSLPKHAGRNS
FT                   YGRITVRHRGGGNRVKYRIIDFKRDKIDAPAKVLSVEYDPNRSAYIALLQYEDGEKRYI
FT                   LAPLGLKAGDTVLSGKEADIKPGNSLALSDIPVGTFVHNIELHPGKGGQLARAAGIMAQ
FT                   LMARENGMALIRLPSGELRNVPQECRATIGQVGNIDHENVKIGKAGRKRHMGWRPTVRG
FT                   SVMNPNDHPHGGGEGKSPIGRPGPVTPWGKPTLGYKTRKKKLASDKFIVKRRGGK"
FT   gene            401503..401781
FT                   /locus_tag="Ethha_0371"
FT   CDS_pept        401503..401781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0371"
FT                   /product="ribosomal protein S19"
FT                   /note="KEGG: hmo:HM1_1382 30S ribosomal protein S19;
FT                   TIGRFAM: ribosomal protein S19; PFAM: ribosomal protein
FT                   S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25956"
FT                   /db_xref="GOA:E6U824"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E6U824"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADU25956.1"
FT                   /translation="MSRSLKKPPYVEEALMKRVVALNKSGEKTVLKTWSRASTIFPEFV
FT                   GHTIAVHDGRKHVPVYVTEDMVGHKLGEFAPTRTFKGHSGSKVSNSR"
FT   gene            401801..402151
FT                   /locus_tag="Ethha_0372"
FT   CDS_pept        401801..402151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0372"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: csc:Csac_2282 50S ribosomal protein L22;
FT                   TIGRFAM: ribosomal protein L22; PFAM: ribosomal protein
FT                   L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25957"
FT                   /db_xref="GOA:E6U825"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E6U825"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADU25957.1"
FT                   /translation="MPAVAHLRYARIAPRKVQIVLDLIRNKPVDVAVAILKHTPKSASE
FT                   YLIKLLQSAIANAENNHAMDVSRLYVSECFVCPGPMLKRIRPRAHGRAFPILKRTSHVT
FT                   IALEEAAEPKNA"
FT   gene            402165..402830
FT                   /locus_tag="Ethha_0373"
FT   CDS_pept        402165..402830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0373"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; Ribosomal protein S3 domain; KH
FT                   type 2 domain protein; KEGG: cce:Ccel_0764 ribosomal
FT                   protein S3; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25958"
FT                   /db_xref="GOA:E6U826"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E6U826"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADU25958.1"
FT                   /translation="MGQKVNPHGLRVGVIKDWDSRWFAKDNVFGDLLVEDYNLRNYLKK
FT                   KLFSAGIPRIEIERDASRVRIHIHCAKPGMVIGKGGVEIDKLRTELEARLGKPVSINIV
FT                   EVRSPDVNAQLVAENIAAQLEKRISFRRAMKQSIGRAMKLGAKGIKVTVAGRLGGAEIA
FT                   RVEHYHEGTIPLQTLRADIDYGFSEAKTTYGRIGVKVWIYKGEVLPEVRRAPKEGGEQ"
FT   gene            402830..403258
FT                   /locus_tag="Ethha_0374"
FT   CDS_pept        402830..403258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0374"
FT                   /product="ribosomal protein L16"
FT                   /note="KEGG: tmt:Tmath_1926 ribosomal protein L16; TIGRFAM:
FT                   ribosomal protein L16; PFAM: Ribosomal protein L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25959"
FT                   /db_xref="GOA:E6U827"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E6U827"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADU25959.1"
FT                   /translation="MLMPKRVKFRRQQRGRLTGRALRGNTVTYGEYGIQALEPAWITSN
FT                   QIEAARIAMTRFTKRGGQVWIKIFPHKPITEKPAETRMGSGKGSPEYWVAVVKPGRILF
FT                   EIGGVSEEIAREATRLAMYKLPIKCKFVKKEETDGEQS"
FT   gene            403255..403455
FT                   /locus_tag="Ethha_0375"
FT   CDS_pept        403255..403455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0375"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: cac:CA_C3125 ribosomal protein L29; TIGRFAM:
FT                   ribosomal protein L29; PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25960"
FT                   /db_xref="GOA:E6U828"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E6U828"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADU25960.1"
FT                   /translation="MKAQEIRTKSVEDLNSQLKDLKAELFNLRFQLAINQLENPMRIKA
FT                   VKKDIARIKTVLRETEMREGA"
FT   gene            403478..403738
FT                   /locus_tag="Ethha_0376"
FT   CDS_pept        403478..403738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0376"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: cpy:Cphy_3658 ribosomal protein S17; TIGRFAM:
FT                   30S ribosomal protein S17; PFAM: ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25961"
FT                   /db_xref="GOA:E6U829"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E6U829"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADU25961.1"
FT                   /translation="MSERTTLRKTRVGRVVSDKMDKTLVVAIEDNVKHPLYKKIIKRTL
FT                   RLKAHDENNEAKIGDRVSITETRPLSKDKRWRLVKILERAK"
FT   gene            403767..404135
FT                   /locus_tag="Ethha_0377"
FT   CDS_pept        403767..404135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0377"
FT                   /product="ribosomal protein L14"
FT                   /note="KEGG: cbe:Cbei_0161 50S ribosomal protein L14;
FT                   TIGRFAM: ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25962"
FT                   /db_xref="GOA:E6U830"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E6U830"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADU25962.1"
FT                   /translation="MIQQQTYLKVADNTGAKELMCIRVLGGSRRRYANIGDIVVASVKK
FT                   ATPGGVVKKGDVVKAVIVRSVKGVGRLDGTHIRFDENAAVIIKEDKTPRGTRIFGPVAR
FT                   ELREKEYLKILSLAPEVL"
FT   gene            404153..404470
FT                   /locus_tag="Ethha_0378"
FT   CDS_pept        404153..404470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0378"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: aco:Amico_0638 ribosomal protein L24; SMART:
FT                   KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25963"
FT                   /db_xref="GOA:E6U831"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E6U831"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADU25963.1"
FT                   /translation="MSKVHVKKGDTVQVISGKDRGKQGKVLEVSPKEGKVIVEGRNMVT
FT                   KHVKPRKMGEQGGIVKAEGALYASKVMIVCPKCGKPTRIGHTIAEDGTKTRVCRKCGAT
FT                   L"
FT   gene            404489..405028
FT                   /locus_tag="Ethha_0379"
FT   CDS_pept        404489..405028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0379"
FT                   /product="50S ribosomal protein L5"
FT                   /note="KEGG: aoe:Clos_0504 50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25964"
FT                   /db_xref="GOA:E6U832"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E6U832"
FT                   /inference="similar to AA sequence:KEGG:Clos_0504"
FT                   /protein_id="ADU25964.1"
FT                   /translation="MARLRETYKNEIAPALMKKFNYKSVMQIPKIEKVVINVGCGDARD
FT                   NAKAIDAVMEEIGMITGQKPVVTKARKSVANFKLREGMNIGVKVTLRQNRMYEFIDRLF
FT                   NTALPRVRDFRGINPNSFDGRGNYALGLKEQLIFPEIDYDKVDKVRGMDVIFVTTAQTD
FT                   EEARELLTLFGAPFRK"
FT   gene            405041..405226
FT                   /locus_tag="Ethha_0380"
FT   CDS_pept        405041..405226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0380"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: cce:Ccel_0771 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25965"
FT                   /db_xref="GOA:E6U8H4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8H4"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ADU25965.1"
FT                   /translation="MAKLSMKIKQQRTPKFSTRSYNRCKICGRPHAYLRKYGVCRICFR
FT                   NLAYKGEIPGVKKASW"
FT   gene            405253..405651
FT                   /locus_tag="Ethha_0381"
FT   CDS_pept        405253..405651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0381"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: cce:Ccel_0772 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25966"
FT                   /db_xref="GOA:E6U8H5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8H5"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADU25966.1"
FT                   /translation="MQVTDTVADMLTRIRNANSAKHDTVDIPASNLKKAIARILLDEGY
FT                   IRNYTVIEDNKQGTIRINLKYGPSKSHVITGLRRVSKPGLRMYANCEDMPKVMKGLGIA
FT                   IVSTSKGIMTDREARKENVGGEVLAFVW"
FT   gene            405664..406215
FT                   /locus_tag="Ethha_0382"
FT   CDS_pept        405664..406215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0382"
FT                   /product="ribosomal protein L6"
FT                   /note="KEGG: cth:Cthe_2918 50S ribosomal protein L6P;
FT                   TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25967"
FT                   /db_xref="GOA:E6U8H6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8H6"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ADU25967.1"
FT                   /translation="MSRIGKQPIEIPNGVNVTLAEGNTVIVKGPKGELTQSFHPDIKIT
FT                   IEGSVIHITRPDDEKEHRALHGLTRSLVANMVHGVVEEYHKELEINGVGYRAAKQGKKV
FT                   TFNLGYSHPVIVEEVPGITIDVPAPNKIIVHGPDKQQVGQFAAELREKRPPEPYKGKGV
FT                   KYADEVIHRKEGKAGKGGKK"
FT   gene            406236..406595
FT                   /locus_tag="Ethha_0383"
FT   CDS_pept        406236..406595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0383"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: cno:NT01CX_1131 50S ribosomal protein L18;
FT                   TIGRFAM: ribosomal protein L18; PFAM: ribosomal protein
FT                   L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25968"
FT                   /db_xref="GOA:E6U8H7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8H7"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADU25968.1"
FT                   /translation="MINKPDNNKARLRRHKRVRGKISGTAERPRLNVFRSLHHIYAQVI
FT                   DDVAGVTLVAASTMDKDFEGTGGNKEAAKKVGLAIAKKAAEKGIIEVRFDRGGFVYHGR
FT                   IKELADGAREGGLKF"
FT   gene            406612..407127
FT                   /locus_tag="Ethha_0384"
FT   CDS_pept        406612..407127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0384"
FT                   /product="ribosomal protein S5"
FT                   /note="KEGG: bts:Btus_0170 ribosomal protein S5; TIGRFAM:
FT                   ribosomal protein S5; PFAM: Ribosomal protein S5 ;
FT                   ribosomal protein S5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25969"
FT                   /db_xref="GOA:E6U8H8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8H8"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADU25969.1"
FT                   /translation="MARNNFRSNNREESDLNEKVVAINRVSKTVKGGRIFKFAALVVVG
FT                   DGKGKVGFGIGKSGEVPDAIRKGIEDAKKNLFTVALKGTTIPHEIVGAFGAGRVLLKPA
FT                   APGTGVIAGGPVRAVVEVAGIKDIRTKALRSNNPCNVVRATIQGLKSIRGAERVAEIRG
FT                   KTVKEILG"
FT   gene            407143..407322
FT                   /locus_tag="Ethha_0385"
FT   CDS_pept        407143..407322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0385"
FT                   /product="ribosomal protein L30"
FT                   /note="KEGG: clj:CLJU_c40860 50S ribosomal protein L30;
FT                   TIGRFAM: ribosomal protein L30; PFAM: ribosomal protein
FT                   L30"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25970"
FT                   /db_xref="GOA:E6U8H9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8H9"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ADU25970.1"
FT                   /translation="MAELKITLLKSLSGRKASHIATAHALGLRKIRDEVTQPDNPQTRG
FT                   KINQISYLVEVVEA"
FT   gene            407341..407781
FT                   /locus_tag="Ethha_0386"
FT   CDS_pept        407341..407781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0386"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; KEGG: afl:Aflv_0124
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25971"
FT                   /db_xref="GOA:E6U8I0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I0"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADU25971.1"
FT                   /translation="MKLYELSPAEGASKDAFRVGRGIGSGNGKTSGKGHKGQKARSGGG
FT                   VRPGFEGGQMPLVRRIPKRGFTNIFAKPYAHVNVQALNVFEDGAVVDAAALKEAGLVKK
FT                   APYGVKVLAQGELTKKLTVKASAFSEAAKQKIEAAGGTTEVI"
FT   gene            407783..409063
FT                   /locus_tag="Ethha_0387"
FT   CDS_pept        407783..409063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0387"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="KEGG: tjr:TherJR_0316 preprotein translocase, SecY
FT                   subunit; TIGRFAM: preprotein translocase, SecY subunit;
FT                   PFAM: SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25972"
FT                   /db_xref="GOA:E6U8I1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I1"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ADU25972.1"
FT                   /translation="MFDTFRNAWRSPELRKKLLYTLLVIVIFRIGAAITVPYLNLTALH
FT                   NEIASGGNSLMGYIDILTGGALSRATIFSMSVTPYINATIIIQLLTVAIPALERLSKEG
FT                   EVGRKKLNSITRYFTMILGLGQGLGMYFYLRGYGITEYNTGFSAVFSAAVIVAVFTAGS
FT                   CLMMWLGEQINDKGIGNGISILLFAGIVSRGPSIGSAISKYWQIGGQYHVLIPLLVVLG
FT                   LFVVVAIVFMNDAERRIPVQYAKRVVGRKMYGGQSSYIPIKVTMSGVMPIIFASSIVSI
FT                   PSIIGGFLPKTSTVYKVFTWFGYTSWLYAVVYFVLIILFNFFYVAIQYNPFEISNNLRK
FT                   NNGGIPGIRPGKPTADYIQRVISRVTLIGAVFLGLVAVLPIALSAGAGLNIALGGTSLL
FT                   ILVGVALDTQRQLESQMMMRHYKGFLE"
FT   gene            409113..409751
FT                   /locus_tag="Ethha_0388"
FT   CDS_pept        409113..409751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0388"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: ate:Athe_1725 adenylate kinase; TIGRFAM:
FT                   adenylate kinase; PFAM: adenylate kinase; adenylate kinase
FT                   lid domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25973"
FT                   /db_xref="GOA:E6U8I2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I2"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADU25973.1"
FT                   /translation="MNLILLGAPGAGKGTQAENICAHFHIPTISTGNMLREAVKNGTKL
FT                   GLEAKAYMDAGKLVPDAVLVGMIQEKLKEPAYQNGFILDGFPRTVPQAEALDQMGVRID
FT                   TVLEIDVPDERIVARMAGRRVCEICGTSYHTEYRPPKTEGICDADGGRLVQRADDAPET
FT                   VKARLEVYHTQTEPVKAYYAKQDKLSVVEGQEDIADTTRLTLQTLEGRS"
FT   gene            409748..410497
FT                   /locus_tag="Ethha_0389"
FT   CDS_pept        409748..410497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0389"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: bts:Btus_0175 methionine aminopeptidase, type
FT                   I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25974"
FT                   /db_xref="GOA:E6U8I3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I3"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADU25974.1"
FT                   /translation="MIILKNEHQLQKMREAGRISQLALLEGGKHVEPGITTADLDHIMH
FT                   EFIVRAGAKPSFLGYGGFPATACISVNNEVIHGIPDKKHKIQNGDIVSIDVGAIYEGFN
FT                   GDNAWTFPAGTISDEAQALLDATRESLFEGIRAAKPGNRVGDIGHAVQSYVEARGFSVV
FT                   RPYVGHGVGEDMHEEPDVPNYGRVGHGARLVPGMVIAIEPMINQGAKEVRTLQNGWTVT
FT                   TVDGSLSAHFEHTVAITENGPVILTAP"
FT   gene            410511..410786
FT                   /locus_tag="Ethha_0390"
FT   CDS_pept        410511..410786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25975"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I4"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2926"
FT                   /protein_id="ADU25975.1"
FT                   /translation="MEIQTGSVVLSLAGHDKGGTFAVIDFADDSHALIADGKRRKTEKP
FT                   KRKKCKHLQVVGRLDLPDAGRATNRQIRKALGAFGADAAAVSGGGI"
FT   gene            410788..411006
FT                   /locus_tag="Ethha_0391"
FT   CDS_pept        410788..411006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0391"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: clj:CLJU_c40820 translation initiation factor
FT                   IF-1; TIGRFAM: translation initiation factor IF-1; PFAM: S1
FT                   IF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25976"
FT                   /db_xref="GOA:E6U8I5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I5"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ADU25976.1"
FT                   /translation="MSKDDMIELEGIVREALPNAMFQVELPNNHMILAHISGKLRMNYI
FT                   RILPGDKVTVEMSPYDLTRGRITWRSK"
FT   gene            411065..411178
FT                   /locus_tag="Ethha_0392"
FT   CDS_pept        411065..411178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0392"
FT                   /product="ribosomal protein L36"
FT                   /note="KEGG: clj:CLJU_c40810 50S ribosomal protein L36;
FT                   TIGRFAM: ribosomal protein L36; PFAM: ribosomal protein
FT                   L36"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25977"
FT                   /db_xref="GOA:E6U8I6"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I6"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ADU25977.1"
FT                   /translation="MKVRPSVKPMCEKCKVIKRKGRIMVICENPKHKQRQG"
FT   gene            411209..411577
FT                   /locus_tag="Ethha_0393"
FT   CDS_pept        411209..411577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0393"
FT                   /product="30S ribosomal protein S13"
FT                   /note="KEGG: cth:Cthe_2929 30S ribosomal protein S13;
FT                   TIGRFAM: 30S ribosomal protein S13; PFAM: ribosomal protein
FT                   S13"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25978"
FT                   /db_xref="GOA:E6U8I7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I7"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ADU25978.1"
FT                   /translation="MARIAGVNLPNEKRVEIGLTYIFGIGRKSADDIIKATGINPDIRV
FT                   KDLTEEQVSLLRDIIDKEYTIEGDLRRRVALNIKRLVEVGCYRGVRHRKGLPVRGQRTK
FT                   TNARTRKGPKKTIANKKK"
FT   gene            411595..412008
FT                   /locus_tag="Ethha_0394"
FT   CDS_pept        411595..412008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0394"
FT                   /product="30S ribosomal protein S11"
FT                   /note="KEGG: cce:Ccel_0785 30S ribosomal protein S11;
FT                   TIGRFAM: 30S ribosomal protein S11; PFAM: ribosomal protein
FT                   S11"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25979"
FT                   /db_xref="GOA:E6U8I8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I8"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ADU25979.1"
FT                   /translation="MANKAVANKKGATATRKRRERKNIDRGAAHIQSTFNNTIVTITDT
FT                   QGNSISWASAGGLGFRGSRKSSPFAAQMAAETAAKVAMEHGMKTIEVFVKGPGAGREAA
FT                   IRALQAAGLEVNMIKDVTPIPHNGCRPPKRRRV"
FT   gene            412036..412662
FT                   /locus_tag="Ethha_0395"
FT   CDS_pept        412036..412662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0395"
FT                   /product="ribosomal protein S4"
FT                   /note="TIGRFAM: ribosomal protein S4; PFAM: ribosomal
FT                   protein S4; RNA-binding S4 domain protein; KEGG:
FT                   cce:Ccel_0786 ribosomal protein S4; SMART: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25980"
FT                   /db_xref="GOA:E6U8I9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I9"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ADU25980.1"
FT                   /translation="MARYTDSVCKLCRREGQKLFLKGERCYSDKCSVGRRSYAPGQHGQ
FT                   DRKKVSEYGIQLRAKQKARRYYGVLERQFRHYFEIAESKPGITGENLLRLLELRLDNVV
FT                   YRLGFASSHAQSRQMVRHGHFTINGKKANIPSMRVRVGDVVAVKEGSRTNEFIKSVVEA
FT                   NASRPIPKWLEINREALSGTVAVLPNREDIDLSVEEHLIVELYSK"
FT   gene            412791..413741
FT                   /locus_tag="Ethha_0396"
FT   CDS_pept        412791..413741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0396"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase dimerisation;
FT                   RNA polymerase alpha subunit domain protein; KEGG:
FT                   pjd:Pjdr2_5652 DNA-directed RNA polymerase subunit alpha;
FT                   SMART: RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25981"
FT                   /db_xref="GOA:E6U8J0"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J0"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ADU25981.1"
FT                   /translation="MIEIEKPRIETAELTSDGSYGRFVVEPLERGYGTTLGNSLRRVLL
FT                   SSLPGVAVTQVKIDGVQHEFSTVPGVKEDVTEIILNIKGLTAKLHSDGPKVVYIDAEGE
FT                   CKVTAGDIKTDSEVEILDPNMHIATLAAGAKLYMEITLDKGRGYVAAERNKQNLQPAIG
FT                   VIPVDSIYTPVLKVNYAVENTRVGQITDYDKLTLEVWTDATISAKEAVSIGAKILNEHL
FT                   GLFVALCAETQSTEIMVEKDDKSKEKVLEMTIEELDLSVRSFNCLKRAGINTVEDLINR
FT                   TEDDMMKVRNLGRKSLEEVISKLNSLGFSLKRDEE"
FT   gene            413775..414116
FT                   /locus_tag="Ethha_0397"
FT   CDS_pept        413775..414116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0397"
FT                   /product="ribosomal protein L17"
FT                   /note="KEGG: cac:CA_C3103 50S ribosomal protein L17;
FT                   TIGRFAM: ribosomal protein L17; PFAM: ribosomal protein
FT                   L17"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25982"
FT                   /db_xref="GOA:E6U8J1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J1"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADU25982.1"
FT                   /translation="MPGTRKLGRSTDHRLAMLRAMVTFLLENGKIETTLARAKEVRSLA
FT                   EKMITLGKETDLHSKRQIYSFITKEAVSKKVIDELGPKYKEVSGGYTRIYKIGPRRGDA
FT                   AEMAIIELI"
FT   gene            414275..414421
FT                   /locus_tag="Ethha_0398"
FT   CDS_pept        414275..414421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0398"
FT                   /product="RNA-binding region RNP-1"
FT                   /note="KEGG: sye:Syncc9902_0300 RNA-binding region RNP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25983"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J2"
FT                   /inference="similar to AA sequence:KEGG:Syncc9902_0300"
FT                   /protein_id="ADU25983.1"
FT                   /translation="MPDKFERKQNGGTRQKGHTPAPAGDQIGENAEEGRWAKEEGKKQD
FT                   RRS"
FT   gene            complement(414487..414957)
FT                   /locus_tag="Ethha_0399"
FT   CDS_pept        complement(414487..414957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0399"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: cth:Cthe_0219 5-nitroimidazole
FT                   antibiotic resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25984"
FT                   /db_xref="GOA:E6U8J3"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J3"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADU25984.1"
FT                   /translation="MRRNDREVTDPDEQIAIMQRCDVCRLAFFDADSPYIVPMNFGFEQ
FT                   ACDTLLLYFHCAKTGKKLDCLAADPRVSFEMDGAHRLLEADSACGYSMEYESVIGRGTA
FT                   RLLGDAEKAHALQCIMRHYRPGKTFVFDLRMMDAVAVFQVSVQSLTAKRLKK"
FT   gene            complement(414986..415669)
FT                   /locus_tag="Ethha_0400"
FT   CDS_pept        complement(414986..415669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0400"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="TIGRFAM: MTA/SAH nucleosidase; KEGG:
FT                   bcb:BCB4264_A2883 bifunctional
FT                   5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase/phosphatase; PFAM: purine or other
FT                   phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25985"
FT                   /db_xref="GOA:E6U8J4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J4"
FT                   /inference="protein motif:TFAM:TIGR01704"
FT                   /protein_id="ADU25985.1"
FT                   /translation="MAKIGVLSAMPVEIESIIQKCGAKPLSTPHFYKVWEGTYGNNTVL
FT                   FACSGIGKVNAAACAQHLIDAFGVDCIINMGIAGGIAKDLHTLDVVIGNEVFYHDFNPA
FT                   SLLEKYYPFQARFTCDARLAEIARNVCTATPEVECFRMGDIASGDCFVEAGETKALIRE
FT                   LGGVCCEMEGAAIGHVCFLNEVPFLIVRTISDLADETAPITYEEFEQKASVQSNHVVEG
FT                   ILKAI"
FT   gene            415851..417170
FT                   /locus_tag="Ethha_0401"
FT   CDS_pept        415851..417170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0401"
FT                   /product="glutamine synthetase, type I"
FT                   /note="KEGG: eel:EUBELI_00431 glutamine synthetase;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25986"
FT                   /db_xref="GOA:E6U8J5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J5"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ADU25986.1"
FT                   /translation="MDREDVFQFMEENDVKFIRFQFTDISGIMKNIAINYSNLESALDG
FT                   VLFDGYAVDGFSRSEESEMLLVPELDTLNIFPWRPQQGKVVRFICDVLSQDGTPFAGDP
FT                   RYILKKMVAKAAAKGYMFLVEPECEFFLFHTDEHGLPTTQTHDTAGYFDLAPIDLGENA
FT                   RREVCLSLENMGFLVESSHHEVAAGQHEIDFRYDDALKTADNIETFRMVVKIIAQKHGL
FT                   HATFMPKPLHNEAGSGMHINMSLVRGEQDVLADPNDELGLSKEGYYFIGGIMKHIRGLT
FT                   ALCNPLVNSYKRLVPGTEAPAYILWARKNRGPLIRVPYFKDGRARVELLSPDPACNPYL
FT                   SLAALLGAGMEGIEKQITPPPEMKANIQDMSPRAIREAGIERLPATLGEALDALEQDAL
FT                   LREILGEHAFRSYLSTKRAEWDSYCETVHPWETGRYLSIY"
FT   gene            417234..417779
FT                   /locus_tag="Ethha_0402"
FT   CDS_pept        417234..417779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0402"
FT                   /product="ANTAR domain protein"
FT                   /note="PFAM: ANTAR domain protein; KEGG: dhd:Dhaf_0995
FT                   response regulator receiver and ANTAR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25987"
FT                   /db_xref="GOA:E6U8J6"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J6"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADU25987.1"
FT                   /translation="MSDGMLVVCGQRAFCKNLCDLIASSIAIHPIVATSGAEARRKTSM
FT                   HEMEAVLLAGKLPDENTLDLALELSQSGVAGVMIVIDRGTLFEAHEVLDGSGVTILANP
FT                   LTKDALIQAIRLVMKVAEGGGTLDRAKLMLVQQKGWTEPQAHRYIQKLSMDKRLPRELA
FT                   AQLVIKALEREQQAKEES"
FT   gene            complement(417839..420031)
FT                   /locus_tag="Ethha_0403"
FT   CDS_pept        complement(417839..420031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0403"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   bld:BLi04209 YycA"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25988"
FT                   /db_xref="GOA:E6U8J7"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J7"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ADU25988.1"
FT                   /translation="MIVLPDKSSSSQLSRKWALLILAGIAALSFGLNFWSISSVGYGNA
FT                   YYAAAIRSMTQNVHNFFFVAFDPAGVVSVDKPPIGLWVQAIFVLIFGYHGWAMLLPQAL
FT                   AGTGCSLMMYLLVAKRFGRPAGLISALVLALTPSVVVAARNNTMDLQLVFVLLAATWFL
FT                   FRSIETGKARYFFLAALMVGIGFNVKMLEAYLAVPAMGIVFLIFSKQKIGKRILTAIVG
FT                   IGIMLAVSLSWTVAVDLTPASERPYVGSSTNNTVWELITGHNGAERLFGQGGGTGGMGG
FT                   PGGQNGGSTNNNNAGGQNGGMGGPGGQNGNATNNNNANGGNTNNNAGGQNGGTGGFGGP
FT                   GGQNGNTANNNNANGGSTNNNAGGQNGGTGGRPGGTGGMSGNGNDIGTAGMFRLWGSTM
FT                   YGQASWLIILALFGIAACASRSTWKKRNEKAAMILYWALWLGTMVGFFSFASFFHRYYL
FT                   CILAPGIAGLAGIGLVQMFKAFRDRQGWKQWLLPASLAAMFVSETVYISGYPALRGWMI
FT                   PLMAVLTGAALIGLFLPRILPRLRRANLIRLIATGCMLAAMLTGPLYWCLTVVWYPPIN
FT                   STMPYAGPELATDTQTAGMTTNQENLTTADSGTKALETYLVAHYKAGSYLVVAARADDV
FT                   AAFIVDTGLPAVAYGGFLGSDNGITLSELKKLVKEGKVTYFLLSDSSGAGMSSSSEITS
FT                   YVKANATLVNASAYGSTSTSGSSSNGVSGASLYLFK"
FT   gene            420302..421246
FT                   /locus_tag="Ethha_0404"
FT   CDS_pept        420302..421246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0404"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cbi:CLJ_B1654 ABC-type MDR transport system,
FT                   ATPase component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25989"
FT                   /db_xref="GOA:E6U8J8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU25989.1"
FT                   /translation="MKMETILTVKNLSKRFKEKEVLKGLDFTVDAGEILCLLGPNGAGK
FT                   STTINILTGVLGHDGGEVLYHGQSIRGRLRAYRQRLGVVPQDIALYEELTAERNLRFFA
FT                   GLYGLRGRELDRATDEALALAGLEDRRRDVIKTFSGGMKRRLNIACAIAHRPELVIMDE
FT                   PTVGIDPQSRNHILESIRTLRGQGMTVLYTTHYMEEVEAISSRIIIMDHGQIIAEGTKE
FT                   SLKQAYEDQRRYTLTVEGAEGLQASDLYRVEGIVSAQIGEHAVEITSLRGVANLDRIIA
FT                   LLYEKGVEIQNITSEEASLETVFLKLTGRTLRD"
FT   gene            421264..422007
FT                   /locus_tag="Ethha_0405"
FT   CDS_pept        421264..422007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0405"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: cbb:CLD_3005 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25990"
FT                   /db_xref="GOA:E6U8J9"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J9"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADU25990.1"
FT                   /translation="MRRFGIIFRIDLFNVFKNPVLVGYNTLFTVALVFTLGYLNGGAYA
FT                   DGWTAYRYYLVSFLVYSVLTGSMTASNAFMERDIKKPNLRILFSPAGSFPIYFSKILAS
FT                   ALFDYICHGTLAVALGALFHFPNFGQFWLLLLVLIPLELASAALGTFFCCVLHSEESTS
FT                   SLLSTVIGVLAFLGGTFFSLDSMGGVVALISRCSPVKWINDALFALLIDGNAAVAAPLF
FT                   FGALAAAAALTAGCVRFFHTEDYVC"
FT   gene            422001..422960
FT                   /locus_tag="Ethha_0406"
FT   CDS_pept        422001..422960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbb:CLD_3004 ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25991"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K0"
FT                   /inference="similar to AA sequence:KEGG:CLD_3004"
FT                   /protein_id="ADU25991.1"
FT                   /translation="MLTILRNDYSRMRKRLAGILIFTVVTLVAMGLAVYLAHQPVKGHI
FT                   ALVTANAAAPVHSARLDVTVLRKAPPESALVRGQYDAFVFDEGGGRYRVQTLRNAQFKA
FT                   MVQALLTDPQAKVPSQSGERGVGENVIGFSMLFLLMSTITNLLMFGEDKEQGQLSRIEV
FT                   TPVSGVGYLAGHCVYALTMFLPPLVLLAGLQEAGVAIGFSLGMYALLFLALAVLGIPLA
FT                   LLLYTLLDKADNATMLGSSILVFTTVLAGGFYANSRKNAVLDTLVGALPQKQLLLFAAQ
FT                   AEKGVGVAHAGHLLYVFAWGVALFALSGFLLRRRRQRG"
FT   sig_peptide     422001..422114
FT                   /locus_tag="Ethha_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.406 at
FT                   residue 38"
FT   gene            423038..425695
FT                   /locus_tag="Ethha_0407"
FT   CDS_pept        423038..425695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0407"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="KEGG: cbf:CLI_1631 LuxR family transcriptional
FT                   regulator; PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25992"
FT                   /db_xref="GOA:E6U8K1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K1"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADU25992.1"
FT                   /translation="MRLPDTLGAALLTKLKMPAPRRGYIARRGLFEKLARWESFGVIYI
FT                   RGAAGMGKTTLVSSFLKEHTALHAAWLSLDAEDDDLFVFWHDFAAAMATLPGMDAKRLT
FT                   GLFDAGELSGAQADVIARRALEAADGMEPGLLVLDDLHLLRDEGLLHTLETFIAALPEQ
FT                   LHLCLLSREAPAVYLGGLAVEGRLLFIDGEALAISAEEGVRFLRDTLGMEEADERAARL
FT                   AAQAEGWIGGLQLLAAADGMGAASPRTGRALAGEYLTHEIFATLSGEEQRFLTVTAILP
FT                   YFDAVLCATLLGPGAYHEIIGRLVGKNLFLICVDEECGVYRYHSILGDYLKQQFAALPQ
FT                   DEQTVLHRRAAAAFLSRGERQAALPHLLAAGAYAEAGQQLALLSTRAETWHYLNRLPLE
FT                   VVMEDPNLAIQSVYYNLLVHPDMERARQVFRAFREDRAGEIFARTLGQAGIYVGETVDF
FT                   KNPPAPVSPEQIEQTGLGPLSQALAYVQGASLLLERDEYAECARFAARAYDIAGGRSPF
FT                   VDFYLFSSRAQLAEETGELNESLRMYGQMADAVARSPTTSLLGVYHAIGRTGVYLKRLE
FT                   KEPAAAALEEADRGLKAFPHFPFLMTYGYAYNRLEYDLIFGPVDAAMDGLENLLRWSTR
FT                   DFQSVLVCDRLLLYPLVQRCLPAVWEERFFAEYQADGGHIPFSARLVGARLLWRRGQRG
FT                   TALRQVEEALAFSRANHNRLALVGAGLLKAAMLLESGGEARTVRNLLREALHYAWENHI
FT                   LLPFYVERAALGDALHALPGAELASGERAFWQEVCALAPPAAPDGVETLSARECEVLRE
FT                   LAHGLTNAQIADRLCITPATVKTHLWKAGRVHAGAGRRGSAQAGSAAVNRRKHIRPRAA
FT                   MPHGAVCAYRVTGT"
FT   gene            complement(425682..426740)
FT                   /locus_tag="Ethha_0408"
FT   CDS_pept        complement(425682..426740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0408"
FT                   /product="lipase class 3"
FT                   /note="PFAM: lipase class 3; KEGG: cbe:Cbei_1776
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25993"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K2"
FT                   /inference="protein motif:PFAM:PF01764"
FT                   /protein_id="ADU25993.1"
FT                   /translation="MDGLQNDLTEQDFSFLAQLVYFDPLRADGTPWPSRGQAHVTCSVG
FT                   DLLASYRRLLGTPNDPLRPPKLTGVHAWVYDDQVHFLTDPNNDAYAGWIVTGICAHNTP
FT                   VESGLYGFTVHIDDHTSAVVFRGSENPKDHLNDWHASLDISNNLLIDQHREALAYIDER
FT                   ADLFGQPGHTLYFVGHSLGGHVAQICTFLSPEPVRANIRQCVTFNSPGFSLAFLEKYAE
FT                   TVAAEKRKILNYQNENDFVSSLLTSPVTPVILRSRYDQLNFFCNHAISSCRLDQNGRFI
FT                   PARVQKKSFVCGGVYNWSLGIQKWSHERQERNKWFWVSLFQGDPLYVKAYSSQLLLLFK
FT                   NGMRAITASMSL"
FT   gene            complement(427044..429272)
FT                   /locus_tag="Ethha_0409"
FT   CDS_pept        complement(427044..429272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0409"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: cce:Ccel_1711 transglutaminase domain protein;
FT                   PFAM: transglutaminase domain-containing protein; SMART:
FT                   transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25994"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K3"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADU25994.1"
FT                   /translation="MKQATADRLIRMALLLGSAAALTHELFKAFLIPHTFTDSPWPLLG
FT                   LDTAVLLPLILCVRGRKSLYFSVFAWVSAGIALILYALFHLTDILASPQTLLYPWLFYL
FT                   VAMPVAILGFYAVRTRTGTLFWAAGGLIGITYLAAGGYDVDIRVTALFCLFCAALFLDM
FT                   QLPPSRHRLRRLGALNGFLGAAFLVTLAILAGLEQLPAVQDMQRLQIKGLADLFKGGLS
FT                   GFADNITTKQLGGPLYPDDTQIFSVTGIAPFYLKGRAYTTYRDGTWTVDKTQTASDFSS
FT                   FETLHPMMGSAFLSGSARFRPYQPLPERASASLRTLTVHLLRGGYRTLFLPLGFTQWQS
FT                   GSIRFPLFQNGSYEAASILRTGNSYTLEYPYIDMQSTAFASLEADYDQRTEPFLETVRT
FT                   GTPDSYTALMQESTAAYAADTALPASVTKRTLALAKALTQNSRNALEASDAIRAWLAKN
FT                   CRYRTDVPAAPAGSEFVDDFLFRSHEGYCVHFATAMTVLLRAAGYPARYVEGYVSPPGE
FT                   DGDGTHIVTNNQSHAWVEVYTQLLGYVTEDPTPGIGPSASGVGASSVQSAQSSKAASSI
FT                   PSTLSVPSSAASSAPAAPASSGQAADGKTTGGPVSPWVIVLTAIGLCALALAGRMAGRA
FT                   VWFARLRRKPRNTQVISLYLYCLRFFARLGRPCGPSETPQRYAREVERILGITGFAGTT
FT                   ELYLKARYSGETTDAESCRQAEAFCRGLPRKAAAAKGRIAALFAMLTA"
FT   gene            complement(429269..430453)
FT                   /locus_tag="Ethha_0410"
FT   CDS_pept        complement(429269..430453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0410"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   tjr:TherJR_0784 protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25995"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K4"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ADU25995.1"
FT                   /translation="MRLPYKLLLLFVLVAIALLPALVMRPIGGFFPAALLVSLLLCSAV
FT                   CALAGALRMKCSVCLRGRALVRGAAAEGVFTLKNRSLLPLPCVTVTAEVIQPGCEAQRF
FT                   TQTLTFAPGQTRQFTLPVACAHVGLCRIRLERFTVRDISGLFNFSMHGHATLETVVAPR
FT                   LDTAGAPAYHRQEGDSAVSQSGIPSGNYDGVRQYAAGDPLHGIHWKLTAHTGAFMSRMY
FT                   ERSTRRGMVIAADLAPQAGTPAEFDRLAEEPLRAALTALESGLEVTVLYTGSDGPRLCH
FT                   PAGRQDLEALGRHWAAAADHPSADDLPTALSGTQADGILLCTARLTDALIRKLLAWRQA
FT                   GAQPALLWVTDTAPFDTDARLTPLVQAGMNCRVLSMDTVQDGAPRAADTKGEPG"
FT   sig_peptide     complement(430382..430453)
FT                   /locus_tag="Ethha_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.631) with cleavage site probability 0.394 at
FT                   residue 24"
FT   gene            complement(430466..431413)
FT                   /locus_tag="Ethha_0411"
FT   CDS_pept        complement(430466..431413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0411"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; KEGG: rrs:RoseRS_0692 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25996"
FT                   /db_xref="GOA:E6U8K5"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K5"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADU25996.1"
FT                   /translation="MEDAQRILERIIENVENVIVGKRDAIELVVTALACGGHVLLEDIP
FT                   GVGKTRLASALAASVDCDFRRIQFTPDILPSDITGFSVFNPKDGVFTFRPGPVISHFVL
FT                   ADEINRASPKTQAGLLEIMEENQVTVDSQTYPLPQPFMVLATQNPIEFVGTYPLPEAQI
FT                   DRFLIRISLGYPAFEEEVRILLDGKGQKTRLTPVATAADLLRIRKTAEQVRVDESVARY
FT                   IVAVITGTRRHPGVELGVSPRGSLALLQLARAYALLRGRGYVVPDDVRTLAPHALCHRI
FT                   RLNGAARLDGRTTQDVLDEVFAGIPAPSLVQSRP"
FT   gene            complement(431601..432902)
FT                   /locus_tag="Ethha_0412"
FT   CDS_pept        complement(431601..432902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0412"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: acl:ACL_1068 ABC-type transport system,
FT                   substrate-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25997"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K6"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADU25997.1"
FT                   /translation="MKKALAAVLAVCLLLLATACTKNTEETSRPVQKTLRITYDGSLYG
FT                   TNWMDSVSKAFSKAHPDIALKITADNHLTQHYTALLQSGPNTPDLIFLARTNWQQDASA
FT                   GLLANLNTLYTGSGGGTPLLTELRAGVAASCALNGQYYIYPWGAQTGGLLYHANLFAQN
FT                   GWQVPQTMSAFATLCTQIRQTGLSPFAWSADHADDWTDNVATWWTQYEGQASIQTYLSM
FT                   QSPDVYGQQGRLVGLQAFEQLVPQNSYGTPLTMNQDAAVKAFSAGHAAMMPIGYLSAFA
FT                   ADTSQENTDIRVMPLPAPDGSKSAALLAAYIPGIAVVPAKAAAPSLAQTFLSDLTSDEE
FT                   LALFISATGTPTPFLLDKKQENALPRLLKSAADLWQGDTLYMLSTQPVYYQRLFDWPAQ
FT                   GSPVLQIFSGSRTADQAFAENLEAARACWTNAGS"
FT   sig_peptide     complement(432843..432902)
FT                   /locus_tag="Ethha_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.713 at
FT                   residue 20"
FT   gene            complement(433038..434417)
FT                   /locus_tag="Ethha_0413"
FT   CDS_pept        complement(433038..434417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0413"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: mla:Mlab_0177 hypothetical protein; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25998"
FT                   /db_xref="GOA:E6U8K7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU25998.1"
FT                   /translation="MDIKKQAMSLLVTEAVKYLEHEPEKHFDRLISIAKVLVKGRDPFY
FT                   QNIIKQFDDMWHDESSPWRGYLINYLTKLNPNQRKKFATNFLVNASIIGFTEQQKMAEK
FT                   LDCNIPWTILMDPTSACNLKCTGCWAAEYAKQNNLTFEELDNVIEQGKKLSIYFYVFSG
FT                   GEPLVRKKDILRLCEKHSDCFFAAFTNGTLIDEEFASEMERLGNFVPIISIEGFEEATD
FT                   MRRGKGVYQSVIRAMDILHARNLAFGMSVCYHSKNTDYVGSDEFVDFMIEKGVLFGWYF
FT                   TYMPVGADAHKELLATPEQRAHMYKRVNEIRATKPIFVLDFWNDGAYVDGCIAAGRRYF
FT                   HINSAGDAEPCAFIHYSNYNIREKSVMEILKSPLFMAYHKGQPFNKNMLRPCPLLDNPE
FT                   ALAGMVKATGAHSTEALSPEDVDVLTSKTKEQAELWAETADDLWKVDPKNKENVRDRVN
FT                   A"
FT   gene            complement(434470..435003)
FT                   /locus_tag="Ethha_0414"
FT   CDS_pept        complement(434470..435003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0414"
FT                   /product="ChrB domain-containing protein"
FT                   /note="KEGG: mca:MCA1926 ChrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25999"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K8"
FT                   /inference="similar to AA sequence:KEGG:MCA1926"
FT                   /protein_id="ADU25999.1"
FT                   /translation="MSDESGTADWAALVYKLPSHPSKYRVYVWRKLKQAGAICYQQGLA
FT                   VLPMNMWNNTYLQNLRAEIHLFGGDASVLRFNFIDRQDEEKLVGQFNDNVRLACQEISN
FT                   ALRDFLKEVEHPQPAGYIRKRQDAGFFEKARNHYEAFKRHGFFQAPLDQSLGRAVENLL
FT                   LKIENHMHGYHLAK"
FT   gene            complement(435289..437109)
FT                   /locus_tag="Ethha_0415"
FT   CDS_pept        complement(435289..437109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0415"
FT                   /product="GTP-binding protein TypA"
FT                   /note="KEGG: cce:Ccel_1471 GTP-binding protein TypA;
FT                   TIGRFAM: GTP-binding protein TypA; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor G
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26000"
FT                   /db_xref="GOA:E6U8K9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K9"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ADU26000.1"
FT                   /translation="MVRSDLRNIAIIAHVDHGKTTLVDEMLKQGGVFRENQTVQDRVMD
FT                   SNDLERERGITILAKNTSANYKGIKINIVDTPGHADFGGEVERILKMVNGVLLLVDAAE
FT                   GPMPQTRFVLQKALSLGHKVIVVVNKIDKPDARIPEVEDEVLELFMELNANDEQLESPF
FT                   IYCSGRQGIASLDRDTLGTDLTPLFEKIIEYMSAPEGDDTGSLQLLVSSIDYNEFVGRI
FT                   AIGRIDRGTLKQGQEVMVAHFHGDHDPYRAKVTNIYQFEGLKRTPVTEAKVGDIVTFSG
FT                   IENAFIGDTICATDAVEPLPFVKISDPTIEMTFAVNDSPFAGKEGKFVTSRQLRARLMK
FT                   ELLKDVSLHVTESENADAFKVAGRGEMHLSILIETMRREGYEFQVSTPQVLFKEEEGQK
FT                   LEPIEELVIDVPENALGSVMEKMGVRKGELQHMEPMGNRMRVEFLIPSRGLFGYRSEFL
FT                   TDTKGEGILNSVFYGYEPYKGEIPGRNYGSLVAFETGESITYGLYNAQERGTLFIGPAT
FT                   PVYAGMVVGYSPKSEDLVVNVCKRKHVSNMRSSGSDEALRLVPPHTMSLEESLEFLAPD
FT                   ELLEVTPKSIRIRKAILDHNQRARAGSKKS"
FT   gene            437553..438086
FT                   /locus_tag="Ethha_0416"
FT   CDS_pept        437553..438086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0416"
FT                   /product="regulatory protein MarR"
FT                   /note="KEGG: cac:CA_C3283 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26001"
FT                   /db_xref="GOA:E6U8L0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8L0"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU26001.1"
FT                   /translation="MREKDASDELVHRYFLTILQFHRVFMNENKQPPDKFPESTYTGTL
FT                   RKHAHTIKHSEKMLMFALHAVSREFPNDVNVSDLSRLLHVKPPSITAPLNHLEKMGLVR
FT                   RVQDEHDRRIVRVHITDEGQDFLRQAKDVFYERTRGLIDYLGEEKAKQYVSLMEDVLAY
FT                   IKTKHEQHDQRDQI"
FT   gene            438098..439825
FT                   /locus_tag="Ethha_0417"
FT   CDS_pept        438098..439825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0417"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cbe:Cbei_2093 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26002"
FT                   /db_xref="GOA:E6U8L1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8L1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU26002.1"
FT                   /translation="MLKIYKNLKGYIPHICVILVLIFAQVLTDLYLPTLMSDIVNTGIM
FT                   KEDVNYILHMGGLMIGVAGIGIVCAVVAVMIGSRVAIGLGGILRSKIFRHVEKFSLHEF
FT                   DKFGSSTLITRTTNDIIQIQTVTILIINMMLRAPLTAIGGIILAYREDKSLTIIFAIAL
FT                   PVLIAVIAIIMSRAMPLFKQVQKKLDKINLVLRENLTGIRVIRAFNRIGHENARFDEAN
FT                   QDLTRTYITVNRIMAFLMPVLMLALNVMQLSIIWFGSVRVDAGSMNIGALAAFIQYAAL
FT                   ILINFIMLAMMFIFIPRAQAASERISEVLETAPEILDPAEPKHADGEQGYVEFRNVCFS
FT                   YQGAERPALSGVSFSAKPGETTAIIGGTGSGKSTLVNLIPRFYDVDEGQVLVDGVDVRE
FT                   QSQKELRAKIGFVPQKAILFTGTITANLRYGKKDATDEEITHASEIAQASGFVGEMREG
FT                   YDTVLAEGGLNLSGGQKQRLSIARALVRRPEIYVFDDSFSALDFKTDARLRAALKKETG
FT                   DATVLIVAQRVGTVMGADRIIVLDDGKVAGIGTHEEMMKTCEVYREIVSSQLSEEELA"
FT   gene            439822..442116
FT                   /locus_tag="Ethha_0418"
FT   CDS_pept        439822..442116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0418"
FT                   /product="ABC transporter transmembrane region"
FT                   /note="KEGG: cac:CA_C3281 ABC-type multidrug/protein/lipid
FT                   transport system, ATPase component; PFAM: ABC transporter
FT                   transmembrane region; ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26003"
FT                   /db_xref="GOA:E6U8L2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8L2"
FT                   /inference="protein motif:PFAM:PF00664"
FT                   /protein_id="ADU26003.1"
FT                   /translation="MSEQKKTAGPMNHGGPGGSLGRPVEKAKDFGGTLKRLLGYLRPQR
FT                   MRLTVVVIFAVLGTVFMVVGPKISGQAINKLTDGFIAKSAVNNVSKIQTQAAPNIKKLL
FT                   DGMSAAKAQAKAAADAKVEAQFGQAGADVTNSAALAASARATAEAQAMQTAQAAVLKQA
FT                   NLTQAQFDAMQAFYNLPNVKTIKSANEKADTVQKIFDLSKQMPQSSGNKASIKESDLKT
FT                   ALADIRETGGAVPFGDIFRIIVLMLAVYALSAIFTFVMQYLMSTVAQKTVYDMRRDVDL
FT                   KLAKLPLKYFDGHSNGEILSRVTNDVDTISTTLQQSLTQLIQSVLQLVGFIIMMLTISP
FT                   ALTGITLATLPLYIFATAMIAKQSQKHFARQQKYLGQLSGHTEEMFTGHKIVKAFGHED
FT                   EAIDIFEDSNEKLYAAGWKAQFLSGIMFPTMNFISNIGYVLVSVFGGLFVTKNWLNVGD
FT                   IVAFIQYSRQFTMPIIQTANITNIIQSTIACAERVFEVLDEDEETPEPANPPVLENPLG
FT                   NVVFEHVKFSYKDTEPLMEDMNLHVKKGDTIAIVGPTGAGKTTLVNLLMRFYEIKGGKI
FT                   TFDGVDTREMRRGDLRTLFGMVLQDTWLFTGTIEANIAYGREGATHEDVVRAAEAAHAD
FT                   HFIRSLPDGYNTVLNEEATNISQGQKQLLTIARAILADPAVLILDEATSSVDTRTEVLI
FT                   QHAMAKLMEGRTNFVIAHRLSTIRDAKMILVMNHGSVIEQGNHEELLAKGGFYADLYNA
FT                   QFSGASIDEAG"
FT   gene            complement(442207..444996)
FT                   /locus_tag="Ethha_0419"
FT   CDS_pept        complement(442207..444996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0419"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: cbe:Cbei_4823 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26004"
FT                   /db_xref="GOA:E6U8L3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8L3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADU26004.1"
FT                   /translation="MEPSTEAKIEKKNSLAYRINIACRLPVIVSSVILGAISIAIFIVS
FT                   LVNSSIVYNINMSELEILQQFSSDYLQTRVIVLRMAERTDAADITFDQQQYTLYRKDMD
FT                   TQLARLYKLNSVPEVRQDYTRLKGVMTEFDAITNPRLQMAQAKDIAGLNTSTAAALNVY
FT                   RTVDNAVSSAQRDTSQAASSRLQNNTIMMLIGIALMAICALGVIWVANRFSGRVASFIR
FT                   NELGKITQAARLLAAGNLELDIDTDDASELGVLARAFDDVRRHLIAMKNDVDHLMQGCN
FT                   KGNLAVQVDSSQHQGIYREIIDRMLDIFMIVNLSIESATQTLGSLANGEHLQPIATDDP
FT                   GIFGQMGASMETIRQVISSLHADVVQLAAAGAEGNLTARGDTSRYRGIYGEIVDGINLA
FT                   FQNIQEPMDVVIERLTTLADGGQIATDNPYQGYPAKLIESLGLLAVALETLQSETDKMA
FT                   AAGAVGDLETRGDTGSLNGRYAVILDGFNQTLDNILLPLNEVRTILTNVQKHDFVAKAR
FT                   EDYQGEMAKLATDVNNVREHFLLIQTIFLKLAKGDTSSLELVRKVGRYCEADQLTPAVT
FT                   EGLQSIRDLITEATGMAQAAQEGNLSARVDEDRFQGGYRNIISGMNRTMQAFAEPISEL
FT                   QSGLNEVAAGNLNVQITSSYSGAYSQMQESFNHAIISFNELIQSVQIAASEVSAGSRQV
FT                   SDASQTLSQSSTEQASAIEEVTASVAELSSQTRENAEKSTQANQLADETKTRADEGNES
FT                   MQDMLRAIEDIGKSAQNISRIIKTIDDIAFQTNILALNAAVEAARAGQYGKGFTVVADE
FT                   VRNLATKSANAAHETAELIETSIQKVHAGTEIAGQTAEKFSVITANAAQVADLLHVIGE
FT                   ASNEQANAITQVDLSVQQISMSVQNNSATAEETAASSQELSGQAQMLLDAVSRFTLRQ"
FT   gene            complement(445166..445462)
FT                   /locus_tag="Ethha_0420"
FT   CDS_pept        complement(445166..445462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0420"
FT                   /product="Stress responsive alpha-beta barrel
FT                   domain-containing protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel
FT                   domain-containing protein; KEGG: cph:Cpha266_1419 stress
FT                   responsive alpha-beta barrel domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26005"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8L4"
FT                   /inference="protein motif:PFAM:PF07876"
FT                   /protein_id="ADU26005.1"
FT                   /translation="MVKHIVMWKLKEFAAGADKKANAIQMKKRLEALQGVVPGAYKMEV
FT                   GINYNPGGYDVVLYSEFNDHDALEGYQVHPEHIRVQEFIREVTMTRVVADYMV"
FT   gene            complement(445515..447035)
FT                   /locus_tag="Ethha_0421"
FT   CDS_pept        complement(445515..447035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0421"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: sti:Sthe_2726 Mg chelatase,
FT                   subunit ChlI; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26006"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8L5"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ADU26006.1"
FT                   /translation="MFAQLKSLGLYGMDAFVVDVEADISQGLPAFDIVGLPDAAVREAR
FT                   ERVRSSMKNSGYSFPVSRITVNLAPADIKKEGPLYDLPVLLALLCATGQLSGDFSGCAF
FT                   AGELSLNGTVKPVNGVLPMAIKAREAGFRRFFVPKANAAEGAVVSGIEICPVEDLQSLV
FT                   CCLTGGAPIIPAVPPEADAQGEPAPDFADVCGQFEARRALEIAAAGGHNVLLVGPPGAG
FT                   KSMLARRLPSILPDMTFGESIETTKIHSIAGTLDTPLIRTRPFRAPHHTISAAGLAGGG
FT                   RIPKPGELSLSHNGVLFLDELPEFSRDALEVLRQPLEEHTVTISRVSGTLTYPCSVMLV
FT                   CAMNPCPCGYFGHPSRPCTCSRGAVSRYLARISGPLLDRLDLHVEVPPVSFEKLHGEAG
FT                   EASSAIRARVNRARALQQKRYAGSGIACNARLTPAMLREHCALDTAAASLLRAAYENMG
FT                   LSARAYDRILKVARTIADLEGSAAIAPAHIAEAVQYRSLDRKYWNNGA"
FT   gene            complement(447266..447940)
FT                   /locus_tag="Ethha_0422"
FT   CDS_pept        complement(447266..447940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0422"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: gym:GYMC10_4414 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1; TIGRFAM: HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26007"
FT                   /db_xref="GOA:E6U8L6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8L6"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADU26007.1"
FT                   /translation="MPKPKAVIFDLDDTLIERRAMMEVFAPLFLHRYFPHAAGAEYDRI
FT                   YETFLRMDDGGNTARPGLFHLFHDALGITERPSDRELLDFWNEHFADHTVPVPGAEDCL
FT                   HALKADGCLLGMITNGNPVLQNHKIDHTGFRGLFDNILVSGTFGCDKPDPRIFRASLDA
FT                   LGITADEAIYIGDNLTNDIYGAHGAGMQAVWANYSGRVNTTEFRPDYEIHAVLELLTLN
FT                   LD"
FT   gene            448075..448728
FT                   /locus_tag="Ethha_0423"
FT   CDS_pept        448075..448728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0423"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: ctc:CTC00182 putative phosphatase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26008"
FT                   /db_xref="GOA:E6U8L7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8L7"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADU26008.1"
FT                   /translation="MDFEEFGGAIFDLDGTLLDSMGVWHAVDVAFLAKRGIPCPPDYAA
FT                   ALKPLNYTQAAVYTKDRFELPESEEAIIREWDDRVRAAYEAGLPMKPGAAVFLHWLKAQ
FT                   GVKIGLATASSQTLYEAGLKANGVYGLFDGFVTLDEENLRGKKFPDIYLRASERIGAGP
FT                   EGCVVFEDILDGIRGAKAGGMRAVGIYDACSEPEKAQIMAEADAYYMDFTEIER"
FT   gene            448746..449465
FT                   /locus_tag="Ethha_0424"
FT   CDS_pept        448746..449465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0424"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   cce:Ccel_2089 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26009"
FT                   /db_xref="GOA:E6U8L8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8L8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU26009.1"
FT                   /translation="MKTVLVTGASRGIGRAAAAAFAREGYRVCINYHRHRTEAEELAAR
FT                   LRAEGADTLVLGADVADAAAVREMVRQAGGVDVLVNNAGIAGQRLFTDVTEEEWQHTLA
FT                   VNLTGLFHCAQAVLPGMLRRKAGKIIALSSIWGITGGSCEVAYSAAKAGVIGLVKALAK
FT                   ELGPSNIQVNCVAPGVIDTDMNRALSAADRAALCEETPLMRIGTPEDVARSILFLAGPG
FT                   GDFITGQVLSPNGGFVI"
FT   gene            complement(449580..450251)
FT                   /locus_tag="Ethha_0425"
FT   CDS_pept        complement(449580..450251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0425"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   clj:CLJU_c25150 acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26010"
FT                   /db_xref="GOA:E6U8L9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8L9"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ADU26010.1"
FT                   /translation="MKKLLYISASPKPETESVSKQAARTFIQRLMAQETDYQLEELDLY
FT                   TSDIPMPGHQHFDRQSHLVAGPAYEALSPEDKAVIDRMNQLCTQFQQADTYVISAPMWG
FT                   MSFPSRLKQYFDCILLIDHLFSIDSTGFHGLLGDKERRMVYVQSSGGVYPKIFYGQMNY
FT                   AVKYCHDIFKHLGVATFDPILVQGAETPGVGRYKALEVAAQDMDDVLCRLAGPHPMPRW
FT                   A"
FT   gene            complement(450283..450978)
FT                   /locus_tag="Ethha_0426"
FT   CDS_pept        complement(450283..450978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0426"
FT                   /product="spore cortex-lytic enzyme"
FT                   /note="KEGG: ctc:CTC00350 spore-cortex-lytic enzyme
FT                   precursor; TIGRFAM: spore cortex-lytic enzyme; PFAM: cell
FT                   wall hydrolase SleB; Peptidoglycan-binding domain 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26011"
FT                   /db_xref="GOA:E6U8M0"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR014224"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M0"
FT                   /inference="protein motif:TFAM:TIGR02869"
FT                   /protein_id="ADU26011.1"
FT                   /translation="MNTKRKAIRFLQICILLVLGVLLVALARNRLNEQGIQTLSRLGST
FT                   GSEVRQIQTRLKSWGYYTGTVDGVYGAGTRAAVIAFQRKNGLTADGVAGSATLRAIGLP
FT                   AGSSGGYGQYSQSDYQLLARVISAESRGEPFVGQVAVGAVILNRVDSPLFPNTIAGVVY
FT                   QPGAFTCLTDGQFNQPVAESAFRAAQNAINGWDPSNGSLYYYNPDTAISQWIRSRPILL
FT                   RIGKHVFCK"
FT   sig_peptide     complement(450895..450978)
FT                   /locus_tag="Ethha_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.794 at
FT                   residue 28"
FT   gene            451603..453094
FT                   /locus_tag="Ethha_R0007"
FT   rRNA            451603..453094
FT                   /locus_tag="Ethha_R0007"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            453429..453504
FT                   /locus_tag="Ethha_R0008"
FT                   /note="tRNA-Ala1"
FT   tRNA            453429..453504
FT                   /locus_tag="Ethha_R0008"
FT                   /product="tRNA-Ala"
FT   gene            453660..453736
FT                   /locus_tag="Ethha_R0009"
FT                   /note="tRNA-Ile1"
FT   tRNA            453660..453736
FT                   /locus_tag="Ethha_R0009"
FT                   /product="tRNA-Ile"
FT   gene            454085..456914
FT                   /locus_tag="Ethha_R0010"
FT   rRNA            454085..456914
FT                   /locus_tag="Ethha_R0010"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            457155..457230
FT                   /locus_tag="Ethha_R0011"
FT                   /note="tRNA-Lys1"
FT   tRNA            457155..457230
FT                   /locus_tag="Ethha_R0011"
FT                   /product="tRNA-Lys"
FT   gene            457425..457499
FT                   /locus_tag="Ethha_R0012"
FT                   /note="tRNA-Glu1"
FT   tRNA            457425..457499
FT                   /locus_tag="Ethha_R0012"
FT                   /product="tRNA-Glu"
FT   gene            457686..457802
FT                   /locus_tag="Ethha_R0013"
FT   rRNA            457686..457802
FT                   /locus_tag="Ethha_R0013"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 92.92"
FT   gene            458357..460162
FT                   /locus_tag="Ethha_0427"
FT   CDS_pept        458357..460162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0427"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: eel:EUBELI_01245
FT                   glucosamine--fructose-6-phosphate aminotransferase
FT                   (isomerizing); TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26012"
FT                   /db_xref="GOA:E6U8M1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M1"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADU26012.1"
FT                   /translation="MCGIVGYIGEKDSADVLLDELGKLEYRGYDSAGIAVFEQGKIKIV
FT                   KAKGHLSELKKKLEKTGTPRGVCGIGHTRWATHGGPSDVNAHPHAAPNVTIVHNGIIEN
FT                   YLQLKEMLKGQGYDFVSDTDTEVMAKLIDYSYHGDPLKAIAAALGHARGSYALGILFAD
FT                   FPERIYAVRKDSPLIVGAGQGENFIASDIPAILKYTRHYYLLDENEIAEITMQGVTFHT
FT                   LSGETVEKEEQTAAFDIAAAEKGGFAHFMLKEIYEQPKSVRDTVNPRLLNGLPSLGCGD
FT                   LSGVERVHIIGCGTAMHAGLVGRAAIERFARVPAEVHVASEFRYGDPIIGKKDLAVIIS
FT                   QSGETADTLAALRLAKQKGVRTMAIVNVVGSSIAREADCVLYTWAGPEIAVASTKAYSV
FT                   QLAMLDLLALQLALDHGRISPHETRVLCADLQKLPDMVEEALKLDASCKEAAAAYAKQE
FT                   IAFFIGRGVDYPSSMEGALKLKEIAYVESEAYAAGELKHGTISLIVEHTPVIALATQSK
FT                   LFEKTVSNIKEVKARGAEVLLLCGKGAHVTEDVADHVLMLPDVPEWLMPSVLVVPLQLF
FT                   AYYMAAERGCDIDQPRNLAKSVTVE"
FT   gene            complement(460297..467922)
FT                   /locus_tag="Ethha_0428"
FT   CDS_pept        complement(460297..467922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0428"
FT                   /product="carbohydrate binding protein"
FT                   /note="PFAM: carbohydrate binding; KEGG: ade:Adeh_3184
FT                   glycosyltransferase 36"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26013"
FT                   /db_xref="GOA:E6U8M2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="InterPro:IPR021478"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M2"
FT                   /inference="protein motif:PFAM:PF06204"
FT                   /protein_id="ADU26013.1"
FT                   /translation="MEEATRQTMERAAKEAAEYAAPHEQAKASAVRKSLHADLARIRET
FT                   YKELVYGRAAVAGASEWLFDNYYIFEREGRLVIRALGETEALPCDEAGLPLIHRYAARF
FT                   CEAAGGRIDTASITAFLSALDQARELESVELAAFPLFLRAALIHRAAEACTRVSQTEAD
FT                   ETAVSDAVRTLHFLTTFDFSEIVEQLSRIERILSTDPAGVYPKMDERSRACYRTRLAEI
FT                   ARKRGMPEGQAAELAVSLAQNGASARTRHVGYYILEQELDRPRRHRRGKAYLLTLWLAP
FT                   LALGLALGLLLGAPWAALPLYLPLWETLRPLLDYVFMKGVPVTQMPRFELDGVIPEGAD
FT                   TLAVISTLLSSTQKVGAFAQKLEQFYMANGRGSIQFGILADLREARLPERPEDKAVVTA
FT                   AVRAVAKLNRKYGPHFCLFVRARRFCETQGDFAGWERKRGAILELVRFIKGEKTSIITA
FT                   EGDLAHVRQVKYLITLDADTGLIMDSAADMVAAAMHPLNAPEVDTARGVVTRGYGILAP
FT                   RIGVDLESAGNTAFSRVMAGCGGVTAYDNAAGDIYQDLFGEGIFAGKGLIHVDAFYQLA
FT                   GGALPENRILSHDILEGCFLRAGFLSDVELTDGFPARPDAWFSRLHRWVRGDWQNIAFL
FT                   GRRIPAADGGRRDSPLDGLSRFKLWDNLRRSLTPVLAFVCLISAAFSPLPLALFLVAAA
FT                   VLSVAGAGLWNALLAVLAGGPSMLSRKYHCKVMPQAVNALAQGALGYLFLPVHAWTALD
FT                   ALCRALWRQHTGKDLLAWTTSAESETRARGGDGLRRFWPAMTAGLLFLFAALSPAAQIA
FT                   GAFFIAAPLIAWFSGRPARPADDSLRPADKEILRSYTAAMWRYYEDFAGEDDHFLPPDN
FT                   VQEAPVHAVAHRTSPTNIGLALLATLAARDFGLIDGETLFRRVDSTVSTMERLPKWHGH
FT                   LYNWYDTRTLAPLHPAYVSTVDSGNLLCCLTALYEGLRDYAAEAPFAPLRVRIRQLMDN
FT                   TDMAVLYNKRRKLFHIGYDIEKKERSNIYYDLLMSEARLASYYAVARRIVPKRHWGTLG
FT                   RTLTRQNGYTGPVSWTGTMFEYLMPHLLLPVYEDSLSAETLRFVLYCQKRRVRSHGVPW
FT                   GISESGFYAFDAALNYQYEAHGVQKLALKRGMDNDLVVSPYSTFLALPFDTANSLRNLE
FT                   RLEKLGLYGRCGFFEAVDFTAARTGGRGAIVKSYMAHHVGMSIVACANALFGGVMQERF
FT                   LRNSSMRAAQDLLQEKIPSGAVVFHDVPRREIPDKPGRGQFVREEFEQVSPATPRAHTI
FT                   ANGEYTLVLTDCGVSFSLFRGIDLTKRSDDLLRRPAGVFALARVGKKTVCATAAPFYMR
FT                   DRAVKHTAAFLPDGALYKAETGSWGLSMRVCLHGQAPCEARALELSNTGSRAVSADLLV
FT                   YLEPLLAKTADEAAHPAFSRLFLRAAYREDTHVLLFARRPRGTELPAFLAVGFAELDTP
FT                   FTFELDRTALLTRPDGIASLAGAFDAPFSRRTGAVPDAAAALRLRLNAPAHGKKSVTLL
FT                   LAAANTDEEAEARLIEARREGFHAILRDAAGKNGSGIESRLAALILPQILFLAEDGDSE
FT                   RAEAKARNRMGQPGLWSLGISGDLPLILFPFHGASEQLDAYVRTHRALRLQGITCDLAI
FT                   TYREGGDYARPQADGIKAVLKTCGSDYLIGARGGVHLVNLSHHPEETGTLLRAVACHIA
FT                   RPSARPAFTPYAAAPLRAPKPSGGDAPAFPFYAGGFVGSDVLIPHGQETPPAPWCHILA
FT                   NQTFGTLVSDRALGCTWAVNAHENKLTPWLNDPVSDNRGELLLLRLGRHIYDLCANARV
FT                   TFTRNEARYDCEVEELSISLQVHIPGNLMAKTLTVELANAGNRPVPYEIAYYTEPVCGA
FT                   HLGTRRCLTVQQQNDAVLLCNPWATVSGVGVLAAQGKSALVTGRAAFLAGDWSGAGAHA
FT                   PGSCAALVQHGTLEPGKRKALAFTLGWGAREQAALDIARMALQLTTPESNDMGGAETPA
FT                   PEHHVPAAVFAEMEAAAPLAPAVLTGTAATDTDMATADPPLTPPASQAPAYRGQPPYTD
FT                   DEIEVETPDEPLNRLMSVLRRQFLSARILGRTGFYQCGGAWGFRDQLQDCGAALLLDPR
FT                   LVKAHIFRCAAHQFREGDVMHWWHQLPPCDGGARGVRTRISDDLLWLPLTVCDYLEKTG
FT                   DSRVLATVIHYLDGPLLEQTESDRYFAPGRSDEQENVYGHCVRAIERASAFGAHGLPLF
FT                   GAGDWNDGMNLVGAGGKGESVWLALFLAHVLDRFAPICRGMHDDARAETYTARAQALRE
FT                   AVDTHCWDGAWYLRGFYDDGAPLGGKTCDECKIDILPQAFAAIADMPDAGRRRQALDSM
FT                   LEHLADGRLKLVKLFTPPFDHGMHNPGYIRSYPPGIRENGGQYTHGAVWAALGLLSDGR
FT                   ADDAWRILQWLNPVGRALDAGQARIYRLEPYAMAGDISSNLAIEGRGGWSLYTGAAGWY
FT                   YRVVLEHLLGLHIRAKELTISPSLPSDWNGFSAHLRLRGSDISLRVKKGGAPGLTVNGD
FT                   KVKAIPLDGRTHTVRLGI"
FT   gene            468122..468412
FT                   /locus_tag="Ethha_0429"
FT   CDS_pept        468122..468412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0429"
FT                   /product="TrpR like protein, YerC/YecD"
FT                   /note="KEGG: cce:Ccel_1455 TrpR like protein, YerC/YecD;
FT                   TIGRFAM: TrpR like protein, YerC/YecD; PFAM: Trp repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26014"
FT                   /db_xref="GOA:E6U8M3"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M3"
FT                   /inference="protein motif:TFAM:TIGR02531"
FT                   /protein_id="ADU26014.1"
FT                   /translation="MNSKIQDDHLDYLFKAILSLKNIEECYNFFEDLCTVAEIKAMAQR
FT                   LHVAKMLRDHHIYSDIVATTGASTATISRVNRCLHYGSEGYTTVLERLESE"
FT   gene            468409..469155
FT                   /locus_tag="Ethha_0430"
FT   CDS_pept        468409..469155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0430"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: cth:Cthe_1855
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26015"
FT                   /db_xref="GOA:E6U8M4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADU26015.1"
FT                   /translation="MSAYDVLGRYYDLLMQDMDYEARADYLLSVLERHGEKPGTVLDLA
FT                   CGTGSLSVELARHGREVVGVDASEQMLAQAAEKAAAFPQGQMLFLLQKMGEIDLYGTVS
FT                   AAVCTLDGINHLLTEHDVRRAFERVALFLEPGGLFVFDVNTPYKFRHVLDGNAFVYDYD
FT                   EIYCVWQNAFDGESGICEFLLTFFEQEKGRYRRQDEAFAERAYGDAELRGWLRDAGLAP
FT                   LARYADLSFDAPGETEERVVYVARKE"
FT   gene            469161..470039
FT                   /locus_tag="Ethha_0431"
FT   CDS_pept        469161..470039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0431"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: cpy:Cphy_3417 HSP33
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26016"
FT                   /db_xref="GOA:E6U8M5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M5"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ADU26016.1"
FT                   /translation="MGRLIRAITGDGTIVAYALDATDMVRQAETIHKTSAVVTAALGRL
FT                   LTAASMMGVMLKGKDDSITLRVNGDGPAGMLIAVADSQGNVKGYVENPVVELPLNAEGK
FT                   LDVGGAVGRRGTLQVLKDLNLKEPYVGHTSIVSGEIAEDITQYLATSEQVPSVCALGVL
FT                   VDTDLSVRVAGGYIIQLLPFADEAAVGRLEQNLKRVPAVTAAMDAGQTPEDLVRQVLDG
FT                   FELEILDECNADYVCECSRERVENALRSMGATELHAMIEEQGGAEVLCHFCGKTYRFGA
FT                   EELENLIPPAK"
FT   gene            470244..471539
FT                   /locus_tag="Ethha_0432"
FT   CDS_pept        470244..471539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0432"
FT                   /product="Cl-channel voltage-gated family protein"
FT                   /note="PFAM: Cl- channel voltage-gated family protein;
FT                   KEGG: efa:EF2463 voltage-gated chloride channel family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26017"
FT                   /db_xref="GOA:E6U8M6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M6"
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /protein_id="ADU26017.1"
FT                   /translation="MVSWRNRILLLLLTAATGVAMGSVSALFLWLLALVTGMRERQPLW
FT                   IALLPVVGVFTVFLYTRFGKNAQRGNNLIIDSVNENEQVPLRMGIFTFICTVLTQLVGG
FT                   SVGREGTAVQVGGTIANVLGRAFHLHHPYHRILVMAGISAGFGSVFGMPLAGAVFGMEM
FT                   CFVGHLGYEALLPCFVASFTADSVTRALGITHETYAITSVPAVGWYSLLVVVIAAMIFG
FT                   VAGRLFAVAIRALKLFYARRVSHPIPRVLLGSAVLLVAMLALRAVPYAGLSTWMIGAGF
FT                   AGKAQWYDGPLKLLMTVLSLGAGFQGGEVTPLFDIGAGLGGWLGLVARLSPSLLAALGM
FT                   ISVFGCAANTPLTTLIMGFELFGNQSLPFVVIAVFVSYYVSGRSGIYGAQRVTAGRPFY
FT                   RPAHPGETLDAAGNRSLTGYLVTHIMARFKKR"
FT   sig_peptide     470244..470324
FT                   /locus_tag="Ethha_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.488 at
FT                   residue 27"
FT   gene            complement(471784..472464)
FT                   /locus_tag="Ethha_0433"
FT   CDS_pept        complement(471784..472464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0433"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cce:Ccel_0808
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26018"
FT                   /db_xref="GOA:E6U8M7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014578"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M7"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU26018.1"
FT                   /translation="MSLYAIADLHLSLGTKKPMDIFEGWQDYVERLEANWRARIRPEDT
FT                   VVVPGDISWAMSLEETKSDFAFLESLPGRKVLMKGNHDYWWATMAKMRAFLAQNGFASL
FT                   SFVHNTAYPVDARCVCGTRGWFYDSEGEKKVLLREAGRLHTSICEAEKQGLEPVVFLHY
FT                   PPIYKDFTCAEITDVLAAHGITRCYYGHLHGRARRYALEGLHGGIRYTLISADQLKFDP
FT                   LLIE"
FT   gene            472616..472783
FT                   /locus_tag="Ethha_0434"
FT   CDS_pept        472616..472783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0434"
FT                   /product="protein of unknown function DUF1540"
FT                   /note="PFAM: protein of unknown function DUF1540; KEGG:
FT                   cbt:CLH_2775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26019"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M8"
FT                   /inference="protein motif:PFAM:PF07561"
FT                   /protein_id="ADU26019.1"
FT                   /translation="MEQRKIIPGIHCDVSNCVYNDKRSNCYANEIEVGPHQAQKKDDTI
FT                   CATFRQGEHQ"
FT   gene            complement(472878..474380)
FT                   /locus_tag="Ethha_0435"
FT   CDS_pept        complement(472878..474380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0435"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="TIGRFAM: threonine synthase; KEGG: cth:Cthe_1381
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26020"
FT                   /db_xref="GOA:E6U8M9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M9"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADU26020.1"
FT                   /translation="MMNYKSTRNNDVTVTASVAISRGISEDGGLFVPESMPWLSYTDLK
FT                   ILTDSDYVARANDILSRFLGDFTPGEVLNCVSQAYTREKFETESIAPLYELEPGVYLLE
FT                   LWHGPTCAFKDMALQLLPHLLSVSVEKAEPGKTVVILVATSGDTGKAALEGFRDVPGTR
FT                   ILVFYPEQGVSPLQKLQMATQEGENVYVSAIRGNFDDAQAGVKAVFTDTAVKQKLAEHN
FT                   MVFSSANSINWGRLVPQIVYYISSYCDLIKNNRISAGEHINIVVPTGNFGNILAAYYAK
FT                   KMGIPINKLICASNANNVLTEFLQTGVYDRNRPFYTTISPSMDILISSNLERLLYDLSA
FT                   CDDKQVRGYMDSLAKTGRYEVDEAIKKSLQEHFWASYCDDDGTRSTIRETYAKNACVTD
FT                   PHTAVALNVYRQYREKTGDEAKTIIASTASAYKFAGDVVGAIRSEQTANADQRTLVGEL
FT                   SKLSLSKPPKQISSLFEKPVRFEGVCDKEGMQQTIFTVLGID"
FT   gene            complement(474533..474910)
FT                   /locus_tag="Ethha_0436"
FT   CDS_pept        complement(474533..474910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0436"
FT                   /product="Uncharacterized protein family UPF0102"
FT                   /note="PFAM: Uncharacterised protein family UPF0102; KEGG:
FT                   sth:STH1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26021"
FT                   /db_xref="GOA:E6U8N0"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8N0"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ADU26021.1"
FT                   /translation="MQARDIGALGERAAAVWLREHGYTIVGANVRTRFGEIDLIAEDGT
FT                   CLAFVEVKTRAPNARFLPREAVDARKQARIVRTALLYLSTHTTPLQPRFDVMEILPGAG
FT                   GDFARCTIRHIPNAFTAQSPF"
FT   gene            complement(474897..475520)
FT                   /locus_tag="Ethha_0437"
FT   CDS_pept        complement(474897..475520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0437"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="KEGG: alv:Alvin_2058 ribonuclease H; PFAM:
FT                   ribonuclease HII/HIII"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26022"
FT                   /db_xref="GOA:E6U8N1"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8N1"
FT                   /inference="protein motif:PRIAM:3.1.26.4"
FT                   /protein_id="ADU26022.1"
FT                   /translation="MDWLTYEHALYAQGFGTVCGVDEAGRGPLAGPVFAAAVILPRGVM
FT                   IEGVNDSKKLSEKRREILFDRIRDQALACAVASADEREIAEYNILGASLLAMRRAVSSL
FT                   QIPAQAALVDGNRDPLLTIPSTCVVRGDARCACIAAASILAKVSRDRYMLELDAKYPQY
FT                   GFAKHKGYPTRAHYEAILRYGPCPAHRLYFLRNLEEKRKQYAGA"
FT   gene            complement(475523..476383)
FT                   /locus_tag="Ethha_0438"
FT   CDS_pept        complement(475523..476383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0438"
FT                   /product="ribosome biogenesis GTP-binding protein YlqF"
FT                   /note="KEGG: cth:Cthe_0763 GTP-binding protein YlqF;
FT                   TIGRFAM: ribosome biogenesis GTP-binding protein YlqF;
FT                   PFAM: GTP-binding protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26023"
FT                   /db_xref="GOA:E6U8N2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8N2"
FT                   /inference="protein motif:TFAM:TIGR03596"
FT                   /protein_id="ADU26023.1"
FT                   /translation="MADMQTVQWFPGHMAKTRRMIAECLPLVDCVAELADARIPQSSRN
FT                   PELDALCAGKPRILLLTKADLADAAATAGWVAHYQAQSLHTLAVDCRSGTGLNRFLPLL
FT                   KDVLRDKITRNAQKEQNRPLRVLVAGIPNVGKSTFINHMAGGRRAKTENRPGVTRGRQW
FT                   VTLRGGVELLDTPGVLWPKFEDQSVGEKLAFIGSVKDTVLDTEELAARLLELLAPHYAD
FT                   ALTARFKCKGELPREGGALLEAVARGRGFLVSGGEADTLRAAGTVLEEYRAGKLGQITL
FT                   EWAED"
FT   gene            complement(476427..477011)
FT                   /locus_tag="Ethha_0439"
FT   CDS_pept        complement(476427..477011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0439"
FT                   /product="signal peptidase I"
FT                   /note="KEGG: afn:Acfer_0473 signal peptidase I; TIGRFAM:
FT                   signal peptidase I; PFAM: Peptidase S24/S26A/S26B,
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26024"
FT                   /db_xref="GOA:E6U8N3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8N3"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ADU26024.1"
FT                   /translation="MEQPISGAAGQPPKNPLLRECYDWMGTLTCTVFVIIFIFTFLLRT
FT                   VSVDGPSMMNTLQNGDHLILAEAGYTPKAGDIVVLYTTAEKQPIIKRVIATAGQTLDID
FT                   YQKHTVKVDGHVLNEPYIREPTAFEGVVPVSMPVTVPAGHIFVMGDNRNNSLDSRSGIV
FT                   GMVDVHDVLGHALIRLFPNPTILQTAPIAVH"
FT   gene            complement(477036..477599)
FT                   /locus_tag="Ethha_0440"
FT   CDS_pept        complement(477036..477599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0440"
FT                   /product="signal peptidase I"
FT                   /note="KEGG: cbi:CLJ_B2668 signal peptidase I; TIGRFAM:
FT                   signal peptidase I; PFAM: Peptidase S24/S26A/S26B,
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26025"
FT                   /db_xref="GOA:E6U8N4"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8N4"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ADU26025.1"
FT                   /translation="MTESTAMENSNKQPSTMQTVYEYVSSTVFALAVVLLVFTFVLRTA
FT                   TVVGVSMMNTLHDGDRLILSTTHDTPRQGDIVVLSTKAVREAIVKRVIATAGQTVNIDF
FT                   QTHTVYVNGKALSEPYIREPTSERGDVTFPVTVPPNHVFVMGDNRNDSYDSRFSAVGMI
FT                   DDRDIIGHAVFRLFPLFKIGPLAR"
FT   gene            complement(477694..478038)
FT                   /locus_tag="Ethha_0441"
FT   CDS_pept        complement(477694..478038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0441"
FT                   /product="ribosomal protein L19"
FT                   /note="KEGG: cth:Cthe_0765 50S ribosomal protein L19;
FT                   TIGRFAM: ribosomal protein L19; PFAM: ribosomal protein
FT                   L19"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26026"
FT                   /db_xref="GOA:E6U8N5"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8N5"
FT                   /inference="protein motif:TFAM:TIGR01024"
FT                   /protein_id="ADU26026.1"
FT                   /translation="MSSLQELVKDQLKTEIPELNVGDTVRVSVRIKEGDRQRIQMFEGT
FT                   IIARRGGGISESFTVRRISYGVGVERVFPVHSPNVEKVEIVRRGRVRRSRLYYLRGRVG
FT                   KAAKVKEQLR"
FT   gene            478297..479058
FT                   /locus_tag="Ethha_0442"
FT   CDS_pept        478297..479058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0442"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="KEGG: btk:BT9727_3219 hypothetical protein; PFAM:
FT                   glycoside hydrolase family 25; SMART: Glycoside hydrolase,
FT                   family 25 subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26027"
FT                   /db_xref="GOA:E6U8N6"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR008270"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8N6"
FT                   /inference="protein motif:PFAM:PF01183"
FT                   /protein_id="ADU26027.1"
FT                   /translation="MRRLARALREHRWIVADAALLLGAALLLFVLYQTGIWEPNRPASS
FT                   SYTVQGVDVSAHQGTVDFARLSAQRIRFAFVKATEGAGFRDSRFAQNWDNARKAELKTG
FT                   AYHFFHFDVDAAAQAVNFIRTVPVEADALPPVVDLEFYGRYKQNHPARAQVRRMLDTLL
FT                   PALEARYGKPPILYCTGDTCGAYLKGAYARNPVWIRSVGLPPAKPANWTFWQYSDKGKL
FT                   DGYSGSEPFIDLDVFCGSERELEAFAAGQAR"
FT   gene            complement(479046..479543)
FT                   /locus_tag="Ethha_0443"
FT   CDS_pept        complement(479046..479543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0443"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   bpa:BPP1370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26028"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8N7"
FT                   /inference="protein motif:PFAM:PF03167"
FT                   /protein_id="ADU26028.1"
FT                   /translation="MSEPRISSFAPVCSPESRVLILGTMASPASLRAGFFYGHPQNAFW
FT                   RILAELTGDDPGVSPTEKRAFLLRRRIALWDTLESCARDGALDSAIRDERPSDIAGLAA
FT                   RCPALRAVFLNGGAALRFYKKYHAPQVALPYFGLPSTSPANARGGYAAKWKAWRALLPY
FT                   LA"
FT   gene            complement(479536..480834)
FT                   /locus_tag="Ethha_0444"
FT   CDS_pept        complement(479536..480834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0444"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="KEGG: cth:Cthe_0683 diaminopimelate decarboxylase;
FT                   TIGRFAM: diaminopimelate decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26029"
FT                   /db_xref="GOA:E6U8N8"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8N8"
FT                   /inference="protein motif:TFAM:TIGR01048"
FT                   /protein_id="ADU26029.1"
FT                   /translation="MFVSDCLNVNLRGHLTIGGCDTLELAEQFGTPLYVMDEATITQNC
FT                   RKYVESIGTYYNSRGRVYYASKAFCCKEICRIMENAGMGLDVVSGGELYTAMSVGFPAD
FT                   RICFHGNNKTPGEINYALDCGVGRFVVDNLTELALLNTLALARNKKPSVLFRIKPGIDA
FT                   HTHNFIRTGQIDSKFGLALETGEAEEAVRQAVALPGVSLTGMHCHIGSQIFDIAPFELA
FT                   AEVMVNFMADMRDRHGADLTELNLGGGFGIQYVPGQNPVPYDRYMQAVSETVKKTCEAR
FT                   DMETPFIMLEPGRSIVASAGITLYTVGAVKDIPGVRTYVSVDGGMGDNPRYALYQAEYA
FT                   AVVAGKAAEKPTETVTIAGKCCESGDLIQEHTAIQPVQAGDILAVFATGAYNYSMASNY
FT                   NRIPRPATVMIRDRQPRVIIRRESFEDLVRNDV"
FT   gene            complement(480904..481506)
FT                   /locus_tag="Ethha_0445"
FT   CDS_pept        complement(480904..481506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0445"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="KEGG: ele:Elen_1096 GTP-binding protein
FT                   HSR1-related; TIGRFAM: ribosome biogenesis GTP-binding
FT                   protein YsxC; PFAM: GTP-binding protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26030"
FT                   /db_xref="GOA:E6U8N9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8N9"
FT                   /inference="protein motif:TFAM:TIGR03598"
FT                   /protein_id="ADU26030.1"
FT                   /translation="MEKILLVHTRFELSAYRAQDLPPCTVPEIVFSGRSNVGKSSMLNK
FT                   LANQKNLARVSSVPGKTVSVNFYRCDRPGDFRLVDLPGYGYAKAARAEKIKWSSLVESY
FT                   LVGRPAVLAVQLVDSRRSLTADDADMLRYFREQSIPFVVTMTKMDKLNVTEQAARLAAF
FT                   PPETGVEDARIIPFSARTGLGVDALTAAIAAALPGKE"
FT   gene            complement(481509..483938)
FT                   /locus_tag="Ethha_0446"
FT   CDS_pept        complement(481509..483938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0446"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="SMART: peptidase S16 lon domain protein; AAA ATPase;
FT                   TIGRFAM: ATP-dependent protease La; KEGG: cth:Cthe_0082
FT                   Lon-A peptidase; PFAM: AAA ATPase central domain protein;
FT                   peptidase S16 lon domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26031"
FT                   /db_xref="GOA:E6U8P0"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8P0"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ADU26031.1"
FT                   /translation="MNTQAPRENTTLPLLPLRGMVVFPGTLLNFDVGRKKSAFAINESM
FT                   KADQMLFLVAQKDIRTEEPTAENFHVMGTVARIRQLLHVSGENIKVSVEGLFRARLCEI
FT                   VQEDPYFVAAVEPCAETGRAPRAATAQALLRQAQDLVGEYTEIGPKLPEELLTEIVAGK
FT                   EPGKTADYIASNILPQQEDKQTALEELSPVKRLTLVLRMLRHEIEVLRLEQEIAQKVQE
FT                   RIDKGQRDYYLREQLKTLAEELGDQSEADESARYHQAVDKLALPEESAKKLHKEADRLA
FT                   RMPQGSHEATVVRSWLDACLTLPWNKESKDKIDLAQAQKVLDAGHYGMKKVKDRILESL
FT                   AVRKLAPEQKGQILCLEGPPGVGKTTIARAVAKSLGRRFARVSLGGIRDEADIRGHRKT
FT                   YIGAMPGRVLTALTQAGTRNPVLLLDEIDKMCESYQGDPSAALLEVLDAEQNHAFRDHY
FT                   IELPFDLSDVLFITTANNIDTIPAPLLDRMELIELPSYTREEKFQIAKRHLLTRQLHTH
FT                   GLTRRTLKVSDAVLYDLIDFYTREAGVRRLERQIAALCRKAARVIAAGEQKTVSVGPEQ
FT                   LESLLGPHRFRPESIPSKDEVGVVTGLAWTSVGGETMPVEVAVLDGSGKVELTGSLGDV
FT                   MKESAMAAISYIRSKADALGIAHDFYKTKDLHIHVPEGAIPKDGPSAGVTMATALTSAL
FT                   LGLPVRRDIAMTGEITLRGRVLPIGGLREKSMAAYRAGVRAVIIPQDNQPDLAEVDKVV
FT                   KEHVRFIPADHMDTVLQNAILFPPQAGTARAEAAAQTAPPLPVPPVAHTSAPVVEQ"
FT   gene            484149..485405
FT                   /locus_tag="Ethha_0447"
FT   CDS_pept        484149..485405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0447"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="KEGG: drm:Dred_3162 serine hydroxymethyltransferase;
FT                   PFAM: glycine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26032"
FT                   /db_xref="GOA:E6U8P1"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8P1"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ADU26032.1"
FT                   /translation="MYADMLDTIGFVKQYDPEVGGAMEGELKRQRRNIELIASENIVSP
FT                   AVLAAMGTVLTNKYAEGYPGKRYYGGCANVDEVETIAIERAKKLFGAEHANVQPHSGAQ
FT                   ANSAVYFGLLKPGDTVMGMSLAEGGHLTHGSPVNISGSYYHFIPYGVDAETGLIDYDAM
FT                   RKLAIENKPKMIVAGASAYPRVIDFKRIGEIAKEAGALLMVDMAHIAGLVAAGLHPSPV
FT                   PYADIVTTTTHKTLRGPRGGLILCREEYAKAIDKAIFPGTQGGPLEHIIAAKAVCLGEA
FT                   LHDDFKAYQTQIVKNAAAMAKGLLSRGHRLVTGGTDNHLMLLDLRGTGVTGKELQRRLD
FT                   DVYITANKNAIPNDPEKPFVTSGVRLGTPAVTTRGMVEADMDKIAEFISIAASDRFEKE
FT                   VEELRADVNALCAKYPLYE"
FT   gene            485405..486676
FT                   /locus_tag="Ethha_0448"
FT   CDS_pept        485405..486676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0448"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: ctc:CTC01048 recombination factor protein
FT                   RarA; PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26033"
FT                   /db_xref="GOA:E6U8P2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8P2"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADU26033.1"
FT                   /translation="MPPLADRLRPKTLDEVVGQRHLLAPDMLLRRVVETGQIPNLIFYG
FT                   PSGVGKTTVASILAKQAGKTLHRLNGTNMSTADIKAIVGELDTFAGMGGVLLYLDEIQY
FT                   LNKKQQQSLLEFIEDGRITLIASTTENPYFYIYNAILSRCTVFEFKSVPSAEIAKAVRR
FT                   AFAVMEQDKGRTIRVPDEVVAQISTGCGGDVRKAINAVELLALAAREADGELTVTAEDA
FT                   AAAAQKSAMKYDREGDEHYDLLSALQKSMRGSDPDAAVHYLARLLEAGDLPSVCRRLMV
FT                   CACEDVGLAYPQIIPIVKASVDAALQVGLPEARIPLADAVVLVATSPKSNSAYLAVDAA
FT                   LADIRAGRSGSIPRNLQNKHYDGADNARKGQFYKYPHGFPGRWVAQQYLPDALEGREYY
FT                   HFAENKTEQAAKTYWDAVKRKSEP"
FT   gene            complement(486739..487014)
FT                   /locus_tag="Ethha_0449"
FT   CDS_pept        complement(486739..487014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: der:Dere_GG13352 GG13352 gene product from
FT                   transcript GG13352-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26034"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8P3"
FT                   /inference="similar to AA sequence:KEGG:Dere_GG13352"
FT                   /protein_id="ADU26034.1"
FT                   /translation="MQATKIRMKPGRSSSDELTEIDSIYLTGCQQVGYYKKEDIHNYLI
FT                   GRPGNIQVNIYPYPNIVPATSSRGEKYVRSTPDSSLKDNLLNLPRT"
FT   gene            487537..488301
FT                   /locus_tag="Ethha_0450"
FT   CDS_pept        487537..488301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0450"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bpu:BPUM_3204 family 2 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26035"
FT                   /db_xref="GOA:E6U8X1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X1"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADU26035.1"
FT                   /translation="MPAYDDGLVSIITPVYNKERYIAQTIDSVQAQTFGDWELLLTDDC
FT                   STDRSAAIIAEYGERDARLRYTCLPRNGGAAAARNEALARAKGRYVAFLDADDLWQPEK
FT                   LEKQLALMRDKGYGFTYTAIEMIDENGAPRTGKRPVPARVDYRYLLANTVIACSSVVID
FT                   RAVIGDFRMPPVRKGQDFATWLSILRKGHRAYGIDEALVRYRVAPGSISSNKWAALART
FT                   WRIYRQQEQLSLFSAAWYFGWYTFHAVKKYWM"
FT   gene            488311..489105
FT                   /locus_tag="Ethha_0451"
FT   CDS_pept        488311..489105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spv:SPH_0462 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26036"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X2"
FT                   /inference="similar to AA sequence:KEGG:SPH_0462"
FT                   /protein_id="ADU26036.1"
FT                   /translation="METFDYVFVVLVYRNPHDLRGFLASLARVEGSRKVIVVNSFYDQP
FT                   TRDETAAVCEEHGCDFLNVENRGYGAGNNAGIRFARAHYRFAFLVISNPDIEIQALPAT
FT                   VLEQKGRTVLLGPLVRTENGKRQNPYMPAHSALRERLMCFYTRHSRSMAPFWAAVALNK
FT                   THRILFNVLFGRRERRVYALHGSFLLFSEPALQKLGLPFDERMFLFREEDHLARRARGL
FT                   GIPMRYTPGIRVLHHEDGSVRFLSAQTRRYALDSLRIYFGLQ"
FT   gene            489145..490569
FT                   /locus_tag="Ethha_0452"
FT   CDS_pept        489145..490569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0452"
FT                   /product="polysaccharide transporter"
FT                   /note="KEGG: sgo:SGO_2015 polysaccharide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26037"
FT                   /db_xref="GOA:E6U8X3"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X3"
FT                   /inference="similar to AA sequence:KEGG:SGO_2015"
FT                   /protein_id="ADU26037.1"
FT                   /translation="MANGVIRRGIANVKYVLLSQFCYYVVTFLTAFVLPGVLGVVPNGY
FT                   YQIYFFYTANFVGLMHIGFNDGIYLKFGGYEFDKLPQELFRTFMRLYICMNGIEMLALL
FT                   AVVLWEPNPNKRFAFVFAVLNILVVNLSALLNYINQATGRIRLYSFIVIAQQVQLIAGL
FT                   VVLFLLRHVDFRTVIVLDFAAKTVVVFINVACCRDLFFGKRAPWRAAWGPYWDNIRVGV
FT                   KLMIANLMAMLVMGAGKLVMERLGTVADFSEYSFASNAINIAMAFISAVGLVLYPVLCR
FT                   LERKTLPYYFQRINRLLCAFIFSMMLLYYPLVVVIRVFLPKYDAVLSYLHLLFPIVIMQ
FT                   SKMQMLINNYYESLREERAMMWANLSAVGLFVAVALPLYLWHPSVLVIVWATLGVFVWR
FT                   CYASELFLKRKMGIHSMRNMFEEWGMGGLFIVANSLLGWGPGLMLYAAAVAAYLLYYRR
FT                   ELLPAVRTVMQSALDR"
FT   gene            complement(490655..491098)
FT                   /locus_tag="Ethha_0453"
FT   CDS_pept        complement(490655..491098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_3034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26038"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X4"
FT                   /inference="similar to AA sequence:KEGG:Cthe_3034"
FT                   /protein_id="ADU26038.1"
FT                   /translation="MTHASRARPVLLPAERGTSLTFFLLAFLPVLASFFLTTDGRLTTA
FT                   HLGAISIPLRTVCVFHLLTGYNCPVDGMTRTFAFMGHGQLAEALRMSLPGVLLYVFCLF
FT                   EIPLRGVWLVRGRMPRILRVLEPVLFGTVGAVDAVFFLAQFFR"
FT   gene            complement(491095..491586)
FT                   /locus_tag="Ethha_0454"
FT   CDS_pept        complement(491095..491586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0454"
FT                   /product="Uncharacterized protein family UPF0547"
FT                   /note="PFAM: Uncharacterised protein family UPF0547; KEGG:
FT                   cai:Caci_4437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26039"
FT                   /db_xref="GOA:E6U8X5"
FT                   /db_xref="InterPro:IPR018886"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X5"
FT                   /inference="protein motif:PFAM:PF10571"
FT                   /protein_id="ADU26039.1"
FT                   /translation="MKNCPQCHHDCADDMIICPDCGYLFSATQPPNDWQQNPPYQSAQN
FT                   GGQPFGNGYNGYPPYQNVPKDSLATPSMVLGIIGVVASCCFIGVIPAIIGLIFGIISKL
FT                   RIARTGARGSGLALAGIILSSVAIAITIVVLIRVIIVFNDPAAMEQYRRIIEQYQQAQQ
FT                   "
FT   gene            complement(491650..492072)
FT                   /locus_tag="Ethha_0455"
FT   CDS_pept        complement(491650..492072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpr:Tpau_1709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26040"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X6"
FT                   /inference="similar to AA sequence:KEGG:Tpau_1709"
FT                   /protein_id="ADU26040.1"
FT                   /translation="MKRCAKCGAACADSDTYCGVCGAPLPAWGRPAPTGDGFAVASMVL
FT                   GIIGICTFWFGLGVITSILAVIFSLIVLCTARRRAVGHGMAIAGLVTGGLALFITLLIV
FT                   VFLIAIGSAASSQRQDTYSDTGGALFSHTDGGDYSA"
FT   gene            492362..493747
FT                   /locus_tag="Ethha_0456"
FT   CDS_pept        492362..493747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0456"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   hmo:HM1_1957 fad dependent oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26041"
FT                   /db_xref="GOA:E6U8X7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADU26041.1"
FT                   /translation="MLKTHYDIVIIGGGIGGLMCAWRLAEKCPDASVAIFEKGEDINNR
FT                   RCPIVSGQAKSCMRCKSCAIMEGLAGAGAFSDGKYIISHEYGGWLPEFLPGQTVVDYIE
FT                   QADRILVSCGATTERFQPDDALKKLCLAHDLHMQQAVVKHLGTDANLETMRRMVDQLRG
FT                   KCAIFTHAEVTDVQADSRTLVVRLPDGEHTCTAENIVFAVGRAGSGFFSAWCARNHVEL
FT                   HNNQVDVGVRVELPAIVWEDFSKKIYEPKIWYRSKNYGDVTRMFCFNERGQVVTENTGG
FT                   ILTVNGHAYRDPAKKTENSNFALLATMRFTSPFREPIAYAKHVASLANLISGGSVLVQR
FT                   LGDLEQGRRTDEKRLHDSTTRPTLRAVAGDLSLCMPKRQLDDIIETLHALDVIAPGTAN
FT                   HDTLLYGVECKYYSARPETEDFELKGYSHIYAIGDGAGFTRSLAQASANGLYLADKLAR
FT                   GRI"
FT   gene            493784..494872
FT                   /locus_tag="Ethha_0457"
FT   CDS_pept        493784..494872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0457"
FT                   /product="Undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: gtn:GTNG_0194
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; PFAM: glycosyl
FT                   transferase family 28; Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26042"
FT                   /db_xref="GOA:E6U8X8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X8"
FT                   /inference="protein motif:PRIAM:2.4.1.227"
FT                   /protein_id="ADU26042.1"
FT                   /translation="MKKIVLTGGGTAGHITPNLALLPLLQTAGFSISYIGLKDGMEEGL
FT                   IRPTGVAFYGITGGKLRRYADLKNFTDLFRIGAGFWESVSLLRKLKPDVLFSKGGFVST
FT                   PVVWAAKLCGVPVVTHESDSTFGLANRLSAPFARKMCYTFPESGAHLPEDKGVFTGLPI
FT                   REQLLHGNREKGLRLCEFSADKPVLVVTGGSQGAAFINRMVRRCLPKLLETFQVCHLCG
FT                   KGNVDEKLEGMPGYRQFAYVTDDLPDVFAMADMVVTRGGSTSLFELLALQKPMLIIPYS
FT                   RKASRGDQIINGRSFQKQGFGEVLMEADENGMDMMPAAFLRAVRQVYENRERYIENMQK
FT                   SPARGGAQNVFAVLCEVAGLSS"
FT   gene            complement(494927..495403)
FT                   /locus_tag="Ethha_0458"
FT   CDS_pept        complement(494927..495403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0458"
FT                   /product="iron dependent repressor"
FT                   /note="KEGG: clj:CLJU_c34350 putative metal dependent
FT                   transcriptional regulator; PFAM: iron dependent repressor;
FT                   SMART: iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26043"
FT                   /db_xref="GOA:E6U8X9"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X9"
FT                   /inference="protein motif:PFAM:PF01325"
FT                   /protein_id="ADU26043.1"
FT                   /translation="MQNDRFYTFHEYLKTEDGALSASMEDYLEMIWRLSGPNGFTRIHE
FT                   LSQALHIRQSSATKMVQRLAQKGYVRYQKYGFLTLEEKGKQAGAWLMQRHRAIERFMRM
FT                   IAVPEALVLEETEKTEHMFGVESTLCLEHFVRFLSARPEVIEQYRLAFPNTGAT"
FT   gene            495558..496859
FT                   /locus_tag="Ethha_0459"
FT   CDS_pept        495558..496859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0459"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="KEGG: clj:CLJU_c34340 putative manganese/divalent
FT                   cation transporter; TIGRFAM: Mn2+/Fe2+ transporter, NRAMP
FT                   family; PFAM: natural resistance-associated macrophage
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26044"
FT                   /db_xref="GOA:E6U8Y0"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Y0"
FT                   /inference="protein motif:TFAM:TIGR01197"
FT                   /protein_id="ADU26044.1"
FT                   /translation="MQSKDSPIELTFRHAGKEKPGCRAVRRSGGRLGQMLKFIGPAFIV
FT                   SVAYIDPGNFATNIEGGSVYNYTLIWVILWSNVLAIFLQTMSAKLGIATGHNLPEMCAK
FT                   AYSKRVNRVFWVLAEVGAMATDLAEFLGGTLGLNILFRMPMFYAGLLTGLLTFFICCLE
FT                   RYGQKLVEIVIAGFVAVVGAAYLLELFLARPDWAQVGWHTVVPSLPDGHALILAAGMLG
FT                   ATVMPHVIYLHSQLVRHRCGNGSAEEKRHHFKMEKIDIAIAMNIAFCVNAAMVAVSAAV
FT                   FFRHGMVVDTMQQAQQSLTPLLGPLSGGAFGIALLASGLSSSAVGTMAGQTVMQGFVNL
FT                   SIPVNLRRLITMLPALVIIAAGVNPMQALVWSQVALSFILPLPVLQMLSIAGKRKWMGE
FT                   MVNRPWEQALGIAAAAVIIAMNALLLVLTFTGQA"
FT   gene            complement(496862..497350)
FT                   /locus_tag="Ethha_0460"
FT   CDS_pept        complement(496862..497350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0460"
FT                   /product="protein of unknown function DUF1648"
FT                   /note="PFAM: protein of unknown function DUF1648; KEGG:
FT                   mba:Mbar_A3397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26045"
FT                   /db_xref="GOA:E6U8Y1"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Y1"
FT                   /inference="protein motif:PFAM:PF07853"
FT                   /protein_id="ADU26045.1"
FT                   /translation="MKTKYTRLQTVLEIVNILLLIAQFVYVLSLWSRLPARIPAHFDAA
FT                   GHINRYGSKNELFIVPFVTVGMYASLLWLQRFPQNWNTSVEVTERSRAYVYSATKTILV
FT                   LCRTCVAVTFFIITICISARQITWIWLDCIPVAALVVFIVLYSGRIKRRADKLNHPYG"
FT   gene            complement(497382..498068)
FT                   /locus_tag="Ethha_0461"
FT   CDS_pept        complement(497382..498068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0461"
FT                   /product="protein of unknown function DUF1648"
FT                   /note="PFAM: protein of unknown function DUF1648; KEGG:
FT                   hmo:HM1_3013 conserved hypothetical protein, putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26046"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Y2"
FT                   /inference="protein motif:PFAM:PF07853"
FT                   /protein_id="ADU26046.1"
FT                   /translation="MKQTRKFSDRLAVELGIASIPVLCYMLAYPYLPEKIATHYGAGGT
FT                   TFSSKSSATMLIGIVLGFTGPVFGQAMEWLAKAGAKHGRSDLDPQDTLTVAKYSGVFLT
FT                   VLLSLLAFFMLEFMPLMRTHLPGLVILRIVFSLSGILLLVIGKRMAPPLRSEADVVHLP
FT                   PFAAKKTARRFAGWTGMICGAAQLALGLMLFLPDDAAVLVQLLSYPALITTLSVFFITR
FT                   KKAKDC"
FT   gene            complement(498190..499524)
FT                   /locus_tag="Ethha_0462"
FT   CDS_pept        complement(498190..499524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0462"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: cli:Clim_0792 amino acid carrier protein;
FT                   TIGRFAM: amino acid carrier protein; PFAM: sodium:alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26047"
FT                   /db_xref="GOA:E6U8Y3"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Y3"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ADU26047.1"
FT                   /translation="MPVLENILGLLASALWGQPLLFALFGTHVFLTVRLRGIQRFIGKA
FT                   IHFSVTKEKGANGDVSPFAALTTSLAATLGTGNIIGVATAVAAGGPGAVFWMWISGIFG
FT                   MATKYTEALLSVKYRMRRGNAMAGGPMYVMQNGLRCKPLGCVFAFFTAVAALGVGASVQ
FT                   SNSIAALFQQTFRVPPVVSGLVTALLAGCILLGGIRSISKVCNLLIPAAGALYIFSNLI
FT                   ILWMGWHSIPQSLALILQSAFCGQAAVGGFVGAAAKDAIRFGISRGLFSNEAGLGSSPI
FT                   VDAAAQCKNPVRQALVSSTGVFWDTVVLAALTGIMLVNSGVWRQGLDGGALTNAVFHSI
FT                   PVMGPGILAVALFTFAFATCIGWSYYAEKAVEYLFGPHAILPYQCVYIAMIFFGGVISV
FT                   NAVWNFSDIANALMAIPNLISLWALSGIAVRETRREMRRGGLLHR"
FT   gene            499718..499794
FT                   /locus_tag="Ethha_R0014"
FT                   /note="tRNA-Met1"
FT   tRNA            499718..499794
FT                   /locus_tag="Ethha_R0014"
FT                   /product="tRNA-Met"
FT   gene            complement(499958..501370)
FT                   /locus_tag="Ethha_0463"
FT   CDS_pept        complement(499958..501370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0463"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: tit:Thit_1365 integrase family protein; PFAM:
FT                   integrase family protein; helix-turn-helix domain protein;
FT                   SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26048"
FT                   /db_xref="GOA:E6U8Y4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Y4"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADU26048.1"
FT                   /translation="MANITKRKNKDGSTAYLIRVYVDETGTGHQIVKSMTWKPKPGMRP
FT                   SAEEKELNIQSTLFEEQVKQGLTAFGGSTRFSDYAKEWIENESLAFKTKERYTEMLERI
FT                   NAAIGHIRLDKLQAHHLEAFYKNLAEAGVNHRGSYAVSEKLDALMKKQKLTRAALAMQA
FT                   GVAAITISSAARGKHISSEKAAAICKALGKPVDAVFTIHMSDTGLSDKTILHHHRLISA
FT                   ILAKAKRERLVPFNVAAEHATAPKAAHKEAKYLDDEQAHTLLTLLLNEPDIRVKAALIL
FT                   LLFSGARRGELCGLSWPDIDFERHLINIERASQYQSGKGVVEKSTKNESSIRSIKIPAF
FT                   VVELLGAYRAWWNKQKLLYGESWHGEKERLFVQADGKPINPDTINYWMNRFLEQHQLEH
FT                   ITPHGLRHTFATLQIAAGVDIRTLQARTGHAQASTLVNIYSHAIKSAQEAASDALEDIL
FT                   LPPTDKSKGKTS"
FT   gene            complement(501342..502097)
FT                   /locus_tag="Ethha_0464"
FT   CDS_pept        complement(501342..502097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0464"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: cth:Cthe_0364 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26049"
FT                   /db_xref="GOA:E6U8Y5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Y5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU26049.1"
FT                   /translation="MADERKNENRIFAKHLRELLDNAGHTQQDVADYVGVTRQAVAQWK
FT                   DGKTIPDINNFRALARFFEVPYEYLIGDTESRVREHFDLADTLGLSDAAIHALQSYRRE
FT                   QLDEDSQPTCITQSEIISRILADKNFWRFLGDLQGSIQKHKQAHDREMRETADQSMPTG
FT                   ASQELVREARQTGYEILSNKELSDFYAYRAETTIRNIVMDMPEQWLMETLGIRKPAFYE
FT                   GEPESPDDLLEDDLEEGDTDHGKYHETEK"
FT   gene            502269..502505
FT                   /locus_tag="Ethha_0465"
FT   CDS_pept        502269..502505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0465"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: cai:Caci_8339 excision promoter, Xis"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26050"
FT                   /db_xref="GOA:E6U8Y6"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Y6"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADU26050.1"
FT                   /translation="METALHPVKMLTIKEAARLVPGLTRYRIRTMCINGELPCVRAGRK
FT                   YLICEQVLLEYLLHPKQEAKQPVVNGIRRVDAR"
FT   gene            502562..502897
FT                   /locus_tag="Ethha_0466"
FT   CDS_pept        502562..502897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF2306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26051"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Y7"
FT                   /inference="similar to AA sequence:KEGG:EF2306"
FT                   /protein_id="ADU26051.1"
FT                   /translation="MAKERGVGIYFKVSEKERGLIGKRCEEAGIRNLSAYLRKMALNGY
FT                   IIRLDITTLKDLVRLMHVTANNVNQIARRINETHSVYFEDMQDLQQGYSQVWSGVRNVL
FT                   RELSKLT"
FT   gene            502910..504313
FT                   /locus_tag="Ethha_0467"
FT   CDS_pept        502910..504313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0467"
FT                   /product="Relaxase/mobilization nuclease family protein"
FT                   /note="PFAM: Relaxase/mobilization nuclease family protein;
FT                   KEGG: efa:EF2303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26052"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Y8"
FT                   /inference="protein motif:PFAM:PF03432"
FT                   /protein_id="ADU26052.1"
FT                   /translation="MGTTRIIPMHGSAGKSITRAISAHTNYAMNPAKTRGGALISAYEC
FT                   SPETVDVEFAFSKKIYTDLTGRTSSARKDVVAYQIRQSFKPGEVAPETANEIGYKLAME
FT                   FTKGQHAFIVATHIDKAHAHNHIIFNSTTLDCTHKFNNYGYSIKAVQRISDQLCQKYGL
FT                   SVVEHPAAKGKHYAEWVAERKGTSWKALLRRTIDEALPDCKNFEMLLARMRKQGYEIKR
FT                   GKYISFRAVGQERFTRAKTLGANYTEQALCERLMEQVRQPAPQKLPQHVGAIQWLVDIQ
FT                   AKMQVGKGPGYEHWAKLFNLKEMARTMNFLSEHGISDMEQLQQRVAELQSSFSDGLEQM
FT                   KVADRRLKENSALRKNYADYLKTKPVYDAYRKSKRPDAYRDAYEADLLVYEAARRNLAA
FT                   FHLNQRPDISALQMENAELSAPKKALYAEYQQTKQEMLEWRTVQGNAERLLRQSEKTLE
FT                   NQRSSDIER"
FT   gene            504784..505005
FT                   /locus_tag="Ethha_0468"
FT   CDS_pept        504784..505005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0468"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="manually curated; PFAM: helix-turn-helix domain
FT                   protein; KEGG: dhd:Dhaf_0513 transcriptional regulator, XRE
FT                   family; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26053"
FT                   /db_xref="GOA:E6U8Y9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Y9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU26053.1"
FT                   /translation="MRLKIRDLREDHDLTQQQIAEYLKCDRSLYAKYERGERDVPLQTA
FT                   VRLAIYYKTSVDYLVGLTDERMAYSRAK"
FT   gene            505141..506646
FT                   /locus_tag="Ethha_0469"
FT   CDS_pept        505141..506646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0469"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: shi:Shel_17670 type I restriction-modification
FT                   system methyltransferase subunit; PFAM: N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26054"
FT                   /db_xref="GOA:E6U8Z0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Z0"
FT                   /inference="protein motif:PRIAM:2.1.1.72"
FT                   /protein_id="ADU26054.1"
FT                   /translation="MATTNSAETGFEKQIWDAACILRGNMDAAEYKHVILGLIFLKYIS
FT                   DRFEFRYNQLVKDKNGDEEDRDEYTSQNVFYVPPSARWESITAQAHMPEIGKIIDNAMD
FT                   SIERENKSLKGVLPKTFARPELDKRRLGEVVDLFTNITIAETGGKMDMLGRTYEYCLGR
FT                   FAEQEGKLAGEFYTPASVVRTLVAVIKPFDGRVYDPCCGSGGMFVQSAEFVKAHAGNIR
FT                   NLSVYGQDSNPTTWKLCRMNLAIHGIDADLGEAAADTFFNDRHPTMKADYILANPPFNL
FT                   SGWGADKLADDQRWKYGQPPAGNANFAWMQHMIFHTSAKGRIGMVLANGSLASQNGGEG
FT                   AIRKAIVEDDLVEGIIAMPPQLFYTTQIPVSLWFLDRAKKQPGKMLFIDARHMGTMVSR
FT                   RLREMTKEDISKISDTFEAFENGTLEDEAGFCAAVPVEEISKQDYILTPGRYVGLAAEE
FT                   DDCEPFEEKMDRLTSELSEMFKRSHELEEEIRKRLGAIGYDIK"
FT   gene            506633..507667
FT                   /locus_tag="Ethha_0470"
FT   CDS_pept        506633..507667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bth:BT_3040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26055"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Z1"
FT                   /inference="similar to AA sequence:KEGG:BT_3040"
FT                   /protein_id="ADU26055.1"
FT                   /translation="MTSNNPEIVMYQTEDGHTKIDVRMEDETVWLSQTQMADLFQTTKQ
FT                   NISLHINNTFEEGELDSSATVKEYLTVQSEGAREVSRKIKYYNLDVIISVGYRVKSLRG
FT                   TQFRRWALEILREYLVKGFSMNDDLLKKAGGGNYWRELLERIRDIRSSEKVFYRQVLDL
FT                   YATSVDYDPRTPESLEFFKIVQNKLHFAAHGHTAAEIISERANAELPFMGLTTFSGEHP
FT                   TKGEVSIAKNYLTEEELSTLNRMVSAFFDLAELRAMQHQPMYMKDWVVELDDFAKRYGK
FT                   GILPGAGTVSHQAALAKAEAEYKKYRQKSIGNLSPAERDFLASIKDTQKRLEGKKKTRR
FT                   DGDG"
FT   gene            507664..508230
FT                   /locus_tag="Ethha_0471"
FT   CDS_pept        507664..508230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0471"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: pin:Ping_0149 restriction
FT                   modification system DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26056"
FT                   /db_xref="GOA:E6U8Z2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Z2"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADU26056.1"
FT                   /translation="MSTTSVWKTEPLRNVVSYITKGVPPVYAPYESETTVRVLNQKCNR
FT                   NFSISYTESRLHDLSKRNVPYGKYLCDNDILINSTGTGTAGRVAQLYCVPCPTIVDGHM
FT                   IIVRAINDIVPRYLGYAMKAHQAEILQLDEGSTGQTELNRERLLSEIEISYPVSLDEQL
FT                   NIVGILSALDAQISENTKINHHLAA"
FT   gene            complement(508219..508863)
FT                   /locus_tag="Ethha_0472"
FT   CDS_pept        complement(508219..508863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0472"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="KEGG: ttu:TERTU_3912 putative type I
FT                   restriction-modification system specificity subunit;
FT                   manually curated; PFAM: restriction modification system DNA
FT                   specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26057"
FT                   /db_xref="GOA:E6U8Z3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Z3"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADU26057.1"
FT                   /translation="MNHHLEQMAQAIFKSWFVDFEPSRPFTEVVQVLSGGTPKTGTETF
FT                   WNGVIPFFTPKDASGIFTLTTEKTLTKVGLSNCNSRLYPVNTVFLTARGTVGKLALAGR
FT                   PMAMNQSCYALVGTEGLGQHYVYHLAQHVVESLKHKATGAVFDAIVTRDFESEIVPDIT
FT                   TAEARSFEEKVAPIYEIILNNSNENIRLAELRDSLLPRLMSGELSVADLGR"
FT   gene            508920..509912
FT                   /locus_tag="Ethha_0473"
FT   CDS_pept        508920..509912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0473"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: fma:FMG_1375
FT                   putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26058"
FT                   /db_xref="GOA:E6U8Z4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Z4"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADU26058.1"
FT                   /translation="MKDKLITEIQTYMSRMLSVAQVEELRRVLTHCFHNVEIVEKKSTE
FT                   KEDITGNPKLLEIFISAKRVEGCSEKSLKYYDATIRHMIVDIAKPVREIDTGDLRIYLA
FT                   NYQKLRNSSKVTIDNMRRIFSSFFGWLEDEDYILKSPVRRIHKIKTEKTIKDTFSDEGL
FT                   EKLRDACDELRDLAMVDLLASTGMRVGELVQLNREDMNFHERECLVLGKGGKERMVYFD
FT                   ARTKIHLRNYLDSRSDDNPALFVSLTSPHERLLIGGVETRIREIGKNAALQKVHPHKFR
FT                   RTLATRAIDKGMPIEQVQRLLGHVKIDTTMHYAMVNQENVKNSHRKFIG"
FT   gene            509926..510462
FT                   /locus_tag="Ethha_0474"
FT   CDS_pept        509926..510462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0474"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: clo:HMPREF0868_0491 type I
FT                   restriction modification DNA specificity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26059"
FT                   /db_xref="GOA:E6U8Z5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Z5"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADU26059.1"
FT                   /translation="MDQWKLVRAMDFIDFNPRESITKGVVAKKVAMEHLLPFTRDVSSY
FT                   EFSPFHGGSKFRNGDTLMARITPCLENGKTALVNILDQGEVGFGSTEFIVMRARPGISD
FT                   KDFIYYLAQSPILRDKAIKSMVGSSGRQRVQLSVLNDTKFYAPPLEEQIEIAGILRALD
FT                   DKIANNTAINHHLAA"
FT   gene            complement(510451..511032)
FT                   /locus_tag="Ethha_0475"
FT   CDS_pept        complement(510451..511032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0475"
FT                   /product="restriction modification system, type I"
FT                   /note="KEGG: neu:NE0384 restriction modification system,
FT                   type I"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26060"
FT                   /db_xref="GOA:E6U8Z6"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Z6"
FT                   /inference="similar to AA sequence:KEGG:NE0384"
FT                   /protein_id="ADU26060.1"
FT                   /translation="MGPFGSNIKVETFVDSGVPIISGNHLRGLYLDELEYNFITEEHAR
FT                   RLSNSLVRAGDIIFTHAGNIGQVALIPDNCDYPYYVISQRQFYLRCDKKKALPEYINYF
FT                   FHSRVGQGKLLANASQTGVPSIARPSSHLKGISVVLPPIEVQLDWFETVRPMLQILNGN
FT                   NKENKRLVSLRNMLLPRLMSGELSVADLSR"
FT   gene            511139..514156
FT                   /locus_tag="Ethha_0476"
FT   CDS_pept        511139..514156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0476"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="TIGRFAM: type I site-specific deoxyribonuclease,
FT                   HsdR family; PFAM: protein of unknown function DUF450; type
FT                   III restriction protein res subunit; KEGG:
FT                   clo:HMPREF0868_0494 type I site-specific deoxyribonuclease,
FT                   HsdR family; SMART: DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26061"
FT                   /db_xref="GOA:E6U8Z7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Z7"
FT                   /inference="protein motif:TFAM:TIGR00348"
FT                   /protein_id="ADU26061.1"
FT                   /translation="MPYAEANFENAVMILLEELGYAKLYGPDVERDFHNPLYLDALTGQ
FT                   LPRINPMADRQAVEEALHKLTHIEHGTLLQKNKRFMDWLQNGIEVTYQKGGETKNELVR
FT                   LIDYEHPEYNMFCAINQWTITEHETKRPDVAVFVNGLPLVVVELKTCMREDTDFSDGYR
FT                   QIKNYMKEIPVLFQYNAFCIISDLIDSKVGTITSEFDRFVDWKTVNGDYEETQFARYDV
FT                   LFRGMLEPRRFLDILRYFILFSQDIPEDHKILAGYHQYFAVRKAIESTRHAVETDGKGG
FT                   VFWHTQGSGKSLSMVFYAALLQQALDSPTIIVITDRNDLDDQLYGQFSACKDFLRQTPE
FT                   HAQSREHLKELLAGRRANGIFFTTMQKFEEAHEPLSERRNIIVMADEAHRSQYGLTERV
FT                   KKDGTLVVGAARVIRDSLPDATFIGFTGTPISSKDRDTRAVFGDYIDIYDMTQAVEDGA
FT                   TRPVYYESRVMNLGLKEDVLRQIDTTYELLAQNANEQDIERSKKELGNLEAILSAPETI
FT                   DTLCRDIIAHYEQNREHLLTGKAMIVAYSRSIAIDIYHKLLELRPGWQKKVKVVMTSGN
FT                   NDPEEWRNIIGNKSYKRELARKFKDNDDSLKIAIVVDMWLTGFDVPSLATMYVYKPMSG
FT                   HNLMQAIARVNRVFRDKEGGLVVDYIGIARALKRAMNDYTVRDRSNYGNLDIAKTALPK
FT                   FEEKLRVCGELLYGFDYSAFLLETSNDRQRADLIAGCINFVLGKNADTQKTFATEALLL
FT                   KQARTLCQSLLNREQRMESALFEAVRVALSRISGTQKLSLKEINDRINEMLQQSVHSEG
FT                   VINLFGEQSAEFSLFDPAFLEEISRMKQKNLAAELLRKLLAEQISAYQHTNLVQAEKFS
FT                   DRMQKLMNAYRNGQITNAEVIEELQKMAADIAKAHQTGASLGLSPEELAFYDAITRPEA
FT                   VKDFYTNDQLLHMTKELADTLRRSRTVDWQKKESARAQMRVMVKRLLRKYKYPPDGMQD
FT                   AIQTVLAQCELWTDEA"
FT   gene            514229..514900
FT                   /locus_tag="Ethha_0477"
FT   CDS_pept        514229..514900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0477"
FT                   /product="restriction endonuclease"
FT                   /note="PFAM: restriction endonuclease; KEGG: pgn:PGN_0982
FT                   putative Mrr restriction system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26062"
FT                   /db_xref="GOA:E6U8Z8"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR025745"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Z8"
FT                   /inference="protein motif:PFAM:PF04471"
FT                   /protein_id="ADU26062.1"
FT                   /translation="MAVPKYNEFMKPLLVCLSDGETHKSKEIQQNLAEYFHLTDEDRQE
FT                   LLPGSGQLVYKNRIGWASTYLKKAGLISSPARSIMQITDTGRQVVRENPLAIDGHYLSK
FT                   FDSFRAFSSPKPASSSQSDIVSNPPCDLATPETPEEQLKQDYEMVLSKLSDDLYEKVMT
FT                   LSPEKFELLVIDLIRAVGYGYPDESSFRHTGKTGDGGVDGIVQEDKFGFNLIYIQCSFS
FT                   R"
FT   gene            complement(515018..515584)
FT                   /locus_tag="Ethha_0478"
FT   CDS_pept        complement(515018..515584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0478"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: mmz:MmarC7_0041 resolvase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26063"
FT                   /db_xref="GOA:E6U622"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:E6U622"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ADU26063.1"
FT                   /translation="MLLGYARVSTGEQLLDRQIDALELAGVEKIYHEKVTGAKVDRPKL
FT                   NELLNHLRSGDVIVVSDLTRLSRSTKDLFSIVDRIQLAGADIKSLKESWIDTTTPQGKL
FT                   LFTIFAGISQFERDLISQRTREGIAAAASRGRHGGRPSKRNPKADTALKMYDSQEYTIP
FT                   EICSATGLSKSTLYRYVASRNQLRD"
FT   gene            complement(515878..516660)
FT                   /locus_tag="Ethha_0479"
FT   CDS_pept        complement(515878..516660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0479"
FT                   /product="papain cysteine protease family protein"
FT                   /note="KEGG: psp:PSPPH_2358 papain cysteine protease family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26064"
FT                   /db_xref="GOA:E6U900"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6U900"
FT                   /inference="similar to AA sequence:KEGG:PSPPH_2358"
FT                   /protein_id="ADU26064.1"
FT                   /translation="MPHKYTLKKDPEDARDFTFSSLAPVSILHDTDYTAKFPPIWDQGQ
FT                   LGSCQSHAIDAIDVYIKGYAFTPSHLFEYYNVRVIEGTVNQDAGGNLRDTCAALAKNGV
FT                   CDATIWPYDISKFAIKPPQAAYNNANFDNDRIYTYYRVSGIDQIRQALSAGHTPLIGIR
FT                   IYENFESQTTLSTGIIPAPRGALLGGHALVIVGHHDEPASGCKAKEFIQHVFFKKSTGN
FT                   VKIRNSWGTGIGLGGSGYFQASYEVLEQLLMDTWVIVQ"
FT   gene            complement(516663..516917)
FT                   /locus_tag="Ethha_0480"
FT   CDS_pept        complement(516663..516917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ere:EUBREC_2081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26065"
FT                   /db_xref="UniProtKB/TrEMBL:E6U901"
FT                   /inference="similar to AA sequence:KEGG:EUBREC_2081"
FT                   /protein_id="ADU26065.1"
FT                   /translation="MKNAIQSLLSDKSFWAAVISLVTSILIAYNVPQGSIEQITAIISA
FT                   AGTFIAYIVSNGIQSAARIKADAQIRATRIAKGLQDTED"
FT   sig_peptide     complement(516831..516917)
FT                   /locus_tag="Ethha_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.626) with cleavage site probability 0.425 at
FT                   residue 29"
FT   gene            complement(516930..518105)
FT                   /locus_tag="Ethha_0481"
FT   CDS_pept        complement(516930..518105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0481"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="PFAM: glycoside hydrolase family 25; KEGG:
FT                   cno:NT01CX_2099 glycosy hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26066"
FT                   /db_xref="GOA:E6U902"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6U902"
FT                   /inference="protein motif:PFAM:PF01183"
FT                   /protein_id="ADU26066.1"
FT                   /translation="MTHIIKRAAVGALMVVLLSATVMAVTPPGGAVFYHGVDIYHGTSD
FT                   NGQINWNRLAQTQNFVYIKTDEGISYVDRMWTVNRTAAAAHGMAWGPYHFLRLNSDPVE
FT                   QADSFWARIRGTGYSLVPAVDVESYDGQQSAASMRQIIRVFITEFQRVSGITPVLYTYT
FT                   AYANDILHGQFTDCPLWLADYRGYAGDVVGWGAWDAWQYSERGQIDAIANGKVDLDYAT
FT                   AEIFLAAPAAAIANRPVPAPSCEASDYYEVPSLPQAPNSRAGADFYIRDRDGARISSHQ
FT                   VDAGDPLIILSVDYATQLTEVLYPNYAADGWFHGYIVNDEAHLHNTGWRQWKNGRSDEP
FT                   AYTVDGEYMGTLSPYEHATILKRCADGRTLLLYDTARGSETKSGYVRYPGK"
FT   sig_peptide     complement(518031..518105)
FT                   /locus_tag="Ethha_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(518180..518908)
FT                   /locus_tag="Ethha_0482"
FT   CDS_pept        complement(518180..518908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckr:CKR_2328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26067"
FT                   /db_xref="UniProtKB/TrEMBL:E6U903"
FT                   /inference="similar to AA sequence:KEGG:CKR_2328"
FT                   /protein_id="ADU26067.1"
FT                   /translation="MANRTQFFSDGTTVYGASDFIAPMNALTTSGIIGGYQVTAPSSGM
FT                   TVNVAAGSAILNGVLTTDDTTQAVPVPTNTGGNARTDAIVLQIDATAMTTTVVDVPGAT
FT                   TEAANQILLAVVTVPAGASSIVAGNIDGSGRVYAGLDNPFAAVASASLGSNGYVLLGNG
FT                   LALQWGTLSLGAFPAYTDVSFPQAFSAVPFTIVATMEDSAPSAVSTAVWTAAKFTVIQA
FT                   DSVAHLMHWFAIGPMAVTRM"
FT   gene            complement(518922..519977)
FT                   /locus_tag="Ethha_0483"
FT   CDS_pept        complement(518922..519977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tps:THAPS_6956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26068"
FT                   /db_xref="UniProtKB/TrEMBL:E6U617"
FT                   /inference="similar to AA sequence:KEGG:THAPS_6956"
FT                   /protein_id="ADU26068.1"
FT                   /translation="MYVKLFDRSHIQLDELYQFSPPKYGWTLNDIDTLTLDIALADPKC
FT                   TPANTRLGNHIEYAADDGTTIWGGYIAGHSFNDAKLTLNCVDYNALLKYRRLRAKQYGT
FT                   MDYGSLVRQMIADCQAARSDDPIGLTGYDIAPGAIQTTREVKATDMLLAKIKDFCADAN
FT                   YDYWVDAARVFHFALRRGADKPQYVLEYGGEADNITAAPTLARDILNLANDVYAESTVT
FT                   DDSNNSTTITSEQQDASSQSTYGLYEGTFSPNDGVTDQSTLDTQTQAALALDSAPADSI
FT                   TLTCTDGTLCPFDDLAIGDRVTLHLAPYFDYTASVRVLRMVQDDDKQTREITVGSVVYK
FT                   PQGPQRRAYAG"
FT   gene            complement(519977..521254)
FT                   /locus_tag="Ethha_0484"
FT   CDS_pept        complement(519977..521254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_5636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26069"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:E6U616"
FT                   /inference="similar to AA sequence:KEGG:Amir_5636"
FT                   /protein_id="ADU26069.1"
FT                   /translation="MLHDVIFGAPKNLLRLLSSAQSANGVTAQVDANGLVTLSGTATAD
FT                   TTFTLPANAVTLGTGAYTASLTVKNGYATGTVTAAITQTAQATQVITNGNFATSSNNLA
FT                   TGFAVGHGVAVSCTNNTQTFRATAQSGQLDMYNYPYLSGHKYFIRCYVQATSTGVVLYA
FT                   QNGTAVTHPGDGKYEPLSCIVTATVSNFYAAIVDRRTSGWDNISVQSFMAIDMGTDASN
FT                   PLYNLTSAQMAALFPSYFDGAKTVTLPNPFATVSVGSPATFTAQSGQSIPSVQISIPAG
FT                   AACSQYAVGLQVESGSTATGWVSPGTQGVIFYPAEGETGTITNTGNVDAYPVITITGAC
FT                   ANPSVTNDTTGESISVNLALGSTDTLVIDCRPATRGCYLNGTLAFGIKQELGWIHCPPG
FT                   DNVLTFARNGYDTKRHCTVSLQGRYL"
FT   gene            complement(521254..522159)
FT                   /locus_tag="Ethha_0485"
FT   CDS_pept        complement(521254..522159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppw:PputW619_0675 pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26070"
FT                   /db_xref="UniProtKB/TrEMBL:E6U615"
FT                   /inference="similar to AA sequence:KEGG:PputW619_0675"
FT                   /protein_id="ADU26070.1"
FT                   /translation="MAALYDLLNRRDTWANWQNNNIILPDGVLGVITDSPADELWLLMG
FT                   DGTTHVKDLKIWKLYQVDMSSLAQSVITLQQTVAALQQVVSTDGTATLSQLTLKSDGVH
FT                   DPLTVEGVDGVSVGSIDKDGYTYIGKASTIMAEDDDHMILSNVGYLGGAQAQGGVNLDN
FT                   VSGLFGMVDENGNGINVTGITMLEFNGAANMNLPSTGLNVNGGPLTSNEKFTSNGGAQI
FT                   NGNTTINGDTSVYGEVASVAPSSLATMSGPTSSRPTQIMDNVPVIPGYQYFDTTLGKPI
FT                   WVKSNVNGTVTWVDSTGAVV"
FT   gene            complement(522159..522704)
FT                   /locus_tag="Ethha_0486"
FT   CDS_pept        complement(522159..522704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0486"
FT                   /product="phage tail component"
FT                   /note="TIGRFAM: phage tail component; KEGG: hau:Haur_2545
FT                   alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26071"
FT                   /db_xref="UniProtKB/TrEMBL:E6U907"
FT                   /inference="protein motif:TFAM:TIGR01633"
FT                   /protein_id="ADU26071.1"
FT                   /translation="MISPVSFNGVALNDSFFSSDLRGVFDSDKALTLDDILGDGQVFGR
FT                   SKVAERKLVLNITAAAQDLARLATLNQMVAGNALKMLIIDTDIGRLYGYGEVTTFAWAD
FT                   DTPLMQSMQLTMPDPHWYALQPSTLSLEPSIANGVIFGDPVRIALDAGGSDNAARTILD
FT                   ADNSDSAARTQLDAGGSN"
FT   gene            complement(522717..525896)
FT                   /locus_tag="Ethha_0487"
FT   CDS_pept        complement(522717..525896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0487"
FT                   /product="phage tape measure protein"
FT                   /note="TIGRFAM: phage tape measure protein; KEGG:
FT                   mcu:HMPREF0573_11227 TP901 family phage tail tape measure
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26072"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E6U908"
FT                   /inference="protein motif:TFAM:TIGR02675"
FT                   /protein_id="ADU26072.1"
FT                   /translation="MAFDGSINIDSSIDGSGFTKGLEKINGVAKGVLGALTGLLGGAAT
FT                   ALGGAAVAGVKYNSEMEQYITSFGTMLGGADKAAAMVVNLKKFAADTPFEFNDLAKGTQ
FT                   TLLSFGVSAKDVMPTIQMLGDVSQGNVDRFNALTLAFAQVSSAGKMQGQDLLQFVNAGF
FT                   NPLQVMAQKSGKSMADLRTEMENGKISAQDVADAFKAATSQGGQFFNAMQAQSKTFNGQ
FT                   LSTLKDNAMQFLGQLTAGLQNSLKDTALPMVNGWMDELQNAFASGGVQGVVQAFGGVLA
FT                   KAITAISEQAPQIISLAALLIQSFLNGIISNTPKIATATANIATQLVSAFTMLLPQFID
FT                   VAFQLMTAFAKGLFANAGNIASNIRVMIAQIIDYIGQDAPEFIAAAAQLIVALVQGFAA
FT                   NAPEIVSVTQQLIVAVVQALLKAAPQLAQAAVQLMGGFYSALMQQNPPVGIFLTLIGAV
FT                   KGLRGAFSGLDAAASAVKGVQNAGGIAIKIAEPFKKAGDNIGVLKGAISDVSGSFKSVG
FT                   SGIVGTAKTIGGGFVSLGKTVAGGLMGAVKGLASGISGLFDILAANPIIIVIALIAVAI
FT                   AAIIYFWNTNAGFRDAVIGIWNGIVGVFQTVIGAIVGFFTKTIPAAWNAFIGFMKTWGP
FT                   LILAIIFPILGIPLLIAQHWGQIVAFFSKLFADVGNAVLTGINAVGQFFLQLPMQIAFA
FT                   LGFAIGTVIKWGIDLVTWATTAIPNFIAAVGNFFAQLPGRIWSIITAAFQAVVNFGFSL
FT                   IGWATTAIPAFISNVVTFFSQLPGQIWGVITAAFQAIVNFGMNLIGWATTAVPQFISSV
FT                   IGFFTSLPGLIWAAIVGAVLFLATWGAQMLNTAASAASSLVSNVITFFSSLPGHIWEAI
FT                   VSAVSILVSWGSQMLSTAKNAASGVVNGIVGFFTGLPGDLENIGKNIVQGLWNGITGAW
FT                   KTITDGVKNLTSGFVSGFKSALGIHSPSRLFRDEIGKMLPPGIAIGFEASMPDAINDMQ
FT                   AQMDAMTAKMQASVAAQQSAVFVGTSGTGAQTVDNSVTKAPVININGPVNVTDQGNQRQ
FT                   TLQQLQFLAAI"
FT   gene            525969..526505
FT                   /locus_tag="Ethha_0488"
FT   CDS_pept        525969..526505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dth:DICTH_1150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26073"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:E6U909"
FT                   /inference="similar to AA sequence:KEGG:DICTH_1150"
FT                   /protein_id="ADU26073.1"
FT                   /translation="MADDLMDQLPDNVAREIPNTEKIELCLKGTNKEWLVCTTAKLYII
FT                   KKGFMTGHTFGSGIYQMPYKNITGVQTEYHALSGYFQVSTGGMADKPKDYWGKGADRPQ
FT                   ESPNCVTITGKTLLARFRAGCDFINNKIADAHAPVTAAQVPSAADELKKFADLHAQGIL
FT                   TDEEFTAKKKQLLGI"
FT   gene            complement(526502..527110)
FT                   /locus_tag="Ethha_0489"
FT   CDS_pept        complement(526502..527110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0489"
FT                   /product="putative protein GP15"
FT                   /note="KEGG: cbl:CLK_1325 putative protein GP15"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26074"
FT                   /db_xref="InterPro:IPR009660"
FT                   /db_xref="UniProtKB/TrEMBL:E6U910"
FT                   /inference="similar to AA sequence:KEGG:CLK_1325"
FT                   /protein_id="ADU26074.1"
FT                   /translation="MNILLDELPEAIDGIPIRSDFRVMVQLELMLGDPDVPQDARLPLA
FT                   LDLLYKQPVHDLKQAIDGLLWFYRCGAPLKQDGAGGGGKQSKRAYDFEVDALDIYAAFM
FT                   QAYGIDLNEVSLHWWKFRSLMIALPEDCKFSRITGYRTMDLSDFKGKERKFYADKQAQY
FT                   RLRPLGMENLTVAAQEQAAKERVAARFAAAETWARERGA"
FT   gene            complement(527107..527490)
FT                   /locus_tag="Ethha_0490"
FT   CDS_pept        complement(527107..527490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26075"
FT                   /db_xref="UniProtKB/TrEMBL:E6U911"
FT                   /inference="similar to AA sequence:KEGG:CLK_1326"
FT                   /protein_id="ADU26075.1"
FT                   /translation="MEINGVTLDLDLDDLDIAQKARDAVADAQKQLDGLQESTDYVTGA
FT                   RKVCEAVNDCFDSIFGEGTAEKLFEGMKFTPHIDAFVTLGDAVFGSMAAIGKNVAAQND
FT                   RMQAVYAKYRPSRTERRHPAKRS"
FT   gene            complement(527504..528007)
FT                   /locus_tag="Ethha_0491"
FT   CDS_pept        complement(527504..528007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmg:Nmag_1329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26076"
FT                   /db_xref="UniProtKB/TrEMBL:E6U912"
FT                   /inference="similar to AA sequence:KEGG:Nmag_1329"
FT                   /protein_id="ADU26076.1"
FT                   /translation="MKLSELMQGKTPSATYAGFATNDDFVLAVDTGDGTTSTADADYAV
FT                   VEAGVTKSEASADAETKDNQYIRTGKKTTKTGTQRKFSIEGDRCDGDAFQDFCLSNAIV
FT                   FGVGAAVERKYIYFNMLTGVGERGTVTIVVSDTQTGDAGDNATFKVDMTSTSTPTNYTY
FT                   SSGS"
FT   gene            complement(528010..528429)
FT                   /locus_tag="Ethha_0492"
FT   CDS_pept        complement(528010..528429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26077"
FT                   /db_xref="UniProtKB/TrEMBL:E6U913"
FT                   /inference="similar to AA sequence:KEGG:CLK_1328"
FT                   /protein_id="ADU26077.1"
FT                   /translation="MSIINSLYEYFKSCPLLGDNKINVDYLPETAREYTIDTITGDPII
FT                   KRYARGATLRQYLYAFGSRDFYGPDVLQNLSNSGFYGDFAAWLDEQNKAKNFPVLPPNC
FT                   VPQKIEAQTSGYLFGADAETARYQIQCRIVYYQEG"
FT   gene            complement(528429..528839)
FT                   /locus_tag="Ethha_0493"
FT   CDS_pept        complement(528429..528839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ere:EUBREC_1294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26078"
FT                   /db_xref="InterPro:IPR021080"
FT                   /db_xref="UniProtKB/TrEMBL:E6U914"
FT                   /inference="similar to AA sequence:KEGG:EUBREC_1294"
FT                   /protein_id="ADU26078.1"
FT                   /translation="MAGNPKIIVKTPRGQVIQTTTKSGKVTAKLTWNPDFGDRKTGDFS
FT                   RAQKFLDSEVLRTTTPFVPIKTGALIKSGQLGTVIGSGQVTWNAPYARYQYYSTSLSRT
FT                   YDAQRGGKWFERSKATNKPAWIAGVKKIAGGR"
FT   gene            complement(528844..529266)
FT                   /locus_tag="Ethha_0494"
FT   CDS_pept        complement(528844..529266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26079"
FT                   /db_xref="UniProtKB/TrEMBL:E6U915"
FT                   /inference="similar to AA sequence:KEGG:CLK_1330"
FT                   /protein_id="ADU26079.1"
FT                   /translation="MTTNADITLFNQWYNRQTRLTEWKRVQIPGVSWRGGVVTTVTDHG
FT                   LQAANAYIVRIPLDAAPAGRTFACPEDWAPTESDDLGALWTIQPGDILINGLLADDIAK
FT                   ASDLTAKYGSRCCTVIGWKDNRRGSAALQHWRIDGK"
FT   gene            complement(529263..529631)
FT                   /locus_tag="Ethha_0495"
FT   CDS_pept        complement(529263..529631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lin:lin0111 protein gp8"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26080"
FT                   /db_xref="UniProtKB/TrEMBL:E6U916"
FT                   /inference="similar to AA sequence:KEGG:lin0111"
FT                   /protein_id="ADU26080.1"
FT                   /translation="MYADYAFYSGAYAGAAVSESDFPALARDASNFIDRVTFGRLKTGA
FT                   PVTDEVRMATCAVIDRMQAAKQSGAMEVNAAVRSENNDGFSQTFNTLSDIRAQFQASFA
FT                   DAAATYLLYTGLMDRSVT"
FT   gene            complement(529644..530819)
FT                   /locus_tag="Ethha_0496"
FT   CDS_pept        complement(529644..530819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jde:Jden_2169 major capsid protein HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26081"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:E6U917"
FT                   /inference="similar to AA sequence:KEGG:Jden_2169"
FT                   /protein_id="ADU26081.1"
FT                   /translation="MPIDRQAAQALIQDQIVNTIFEDVPKQSSTLSLMRKLPNMTSKQT
FT                   RIPVLDTLPLAYWVNGDTGYKQTTRQAWENVWLTAAEMAAIVPIPEAVLDDSSYDIMGE
FT                   VQPRVNEAMGAVIDGAIAFGVGRPSEWQNDIITLARQAGNNVSASGGITYDNIMGQDGL
FT                   ISKVEESGYMVDGILASIKTRAGLRGIKDSNNRPIFVPDMQSGTTYTLDGTPITFQQNG
FT                   AFNATVAQMIAGAWSQAVYAMRQDVTVKILDQGVIQDPNTKEIIYNLAQQDMIALRVVM
FT                   RLGWALPNPATAVNSDRTNVPFAYIEAATPYTDYSVTFTVKDNATDPIAGVRVNVNGAN
FT                   KKTAADGTAVFNLRAGTYPATIKADGYVPQTATVTVTNAPVPVAITLQAAS"
FT   gene            complement(530832..531371)
FT                   /locus_tag="Ethha_0497"
FT   CDS_pept        complement(530832..531371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0497"
FT                   /product="putative scaffolding protein"
FT                   /note="KEGG: lmh:LMHCC_2983 putative scaffolding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26082"
FT                   /db_xref="GOA:E6U918"
FT                   /db_xref="InterPro:IPR009636"
FT                   /db_xref="UniProtKB/TrEMBL:E6U918"
FT                   /inference="similar to AA sequence:KEGG:LMHCC_2983"
FT                   /protein_id="ADU26082.1"
FT                   /translation="MKREDITALGIGDEATVNKIMDLHGADLEKQKNTITTLTAERDGL
FT                   KTQLGEANGKLAGYDPEWKTKAATAQQEADGKVAALQYEFAAATAVNGMKFTSESAKKA
FT                   FLADLVAKKLPLQDGKLLGYDDFTKSYKETDPGAFVSDAPAPHFGGSTPGPAADTLTGN
FT                   DKANAALREAFGRVSQ"
FT   gene            complement(531534..531755)
FT                   /locus_tag="Ethha_0498"
FT   CDS_pept        complement(531534..531755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpc:Cpar_2046 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26083"
FT                   /db_xref="UniProtKB/TrEMBL:E6U919"
FT                   /inference="similar to AA sequence:KEGG:Cpar_2046"
FT                   /protein_id="ADU26083.1"
FT                   /translation="MLQFEESDKTFIRRNLENADALLSGSSLGNVLDALFDLIEEKGYA
FT                   PPHYYDYNDFGRKAQRVYDSVYYLNTQK"
FT   gene            complement(531758..533428)
FT                   /locus_tag="Ethha_0499"
FT   CDS_pept        complement(531758..533428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0499"
FT                   /product="minor capsid 2 protein"
FT                   /note="PFAM: minor capsid 2 protein; KEGG: ere:EUBREC_1286
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26084"
FT                   /db_xref="GOA:E6U920"
FT                   /db_xref="InterPro:IPR009319"
FT                   /db_xref="UniProtKB/TrEMBL:E6U920"
FT                   /inference="protein motif:PFAM:PF06152"
FT                   /protein_id="ADU26084.1"
FT                   /translation="MLAPDWFDTAADDILDLYSQLDQSIMRDFVRRILKSGDITQTARW
FT                   QANALQASGMLYEDVIRAVSAMTDSSTAQMRALFEDGGVEALKVDFSIYEAAGLSPVPL
FT                   RQSAAAAQVLRSGLQKTAGHLRNLTMTTAASTEQAYKDAARLAEMQVESGAFDYISAIR
FT                   NAVRTAAQAGTTVLYPSGHTDALDVAVRRAVLTGVSQTAAQVSLHYADDMGCDLVETTA
FT                   HPGARPSHAVWQGRVFSRCGDRGRYPDFVSSTGYGSGGGLCGWNCRHSFFPFFEGLSTS
FT                   AYPRTKLAEYENKTVPYNGETVPYYEATQKQRAMERAIRATKRELAGYFTGLQAEDEGV
FT                   RNAMREEYNRASVTLKRQEARLKDFTEKTGLNRQREREQSLGFGRSQAQTARQAAEKHY
FT                   RQWTHGIGADGAAPKTLAKYYQKKYNNSPDHELLTGYNRAVKKGDISPLVGFEQYTHTA
FT                   QAVDKEIVGVTTASGVKIESYATHFIDRLIGQTSTSHPDMRMGVPVSDAKDALLNPLRV
FT                   GKTRTMADGDIRQTFYGKNATVSVSVRDKRIIQTNPRRK"
FT   gene            complement(533428..534852)
FT                   /locus_tag="Ethha_0500"
FT   CDS_pept        complement(533428..534852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spa:M6_Spy1364 minor capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26085"
FT                   /db_xref="UniProtKB/TrEMBL:E6U921"
FT                   /inference="similar to AA sequence:KEGG:M6_Spy1364"
FT                   /protein_id="ADU26085.1"
FT                   /translation="MFEKLLRWLRSMLSQMFDQGVGADIILSDRMTSALALWARMYEDG
FT                   GPWCGGKSGIHSLRLPAAIASEIARLVTIEMGVSVTGSARADFLQAQLGPFLDSMRRHV
FT                   ELGGALGGAVFKPYVDGGRICIDAVQADAFFPTTVDTSGQMMGAIFCAQIKRRDMIYTR
FT                   ADHHEFNSGTYTIESKAFASRSSSTIGSPVDLTAVPEWANIQPLVTIEDVDRPLFAYFR
FT                   IPRANKQDRQSPLGVSVYADAAETIRDADEQYGRMLWEYEGGQLAVEMDESMMKHDPDG
FT                   SVSFPRLEQRLYRRRAGDMAEGSNFYQIFAPALRDEAYSRGLNTILKRIEYQSGLAYGT
FT                   LSDPQEVDRTATEITASKQRSYSTVRDIQKALQHALDDLLYSMDTLATLYNLTPAGNYT
FT                   AAYDWDDSIVNDPNQRKQMFWSYVTAGKFPMWRYLVEFEGYTEDEAKTIADETQADFNN
FT                   PFGFAQTPPASGSGDA"
FT   gene            complement(534879..536330)
FT                   /locus_tag="Ethha_0501"
FT   CDS_pept        complement(534879..536330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0501"
FT                   /product="phage uncharacterized protein"
FT                   /note="TIGRFAM: phage uncharacterized protein; KEGG:
FT                   cpy:Cphy_2971 phage uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26086"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="UniProtKB/TrEMBL:E6U922"
FT                   /inference="protein motif:TFAM:TIGR01630"
FT                   /protein_id="ADU26086.1"
FT                   /translation="METKQDRSIRMLNEMVKLGKGPKRKRGAVSTSVMRRARTDFFAFC
FT                   RACAPEFYKPDRAYLVQLCAELQDFYRSGDELLVINLPPRHGKSRTAGLFAQWVFGCNP
FT                   AEKIMTGSYNERLSTQFAKSVRNGIAEQKTDPGMLVYSDIFPGVHIQRGDASANLWALE
FT                   GQYASYLATSPTGTATGFGCGLLIIDDVIKNAYEANNAPLLDNQWHWFTDTMLSRVEEG
FT                   GKIIIIMTRWATGDLAGRAVKTFAEQGRPVRILSMKAFQDDGTMLCPEVLSLQSYENKT
FT                   RTMAPEIAAANYQQEPIDVKGRLYSGFKTYAEIPAISGHPLFDGIYSYTDTADEGSDYL
FT                   CSIIFGVYRHEAYVLDVYYTKEPMEITEPEVAKRQQAYGVTVARIESNNGGKGFARAIK
FT                   QILDDRLHWYSTNVRWFAQTRNKVARILTAAPWIMEHTYYPVNWRDRWPAYYNAMMDYQ
FT                   REGKNAHDDAPDATTGMAETVQAQR"
FT   gene            complement(536560..537054)
FT                   /locus_tag="Ethha_0502"
FT   CDS_pept        complement(536560..537054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0502"
FT                   /product="NGN domain-containing protein"
FT                   /note="PFAM: NGN domain-containing protein; KEGG:
FT                   dae:Dtox_4226 NusG antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26087"
FT                   /db_xref="GOA:E6U923"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E6U923"
FT                   /inference="protein motif:PFAM:PF02357"
FT                   /protein_id="ADU26087.1"
FT                   /translation="MSMYVLQVLSGAEKDVRAALLDQGIPAYAPEENRQIRSGGIWQTR
FT                   PYLLFGGYVFVVVGNVCAMYYRIRRVPGVLRWLELHAGDATALLPDEEALIRRIGSQTF
FT                   ESHVRQLAGDTFEPVDGPLKEYADAGVRILYNRRQRRAFVFEPLSMMHNRCLRMSFTLI
FT                   K"
FT   gene            complement(537051..537623)
FT                   /locus_tag="Ethha_0503"
FT   CDS_pept        complement(537051..537623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_4225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26088"
FT                   /db_xref="InterPro:IPR021874"
FT                   /db_xref="UniProtKB/TrEMBL:E6U924"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4225"
FT                   /protein_id="ADU26088.1"
FT                   /translation="MANRAHGIIDGLNPALRSTVEQMLLSGKSTYADVIDYLARHDVAI
FT                   SAASVCRYAQRYNANAALLNVAQENFSRMMQEMDKYPDLDTTEAIIRLASQNVFAALAN
FT                   TNEDQWNNLDKDKLLDSALGLARAASYKKRTDAAVRAEADVGLDAVKSIVFQAMSKERP
FT                   ELYKQVASFLSEKKRDGSLRPKKEKSP"
FT   gene            complement(537645..537971)
FT                   /locus_tag="Ethha_0504"
FT   CDS_pept        complement(537645..537971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_4224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26089"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z7"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4224"
FT                   /protein_id="ADU26089.1"
FT                   /translation="MDKKELERRIEGGAFAANNGRLLRTINILSGRDIKMRSLQYALPD
FT                   VSKGELAESLYYLQEAGYLHARHAAYGADVDVAEADQDDTEVRLTAKGIQLLKGYAADP
FT                   AVSI"
FT   gene            complement(537964..538302)
FT                   /locus_tag="Ethha_0505"
FT   CDS_pept        complement(537964..538302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_4223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26090"
FT                   /db_xref="GOA:E6U5Z6"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z6"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4223"
FT                   /protein_id="ADU26090.1"
FT                   /translation="MNASNWLNAIPPLILSVLVGIIGFFLKRTIGLVDRHETEISAIKD
FT                   QYVTKEEMDCLQDDLKSGLGKLSEGIDALKDNYMRKDDFVRAIADVNRRQDRIFDVLLE
FT                   MKGDKNRG"
FT   gene            complement(538600..538797)
FT                   /locus_tag="Ethha_0506"
FT   CDS_pept        complement(538600..538797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0506"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_0355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26091"
FT                   /db_xref="GOA:E6U927"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:E6U927"
FT                   /inference="similar to AA sequence:KEGG:CV_0355"
FT                   /protein_id="ADU26091.1"
FT                   /translation="MNLERVTLEDLDGDQRELAELIGMEAYRALATHHGGTYVYVQAPN
FT                   SLLRKDRNEQIRRKFDGKKL"
FT   gene            complement(538858..539295)
FT                   /locus_tag="Ethha_0507"
FT   CDS_pept        complement(538858..539295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0507"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_4217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26092"
FT                   /db_xref="InterPro:IPR009363"
FT                   /db_xref="UniProtKB/TrEMBL:E6U928"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4217"
FT                   /protein_id="ADU26092.1"
FT                   /translation="MNITKQQIKSIYALGAGLHIVGRGHDDELHALVDGLTGKESITAL
FT                   DRDEAQRVIAELMRRMRGTPPVPPARKKPRHYEEAPGGITADQQRKVWALMYELKKIRR
FT                   QAGGRCPWRPAVRDHPAAIRHGLHRKKADAVSGPGRGRRTD"
FT   gene            complement(539326..539991)
FT                   /locus_tag="Ethha_0508"
FT   CDS_pept        complement(539326..539991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_4388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26093"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z3"
FT                   /inference="similar to AA sequence:KEGG:Amet_4388"
FT                   /protein_id="ADU26093.1"
FT                   /translation="MMENEPLFSTEETVLRVGRLVALKAQESKIKAEIGDLQGYFERLG
FT                   IDALENTKEKTVAWWSAAGRVEVGTSEKVDILSETALKTLLQGVFGDLFKEQPVTYQPT
FT                   AACKQLLAAIAAGNYLEGSLDDIVARVADDDKTNKTLRKKLCGNFKRDKKALIDVAGLS
FT                   KTDAEEYAYMAAEIVAYTRFRQLLQAAGYTGTFEAARDIVKAAVVVEEGTKVTVEASK"
FT   gene            complement(539988..540251)
FT                   /locus_tag="Ethha_0509"
FT   CDS_pept        complement(539988..540251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0509"
FT                   /product="SpoVT/AbrB domain-containing protein"
FT                   /note="PFAM: SpoVT/AbrB domain-containing protein; KEGG:
FT                   cby:CLM_2558 transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26094"
FT                   /db_xref="GOA:E6U930"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E6U930"
FT                   /inference="protein motif:PFAM:PF04014"
FT                   /protein_id="ADU26094.1"
FT                   /translation="MTVSKRLGGKGGLTIPQAVRHAAGLAPGAPIDIEDAGDGILIRKH
FT                   VPSCIFCGGTTEVVTVAGKEICLACARELAALAAEKLEDFCA"
FT   gene            complement(540253..540693)
FT                   /locus_tag="Ethha_0510"
FT   CDS_pept        complement(540253..540693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lif:LinJ36.6870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26095"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z1"
FT                   /inference="similar to AA sequence:KEGG:LinJ36.6870"
FT                   /protein_id="ADU26095.1"
FT                   /translation="MELKDAIRQAMTDGSGCIARQIGVMKARYVLLTGGKLLRTESYGP
FT                   LGGLSPLVPWEPDIDDFNGTDWTPVPAAKVAGAPLAPAKPEERGPCTMQDARESVCRAI
FT                   CEMTARGVDLESDGRCASYLADALCKLAEAEANLNTIQKEAD"
FT   gene            complement(540795..541103)
FT                   /locus_tag="Ethha_0511"
FT   CDS_pept        complement(540795..541103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cwo:Cwoe_0992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26096"
FT                   /db_xref="UniProtKB/TrEMBL:E6U932"
FT                   /inference="similar to AA sequence:KEGG:Cwoe_0992"
FT                   /protein_id="ADU26096.1"
FT                   /translation="MRKLAWFWAGILFGAVFSAGGVLAASVGGMSAPGWAAELAVLVLV
FT                   LALGILLGYEFGRHKAYARGYRRGFEAGKNAPPDHPSCRHSFALYCEERPGRISNWN"
FT   sig_peptide     complement(540993..541103)
FT                   /locus_tag="Ethha_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.584 at
FT                   residue 37"
FT   gene            complement(541096..541569)
FT                   /locus_tag="Ethha_0512"
FT   CDS_pept        complement(541096..541569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN3505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26097"
FT                   /db_xref="UniProtKB/TrEMBL:E6U933"
FT                   /inference="similar to AA sequence:KEGG:PSEEN3505"
FT                   /protein_id="ADU26097.1"
FT                   /translation="MDFVSAVKSMWACGATCVCLPIGQGRKMVIRPQSYPQMMAKATFG
FT                   PETRLSVAYRSASLTLNEILAKDWEVFDPAEFAIAPVEPSPKEELKLPETLAAAKNVTA
FT                   VEAAVRRLSDEELYTAADVYAERVAQGQREKTRLRVVLEEIRHRERKRGQAHA"
FT   gene            complement(541576..541863)
FT                   /locus_tag="Ethha_0513"
FT   CDS_pept        complement(541576..541863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nve:NEMVE_v1g211222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26098"
FT                   /db_xref="InterPro:IPR024522"
FT                   /db_xref="UniProtKB/TrEMBL:E6U934"
FT                   /inference="similar to AA sequence:KEGG:NEMVE_v1g211222"
FT                   /protein_id="ADU26098.1"
FT                   /translation="MGLFILGSFFGASAGVTVMCLLQIGKRKGDETLGLWYLSAVESAV
FT                   FLEQLHQADTRDLRIAKAALGSYKAQGYHVADRYQAVKKELNKRMAYGRR"
FT   gene            complement(541874..542824)
FT                   /locus_tag="Ethha_0514"
FT   CDS_pept        complement(541874..542824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0514"
FT                   /product="putative ATPase, transposase-like protein"
FT                   /note="KEGG: dae:Dtox_4216 putative ATPase,
FT                   transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26099"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U935"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4216"
FT                   /protein_id="ADU26099.1"
FT                   /translation="MAQTYDVKLQARVEELIKQCGSQAKASRILGWSDGVISQYRRSDY
FT                   ERGRVDEVEASLREYFRLQDEAAAQAQRAEPFQPVLDTYIPISVSEDIRKAIRFGQLKK
FT                   GITILHGDAGIGKTMAAEKYLRDNPNTAVLITVTPLTGTVGNVMKLICRALHIPEGRSK
FT                   LDMIIDLKERLYNTDKVLIIDEAQHLQVRALDEIRPLSEPHIDGKKGIGIVLIGNSEIY
FT                   DRMEGRRQSCFAQLYSRKRLTRKYTTKQVTPEDIALLFPALEGKKRELNFLRGICQGRY
FT                   GIRGGVNVYNNAVDAENIGIDMLTLQAREMGIGII"
FT   gene            complement(542840..544792)
FT                   /locus_tag="Ethha_0515"
FT   CDS_pept        complement(542840..544792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0515"
FT                   /product="Transposase-like Mu"
FT                   /note="PFAM: Transposase-like Mu ; Integrase catalytic
FT                   region; KEGG: dae:Dtox_4214 transposase-like Mu"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26100"
FT                   /db_xref="GOA:E6U936"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009004"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6U936"
FT                   /inference="protein motif:PFAM:PF09299"
FT                   /protein_id="ADU26100.1"
FT                   /translation="MLTVAQVAQVKGCTPQYVRALIAKGKLEHVLDGDPRNHIRQYLVP
FT                   VTALPEKLQAKYYGRAAPPKTEAITAPQEPPKPLDAYSDEERREIELWIGIVQEWKTYR
FT                   IGRDRKVADGAFVAQMRQRKPELSISTDVLYRRWKAWRDQHYDGLIDRRGKWRKGRYAM
FT                   DETVWECFLSYWFDLRKYPMKQCIHYTQLWCEQEHPELLAGIPSYSAFYRRWKAEIPEA
FT                   LNVLGREGDKVFDDRCGPYLPRIYDDMASNDFWIADNHTFDIISEGENGTRHRLYLTAF
FT                   MDARSGIITGFHITDNPSSEATIYALRAGILQYGIPKYIYVDNGREFLTYDVGGLGHRR
FT                   KKKSADTFSPPPIFARLGITMINAQVRNARAKIIERRFLDFKNQISRLFMTFTGGNVLE
FT                   KPANLKHVLKAGHVPADHRLREVVGQLLEGYFNEQPYNGSVAADKGQNRKDVYYDHLEE
FT                   KRVASADDLTLMLMRSTRLQKVGRMGVHLTIGGFRIDYRDDAFCLRYQGEQVYVRYDPE
FT                   NISSVRVYDEQDRFIAVLQANSNIISGYVTSKEVAKESISKIKSAKKLARQEIKSRVLA
FT                   SMDQVDALDLVLGDAQRNIAARMENGEPDRSVLQIHRVSEEPLMPPRVVNGALPLDTML
FT                   KNAENAQRASQHKDI"
FT   gene            complement(544887..545720)
FT                   /locus_tag="Ethha_0516"
FT   CDS_pept        complement(544887..545720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0516"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="KEGG: amt:Amet_2601 IstB ATP binding
FT                   domain-containing protein; PFAM: IstB domain protein
FT                   ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26101"
FT                   /db_xref="GOA:E6U937"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U937"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADU26101.1"
FT                   /translation="MEQAMKNGLESWFQPLPDQKCPYCGRILHQLTHTVASGQTYLLGI
FT                   YEICDCEGAVRRREQTAAAKAKQEQYRVEQLHQGKVDKLLKAMDIPARYTHCTLQNYSV
FT                   PPGDQRALEMVSAYVERFGAQRKKGMGLYLHGANGLGKTHLAYAIARALCEKEHAVICK
FT                   AAVDILLDFRAVMDGALNETEYTAMRAYVSADLLVVDDLGKEHVTDWSLAQFFGILDGR
FT                   YRQMRPTIVTTNYVDDALIRRLALQSDRETATGIVSRLHGMAYDVPMSGKDYRSQ"
FT   gene            complement(545722..546063)
FT                   /locus_tag="Ethha_0517"
FT   CDS_pept        complement(545722..546063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppe:PEPE_1019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26102"
FT                   /db_xref="InterPro:IPR011741"
FT                   /db_xref="UniProtKB/TrEMBL:E6U938"
FT                   /inference="similar to AA sequence:KEGG:PEPE_1019"
FT                   /protein_id="ADU26102.1"
FT                   /translation="MDKQEEQTVIGRVIAYLNEKTGARYRAEAAANRRHVLARLADGFS
FT                   EQDLLDVIDGMSAAWADSDFARYLRPETLFRSQGKTESYLQEARRRQKKKAAPAATGRF
FT                   RSASDLLED"
FT   gene            complement(546080..546259)
FT                   /locus_tag="Ethha_0518"
FT   CDS_pept        complement(546080..546259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26103"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU26103.1"
FT                   /translation="MQIAKTRARGTPTKPVTVRYELGVYDSIKKYADENSMSIALATES
FT                   LVIKGLKRASRQAS"
FT   gene            546417..546827
FT                   /locus_tag="Ethha_0519"
FT   CDS_pept        546417..546827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0519"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: bay:RBAM_012510 Xre; PFAM: helix-turn-helix
FT                   domain protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26104"
FT                   /db_xref="GOA:E6U940"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6U940"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU26104.1"
FT                   /translation="MEFKDILISLLNQQNKTVYRLSKDIGVSPSLVGYWKKGEKTPSIV
FT                   NMQKLADYFGVSVDYLLTGEKSPETDPPRDPEEAEIDSQITGIKYALSSLDRDAIGDLT
FT                   IGEKKDVLKFINFLKSQRPGAKKKEGNSGDNP"
FT   gene            546811..547230
FT                   /locus_tag="Ethha_0520"
FT   CDS_pept        546811..547230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0520"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   dtu:Dtur_1293 protein of unknown function DUF955"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26105"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:E6U941"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADU26105.1"
FT                   /translation="MVTTLEYLLQKAADNGISVYELSLENIQSMIADLKDMDPAICLSS
FT                   SGISSSREAAELMAHELGHFFTGTYYDSPYCANNRGKMEHKANTWMVKELLPFASLREA
FT                   LKDSCHEYWEIAEYCNCTEHLVETAIQIYQQKGLL"
FT   gene            547641..547943
FT                   /pseudo
FT                   /locus_tag="Ethha_0521"
FT   gene            complement(548502..549299)
FT                   /locus_tag="Ethha_0522"
FT   CDS_pept        complement(548502..549299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0522"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="KEGG: mac:MA3353 IstB helper protein; PFAM: IstB
FT                   domain protein ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26106"
FT                   /db_xref="GOA:E6U942"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E6U942"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADU26106.1"
FT                   /translation="MTELTMERLRENLESLKMKNTLEILDNYLERAVKDELNVVDVLDH
FT                   IFAEEALSKRRRAYEKQVQMSGFPIKKTLEDFDFSFQPSIDKRQIEELATMRFLENGEN
FT                   IVFLGPPGVGKTHLASALGLVAAKHRFSTYYINCHTLIEQLKKAHFENRLPDKLKTLGK
FT                   YKMLIIDEIGYLPMDIQGANLFFQLIARRYERVSTIFTSNKTFSQWNEIFADVTIASAI
FT                   LDRVLHHCTVVNIKGESYRLKERKEYMKQKQRIVNTLFEQGQN"
FT   gene            complement(549296..550517)
FT                   /pseudo
FT                   /locus_tag="Ethha_0523"
FT   gene            550644..550799
FT                   /pseudo
FT                   /locus_tag="Ethha_0524"
FT   gene            550982..551533
FT                   /locus_tag="Ethha_0525"
FT   CDS_pept        550982..551533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0525"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: cbf:CLI_3522 sigma-70 family RNA polymerase
FT                   sigma factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26107"
FT                   /db_xref="GOA:E6U943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6U943"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADU26107.1"
FT                   /translation="MPTDSELIKEILDGSQSAMEVLIRRHYKTVFAFIYRHLGDYHTSY
FT                   DLTQEVFIKVMKSLKYYRESNQFEHWIIKIAVNCCRNYYSSREYADKNSLVPYDEITGD
FT                   TNITNLFDQSSNQQEIKKAILSLSKDQRDAVILFYYSGYKIREISKMTGSNDATVKSRL
FT                   HQALKKLKKIFVGGGYFAER"
FT   gene            551520..552314
FT                   /locus_tag="Ethha_0526"
FT   CDS_pept        551520..552314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cby:CLM_3793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26108"
FT                   /db_xref="UniProtKB/TrEMBL:E6U944"
FT                   /inference="similar to AA sequence:KEGG:CLM_3793"
FT                   /protein_id="ADU26108.1"
FT                   /translation="MQNDDVKKPFGQIEQYLASYQVPYPSEDEISDTIETLRQYVPSKR
FT                   KLLVTRYKTFRRIFVDMLITINFMSVSYWIITILLFTIGYLSAVQFSQNPYKLSFVFAP
FT                   IPMTFGLIEVFRGREEGVTELELSCKISPQEMLITRIIVIGIYTAVLNASLCGFVFLHG
FT                   QANVILWRITLLWLTPMDLIGSITLWFCSRIKGTYSVMLSLFCWSGASYVFVTNEGLFR
FT                   NFLYLNPLCYLIPLFIGIGIFVKEIIKLKDRYIFEGRNSSWN"
FT   gene            552305..553195
FT                   /locus_tag="Ethha_0527"
FT   CDS_pept        552305..553195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0527"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cby:CLM_3792 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26109"
FT                   /db_xref="GOA:E6U945"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U945"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU26109.1"
FT                   /translation="MELKIENLSKQYKKRWAVNNFSISIGEGVYGLLGPNGAGKSTLMR
FT                   MLVDILKPTSGRVLLDNQDIHQMGDSYRDVIGYLPQNFGVYKNFTAHRFLLYLASLKGI
FT                   SRREAEPKIDHLLKFVNLEEMKSKKIHTFSGGMKQRLGIAQALLNDPAILILDEPTTGL
FT                   DPNERIRFRNLLSELSSNKIVLLSTHIVSDVEYIAKDVIVMKKGQLLRQAPSAELIDEM
FT                   QGKVWKVKVTESRLMELKQQYVIGNILRHKHDVEVKIIADEAPEPGAISTEPDLEDYYL
FT                   YHFGEEAIQDGTFSA"
FT   gene            553176..554327
FT                   /locus_tag="Ethha_0528"
FT   CDS_pept        553176..554327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_3519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26110"
FT                   /db_xref="UniProtKB/TrEMBL:E6U946"
FT                   /inference="similar to AA sequence:KEGG:CLI_3519"
FT                   /protein_id="ADU26110.1"
FT                   /translation="MELFRHELYKVFTRKMVWIGLIFATVLVLFSSFATSSQLTQMYGN
FT                   MNGFYKNFYSGNEGPITDQLRQKASEWIKTDGKALNLKIATGQATVQDKQTLAFYSQIA
FT                   QPDTLTSNRADKISGLKSDEQKANDGYDQKKANLNIAMLNGIQTSSLYFTLPLGNDIEF
FT                   PIGLGFVVMGILILLGVSPIFTDEYSTNMDLLILSSKRGRRSVVTSKILSTVVYCMAVS
FT                   LFVLLLNFLIQVASLGIHGLNAPIQLNSVFTDSPYAITYGNYLIIQFGLSTLACVFFGL
FT                   LVLFVSSVSVNVLLPFFICGALFASTAFINSLGSAVPTALAEFSNLSYTELMRVDELFK
FT                   SFKTYNLFGQPVLYLNLTIGLYIIITALAICLTYIIFKRREAK"
FT   sig_peptide     553176..553286
FT                   /locus_tag="Ethha_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.841) with cleavage site probability 0.612 at
FT                   residue 37"
FT   gene            554644..555048
FT                   /locus_tag="Ethha_0529"
FT   CDS_pept        554644..555048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0529"
FT                   /product="rna polymerase, sigma-24 subunit, ecf subfamily
FT                   (ecf subfamily rna polymerase sigma-70 factor)"
FT                   /note="KEGG: cdl:CDR20291_1754 rna polymerase, sigma-24
FT                   subunit, ecf subfamily (ecf subfamily rna polymerase
FT                   sigma-70 factor)"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26111"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9C0"
FT                   /inference="similar to AA sequence:KEGG:CDR20291_1754"
FT                   /protein_id="ADU26111.1"
FT                   /translation="MEVHININGQSVAVDVSVEVFAYMDRANHKDENLSHEKRRHWDRR
FT                   EFDEYIVSHECSRSYYETPEEWLCRKETVHEITAALETCTAKQRYRFLLFALEGFSCSQ
FT                   IGNICGCSKSGIQRSIEEVRKKVKCALQAE"
FT   gene            555163..555594
FT                   /locus_tag="Ethha_0530"
FT   CDS_pept        555163..555594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_0264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26112"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9C1"
FT                   /inference="similar to AA sequence:KEGG:CKL_0264"
FT                   /protein_id="ADU26112.1"
FT                   /translation="MPKLNLRKYYPFLSEDCFIEVSDEIAEAFLLSKRQEDNYHHRTWY
FT                   HKAYYSLDCNDGIENSILHTEPSPEEILVQKVSMQQLYEALDHLPPIQAWRVYAHYILG
FT                   MKKIDIARAEGVNSSGVCDSVKKGVKNLRRYFEKKKWME"
FT   gene            555613..555843
FT                   /pseudo
FT                   /locus_tag="Ethha_0531"
FT   gene            556029..557474
FT                   /pseudo
FT                   /locus_tag="Ethha_0532"
FT   gene            complement(557523..557798)
FT                   /locus_tag="Ethha_0533"
FT   CDS_pept        complement(557523..557798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0533"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="manually curated; TIGRFAM: addiction module toxin,
FT                   RelE/StbE family; KEGG: clo:HMPREF0868_1572 toxin-antitoxin
FT                   system, toxin component, RelE family; PFAM: plasmid
FT                   stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26113"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9C2"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ADU26113.1"
FT                   /translation="MDIVWTTQFKKDYKLAMKRGLKMDLLDNIIRQLSKGQLLPEKNRD
FT                   HLLTGNWVGYRECHIQSDWLLVYRIENGVLVLTLSRTGSHSDLFGE"
FT   gene            complement(557801..558076)
FT                   /locus_tag="Ethha_0534"
FT   CDS_pept        complement(557801..558076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0534"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="KEGG: clo:HMPREF0868_1571 putative toxin-antitoxin
FT                   system, antitoxin component, ribbon-helix-helix domain
FT                   protein; TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26114"
FT                   /db_xref="GOA:E6U9C3"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9C3"
FT                   /inference="protein motif:TFAM:TIGR02384"
FT                   /protein_id="ADU26114.1"
FT                   /translation="MANTTNFSVRMDSDIKKQCEALYSELGVNLTTAINVFLRQSLRSG
FT                   GFPFDVTLNTPNAVTLAAMQEAERLAKDPNAKRFSDVEEALRELKK"
FT   gene            558365..558541
FT                   /locus_tag="Ethha_0535"
FT   CDS_pept        558365..558541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_2706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26115"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9C4"
FT                   /inference="similar to AA sequence:KEGG:Glov_2706"
FT                   /protein_id="ADU26115.1"
FT                   /translation="MPKMSKKRKLEWQFFLTPRNRMTYNPLCRKCAHSCKQSFRADVAD
FT                   CPRYLSKRAKRSY"
FT   gene            558541..558741
FT                   /locus_tag="Ethha_0536"
FT   CDS_pept        558541..558741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fma:FMG_0969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26116"
FT                   /db_xref="InterPro:IPR026990"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9C5"
FT                   /inference="similar to AA sequence:KEGG:FMG_0969"
FT                   /protein_id="ADU26116.1"
FT                   /translation="MNGEKIVNINAADSVVPLSTQEDERPALVKKIGKTTYRVKIHFST
FT                   TSRETMNDKIKRMLRNEAQRI"
FT   gene            558795..558953
FT                   /pseudo
FT                   /locus_tag="Ethha_0537"
FT   gene            559004..559141
FT                   /pseudo
FT                   /locus_tag="Ethha_0538"
FT   gene            559348..560679
FT                   /locus_tag="Ethha_0539"
FT   CDS_pept        559348..560679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0539"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Ferric reductase domain protein transmembrane
FT                   component domain; FAD-binding 8 domain protein; KEGG:
FT                   dak:DaAHT2_1231 oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26117"
FT                   /db_xref="GOA:E6U9C6"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9C6"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADU26117.1"
FT                   /translation="MIKRIFSLAAYFLAPVLLVAVIFSSNPGYYGSVGFVPMVLGAVAY
FT                   TLLNAQLILSARPKWIESAFGLDRFYRFHSLMAVIAIILAFAHKLLEGKAFPESFQTKL
FT                   GDMALVLFIGVSALALVFMADTLIRLFRPLRWVRSLFVRLKVGKYNVQRILHNASVAAV
FT                   VLVFVHVILTYSAHDPLVKAFYILYFGGAMGFYLYHKIFRKLLAGKWFTVETVVPESGS
FT                   MTTLLLKPQNGAVFPYLPGQFGFLRVFQHGISSEEHPFSISSQPLEKEHLRMTIKNLGD
FT                   WTSGVQKIEPGSKVLLDAPYGRFSPPLYDCREGIVLIAGGVGITPMLSILRYYAQADRR
FT                   QKIMLLWGVNRQEELICQSELRAMENEMEHFMFLPVANDPGFAGKKGYITRELVERTLR
FT                   EQNADIQKQHYFFCGPAPMWASIRKNLKTMGIRERMIHAERFSL"
FT   gene            560714..561097
FT                   /locus_tag="Ethha_0540"
FT   CDS_pept        560714..561097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0540"
FT                   /product="cytochrome b5"
FT                   /note="PFAM: cytochrome b5; KEGG: bpf:BpOF4_20214
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26118"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9C7"
FT                   /inference="protein motif:PFAM:PF00173"
FT                   /protein_id="ADU26118.1"
FT                   /translation="MKKHTFLLPAATLAVVVFLAGCAANQSAASPSAAGTTSVSAASSA
FT                   VSSSSSAQKVFTLSELKQYNGKNGNPAYITVNGVVYDVTNAKDWSGGSHHGYSAGQDLT
FT                   QAIQQSPHGTSVLKSLPIIGKLQ"
FT   sig_peptide     560714..560800
FT                   /locus_tag="Ethha_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.366 at
FT                   residue 29"
FT   gene            561177..561431
FT                   /locus_tag="Ethha_0541"
FT   CDS_pept        561177..561431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0541"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: ttj:TTHA1730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26119"
FT                   /db_xref="GOA:E6U9C8"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9C8"
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /protein_id="ADU26119.1"
FT                   /translation="MMYFGRGFGGCLGYGSPFGGIGGILMGVVCVLLIAAMIVFVVRAL
FT                   KKAEHSRPSTGAMEALRLRYAKGEITEEEYLRIKKTLEQ"
FT   gene            561431..562174
FT                   /locus_tag="Ethha_0542"
FT   CDS_pept        561431..562174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0542"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: cby:CLM_1197 DNA-binding response regulator;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain-containing protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26120"
FT                   /db_xref="GOA:E6U9C9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9C9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU26120.1"
FT                   /translation="MRHRHIPRRCVTMGGGGDGMQYTVMIVEDNAEIRGIVTKYLDAEG
FT                   YIPLFAKDGFEALALFAQRLVHLVLLDVMMPGIDGFEVLRELRKISDVPVILLTARQEE
FT                   TDRLNGFDCGADDYVVKPFSLKELMKRVNALIRRVYHDADGIVYRYRDLSLHTRAMKLY
FT                   KGDAEISITAAEYALLDAMFRHPGQVLSREQLIELAFGSRYEGYDRNIDSYIKRIRQKI
FT                   EDDPKNPQILITKYGAGYRFGGAEK"
FT   gene            562171..563610
FT                   /locus_tag="Ethha_0543"
FT   CDS_pept        562171..563610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0543"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: clj:CLJU_c40260 putative sensory transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26121"
FT                   /db_xref="GOA:E6U9D0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU26121.1"
FT                   /translation="MTLRRQWLILLTLTAVLAVGIHSVVLGSLINRYFQAYTTANYQKN
FT                   LAQIKQFSQKTLMEKSYTIEQLDTQLSSYLSDPILRIRLYDAKGGLLADIGGAEAAEGM
FT                   MSGMMEQMMSGSGARQVDSTPVVVSGTVLGRLLITRYETVGDSLVNAKFRDALIRDSLC
FT                   SFGIVLVALVFVGLFVSRRMSRDLTRTASMALDIDMDKQANGPLSNIREVRVIQQSLLE
FT                   LQSRLRLRQIGRKHLVDELVHQTRTPLTILKTHLEAMQDGMLQITPDVMQTCEAQIEHL
FT                   SSIITNMRRMLDAERENRPLHIETFDFSPFIRQILSGLKLQFGRKQVELRLLNQNKAVL
FT                   TTDPYLLSQCIYNLLTNAYKFTEPGGRVRVSYERSGESFSVCIKDSGVGISPEEQGHLF
FT                   DAYFKGSNVGSDSGDGLGLYVVKQNLDRLNGSIQVESAPGQGSSFLIRITDGRRKYWPS
FT                   RCKTSTGTGCRHHKPSAAHHR"
FT   gene            complement(563883..564659)
FT                   /locus_tag="Ethha_0544"
FT   CDS_pept        complement(563883..564659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0544"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rop:ROP_70730 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26122"
FT                   /db_xref="GOA:E6U9D1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU26122.1"
FT                   /translation="MTKNTYPFHQKVVLITGGGSGIGRAIACAFLENNATVVIIGRRME
FT                   ALRETLASYPKERTLAISRDISEPQAAAQIVAEVLKRFGHLDVVVSNAGAYASGDLVDL
FT                   DKKTWEHLCSVNIDALFYLAQAAFPALRKVSGTLVATSSVSGLNGDWKQAAYNATKHAV
FT                   SGFVRSLALDWGGEGVRVNAVAPAFTITDMTADVAGSPEQLVPFIDRIPLERPGTPEDI
FT                   APVVLFLASPDAAYITGVVLPIDGGTSASTGQPHLL"
FT   gene            complement(564656..565375)
FT                   /locus_tag="Ethha_0545"
FT   CDS_pept        complement(564656..565375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0545"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   kfl:Kfla_1474 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26123"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU26123.1"
FT                   /translation="MSGQLNKQKVLVIGGSKYLGLAIAKQASEAGAEVVIGARNPEQAS
FT                   QAAAQLPLASAIRVDITDEGTIAAAASQLGHVDHVVITASAHHNVRVQDLEHDKIVTAF
FT                   EAKVIGPLLLAKHFAPIISPAGSILLFSGVAAWKPSPEYTVMGVTNGAVAFLVSQLAKE
FT                   LAPIRVNAISPGITDSGTWNVLGKQNKRELLESASVSSLVGRAGTADDIADAAIWLLGA
FT                   GFVSGETIHVEGGTRHT"
FT   gene            565622..566494
FT                   /locus_tag="Ethha_0546"
FT   CDS_pept        565622..566494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0546"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bmd:BMD_1434 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26124"
FT                   /db_xref="GOA:E6U9D3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU26124.1"
FT                   /translation="MISLEQIQYFLAIVRYGSLNKASEHLYISQPSLSKQLQHLEKELG
FT                   CKLLIRNYDGIEATSPGKLFYEQMSGILEEFDRAIDKVRHFDEVRQLRVGGLGNLVTYF
FT                   LPRYIERLKAGGRNQVTVDTRFSNEELVKGVESGKFDLVLLSNAEPQQNLAVIPLMTEP
FT                   LYVVFPVAHPLRCQQSISFMEIVLHEKLVLYKDPCTIRASIRRQCNRMKVTPNIVLELD
FT                   LTESLLRYVSHGDGITLLPSIVAKGIQDPSIATREISRIPIYREISVAMKKENVPSYLP
FT                   MFSENIKAF"
FT   gene            complement(567055..572592)
FT                   /locus_tag="Ethha_0547"
FT   CDS_pept        complement(567055..572592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0547"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="KEGG: lrh:LGG_02087 N-acetylmuramoyl-L-alanine
FT                   amidase; TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; PFAM: metallophosphoesterase; Ig domain protein
FT                   group 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26125"
FT                   /db_xref="GOA:E6U9D4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D4"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ADU26125.1"
FT                   /translation="MKKRVKRKLAAAAVAISICAAQILSSVDVYALGPVDIQSSVFKSI
FT                   IDETKTTISPDVGQKTFTYINKGDNNRVACYEADVDLSNKNASLVVGMPNDGTSYGMQT
FT                   VRDQASAAEKNGKNIVAAVNGDFYDMSTGEPVSLIVKDGVELHASNNSSGFFGIKKDGM
FT                   AVIGDASTYNQIKGDLQEAMSSNQLLVVNGKTVGSSTDLEPRTAVGIRADGSVFFIVID
FT                   GRQSPYSEGITLTDLSQLMLDDGAVQAANLDGGGSSTFASRTPGDTDLTVKNSPSDGNE
FT                   RTVANSWLIVSNAVSDGQFASAAITPGDQTYTPGATVQFAAKGVDASGAPAQLPGGLSW
FT                   SLSDPSYGSIDQTGKFVSGGKTGQFQVQLSSNGKVVGSAWAEVAVPDSLQFLQSELSLK
FT                   FNAQQDLGLTATYKGRTVTLHSGDIQWTYNTAMGTIDDSNIFHAGGQSASGTVTAQFSG
FT                   TNLTASINLKVGQLPVVLYDFEGNLDDWSTSTAGRGEQCSISLAKYPNDPVRFGQQSLR
FT                   IDFDNTNAQKSTTLGDYAGPATSVPVPGTPTAIGMWVYATPEAQGYWLRMYVYDKNGSV
FT                   KPLDITPQSGVNWTGWKYCEAAIPSTYQGPFTTFPKQMIRIMSLKSGIVGPMTKGSIYV
FT                   DNIRAVYGANVDDLTAPVIDSVNVDGKTYNTSSVNITTAIHDVSEPNESGINWDRNRIW
FT                   VDGVEYTNAQDHYSYDKDGTFSLSGYQWADGVHHVHLSIQDNFGNETDKDVYFTVKTSN
FT                   GTGISLNPQGASAPLGGTYLFTLNADDLSNVTGATATVNISEAFPVTGVDFAGSAAGST
FT                   YQYDVSTGNVTLNIKNSGAAKGSGTLATIHVAVPAGTAQGGTIPYSVTSGAATFTAAQG
FT                   GTFNATFSCTAGAIPVSSSLNVSLGQMVVGADGQLTVTTADGKPAAGADVTFTPAGGTA
FT                   QDLGKTDADGNLSSAVPTQTAQKFTLSAQLDTAYSFPTAGQSFNPQKGAAPSNLLAGST
FT                   QDPTTEKTFTWMTNPLQGGGKAIMQVAGQDDYAKNGDSAFADYTGTCKLITYTADSSAV
FT                   TLNSVTATGLTAGTTYAYRVGDGTNWSDVRTFTTLKPDDSNLTFNVFGDTQVSDTAGLS
FT                   ALDGFITDIENAPVKSDFALHVGDFTDDQSIFNEMDITANMLSSHSIFDSMDFIHVMGN
FT                   HELQGDDGTKSAAILGMPNSNGPDCDKTGTYSVDYGNMHIAVLGWTGDTTQMQEKLDWL
FT                   RKDMNASHKTWKMIATHQPTFNTNPSDGSTMFYDMLPQVCDELGVDIVFNGHDHAYGRT
FT                   YPIYDKTPATSDPANCNNGTVYIAAGHSGDKTYDIDPVQPDAFVTHQQEANKDDAVYLT
FT                   CSVDKNKMHLVVHDSQNGETTDDVTLTAHKTDKTALQSAIASAQALDGAAVVGNYEGNY
FT                   PQSAMDSMKSAINAANAVNSDDNATPEDVAAAVTALNTAVATFQSAVVTVDRTQLNTLV
FT                   SNAEKLDSTKYTPNSWKPFGDALTAAQTVLAGHPRQEDINEAFNALLTAQNSLVFAADK
FT                   SALQQIVTLAKNTDTSNDKPARVKALTDAVAAAQAVLDDPNAVQTEADNAVAAVLQALT
FT                   NLQEIADRTDLNALIVTVQKLDGSKYTNASWQSLQTALSAAQAEAADLDNNASDIQTAY
FT                   SNLAGAVNALVTVSNKAALSNTVSLAGQVLANAGSYAPATLQGISDLVAQAQALLVQND
FT                   ATQSAVDSADSALLNALAKVRVKADKTDLAKLVDATSKMDLTKYTAASAETLRQELTAA
FT                   KTALTDENITQDAVNQLTGSLQNAVNGLVPVSAGNGTTSSNDASSHSNASNPKTGAAQS
FT                   SALPVAAAGGLVGACAFVVVLFRRRKKESR"
FT   gene            complement(573246..573788)
FT                   /pseudo
FT                   /locus_tag="Ethha_0548"
FT   gene            complement(574063..574404)
FT                   /locus_tag="Ethha_0549"
FT   CDS_pept        complement(574063..574404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_0005 type IV secretory pathway, VirD4
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26126"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D5"
FT                   /inference="similar to AA sequence:KEGG:CLL_0005"
FT                   /protein_id="ADU26126.1"
FT                   /translation="MFPVYTVFCTVFFVFHKTFLHSFPYRLVNNPGTAFPITIASGLAY
FT                   MPKLVGESDSFDFVNKQAIRALVIGTTRSGKDMRIILNTIRLAGQGRNRESFLVFDLKG
FT                   EDFESWYTF"
FT   gene            574434..574934
FT                   /locus_tag="Ethha_0550"
FT   CDS_pept        574434..574934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0550"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_6414 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26127"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D6"
FT                   /inference="similar to AA sequence:KEGG:SACE_6414"
FT                   /protein_id="ADU26127.1"
FT                   /translation="MRCAWGGVTISSKGYGHSYLYLPEQKKAPHLRAKNMAVADIEPLF
FT                   VNCLKNEILNGKLIKNTADAILQACKDDGVGKANAIRPEISATGKKIENLMHTLEDGLD
FT                   NDMVRNRIIGHQAHLKILRDRPVAAQPAPTVTCEKLIEKLSRDRNLLLSDPLISGRRFG
FT                   NVL"
FT   gene            complement(575137..578406)
FT                   /locus_tag="Ethha_0551"
FT   CDS_pept        complement(575137..578406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0551"
FT                   /product="Ig domain protein"
FT                   /note="PFAM: Ig domain protein; KEGG: tva:TVAG_495790
FT                   surface antigen BspA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26128"
FT                   /db_xref="GOA:E6U9D7"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D7"
FT                   /inference="protein motif:PFAM:PF07523"
FT                   /protein_id="ADU26128.1"
FT                   /translation="MKMLKKRSQSLFSSRVWKQTALRAGAIAVSFAVLLSSLNLFGLNV
FT                   SADTGASADFLTYYDLNIEDGIVTGYTLKPIYNILTVPSDLSLAIPSNVTGIGDNAFDR
FT                   CNLTSVTIPSSVTSIGDYAFASCRFTSVTIPSSVTSIGAFAFVGSTLASLTVPSSVTKS
FT                   VSAFEGCDDLTSVTLAPGTTQIGDYEFNYCAGLKSVTIPDTVTSIGNLAFAGCPFANII
FT                   IPSSVNTIEGSFENCSNLKSIDLPGVTSIEGESFSGCTSLTSVGFSSHLTYIGMQAFAD
FT                   CQSLTSVIIPSSVTDVDYEAFDGSGLTSITFESATTTIGEGQSGYKDNVGVTLPASAVI
FT                   YGYDPSTAKDYAAEYGRTFKPIAEAPVTLESIAITTPPGKTSYVVGESLDITGLVVTGT
FT                   YSDGSTKVEPITSANISGFDSSAPKDSETLTVIYVGKAATYTVKIESFVSKALILGTDT
FT                   STFTNNYNDFFNTSDVSNYTISDHLFNKLVECVEDKYTNDNDYSSVVNDLLNERNSAWG
FT                   GSCFGMSSAMILSKLGNINIQNFDSYNPNVSNFSDLNKPKNDSHVRDLINYYHLSQYIP
FT                   AISDKIVNAVNPKLTGDTEQISQSVMGSIVQKAKAVASGGMPFVLQVGQISNGQPDNHA
FT                   IICNGYLKDSDGYHELEIIDPNDTTKFETLKIADDFMSYQFSDDPLTINASNWNEIGYM
FT                   DTDALRFIDIDGQDNNNPYIVSGPDTNSSAGETETLTGTYFDLGAADGFSISDASGSTF
FT                   TRAQSFAQSGSLVPDSEVPLSDGVGGEMRYHFSTAGTYTVTPEGKAMKVSALDHNSFAS
FT                   VNETGAADMVFKSNNAVDINGSSFSYTASVPDPTSDGNIQVSSNSGANVSISQNAQGVI
FT                   VSSPHLQNLTVGTVREPDGENTTQTVSTDKTSILIKDKTGDSTGAVQVFVSSKNDGNYD
FT                   QLLGTTNIPPSSTTYSLVYAAGAGGTVSGSAKQTVSQGADGTSVAAIANAGYHFVKWSD
FT                   GFISATRQDKKVTGDIRVTALFSADSSSSNSSTGTYGGISTSTPESNQMSSSNSQAAIV
FT                   NPQTGDERMNWYMVILSLILAGTAIGITAFSVLIKKKAKRR"
FT   gene            579237..585098
FT                   /locus_tag="Ethha_0552"
FT   CDS_pept        579237..585098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0552"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; Ig domain protein
FT                   group 2 domain protein; KEGG: lrh:LGG_02087
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26129"
FT                   /db_xref="GOA:E6U9D8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D8"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU26129.1"
FT                   /translation="MKKSYLRRQYAILKKTAAIVLCFVVVASSVIYKGPRALADDSDST
FT                   GIGTIQSAEIKELTPGLNYQVTESSNTDGLQKSHTLTYNPKTASVKPEVTSGQYIWGAE
FT                   TVAQMAAEQSGTVVAAVNGSFFDINNGTPRGEVIENGELTSCVEGYDRTGTTTYPSTGT
FT                   KKNGYALVGFRKDGTFACGVGNYSIKYTVKGADGTIKTNNWDIDYFNKYYSPMTSWKYL
FT                   FSSKYGTSTHTDAPGTEIVMDVQSGTMQLGGIVTAKVVEKKLNSTDTPIGANQLVLYAA
FT                   NQSNKFSDLSDSHINVGDTVTISVSDLNESTNHFADSNNPVVNAVTGLAVPIVENGQVT
FT                   QDASQYADEQTLNPRTAIGVKADGSVVLFQVDGRQDGWSEGMNGVGIGEYMVQQGCERA
FT                   CFLDGGGSSTTLVRQPGDDSLSLANRPSDGSERADSDCILLVSTATVTHQFASAYVTPS
FT                   QETVPPQSTVQFSAKGRDSSGASADLPSSGLQWSLYDNSYGTIDATTGAFVSNGKLGKV
FT                   NIILKYNGNEVGSASLEIENPDSFTSSANNVTMQPGDTKSLGLTATYQGHTVKFTKSDV
FT                   TWSIPDNLGTVDNDNNFVAGTTCGSGNITAKFNNTNLSVTIHIQVGQDPVVVENCESLT
FT                   DDTTAQSLWTSFPGKRGEQVSVGASTYPDSPVRFGNHSVRVDFDFTQAQKNTTLTAHAG
FT                   PKTVTESAQGTPTSFGVWVYGTPETQGMSLWFGFVDGNGNDFGMYMPPETGEPYIANLG
FT                   QIYWEGWKYISIPIDTSAHPGPIKLQDNGYAIDLISLKSGTTGGGPMTKGSIYFDNFRF
FT                   VYGTANDDLYAPIIDSVNVDGKAYNSSSVNISANIHDDTSDKYMSGINWDRVRVLVDGK
FT                   DYTSDKQHFSYDKDGIVYLSGYQWSDGTHKVTVDIQDNFGNETTKDVYFTVNTGNGSKL
FT                   SLEPQANSVQLGGTGGLVLKADDMSTVTGATATVTIGKGYPVTSVDFAQSAAQSTYQYD
FT                   ASTGNLTLNIQNRGAAQSAGTLATIHVSAPNTVAQGSSIAYSASGAFTLTSQTSTSFIS
FT                   SFSASGSLSVAAGLNITVGQMVVGSPGTMTVTTADGKAAAGADVTFLSADGTKTDLGTT
FT                   GADGTLQSTVPTQTAQKFTLWASLGDAYSFDTSGQSYNPQLSATPQNLLAGSTQDASTE
FT                   KTFTWMTNPLQGENKAVMQIALQSDYEKNGESAFKHYTGTRQLITYSSDSSAVELSSVT
FT                   ATGLSAGTTYSYRVGDGTNWSDVRSFTTLKADDDRLTFNVFGDTQVTNTSGLSDFSTFL
FT                   SQIESAATKPAFSIHVGDFTDDQTNFSEMNMTANMFSQHAAFDSLDAIHVLGNHEYMGD
FT                   DGTKSAAILGLADSNGPDCDKTGTYSVDYGNMHIAVLGWTDNASDMAKKMDWLRQDMKS
FT                   TNKTWKIIATHQPTYNKNPDDSSTLFYDTLPQVCDELGIDIVFSGHDHSYGRTYPIYNK
FT                   TAVTTDPTNCNSGTVYISAGHTGDKTYDINPVYPDAFAKVQAEANKDDKVYLTCTVNSN
FT                   KMNIKVTDSENGATSDDVTLTAHKADKTALQSGITTAKALLAGAQTGDGKNEYPQSAVN
FT                   GLSSAIIAAQTVNTDDDATPEEVCAAISSLGAAVNTFKSNVVTVDETALDTLVDTAGQI
FT                   SDSNSYTVASWDTFQSALQAAKGVQQELNPTQQEIDSAYNVLDAAQKGLASSGDPTSLN
FT                   VEIALTGAYQQSDYTADSWSGLQKALESAQSAISARSGQTTLDAALVALKKAVNTLAET
FT                   GTKRDTGTGVTLTVPEGTLPVGSSMHVSQIQSGKDYHTAAYAVRDVSSKFVLYDISVLL
FT                   QNGTVWEPSSNISIQISLPIPAGYDTSRLAVYYIDDNGNKEMQKGHVENGYYVFMAQHL
FT                   SRYLLAEVNNTSSEETSSDNNSTGSTSSSSTSTSSASTSSAASASNPDTGSSSVPTAVG
FT                   VLALVLGTGVFLLKTGKKKK"
FT   gene            585308..585481
FT                   /locus_tag="Ethha_0553"
FT   CDS_pept        585308..585481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0553"
FT                   /product="protein of unknown function DUF1540"
FT                   /note="PFAM: protein of unknown function DUF1540; KEGG:
FT                   cce:Ccel_0727 protein of unknown function DUF1540"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26130"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D9"
FT                   /inference="protein motif:PFAM:PF07561"
FT                   /protein_id="ADU26130.1"
FT                   /translation="MMEAPSMKVKCGVENCHYNRQNMCHANNLEVNTMSDKVSASTSDE
FT                   TCCSTFVDHSTK"
FT   gene            585642..585782
FT                   /locus_tag="Ethha_0554"
FT   CDS_pept        585642..585782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26131"
FT                   /db_xref="GOA:E6U9E0"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9E0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU26131.1"
FT                   /translation="MVLLGIFVYFIFAILGILLYFNGKDVPSDLPKSDTPDIAATEKIN
FT                   R"
FT   gene            585779..586822
FT                   /locus_tag="Ethha_0555"
FT   CDS_pept        585779..586822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0555"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: hmo:HM1_1689 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26132"
FT                   /db_xref="GOA:E6U9E1"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9E1"
FT                   /inference="similar to AA sequence:KEGG:HM1_1689"
FT                   /protein_id="ADU26132.1"
FT                   /translation="MTDALTIRIPQRSTNGVLILADYNCAENGTGRMWLLQRKQAFCFV
FT                   GKGAIMKKGHIAILSAAAILAGAMLIPPVQAATISALSVFRVSDTKTITISMTDIQALS
FT                   AKIKQPGENKTKSAAQSDAISQQLDAYAKSEVQPLGSTKEFHAFSIYLPEGEALGTPKL
FT                   YSISSQTKTVTLDTQKLNAELAKAGASPLSETYNGTKISIVTPPAAIAAYADATLLETQ
FT                   GAYIDAPAKEVDALWSSLTSATAIPADLRSQLAAIDPTSRDVYLPVIEGLGRQTDIGVT
FT                   TGYLYSAKDLAQLSSAIPNFPAAETLSKLQSDNTTVLIWTKNGILYALAGKKSDSALTQ
FT                   IARSIHS"
FT   gene            586819..587730
FT                   /locus_tag="Ethha_0556"
FT   CDS_pept        586819..587730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0556"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: clj:CLJU_c25890 putative ABC transporter
FT                   ATPase; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26133"
FT                   /db_xref="GOA:E6U9E2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9E2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU26133.1"
FT                   /translation="MIIEAVNLSKKYQNKLVVDSVSFSVEKGQVYGFLGPNGAGKSTCI
FT                   KMLMGLVFPTSGKGQVLGKPLGDVSARMKLGYLPELFRYQEWMTGEDLLDFHSSLFRLK
FT                   PDRQRNAGVLRRVGLLGQEKYKVGSYSKGMQQRIGLACALLPNPELLFLDEPTSALDPI
FT                   GRKEVRNIILDLQKEGTTVFLNSHLLSEVEAVSDYITIINKGSVVRSGAIHDLLMKQIN
FT                   LKVTCSPIAEELFSNLKQHFDAELKPQGPDGTLYFRLTNTDSVHEIASFLISQGLELYE
FT                   LTPQHETLESLFLNAVGEGSAT"
FT   gene            587727..588581
FT                   /locus_tag="Ethha_0557"
FT   CDS_pept        587727..588581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: clj:CLJU_c25880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26134"
FT                   /db_xref="GOA:E6U9E3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9E3"
FT                   /inference="similar to AA sequence:KEGG:CLJU_c25880"
FT                   /protein_id="ADU26134.1"
FT                   /translation="MKSIMTVTLKEAIRKKTFLVMGIITVLYLIFWVAILNYFQNAHLS
FT                   SRSVDFKPLASIMLTQTVLQFSSMIMCLLTIVLGAGAVSSELETGMIHAMLSRPLGRAE
FT                   YILGKFFGLAILISAYATGLMAAILIIGRAYSLDTIIALSFPQIVQSWLIYICVPLAVL
FT                   CVTLYGSISLKTVPNGLLMIFVYILGNIGGIVEMIGNYINSKVINSVGILISLISPFHT
FT                   LYASAERVLLPSSGIAGELVRGAGGLTGSGQPASVVMYLYIAFYAIGFLLISIRKFRKL
FT                   DIT"
FT   gene            590206..590979
FT                   /locus_tag="Ethha_0558"
FT   CDS_pept        590206..590979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0558"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: cdl:CDR20291_0671 DeoR-family transcriptional
FT                   regulator; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26135"
FT                   /db_xref="GOA:E6U9E4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9E4"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADU26135.1"
FT                   /translation="MVQERLEKIKALLSANGMVKANELTRQLGVSIETVRRDLEFLEKC
FT                   GLLKRVYGGGIANNTRGIERNYSSRECLHMDEKRAIAKKTASLVNDGDALVMDLGTTTL
FT                   EVAKCLADKNELTILTNSLPVGMEMVKNRSCHVYMLGGELRDGDFSTSGLLATSGLSNF
FT                   RVDKAIFGASGVSPKNGVTDYHVEEANVRRRMMEIADKVILCTDSSKFAISAFVHVCDV
FT                   TDIDVIVTDSGVSQQMVDAFDGLAVELSIAQVTDL"
FT   gene            591147..592280
FT                   /locus_tag="Ethha_0559"
FT   CDS_pept        591147..592280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0559"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbe:BBR47_00210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26136"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9E5"
FT                   /inference="similar to AA sequence:KEGG:BBR47_00210"
FT                   /protein_id="ADU26136.1"
FT                   /translation="MKMKKQKAAALLMALVLASGALAGCKTSTTGAASTASGSTNDLNS
FT                   MSLAQITAEAKKEGSLQSVGMPDDWANWGDTWTQYTAKYGIKHQDTDMSSAEELAIFQS
FT                   EKNNPTKDIGDVGQSFGPLAVQKDLVQAYKTPYWNDIPSWAKDKDGKWIVGYYGTISFM
FT                   TNTDSVKNPPKSWSDILNGNYKVCVGDVTKANQSQNAVLAAAIAMGGSEKNIQPGIDFF
FT                   AKLAAQGRLDMGDSSMTRLEKGDVQVVILWDYLSLGYRDKVKQSGSTVNYDVTVPTDGS
FT                   VEGGYAEVINKYAPHPAAAALARDYILSDQGQINLAKGYARPIRSDVKLPADVKAKLLP
FT                   DSEYKKARPVKDFDAWDKTAEQLPEMWQEQVLSKQKS"
FT   sig_peptide     591147..591218
FT                   /locus_tag="Ethha_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.902 at
FT                   residue 24"
FT   gene            592356..593168
FT                   /locus_tag="Ethha_0560"
FT   CDS_pept        592356..593168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0560"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: bbe:BBR47_00220 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26137"
FT                   /db_xref="GOA:E6U9E6"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9E6"
FT                   /inference="protein motif:PFAM:PF01663"
FT                   /protein_id="ADU26137.1"
FT                   /translation="MGKVIFVVLDGLNLAASRHMGFMEHLAETGVAQKCTVRAELPTLS
FT                   RPLYEVLLTGVPVFEHEVFSNSICRLSKEQHVFSLARAAGRTTAAAAYYWMSELYNRAP
FT                   FAPADRFQLDVDRPIQHGIFYFEDSYPDSHLFCDAEFLRLAYRPDFLLVHSMNVDDAGH
FT                   KYGGDSAEYAAAAAKADGILAHVIKDWLADGYAVVVTADHGMNASRFHNGTSDEERLVP
FT                   LYIAGVPVAGEDAACMQQLAVAPLLCELLGVPKSSKMLRQGPFTIRES"
FT   gene            593174..594028
FT                   /locus_tag="Ethha_0561"
FT   CDS_pept        593174..594028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0561"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bbe:BBR47_00230 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26138"
FT                   /db_xref="GOA:E6U9E7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9E7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU26138.1"
FT                   /translation="MKKIGKCLLPLLPFLLLVFLFELLPIVMMAVTSFQSQTTGGFTLL
FT                   NYWNIFTKRYYWEAIINSVSISVFSSLVGIGVAFLGGMALQNVSGRTKNAFSTLLNITS
FT                   NFAGIPLAIAYVVLLGNTGILVLLGKTCGWQWLAGFNLYSINGLGLIYIYFQIPVSTLL
FT                   LMPAFAGIRGEWMESAELLHASRWRFWFHVGLPVMLPSLVGTFCFLFANSMAAYASAYA
FT                   LMGSNFSLMTTLISSMISGDVFPQYGLSSALSVVMIVLVGAAILISHWLSNRDGKGEGA
FT                   HEA"
FT   gene            594018..594797
FT                   /locus_tag="Ethha_0562"
FT   CDS_pept        594018..594797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0562"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bbe:BBR47_00240 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26139"
FT                   /db_xref="GOA:E6U9E8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9E8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU26139.1"
FT                   /translation="MRRKPVVSIIILCVIGVFLVVPLIAMIGYSFFDDRGFTLQFYQSF
FT                   LGMADFLPMLANSIWLSAVSVLLCMVILLLALFAVLVYAPGLEKYLQILCMVPYSIQGV
FT                   ILATSLLTLYANADGFFSNRVLLLVLAYCIVILPYMYQGMRNSLHTIAVRQILESAEIL
FT                   GAGKLYTFWFIIVPNILSGITVSILLSTGIVFGDFAVINLLASSYIETMMMYMARARSL
FT                   SGHQTSAVVIVFFAVMGLLAAGMLAFAGRKQVKKEKG"
FT   gene            594826..595836
FT                   /locus_tag="Ethha_0563"
FT   CDS_pept        594826..595836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0563"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vex:VEA_000665 spermidine putrescine transport
FT                   ATP-binding protein PotA; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26140"
FT                   /db_xref="GOA:E6U9E9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9E9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU26140.1"
FT                   /translation="MSYIALESIEKRFGKQHVLKNIHLELGKGEFASLLGPSGCGKSTL
FT                   LRCIAGLETVTSGSICIDGIDVTGRSPKERAVGMVFQQYSLFPNMTVEQNIGFGLKMMH
FT                   VPKQEIRERVRAMLDTVALTGSEKKKPAQLSGGMQQRVALARALITRPKVLLLDEPLSA
FT                   IDAKLRKDLQTEIRRIQKETNITTVFVTHDQSEAMLMSDTIHIMHEGVIEQSGCPSDIY
FT                   VAPKTPFAAGFIGNYNLLSAAAFQKLTAAEIEGENVAIRPEVIGISKEKPDCDEDTICA
FT                   QGVVVESLLHGNILSYQVRCGDCILKTDVLYRTVDRFENNAPVWLCFSGKDFVAL"
FT   gene            595866..596591
FT                   /locus_tag="Ethha_0564"
FT   CDS_pept        595866..596591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0564"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="KEGG: pjd:Pjdr2_0215 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1; TIGRFAM: HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26141"
FT                   /db_xref="GOA:E6U9F0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F0"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADU26141.1"
FT                   /translation="MKEEIKGVLFDKDGTLLDADSLWVPVGEDVADAVVQRGGMGSEGR
FT                   AVVLERIGVSGGRIIPNSPLASGTTRDVAQAACMVLRERRIPCAVDALSRELHAVIVES
FT                   VPRHAQHIRPLGDLQRLFLFLKRRGIKIGLATSDLYETAVICLTKLHVLEFFDFVGADT
FT                   GSERPKPAPDLLNRFCSTCGLRAEEVAMVGDSRVDMQMAKDGGAGLAVVIGERDMENAD
FT                   YRITTLDDLVVENERLLWA"
FT   gene            complement(596655..596849)
FT                   /locus_tag="Ethha_0565"
FT   CDS_pept        complement(596655..596849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26142"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU26142.1"
FT                   /translation="MPQILYSDMVGITIMRSVNRLLYLKTAVGQAFCEQPRQNKTACIK
FT                   QTAWACHKRLTQAVCFGYL"
FT   gene            complement(597354..598328)
FT                   /locus_tag="Ethha_0566"
FT   CDS_pept        complement(597354..598328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0566"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="TIGRFAM: mannose-6-phosphate isomerase, class I;
FT                   KEGG: eel:EUBELI_00149 mannose-1-phosphate
FT                   guanylyltransferase; PFAM: mannose-6-phosphate isomerase
FT                   type I"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26143"
FT                   /db_xref="GOA:E6U9F2"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F2"
FT                   /inference="protein motif:TFAM:TIGR00218"
FT                   /protein_id="ADU26143.1"
FT                   /translation="MKQELIRYPMKMTPAFKDYIWGGDILTTRFHKDSPYARTAESWEL
FT                   SCHPAGQSTIADGPYAGETFVAYADLFGKEVLGKNCERFSEFPILIKLIDANDNLSIQV
FT                   HPDDAYALKYEHGFGKTEMWYVVDCVPGASLIYGFKKEISAEEFRKRIAENTLLDVLNT
FT                   VPVHKGDVFMIRSGTIHAIGKGCLVAEIQQSSNLTYRVYDYGRIGKDGKPRELHVEKAL
FT                   AVTSLHPVAEETKSETEHLDGYSRQTLASCPYFTVDLLNVERTAALDVTDVSFQALTCP
FT                   DGALSLKNGDHVLKMHAGDTVFLPAGSGAYTLTGNGRVLLTHL"
FT   gene            complement(598378..598635)
FT                   /locus_tag="Ethha_0567"
FT   CDS_pept        complement(598378..598635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0567"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="KEGG: cpy:Cphy_1769 phosphotransferase system,
FT                   phosphocarrier protein HPr; TIGRFAM: phosphocarrier, HPr
FT                   family; PFAM: phosphoryl transfer system HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26144"
FT                   /db_xref="GOA:E6U9F3"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F3"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADU26144.1"
FT                   /translation="MLSFTHTITDPAGMHARPAGLLAKCTQKCSSTVNISLNGKTADAK
FT                   RLFAVMGLGAKQNDVLSFTVTGESEAADCAAIEAFCKENL"
FT   gene            complement(598638..600053)
FT                   /locus_tag="Ethha_0568"
FT   CDS_pept        complement(598638..600053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0568"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="KEGG: lrl:LC705_00323 PTS system fructose-specific
FT                   transporter subunit IIC; TIGRFAM: PTS system, fructose
FT                   subfamily, IIC subunit; PTS system, fructose-specific, IIB
FT                   subunnit; PFAM: phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26145"
FT                   /db_xref="GOA:E6U9F4"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F4"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ADU26145.1"
FT                   /translation="MKIIGVTKCPTGIAHTYMAAEKLARAAKELSYDAKIETQGASGTE
FT                   NKLTDADIKEADYVIIAADVTIDGKERFAGKKLLELPIKPVIKDPVGILKSLETEAKVY
FT                   AEKSVDSPAKSNAAGGSAVIKQLMNGVSHMIPFVVIGGLFIATSLAFGGHATSSGLVIS
FT                   SPFWQKVNAIGGISFNYLMYPILAGFIAFAISGRAALAPAMVCALVANDKTILGTNAGM
FT                   GFLGAILVGYLAGYLVKWFNSWKVPKSIQPIMPIFVIPILGIGIISAALILVLGAPISW
FT                   LMTALQHVLKLLSLNPSTSIVLGLLLGAMVGVDMGGPINKVAFLFGVASITSGNPQIMG
FT                   AVACAIPVPPLSMGLATLIGKKYFDEDEQTAGIPALLMGLIGITEGAIPFASADPKRAL
FT                   PSVIIGSSIAGAVGMLFGITDVVPHGGPIIGILGATNNIALFFLTIAAGSVIAALLAVF
FT                   LKSRYFKAQAKGE"
FT   gene            complement(600132..600593)
FT                   /locus_tag="Ethha_0569"
FT   CDS_pept        complement(600132..600593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0569"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: lrl:LC705_00322 PTS
FT                   system transporter subunit IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26146"
FT                   /db_xref="GOA:E6U9F5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F5"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADU26146.1"
FT                   /translation="MIENLLKPESIFFDVEVPSTSKTDAVKTVSKLCSTYGNVKEDTLL
FT                   KIFMDREEVDSTGFGGGIAIPHAKISGLKNPFVAIIRFKEPVDWDAIDDEPVKVAIALV
FT                   MPSGDKNNLHLEVLAKLSRKLMDETFVQKLVNETTPQNLYDFMIKELEG"
FT   gene            complement(600656..602590)
FT                   /locus_tag="Ethha_0570"
FT   CDS_pept        complement(600656..602590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0570"
FT                   /product="transcriptional regulator, MarR family"
FT                   /EC_number="2.7.1.69"
FT                   /note="KEGG: cdl:CDR20291_2852 putative transcriptional
FT                   antiterminator; PFAM: regulatory protein MarR;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26147"
FT                   /db_xref="GOA:E6U9F6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F6"
FT                   /inference="protein motif:PRIAM:2.7.1.69"
FT                   /protein_id="ADU26147.1"
FT                   /translation="MIFVDFTGKFNITERQFKILHILNSSPNTTVKYISEFLKVSPQTV
FT                   KTELLNLKPLFSHYNILIDLEKNNQIQINEPARLPRLMNSAGVLLQFPLKKRILLMLVL
FT                   NTGFLTLQDIADELYVSKSLVEKQMKDLLKTYSSEVKSLRHYGFRYIASQFKRREIFVM
FT                   LVSPYVQGLDFEESLENFNNIHFPIMRYFTHGDIEKALKIVAYIQQLKNLLFTDKAIGQ
FT                   MFLYQLIVTRNRRLSENTQIGDDFVPIMRQLPYFSQYMSLSEETDRAMQLALPKNEKYY
FT                   LCYLLINLKKQHVLNSQEIVNDMRPFILDSFAQIKNHLSLDFSGNEKLLEGLALHIHTT
FT                   LSANDNHYAGNNYGWDEMKGEYPLGFEAATVMAQMILSKYGKCVTDNELIYLTIHFQNA
FT                   IEQMYMGYEKIRAVVICHYGVAAANLIRAKVEKLYPEIDVTNLFSLQEFNQAGKIDCDL
FT                   IITTEKLEANGIKVIYVSPALKQSELKQFQEFIEDKKSKDFLKQIIREAIVLDLSEVAT
FT                   KYEIISKMAERLEKEQIVTSQYKQSVLEREEISSTDYQAIATPHGNPHYVMKTKLCIAR
FT                   LTKEVEWGDAKVKYAFMLACSTDLLKSSQSTFSLFYHLLTQTKFENFLVEVGDIPPAEF
FT                   LHEFVKLLY"
FT   gene            603760..604122
FT                   /locus_tag="Ethha_0571"
FT   CDS_pept        603760..604122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0571"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: amt:Amet_1464 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26148"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F7"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADU26148.1"
FT                   /translation="MKIAIPSEGKELGSPVCRFFGRTSFFIIADTDTLEFQVLDNDASA
FT                   AQGGAGVKAAQTVADSGVQAVVTFHCGENAAEVLEGADIKLYKAVAGTIAELIEKYKNG
FT                   VLQELTEIHPGYHDHG"
FT   gene            604248..605087
FT                   /locus_tag="Ethha_0572"
FT   CDS_pept        604248..605087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0572"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY3440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26149"
FT                   /db_xref="GOA:E6U9F8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F8"
FT                   /inference="similar to AA sequence:KEGG:DSY3440"
FT                   /protein_id="ADU26149.1"
FT                   /translation="MRIAVLSGKGGTGKTFVSSNLAAAIQDFTYLDCDVEEPNGHLFLK
FT                   PKVMNAWTVSVPVPEFDAEKCSGCRKCVEFCRYHALAFIKGKPRLFPEICHSCGGCSLL
FT                   CPSGAITETERAIGVIEKGNAEGVAVFTGTLQNGEATGVPIIRKLIRSAPTTGNVIIDC
FT                   PPGSACAVMESIVNADYCLLVAEPTRFGLHNLSLVTQLVQLFQKQCGIVVNKAVGAEDL
FT                   IEQFASTQHIPVLCKIPYDAHLGALNAEGMLAVKEERYKKLFVNLYHRILEEAGGAA"
FT   gene            605084..605959
FT                   /locus_tag="Ethha_0573"
FT   CDS_pept        605084..605959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0573"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /note="KEGG: dhd:Dhaf_1984 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26150"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F9"
FT                   /inference="similar to AA sequence:KEGG:Dhaf_1984"
FT                   /protein_id="ADU26150.1"
FT                   /translation="MRQLVILSGKGGTGKTTIASSFVRLAEHKVFADCDVDAPNLHQIF
FT                   GFGKVPEEKPFYGLNKAVKDDTVCTNCGKCEALCRFGAIENGKVNPYACEGCGVCEAVC
FT                   PAKDREGKAAIRLEERESGKTMLYNENGQVFSTAELFMGNGASGRLVTEVRRNLFQAAR
FT                   GEKYAILDGSPGIGCPVIASVTGVSMVLVVAEPTVSGMHDMKRIVETARRFGTKIAVCI
FT                   NKFDVSNTNTNAIKTFCGEEEIPMIGLIPYDRAVITAVNSGKAVVDYEDSMAGRAIRKI
FT                   WERAKKMLVS"
FT   gene            605970..606389
FT                   /locus_tag="Ethha_0574"
FT   CDS_pept        605970..606389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0574"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   cth:Cthe_1260 4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26151"
FT                   /db_xref="GOA:E6U9G0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G0"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADU26151.1"
FT                   /translation="MITETKLIVRYAETDQMGIVHHAVYPIWFEAARTDFLKQAGMSYS
FT                   KMEADGLLLPLAEMHCRFKASAHYEDEIVVKTEIKKMTYAKVVFEYKVYREADRRLLVE
FT                   GGTVHACTDRSLKPINVAKSFPELYQAIYTLSTKE"
FT   gene            606396..606764
FT                   /locus_tag="Ethha_0575"
FT   CDS_pept        606396..606764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0575"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: amt:Amet_1467 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26152"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G1"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADU26152.1"
FT                   /translation="MKIAVACDGKNVSGHFGHCEGFELFTEDGGNITECKFYQNPGHKP
FT                   GFLPNYLNDLGTNTIIAGGIGGGAIEIFNEKNIEVIAGARGDAAEAVEQYLKGQLKSTG
FT                   SVCHEHEFESTCEEHDQH"
FT   gene            606860..607705
FT                   /locus_tag="Ethha_0576"
FT   CDS_pept        606860..607705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0576"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: hor:Hore_18400 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26153"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G2"
FT                   /inference="similar to AA sequence:KEGG:Hore_18400"
FT                   /protein_id="ADU26153.1"
FT                   /translation="MLDFQILTDNIVNRPHLLAEHGLSLWIRDDDKQILFDTGQTSVFL
FT                   QNALSLGIPIQNADAIVLSHGHYDHCGGVVSYPFGDSKTKLYIGSNAFETKLSVKGGAI
FT                   RNIGIPWGRAFFDRVGDRIVEIKNGDEIFTGIHVLGGIARYNDYEKVSECFYTERDGQK
FT                   SRDTMEDEQLLVMERKDRLAVFSGCSHKGVINCVEHVRTKFPGKRIHTLVAGMHLQGVS
FT                   KERLDATIEYFVNSEIERIIPLHCTGIEPICELKRALQDRCLICAVGDRIVIDEGTRWV
FT                   "
FT   gene            607696..607869
FT                   /locus_tag="Ethha_0577"
FT   CDS_pept        607696..607869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26154"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU26154.1"
FT                   /translation="MGLIAGISVCNQKTVIHVPVRVDDRLMFFIPIRTLHSAWDQFKKS
FT                   GSFRTNANDFYI"
FT   gene            complement(607883..609367)
FT                   /locus_tag="Ethha_0578"
FT   CDS_pept        complement(607883..609367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0578"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: cbe:Cbei_4936
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26155"
FT                   /db_xref="GOA:E6U9G4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G4"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADU26155.1"
FT                   /translation="MAVKKMYIDGKWVEGSSGKVIDIVNPATGNVFSQVYESSLDDTRQ
FT                   AIAAAKRSFYETREWRDMDSQKRGDLLLKIADKIEEHAAELAKLDTMDNGKPLREAEGD
FT                   IDDGIHTFRYYAGLIKAPYGGAYDVNSNFGPMHAYTVREPVGVCAQITPWNYPFLMSVW
FT                   KLAPALAAGNSVVFKPSPKAPLSTIRLFEIFEEIGLPKGCANLLQGDAEVGAELGQNTD
FT                   VDMIAFTGSTRVGQSLMRAAAGNVKRIGLELGGKSPNVIFADADLDGAVEWAMIAIFFN
FT                   QGEICSAGSRIIIEESIKDAFVKRLAERANAMTIGNGLDNPDIGPLITEKDMEKVLGYI
FT                   HSGVEQGAMLVCGGERYTEGECASGFFVRPTIFDDCTSDMKIVREEIFGPVVTVQTFKT
FT                   EAEAIALANDTEYGLAGAVFTSDVTRAMRVIREIRAGITWINCYNPTFNEAPWGGYKRS
FT                   GIGRELGVHGLEEYQEIKQINLNLAPGPIGWYPERT"
FT   gene            complement(609946..611343)
FT                   /locus_tag="Ethha_0579"
FT   CDS_pept        complement(609946..611343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0579"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   clj:CLJU_c20470 4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26156"
FT                   /db_xref="GOA:E6U9G5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G5"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADU26156.1"
FT                   /translation="MLPKETISAAKPQLLRDALPQIRTQLPGPKASAVLARRSAAVPNA
FT                   IKTVYPCVIERGEGAMIEDVDGNIFLDWVGGVGVLNIGYSQPEVVQAVQEQAGKYFHAM
FT                   MNIVTHEGYVRLAEKMNEIAPIRGARKKTMFANSGAEADENAVRIAKSFTKRPNIIVFS
FT                   GAFHGRTLLTLTMTSKKVYSSGIGPYPDGVYRADFPYLYRAPKGYSKDEAIAYYMERLE
FT                   RAFDEASPAEYVAAIVLEPVQGEGGFIPAPIEWVQAVRKLCDEKGILLIADEVQTGFAR
FT                   SGKMFVSNYWEEAGCAPDILATAKSIAGGVPLSAVTARAEIFDGIKPGIIGGTYGGNAL
FT                   ACASALKVIEIMERDHLCERAQEISHTCMSVFNGWKEKYEEVGDVRGIGCMMGIEFVTD
FT                   KTSKHPNARLVSDIIQNAVANGLIIEGAGIYSNVLRFLCPLVVTDAQLNSGLAILESAI
FT                   QTSLAGQ"
FT   gene            complement(611381..612511)
FT                   /locus_tag="Ethha_0580"
FT   CDS_pept        complement(611381..612511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0580"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   cbe:Cbei_4354 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26157"
FT                   /db_xref="GOA:E6U9G6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G6"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADU26157.1"
FT                   /translation="MEFQYYLPVNLIFGREKVNRLGETASLYGKKALIVTGRNSTKKTG
FT                   LLDRATDSLKKAGIETVLFDKVEQNPLTSTACQGAALSRASGCDVVVGIGGGSAMDSAK
FT                   AIAFLSKNEGDISDYIFGKKVSDQALPIVLVPTTCGTGSEGNGFAVLSNPENHDKKSLR
FT                   CNAIVPKASIIDPELMTTMPRHILASVGFDALCHNMEAFISRIGQPMTDILSAEGIRLL
FT                   GKYLIRAYTDPADLDAWDHISWGSTLGGMVIHTAGVTAPHGMEHPASGLHNIVHGGGLA
FT                   ALTPAVYEESISGAPEKFALISRSLGGKNETDCVDQIRHLLAQLHLSTHLGEQGIQNGD
FT                   IDWMVENCMKVSAAGIANHPVVFDREALRNIYRKAL"
FT   gene            complement(612767..613318)
FT                   /locus_tag="Ethha_0581"
FT   CDS_pept        complement(612767..613318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0581"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: ere:EUBREC_0101 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; Cupin 2 conserved barrel
FT                   domain protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26158"
FT                   /db_xref="GOA:E6U9G7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU26158.1"
FT                   /translation="MDYLNENIAINLKKIRKAKKLSLDALATETGISKSMLGQIERGEA
FT                   NPTIATLGKIVSGLRVEFMDLVGPPHDEVYIMRKDTLIPIKSAKDAFRNYAYFPYEPDR
FT                   DFEIYSVEVEPGGSYPCSSHGEKTTEYNIVFSGQLTVEMGGTRYILNEGDAIRMDADKE
FT                   HCYYNAGKGILRFYMLFTWK"
FT   gene            613824..614558
FT                   /locus_tag="Ethha_0582"
FT   CDS_pept        613824..614558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0582"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="KEGG: cbe:Cbei_4943 response regulator receiver
FT                   protein; PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26159"
FT                   /db_xref="GOA:E6U9G8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G8"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADU26159.1"
FT                   /translation="MKQLETNDWLVLNSIIYKIYTMEDFDGMRKTLLEQLKMVLDFDSA
FT                   DFFLANTDGKPGLIRPVAHNCDCIYPQTYDELDYSRGIMYGGKSLIYRETDIISDEKRM
FT                   ETTYYKKVYIPNNWHFSLQMILAREKDFLGVITFYRTIGKDNFHYDDIFLLDMLKDHLA
FT                   FRLYQERESKSTDKLTVTQAAEQYGLTRREETILGLLVEGEENGAICEKLVISINTLKK
FT                   HMLNIYRKMGIKHRVQIFKIIQ"
FT   gene            614776..615126
FT                   /locus_tag="Ethha_0583"
FT   CDS_pept        614776..615126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0583"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   cbe:Cbei_4942 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26160"
FT                   /db_xref="GOA:E6U9G9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G9"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADU26160.1"
FT                   /translation="MKELVLVIRPEMLEVLKSILDDVHCGGMTVSSVMGCGTQKGVVEG
FT                   GINEIKGFKMNINLLPKIRVEVVVEDDVVEEIISSVRERMATGHVGDGKIFIRNIDGVV
FT                   RIRTGERGVKAL"
FT   gene            615150..616259
FT                   /locus_tag="Ethha_0584"
FT   CDS_pept        615150..616259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0584"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; KEGG:
FT                   cbe:Cbei_4940 spermidine/putrescine ABC transporter ATPase
FT                   subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26161"
FT                   /db_xref="GOA:E6U9H0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H0"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ADU26161.1"
FT                   /translation="MGKNIMVHIQDVSKSFGENRIVRNLSMDVYEGEFLTILGSSGCGK
FT                   TTTLRMVAGFEHPTSGRILVQGVDIADKEPYERDVNTVFQSYALFPHMSIFDNVAYGLK
FT                   MKKVPKKEIRERVMSMLELVQLDGFQKRMPSQLSGGQKQRVAIARALINHPKVLLLDEP
FT                   LGALDLKLRKQMQLELKRLQRKLNITFIYVTHDQEEALSMSDRIAIMHDGVLEQVAGPE
FT                   EIYEAPASKFVATFIGETNLFEGVISNMADGNVSVTIESGLIQCRGAGFHEKDIVAVSV
FT                   RPERMQFSTSSVDGFSLEGVVKEQVYVGSILKAIVVLPNGYEVKLERLAGDALPMNGAV
FT                   YLYWRPEDARLIHLQDQVVYHAVENVKLA"
FT   gene            616272..617138
FT                   /locus_tag="Ethha_0585"
FT   CDS_pept        616272..617138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0585"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cbe:Cbei_4939
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26162"
FT                   /db_xref="GOA:E6U9H1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU26162.1"
FT                   /translation="MGKPSKRTDAGQIAVMVGPVTLWLAFLVAVPLVYVFIMSFCSLDQ
FT                   NYNVVFRFTLENYRRLLDWDYIQVYGQSILIAFLATAICIVLAYPFAFLIARTFQSKKT
FT                   TLYMMVIIPFWTNSLIRIYGWRTFLGANGMLNKLLMALHMTGGPVQFLFTRGATVLGMV
FT                   YVLFPFMVLPLYTAIEKLDQSQLEASADLGARGGSTFWHVILPQTTSGVFSGCIMVFIP
FT                   CLGYFYVSDILGGGNTNVIGNLIERQFQSGNNWPLGAALSIILIAITLLLVKLYQKCGG
FT                   DMQSLGV"
FT   gene            617143..619077
FT                   /locus_tag="Ethha_0586"
FT   CDS_pept        617143..619077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0586"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; extracellular solute-binding
FT                   protein family 1; KEGG: cbl:CLK_3773 putative
FT                   spermidine/putrescine ABC transporter, permease
FT                   protein/spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26163"
FT                   /db_xref="GOA:E6U9H2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU26163.1"
FT                   /translation="MHGQTRETFRRKSGAVYCGLIYAFLFLPIAVIIINSFNANTFKPY
FT                   FRWTGFTFDWYVKLFQNTGLLQSFGNTIFLALATTVLSVMIGTVAAVGIYKFRFRGKDI
FT                   INGLLYIPVVIPEIVLGIALLSLFSKVGIPLGMLSLLLAHVTFCIPYVIFNVRARLDGY
FT                   DRSIEEASMDLGATRLHTFLRITLPVLAPGIGGGALLAFTLSIDDVIISYFTNGQTMTF
FT                   PLKVMASIKSGVAPDVNALSTLILLVTTGVVALVQTGLLKKFVGKVGTALSALFYIGRD
FT                   ELDTKQRAVRRRRGVGTALAIAIVAGVLLSVGKNAGTSAVGRNGQLNLFIWTEYVPDSV
FT                   IQNFEKETGIQVNVSNYSSNEDMLAKVKSEKAGAFDIVQPTDYMVQQMIGQGLLQKLDK
FT                   SALTNMKNIGSSYLNQYYDPNNNYSVPYLGGVAAIAVNTQKIKDRITGYADLFNPKYKN
FT                   SIVSLDDYRAVIGMTARSLGMSMNETDSAKLDEIKTQLMKLKGNIKLYDSDSPKSALIS
FT                   GDATLGFCWNAEITLAMEENPAIKIVFPKEGAYVFVDNWCITKGAKNVRQATAFINYML
FT                   KAETAKEVSEEYPYMQPNAAAVELLGSAYKNNPARNVPQDVIKKGEHVANLDVNTLARY
FT                   DAMWTDLKK"
FT   gene            619409..620761
FT                   /locus_tag="Ethha_0587"
FT   CDS_pept        619409..620761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0587"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   cbe:Cbei_4934 putrescine--2-oxoglutarate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26164"
FT                   /db_xref="GOA:E6U9H3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H3"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADU26164.1"
FT                   /translation="MSYADVSKDLERVIGYIHADKLTDEEKETMTRETLHYFDEYVSPG
FT                   WLKYRKSVSTNSAVLEWTDRDSVLDGMNGEEFIDCLGGFGIYTCGHRNPEILDTVKAQL
FT                   DHQALHSQELLDPLRGYLAKAVADITPGDLGKCFFTNGGAEAVEMSLKLARIATGGRWF
FT                   VSTVSAFHGKSMGAISVGGKNTFRIPYTPMVQQVVHVEYGNAEDTRKAVRNLQAVGEKV
FT                   AAVIVEPIQGEAGVIVPPEGYLKELRAVCDECGVALIFDEIQTGMGRTGTMWRCEVENV
FT                   TPDILIFGKAFGGGIMPITGLICRPPMWTQQLIDNPWLLGSPTFGGNPVCCSAALATIK
FT                   FMIDHDIPGQAKRKGAVLKAGLQKLKEKYPAVIVDVRGEGLMLAVEFEKSEIGYSIAKG
FT                   MFARGVLTAGTLNNSKTVRFEPPAVITEEQIEKVLARMDEALAETEREFAR"
FT   gene            620985..621185
FT                   /locus_tag="Ethha_0588"
FT   CDS_pept        620985..621185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26165"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU26165.1"
FT                   /translation="MIDVCTNRHKLLACVKCPGSVNCPEYAGKAKKYKPQSQSEEKWDV
FT                   PMKTDSFSERPGWVPTAVREG"
FT   gene            621412..622161
FT                   /locus_tag="Ethha_0589"
FT   CDS_pept        621412..622161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0589"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: bmq:BMQ_pBM70141 DNA-binding response
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26166"
FT                   /db_xref="GOA:E6U9H5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU26166.1"
FT                   /translation="MSYEKRPICSGRITGIFKKGMAMQNRILIADDDREIVEVMDDALR
FT                   DEGFETVRAYNGKQVLEQLSGEKPIDLFILDIMMPEMDGLETLRHIRERTDAPVLILSA
FT                   RGREIDKVIGLRVGADDYVSKPFSVDELMARVGAHLRRENKHRQSAPVTGIGALKLDPS
FT                   SWTVEVDGKPVELSGKEFQILSYLLINAGQTVSREQIYAAVWKDAFGGDLSTVTVHIKN
FT                   LRDKLGAEGRRIRTVWGIGYRLERDLP"
FT   gene            622158..623477
FT                   /locus_tag="Ethha_0590"
FT   CDS_pept        622158..623477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0590"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: pjd:Pjdr2_4498 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26167"
FT                   /db_xref="GOA:E6U9H6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU26167.1"
FT                   /translation="MKHSLRFRLPVLFLVLFVCFLATLLVSISAFFRDEVRFDIARQTQ
FT                   SYQNTVTALARAASAYSSEDDIIRYLAAHTPDDRKVELYDDQNKLLWSKGQVRAVLQIS
FT                   VGDYILSRSGARYGLRVSGNYPGRAVLFEDYASRWLWIILLLFALLFLGMALALHFTIT
FT                   RPILALYRRMEADPLHNKARARSCRRDEIGGLEQRFDQMLERLQTEDRQQQTMLAAISH
FT                   DLRTPLTSILSYTERLAVGKVQDEQKRRHYYDVIHRKAQDIQVLIDHFQEAAEAGSFDR
FT                   KLQLETVPAAAFWKAACEACTEGWDAAQAVLEWNGDVNASAVLRLEPLSMRRVLANLLE
FT                   NARKYGARPLRVRVSLTVREHMLHLRVENNGAQVPEEKLPLLFDRFYRAEPSRSRERGG
FT                   SGLGLFICREIVEQHGGSIRAYKPWDMDFGVEMCLPLVES"
FT   gene            623575..624282
FT                   /locus_tag="Ethha_0591"
FT   CDS_pept        623575..624282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0591"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cpy:Cphy_2590 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26168"
FT                   /db_xref="GOA:E6U9H7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU26168.1"
FT                   /translation="MSEPIIQFEHITKQYHMGEVVIDALRGVDFTINKGEFAIVAGPSG
FT                   AGKSTVLNILGGMDTPTDGHLLVDGQDISRFDRKQLIAYRRKAIGFVFQFYNLVPNLTA
FT                   LENVELAVEICDHPFSPRKVLEQVGLEDRMQNFPAQLSGGQQQRVAIARALAKNPTLLL
FT                   CDEPTGALDSGTGRAVLKLLQDTCRRTGMTVVLITHNLAIAPMGDRLIHIKNGVVERME
FT                   TNPHPKTVDEIAW"
FT   gene            624276..627530
FT                   /locus_tag="Ethha_0592"
FT   CDS_pept        624276..627530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0592"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ele:Elen_2177 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26169"
FT                   /db_xref="GOA:E6U9H8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H8"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU26169.1"
FT                   /translation="MVSRMQKTILKETFREVRRSLGRFLAILILILLGVTFFVGFNAMG
FT                   PDLSASATRYFAQSHFHNYRILSTIGFDNDDVQAIRSLKETENAQAFYTLDAIETYGGQ
FT                   SGVAHVMSLPESVDTLTVVRGRLPQSADECVVDEQKNGTTPRIGQTVTLTSGTDDDLSQ
FT                   KLHQTAFRVVGVVNSPSYLARDRGTSKIGNGKVSGLLFVQSGVFSLPAYTEVDVTAKGM
FT                   NGLSVFSTPYYQKAAELGHALEKLAPVRTQVRHDELVNDANAQLADQQNAYDTQKAQAD
FT                   QALADAQAQIDGVQSRLDAAQVQLTQAEKQADAQMSATQAQIDSASDQLAEKTAAYQQG
FT                   LVAYDQQAAAAQPKIDQAEQGLSALAANLQTVQAQQQALQAALSSGQADGSLSASEAQQ
FT                   MNVQLAALQQNMDALTQQQSAAQASLNTQQQQLAAAKSQLDETKRQLDASSAQLANQQA
FT                   AFASAQKQSQDTFAQKQKELDAQKTTLEQSRQSFAAQQADTDQKLNDVAAQIADAKQRI
FT                   ADIEMPQWSVLSRDKNAGYTNLKSTLDRNNGISSILPILFFSIAALVCLTSMTRMVEER
FT                   RTQIGTLKALGYGNGSILSQYLFYAGAASALGSAAGIVLGLCLLPRMLFHAYMSMFTMP
FT                   VMDILAQPGIAAAAAGIALSLILFATAITCMGELRAVPSALLRPEAPKAGKRILLERIP
FT                   FIWEHLSFSRKVTVRNLFRYKKRFWMTVLGVACCCAMLVSGFGLYDSISTQVSAREFGG
FT                   ILKYSLTVQMKDDASASQIADVAGALQKTSGVASLTENTQKTVTAKNGAASQQCSLMVP
FT                   QQPAKFSDYIALRSVPGGLGKSGSPLSLTDSGVIITQQLAKNLGLKQGDTLTVQDDDTH
FT                   SHRFRVSGIAENYLMNDVFITPAAYQDAYGSAADVNQLLVNLKAGASQNTISENAMKMD
FT                   GVASVSLLSDLKQTFSDTVKSLNGMVAIVIFSALLLAAVVLFTLTSINIAERFREIATI
FT                   KVLGFYDREVSGYVTRESYILTLIGIALGCAGGIVLHARILDAISVNNVMFVRSILPQS
FT                   FLISAALTLVFTWLINLLAMRAMQKIDMVEALKGTE"
FT   gene            627934..628119
FT                   /pseudo
FT                   /locus_tag="Ethha_0593"
FT   gene            628157..628501
FT                   /pseudo
FT                   /locus_tag="Ethha_0594"
FT   gene            628515..629559
FT                   /pseudo
FT                   /locus_tag="Ethha_0595"
FT   gene            629593..630081
FT                   /locus_tag="Ethha_0596"
FT   CDS_pept        629593..630081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0596"
FT                   /product="PTS system glucitol/sorbitol-specific IIA
FT                   component"
FT                   /note="PFAM: PTS system glucitol/sorbitol-specific IIA
FT                   component; KEGG: cbe:Cbei_0339 PTS system,
FT                   glucitol/sorbitol-specific IIA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26170"
FT                   /db_xref="GOA:E6U9H9"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H9"
FT                   /inference="protein motif:PFAM:PF03829"
FT                   /protein_id="ADU26170.1"
FT                   /translation="MCAANSCGINLRLSLLSPYYTFSKVLDYISKWREALFWQRAYMTT
FT                   IYENMVKSMGACVNSFQDEGMFILFGNQAPDTLQDYCYVIDVLPINGKIEPGQVAEIDG
FT                   TRYMITAVGELVEKKLGNFGHVTFSFTGDTQAELPGTIYLGKKPVPQLNIGSQITIHS"
FT   gene            630119..630349
FT                   /locus_tag="Ethha_0597"
FT   CDS_pept        630119..630349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0597"
FT                   /product="phosphoryl transfer system HPr"
FT                   /note="PFAM: phosphoryl transfer system HPr; KEGG:
FT                   cpy:Cphy_1769 phosphotransferase system, phosphocarrier
FT                   protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26171"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9I0"
FT                   /inference="protein motif:PFAM:PF00381"
FT                   /protein_id="ADU26171.1"
FT                   /translation="MEQFTYVIKDSGGIHARPAGMLVKKAAEFSSRVVLKKGQKAADIH
FT                   RLFSIISLGANRAIRLRLKSKARMKKLRWTT"
FT   gene            630501..630893
FT                   /locus_tag="Ethha_0598"
FT   CDS_pept        630501..630893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0598"
FT                   /prod