(data stored in ACNUC1104 zone)

EMBL: CP002417

ID   CP002417; SV 1; circular; genomic DNA; STD; PRO; 6550056 BP.
XX
AC   CP002417;
XX
PR   Project:PRJNA43457;
XX
DT   30-DEC-2010 (Rel. 107, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Variovorax paradoxus EPS, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Variovorax paradoxus EPS
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Variovorax.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-6550056
RX   PUBMED; 24158554.
RA   Han J.I., Spain J.C., Leadbetter J.R., Ovchinnikova G., Goodwin L.A.,
RA   Han C.S., Woyke T., Davenport K.W., Orwin P.M.;
RT   "Genome of the Root-Associated Plant Growth-Promoting Bacterium Variovorax
RT   paradoxus Strain EPS";
RL   Genome Announc 1(5):e00843-13(2013).
XX
RN   [2]
RP   1-6550056
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Goodwin L., Pitluck S.,
RA   Teshima H., Detter J.C., Han C., Tapia R., Land M., Hauser L., Kyrpides N.,
RA   Ivanova N., Ovchinnikova G., Orwin P., Han J.-I.G., Woyke T.;
RT   ;
RL   Submitted (22-DEC-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; bf2f161e58427bd66882afee94826341.
DR   BioSample; SAMN00149467.
DR   EnsemblGenomes-Gn; EBG00001124545.
DR   EnsemblGenomes-Gn; EBG00001124546.
DR   EnsemblGenomes-Gn; EBG00001124547.
DR   EnsemblGenomes-Gn; EBG00001124548.
DR   EnsemblGenomes-Gn; EBG00001124549.
DR   EnsemblGenomes-Gn; EBG00001124550.
DR   EnsemblGenomes-Gn; EBG00001124551.
DR   EnsemblGenomes-Gn; EBG00001124552.
DR   EnsemblGenomes-Gn; EBG00001124553.
DR   EnsemblGenomes-Gn; EBG00001124554.
DR   EnsemblGenomes-Gn; EBG00001124555.
DR   EnsemblGenomes-Gn; EBG00001124556.
DR   EnsemblGenomes-Gn; EBG00001124557.
DR   EnsemblGenomes-Gn; EBG00001124558.
DR   EnsemblGenomes-Gn; EBG00001124559.
DR   EnsemblGenomes-Gn; EBG00001124560.
DR   EnsemblGenomes-Gn; EBG00001124561.
DR   EnsemblGenomes-Gn; EBG00001124562.
DR   EnsemblGenomes-Gn; EBG00001124563.
DR   EnsemblGenomes-Gn; EBG00001124564.
DR   EnsemblGenomes-Gn; EBG00001124565.
DR   EnsemblGenomes-Gn; EBG00001124566.
DR   EnsemblGenomes-Gn; EBG00001124567.
DR   EnsemblGenomes-Gn; EBG00001124568.
DR   EnsemblGenomes-Gn; EBG00001124569.
DR   EnsemblGenomes-Gn; EBG00001124570.
DR   EnsemblGenomes-Gn; EBG00001124571.
DR   EnsemblGenomes-Gn; EBG00001124572.
DR   EnsemblGenomes-Gn; EBG00001124573.
DR   EnsemblGenomes-Gn; EBG00001124574.
DR   EnsemblGenomes-Gn; EBG00001124575.
DR   EnsemblGenomes-Gn; EBG00001124576.
DR   EnsemblGenomes-Gn; EBG00001124577.
DR   EnsemblGenomes-Gn; EBG00001124578.
DR   EnsemblGenomes-Gn; EBG00001124579.
DR   EnsemblGenomes-Gn; EBG00001124580.
DR   EnsemblGenomes-Gn; EBG00001124581.
DR   EnsemblGenomes-Gn; EBG00001124582.
DR   EnsemblGenomes-Gn; EBG00001124583.
DR   EnsemblGenomes-Gn; EBG00001124584.
DR   EnsemblGenomes-Gn; EBG00001124585.
DR   EnsemblGenomes-Gn; EBG00001124586.
DR   EnsemblGenomes-Gn; EBG00001124587.
DR   EnsemblGenomes-Gn; EBG00001124588.
DR   EnsemblGenomes-Gn; EBG00001124589.
DR   EnsemblGenomes-Gn; EBG00001124590.
DR   EnsemblGenomes-Gn; EBG00001124591.
DR   EnsemblGenomes-Gn; EBG00001124592.
DR   EnsemblGenomes-Gn; EBG00001124593.
DR   EnsemblGenomes-Gn; EBG00001124594.
DR   EnsemblGenomes-Gn; EBG00001124595.
DR   EnsemblGenomes-Gn; EBG00001124596.
DR   EnsemblGenomes-Gn; EBG00001124597.
DR   EnsemblGenomes-Gn; EBG00001124598.
DR   EnsemblGenomes-Gn; EBG00001124599.
DR   EnsemblGenomes-Gn; EBG00001124600.
DR   EnsemblGenomes-Gn; EBG00001124601.
DR   EnsemblGenomes-Gn; EBG00001124602.
DR   EnsemblGenomes-Gn; EBG00001124603.
DR   EnsemblGenomes-Gn; EBG00001124604.
DR   EnsemblGenomes-Gn; EBG00001124605.
DR   EnsemblGenomes-Gn; EBG00001124606.
DR   EnsemblGenomes-Gn; EBG00001124607.
DR   EnsemblGenomes-Gn; EBG00001124608.
DR   EnsemblGenomes-Gn; EBG00001124609.
DR   EnsemblGenomes-Gn; EBG00001124610.
DR   EnsemblGenomes-Gn; EBG00001124611.
DR   EnsemblGenomes-Gn; EBG00001124612.
DR   EnsemblGenomes-Gn; EBG00001124613.
DR   EnsemblGenomes-Gn; EBG00001124614.
DR   EnsemblGenomes-Gn; EBG00001124615.
DR   EnsemblGenomes-Gn; EBG00001124616.
DR   EnsemblGenomes-Gn; EBG00001124617.
DR   EnsemblGenomes-Gn; EBG00001124618.
DR   EnsemblGenomes-Gn; EBG00001124619.
DR   EnsemblGenomes-Gn; EBG00001124620.
DR   EnsemblGenomes-Gn; EBG00001124621.
DR   EnsemblGenomes-Gn; EBG00001124622.
DR   EnsemblGenomes-Gn; EBG00001124623.
DR   EnsemblGenomes-Gn; Varpa_R0001.
DR   EnsemblGenomes-Gn; Varpa_R0002.
DR   EnsemblGenomes-Gn; Varpa_R0003.
DR   EnsemblGenomes-Gn; Varpa_R0004.
DR   EnsemblGenomes-Gn; Varpa_R0005.
DR   EnsemblGenomes-Gn; Varpa_R0006.
DR   EnsemblGenomes-Gn; Varpa_R0007.
DR   EnsemblGenomes-Gn; Varpa_R0008.
DR   EnsemblGenomes-Gn; Varpa_R0009.
DR   EnsemblGenomes-Gn; Varpa_R0010.
DR   EnsemblGenomes-Gn; Varpa_R0011.
DR   EnsemblGenomes-Gn; Varpa_R0012.
DR   EnsemblGenomes-Gn; Varpa_R0013.
DR   EnsemblGenomes-Gn; Varpa_R0014.
DR   EnsemblGenomes-Gn; Varpa_R0015.
DR   EnsemblGenomes-Gn; Varpa_R0016.
DR   EnsemblGenomes-Gn; Varpa_R0017.
DR   EnsemblGenomes-Gn; Varpa_R0018.
DR   EnsemblGenomes-Gn; Varpa_R0019.
DR   EnsemblGenomes-Gn; Varpa_R0020.
DR   EnsemblGenomes-Gn; Varpa_R0021.
DR   EnsemblGenomes-Gn; Varpa_R0022.
DR   EnsemblGenomes-Gn; Varpa_R0023.
DR   EnsemblGenomes-Gn; Varpa_R0024.
DR   EnsemblGenomes-Gn; Varpa_R0025.
DR   EnsemblGenomes-Gn; Varpa_R0026.
DR   EnsemblGenomes-Gn; Varpa_R0027.
DR   EnsemblGenomes-Gn; Varpa_R0028.
DR   EnsemblGenomes-Gn; Varpa_R0029.
DR   EnsemblGenomes-Gn; Varpa_R0030.
DR   EnsemblGenomes-Gn; Varpa_R0031.
DR   EnsemblGenomes-Gn; Varpa_R0032.
DR   EnsemblGenomes-Gn; Varpa_R0033.
DR   EnsemblGenomes-Gn; Varpa_R0034.
DR   EnsemblGenomes-Gn; Varpa_R0035.
DR   EnsemblGenomes-Gn; Varpa_R0036.
DR   EnsemblGenomes-Gn; Varpa_R0037.
DR   EnsemblGenomes-Gn; Varpa_R0038.
DR   EnsemblGenomes-Gn; Varpa_R0039.
DR   EnsemblGenomes-Gn; Varpa_R0040.
DR   EnsemblGenomes-Gn; Varpa_R0041.
DR   EnsemblGenomes-Gn; Varpa_R0042.
DR   EnsemblGenomes-Gn; Varpa_R0043.
DR   EnsemblGenomes-Gn; Varpa_R0044.
DR   EnsemblGenomes-Gn; Varpa_R0045.
DR   EnsemblGenomes-Gn; Varpa_R0046.
DR   EnsemblGenomes-Gn; Varpa_R0047.
DR   EnsemblGenomes-Gn; Varpa_R0048.
DR   EnsemblGenomes-Gn; Varpa_R0049.
DR   EnsemblGenomes-Gn; Varpa_R0050.
DR   EnsemblGenomes-Gn; Varpa_R0051.
DR   EnsemblGenomes-Gn; Varpa_R0052.
DR   EnsemblGenomes-Gn; Varpa_R0053.
DR   EnsemblGenomes-Gn; Varpa_R0054.
DR   EnsemblGenomes-Gn; Varpa_R0055.
DR   EnsemblGenomes-Gn; Varpa_R0056.
DR   EnsemblGenomes-Gn; Varpa_R0057.
DR   EnsemblGenomes-Gn; Varpa_R0058.
DR   EnsemblGenomes-Gn; Varpa_R0059.
DR   EnsemblGenomes-Gn; Varpa_R0060.
DR   EnsemblGenomes-Gn; Varpa_R0061.
DR   EnsemblGenomes-Gn; Varpa_R0062.
DR   EnsemblGenomes-Gn; Varpa_R0063.
DR   EnsemblGenomes-Gn; Varpa_R0064.
DR   EnsemblGenomes-Gn; Varpa_R0065.
DR   EnsemblGenomes-Gn; Varpa_R0066.
DR   EnsemblGenomes-Gn; Varpa_R0067.
DR   EnsemblGenomes-Tr; EBT00001715718.
DR   EnsemblGenomes-Tr; EBT00001715719.
DR   EnsemblGenomes-Tr; EBT00001715720.
DR   EnsemblGenomes-Tr; EBT00001715721.
DR   EnsemblGenomes-Tr; EBT00001715722.
DR   EnsemblGenomes-Tr; EBT00001715723.
DR   EnsemblGenomes-Tr; EBT00001715724.
DR   EnsemblGenomes-Tr; EBT00001715725.
DR   EnsemblGenomes-Tr; EBT00001715726.
DR   EnsemblGenomes-Tr; EBT00001715727.
DR   EnsemblGenomes-Tr; EBT00001715728.
DR   EnsemblGenomes-Tr; EBT00001715729.
DR   EnsemblGenomes-Tr; EBT00001715730.
DR   EnsemblGenomes-Tr; EBT00001715731.
DR   EnsemblGenomes-Tr; EBT00001715732.
DR   EnsemblGenomes-Tr; EBT00001715733.
DR   EnsemblGenomes-Tr; EBT00001715734.
DR   EnsemblGenomes-Tr; EBT00001715735.
DR   EnsemblGenomes-Tr; EBT00001715736.
DR   EnsemblGenomes-Tr; EBT00001715737.
DR   EnsemblGenomes-Tr; EBT00001715738.
DR   EnsemblGenomes-Tr; EBT00001715739.
DR   EnsemblGenomes-Tr; EBT00001715740.
DR   EnsemblGenomes-Tr; EBT00001715741.
DR   EnsemblGenomes-Tr; EBT00001715742.
DR   EnsemblGenomes-Tr; EBT00001715743.
DR   EnsemblGenomes-Tr; EBT00001715744.
DR   EnsemblGenomes-Tr; EBT00001715745.
DR   EnsemblGenomes-Tr; EBT00001715746.
DR   EnsemblGenomes-Tr; EBT00001715747.
DR   EnsemblGenomes-Tr; EBT00001715748.
DR   EnsemblGenomes-Tr; EBT00001715749.
DR   EnsemblGenomes-Tr; EBT00001715750.
DR   EnsemblGenomes-Tr; EBT00001715751.
DR   EnsemblGenomes-Tr; EBT00001715752.
DR   EnsemblGenomes-Tr; EBT00001715753.
DR   EnsemblGenomes-Tr; EBT00001715754.
DR   EnsemblGenomes-Tr; EBT00001715755.
DR   EnsemblGenomes-Tr; EBT00001715756.
DR   EnsemblGenomes-Tr; EBT00001715757.
DR   EnsemblGenomes-Tr; EBT00001715758.
DR   EnsemblGenomes-Tr; EBT00001715759.
DR   EnsemblGenomes-Tr; EBT00001715760.
DR   EnsemblGenomes-Tr; EBT00001715761.
DR   EnsemblGenomes-Tr; EBT00001715762.
DR   EnsemblGenomes-Tr; EBT00001715763.
DR   EnsemblGenomes-Tr; EBT00001715764.
DR   EnsemblGenomes-Tr; EBT00001715765.
DR   EnsemblGenomes-Tr; EBT00001715766.
DR   EnsemblGenomes-Tr; EBT00001715767.
DR   EnsemblGenomes-Tr; EBT00001715768.
DR   EnsemblGenomes-Tr; EBT00001715769.
DR   EnsemblGenomes-Tr; EBT00001715770.
DR   EnsemblGenomes-Tr; EBT00001715771.
DR   EnsemblGenomes-Tr; EBT00001715772.
DR   EnsemblGenomes-Tr; EBT00001715773.
DR   EnsemblGenomes-Tr; EBT00001715774.
DR   EnsemblGenomes-Tr; EBT00001715775.
DR   EnsemblGenomes-Tr; EBT00001715776.
DR   EnsemblGenomes-Tr; EBT00001715777.
DR   EnsemblGenomes-Tr; EBT00001715778.
DR   EnsemblGenomes-Tr; EBT00001715779.
DR   EnsemblGenomes-Tr; EBT00001715780.
DR   EnsemblGenomes-Tr; EBT00001715781.
DR   EnsemblGenomes-Tr; EBT00001715782.
DR   EnsemblGenomes-Tr; EBT00001715783.
DR   EnsemblGenomes-Tr; EBT00001715784.
DR   EnsemblGenomes-Tr; EBT00001715785.
DR   EnsemblGenomes-Tr; EBT00001715786.
DR   EnsemblGenomes-Tr; EBT00001715787.
DR   EnsemblGenomes-Tr; EBT00001715788.
DR   EnsemblGenomes-Tr; EBT00001715789.
DR   EnsemblGenomes-Tr; EBT00001715790.
DR   EnsemblGenomes-Tr; EBT00001715791.
DR   EnsemblGenomes-Tr; EBT00001715792.
DR   EnsemblGenomes-Tr; EBT00001715793.
DR   EnsemblGenomes-Tr; EBT00001715794.
DR   EnsemblGenomes-Tr; EBT00001715795.
DR   EnsemblGenomes-Tr; EBT00001715796.
DR   EnsemblGenomes-Tr; Varpa_R0001-1.
DR   EnsemblGenomes-Tr; Varpa_R0002-1.
DR   EnsemblGenomes-Tr; Varpa_R0003-1.
DR   EnsemblGenomes-Tr; Varpa_R0004-1.
DR   EnsemblGenomes-Tr; Varpa_R0005-1.
DR   EnsemblGenomes-Tr; Varpa_R0006-1.
DR   EnsemblGenomes-Tr; Varpa_R0007-1.
DR   EnsemblGenomes-Tr; Varpa_R0008-1.
DR   EnsemblGenomes-Tr; Varpa_R0009-1.
DR   EnsemblGenomes-Tr; Varpa_R0010-1.
DR   EnsemblGenomes-Tr; Varpa_R0011-1.
DR   EnsemblGenomes-Tr; Varpa_R0012-1.
DR   EnsemblGenomes-Tr; Varpa_R0013-1.
DR   EnsemblGenomes-Tr; Varpa_R0014-1.
DR   EnsemblGenomes-Tr; Varpa_R0015-1.
DR   EnsemblGenomes-Tr; Varpa_R0016-1.
DR   EnsemblGenomes-Tr; Varpa_R0017-1.
DR   EnsemblGenomes-Tr; Varpa_R0018-1.
DR   EnsemblGenomes-Tr; Varpa_R0019-1.
DR   EnsemblGenomes-Tr; Varpa_R0020-1.
DR   EnsemblGenomes-Tr; Varpa_R0021-1.
DR   EnsemblGenomes-Tr; Varpa_R0022-1.
DR   EnsemblGenomes-Tr; Varpa_R0023-1.
DR   EnsemblGenomes-Tr; Varpa_R0024-1.
DR   EnsemblGenomes-Tr; Varpa_R0025-1.
DR   EnsemblGenomes-Tr; Varpa_R0026-1.
DR   EnsemblGenomes-Tr; Varpa_R0027-1.
DR   EnsemblGenomes-Tr; Varpa_R0028-1.
DR   EnsemblGenomes-Tr; Varpa_R0029-1.
DR   EnsemblGenomes-Tr; Varpa_R0030-1.
DR   EnsemblGenomes-Tr; Varpa_R0031-1.
DR   EnsemblGenomes-Tr; Varpa_R0032-1.
DR   EnsemblGenomes-Tr; Varpa_R0033-1.
DR   EnsemblGenomes-Tr; Varpa_R0034-1.
DR   EnsemblGenomes-Tr; Varpa_R0035-1.
DR   EnsemblGenomes-Tr; Varpa_R0036-1.
DR   EnsemblGenomes-Tr; Varpa_R0037-1.
DR   EnsemblGenomes-Tr; Varpa_R0038-1.
DR   EnsemblGenomes-Tr; Varpa_R0039-1.
DR   EnsemblGenomes-Tr; Varpa_R0040-1.
DR   EnsemblGenomes-Tr; Varpa_R0041-1.
DR   EnsemblGenomes-Tr; Varpa_R0042-1.
DR   EnsemblGenomes-Tr; Varpa_R0043-1.
DR   EnsemblGenomes-Tr; Varpa_R0044-1.
DR   EnsemblGenomes-Tr; Varpa_R0045-1.
DR   EnsemblGenomes-Tr; Varpa_R0046-1.
DR   EnsemblGenomes-Tr; Varpa_R0047-1.
DR   EnsemblGenomes-Tr; Varpa_R0048-1.
DR   EnsemblGenomes-Tr; Varpa_R0049-1.
DR   EnsemblGenomes-Tr; Varpa_R0050-1.
DR   EnsemblGenomes-Tr; Varpa_R0051-1.
DR   EnsemblGenomes-Tr; Varpa_R0052-1.
DR   EnsemblGenomes-Tr; Varpa_R0053-1.
DR   EnsemblGenomes-Tr; Varpa_R0054-1.
DR   EnsemblGenomes-Tr; Varpa_R0055-1.
DR   EnsemblGenomes-Tr; Varpa_R0056-1.
DR   EnsemblGenomes-Tr; Varpa_R0057-1.
DR   EnsemblGenomes-Tr; Varpa_R0058-1.
DR   EnsemblGenomes-Tr; Varpa_R0059-1.
DR   EnsemblGenomes-Tr; Varpa_R0060-1.
DR   EnsemblGenomes-Tr; Varpa_R0061-1.
DR   EnsemblGenomes-Tr; Varpa_R0062-1.
DR   EnsemblGenomes-Tr; Varpa_R0063-1.
DR   EnsemblGenomes-Tr; Varpa_R0064-1.
DR   EnsemblGenomes-Tr; Varpa_R0065-1.
DR   EnsemblGenomes-Tr; Varpa_R0066-1.
DR   EnsemblGenomes-Tr; Varpa_R0067-1.
DR   EuropePMC; PMC3536118; 23087034.
DR   EuropePMC; PMC3754582; 23772073.
DR   EuropePMC; PMC3813184; 24158554.
DR   EuropePMC; PMC5589539; 28883145.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP002417.
DR   SILVA-SSU; CP002417.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083792
CC   Source DNA and organism available from Jong-In Han
CC   (jihan@daist.ac.kr)
CC   Contacts: Jong-In Han (jihan@daist.ac.kr)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Variovorax paradoxus EPS
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Soil
CC   num_replicons       :: 1
CC   ref_biomaterial     :: Missing
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Aerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02063
CC   Greengenes ID       :: 142409
CC   Funding Program     :: DOE-CSP 2008
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454, Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6550056
FT                   /organism="Variovorax paradoxus EPS"
FT                   /strain="EPS"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:595537"
FT   gene            88..1467
FT                   /locus_tag="Varpa_0001"
FT   CDS_pept        88..1467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   vap:Vapar_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34224"
FT                   /db_xref="GOA:E6UWL9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E6UWL9"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADU34224.1"
FT                   /translation="MSTDGIGESLWQACVDQLAQELSEQQFNTWIKPLTAQVADDLSRM
FT                   TVFVANRFKLDWIRAQYAGKIAAMAEKMYGQPVAVELALAPREAPVRSAPIAVMTETDV
FT                   PRDVAGPGEEPAAAGFKNRLNSGLTFDTLVEGTANRMARAAAMHVAGMPGHLYNPLFIY
FT                   GGVGLGKTHLMHAVGNRLLADRPDSKVLYIHAEQFVSDVVKAYQRKTFDEFKERYHSLD
FT                   LLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGLADIHERLVSRFDSG
FT                   LTVAIEPPELEMRVAILINKARAESAEMPEEVAFFVAKNVRSNVRELEGALRKILAYSR
FT                   FNQKEISIALAREALRDLLSIQNRQISVENIQKTVADYYKIKVADMYSKKRPASIARPR
FT                   QIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKISGERQQLTELNQQLHVLEQTLK
FT                   G"
FT   gene            1556..2662
FT                   /locus_tag="Varpa_0002"
FT   CDS_pept        1556..2662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: vap:Vapar_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34225"
FT                   /db_xref="GOA:E6UXN1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN1"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADU34225.1"
FT                   /translation="MIVLKATQDKVLAALQSVSGIVERRHTLPILANVLIRKTGGQLQL
FT                   TTSDLEIQIRTTAELGGDEGNFTTTIGARKLIDILRTMPADQTVSLESSASKLVLKGGK
FT                   SRFTLQSLPAEDFPLVQEAANFGPVFSVPQKTLKDLLSQVSFAMAVHDIRYYLNGILFV
FT                   AEGKQLSLVATDGHRLAFSSAMLDVEVPRQEVILPRKTVLEMQRLLSDAEGAIEMQFAN
FT                   NQAKFSFGGMEFVTKLVEGKFPDYNRVIPKNHKNTVTLGRAPLLASLQRTAILTSEKFK
FT                   GVRLNIEPGTLRIASNNAEQEEAQDELDIDYGGDAIEIGFNVTYLIDALSNMDQDMVKL
FT                   DLADSNSSALLTIPENASFKYVVMPMRI"
FT   gene            2798..5419
FT                   /locus_tag="Varpa_0003"
FT   CDS_pept        2798..5419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein; KEGG: vap:Vapar_0003 DNA gyrase, B subunit; SMART:
FT                   DNA topoisomerase II; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34226"
FT                   /db_xref="GOA:E6UXN2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADU34226.1"
FT                   /translation="MSAEENKPEVPHTEPVYTPEVQVVAPEVILADTSYGEGSITILEG
FT                   LEAVRKRPGMYIGDTSDGTGLHHLVFEVVDNSIDEALAGHCDDIVVTIHSDNSISVTDN
FT                   GRGIPTGVKMDDKHEPKRSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSIK
FT                   LRLIVRREGKIHELEFSRGFVQNRLLETVNGFEVSPMKIIGDTDKRGTEVHFLPDTEIF
FT                   KENNDFHYEILSKRLRELSFLNNGVRIRLLDERTGKEDDFSGAGGVRGFVEFINKGKTV
FT                   LHPNSFYAAGEKPADTYGGIPGTHIGVEVAMQWNSGYNEQVLCFTNNIPQRDGGTHLTG
FT                   LRAAMTRVINKYIEENEFAKKAKVEVTGDDMREGLCCVLSVKVPEPKFSSQTKDKLVSS
FT                   EVRAPVEDIVGRLLTDYLQERPNDAKIICGKIVEAARAREAARKAREMTRRKGVLDGMG
FT                   LPGKLADCQEKDPALCEVYLVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARYEKL
FT                   LTSNEILTMITALGTGIGRAGATTAGGGADDFNVAKLRYHRIIIMTDADVDGAHIRTLL
FT                   LTFFYRQMPELVERGHIYIAQPPLYKVKVGKEEQYLKDGPALDAFLLKVALKDARIETG
FT                   GASSTTLTGDTLAELARKHQVAESVIARLRNFMDAEALRAIADGVALDLDTTPAAEASA
FT                   VALQAKLRELNTTGIPAEVSNEFDARTDKPLLRISRRHHGNIKSSVITQDFVHGADYAA
FT                   LAEAANTFRGLLSTEGALVKRGEGERAKEEKVDDFRQAMKWLISEAERATSRQRYKGLG
FT                   EMNPEQLWETTMDPTVRRLLRVQIDDAIEADRVFTMLMGDEVEPRREFIEQNALRAANI
FT                   DV"
FT   gene            complement(6085..6729)
FT                   /locus_tag="Varpa_0004"
FT   CDS_pept        complement(6085..6729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_0003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34227"
FT                   /db_xref="GOA:E6UXN3"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN3"
FT                   /inference="similar to AA sequence:KEGG:Pnap_0003"
FT                   /protein_id="ADU34227.1"
FT                   /translation="MNGTDDHDPLPERREAMTAWERGLRPKRDRHWALWLALAALLVFL
FT                   LFRGAEWLLAQRASSQPAQQRPTAPPAPIGRAAPVPPSPSLAPAPPDTFEVTKCLTPSG
FT                   KAAYSDGPCPPGSRATTVRLRRDVNIADGMSISEREASNRNNTAVAEQQQQYERQVARN
FT                   VDSAMAECSQLDESVKRLDAAARQPQDVYSQDRLRSERHAARDRRFRLGCQ"
FT   gene            complement(6779..7039)
FT                   /locus_tag="Varpa_0005"
FT   CDS_pept        complement(6779..7039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34228"
FT                   /db_xref="GOA:E6UXN4"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0005"
FT                   /protein_id="ADU34228.1"
FT                   /translation="MTIQSTINEFKRVDAQRADFPGEHLAVLGAGVLLLLISGRSRSFI
FT                   ARLVAGAAGGALIGRAASGTGGIARVAAAMQGRGQPGRVKS"
FT   gene            7338..7856
FT                   /locus_tag="Varpa_0006"
FT   CDS_pept        7338..7856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34229"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0006"
FT                   /protein_id="ADU34229.1"
FT                   /translation="MNPMRLRRPLAALVLGGTAAFLGAVLPAHAFSNPPIQVAQGVEYM
FT                   CGGAAKGEAEFMEMVAPRWAATIELGVSDGKGAQFAGFPAKASVEIRQKYTGQTVMDVQ
FT                   TQAPYMLARLDPGAYDVNVTLGGLTLTQTLIVIAGVPGRASFLWPSNFDMASVTPPMPQ
FT                   ALAQTSAAR"
FT   sig_peptide     7338..7430
FT                   /locus_tag="Varpa_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 31"
FT   gene            7994..8494
FT                   /locus_tag="Varpa_0007"
FT   CDS_pept        7994..8494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34230"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN6"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0007"
FT                   /protein_id="ADU34230.1"
FT                   /translation="MTSRFSSSSSSRMRPLAAAMLCGAVLLGALSSAHAAVNPPIYMTH
FT                   GVEYMSGGIGSDEAQLMETVSPRWPATFEFAVKDHKGSADFAAGVHITVRDSSGTKLLD
FT                   NVVSGGPFMVARLEPGTYEVEARIGSQTLKQSLTVPHGASAKAIFEWPAGTDMASAGTR
FT                   TVQ"
FT   sig_peptide     7994..8101
FT                   /locus_tag="Varpa_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 36"
FT   gene            8667..9875
FT                   /locus_tag="Varpa_0008"
FT   CDS_pept        8667..9875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0008"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: vap:Vapar_0008
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34231"
FT                   /db_xref="GOA:E6UXN7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN7"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU34231.1"
FT                   /translation="MPEPIAPMPIRPLSALTALLHVYIALRLVPALATLTPAWPLALVL
FT                   LAVSALTIPLPFVSRRIASNASMGEVLKWVGLISMGWFSSMFVLTLLRDAGLLLAWLAG
FT                   ALGLVQVRWNALLPWSALAVLAMATGTSLVGFLNARRTASVKRVEVPIRGLPAALEGFT
FT                   IAQLSDIHVGPTIRSAYIQRIVDAVNRLGADAIAITGDLVDGTVPELREHIAPLAGLRA
FT                   RHGTFVVTGNHEYYAGAHAWIDELRRLGLKVLLNEHVVLQTRNVRGAQTDEELFESALV
FT                   LAGVTDFTAGHFDAAHASDPHLALFDAPPLVHTRVLLAHQPRSATVAAAAGYQLQLSGH
FT                   THGGQFFPWNLFVPMQQPFTAGLHRLHDMWIYVSRGTGYWGPPKRFGAPSEITLLTLVP
FT                   ARP"
FT   gene            complement(9894..10391)
FT                   /locus_tag="Varpa_0009"
FT   CDS_pept        complement(9894..10391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34232"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN8"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0009"
FT                   /protein_id="ADU34232.1"
FT                   /translation="MSSLSSTARLANPLMQWLDLALKTNEMLLSSGSVIRMRTERIAKA
FT                   GLTPSAADLAEFQLMGHEKLAAASESGMAMVKQWHSSHFSLANKALQQWLQGTTAFFSM
FT                   AGSVTPAQAAARGDAFVQTAARTANAASQLSGVAVRIAREGLKPIHAAATSNARRLAEL
FT                   QS"
FT   gene            10594..11169
FT                   /locus_tag="Varpa_0010"
FT   CDS_pept        10594..11169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0010"
FT                   /product="Lipid A 3-O-deacylase-related protein"
FT                   /note="PFAM: Lipid A 3-O-deacylase-related; KEGG:
FT                   vap:Vapar_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34233"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN9"
FT                   /inference="protein motif:PFAM:PF09411"
FT                   /protein_id="ADU34233.1"
FT                   /translation="MKSHPCAPLRAAVFAGLFGLLGTAAHAFGDDTRGFYLDGGHARHG
FT                   EKGDTNSVSVGMTVPWSFNERRPGSPFSSYLDFYISNWHARPLDDGPRNFVQIGAIYTL
FT                   RYRFGDGASPWFAEGGVGATLMDHVYRTPDRSFSTAFQFTEVLGIGRSFGDNGAHEVSL
FT                   RVQHVSNGGIKKPNPGETFLRLRYTYHF"
FT   sig_peptide     10594..10677
FT                   /locus_tag="Varpa_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.703 at
FT                   residue 28"
FT   gene            complement(11171..12139)
FT                   /locus_tag="Varpa_0011"
FT   CDS_pept        complement(11171..12139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34234"
FT                   /db_xref="GOA:E6UXP0"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0011"
FT                   /protein_id="ADU34234.1"
FT                   /translation="MALARQSWWPWARRVVVWGFFGLVAWLLVTQARAIDWSEVFQAIR
FT                   ALPATTLLAAGALAASSFVLYSTYDLLGRHLTRHKLGAGTVMGVTFISYAFNLNFGSLV
FT                   GGVAFRYRLYSRLGLGNATITRVLGFSMLTNWLGYLVVAGAAFFFWPMALPPEWKIGSG
FT                   GLRVLGAVLLALSVGYLALCAFSAGRVWRVRGHTFKTPGLAMALLQLAMSCLNWSLMGG
FT                   VIWLLLQGQVGYPHVLAVLLVAAVAGVVTHVPAGLGVLEAVFVALLSYQVAETTLLGAL
FT                   LAYRGLYYLLPLAVALCAYLVTEMRMRRSRPRRLPGRAPGA"
FT   gene            complement(12168..13439)
FT                   /locus_tag="Varpa_0012"
FT   CDS_pept        complement(12168..13439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0012"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: vap:Vapar_0012 cardiolipin synthase 2; PFAM:
FT                   phospholipase D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34235"
FT                   /db_xref="GOA:E6UXP1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP1"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADU34235.1"
FT                   /translation="MSHGNHWVGGNRIELLENGEEFFPRVFDAIRAAEREVIVETFILF
FT                   EDKVGLGLHAALREAAQRGAKVDLMIDGFGSPDLSREFIEGLTSVGVKVRVFDPGHRFM
FT                   GQRLNVFRRMHRKIVVVDGERAFVGGINYSADHLLDFGPKAKQDWAVELAGPIVAEIHQ
FT                   FVLRAIAVGGKGAGWFRRRLKQAPPVRQLTAGEADAMFVTRDNRRHTNDIERHYRAAIR
FT                   AARERIVIANAYFFPGYRLIKELRRAARRGVDVRLILQGEPDMPIVKTAASMLYHHLLH
FT                   AGVRIYEYCDRPLHGKVALMDDRWSTVGSSNLDPLSLSLNLEANVVVRDKAFNEVLWKR
FT                   MDQLMQESCKRIETTDLASEWSGWRLVRSFFIFHFLRWYPAWLDRLPRHVPRLTPAEAT
FT                   DLAERQKNEKNSNNTGGATPTEAA"
FT   gene            complement(13453..14241)
FT                   /locus_tag="Varpa_0013"
FT   CDS_pept        complement(13453..14241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0013"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   vap:Vapar_0013 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34236"
FT                   /db_xref="GOA:E6UXP2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP2"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADU34236.1"
FT                   /translation="MSSSPIPTVAAAPAPTSLKVMTVNTHKGFTALNRKFILPELRDAV
FT                   RTVGADVVFLQEVLGTHSRHSRKVSNWPDAPHYEFLADTMWPQFAYGRNAVYPKGHHGN
FT                   AVLSKFPIVHFRNHDVSVSGPEKRGLLHCVLRLPGRTVDVHVICAHLGLAEAHRQQQLE
FT                   LLCHIVRDEVPADAPLIVAGDFNDWRGRAHEVLEKGADLREVFVHANGRAARTFPSRFP
FT                   LLPLDRIYVRNAGVHAPVVLPRRPWSHLSDHAPLVADIDL"
FT   gene            14461..14895
FT                   /locus_tag="Varpa_0014"
FT   CDS_pept        14461..14895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0014"
FT                   /product="serine/threonine kinase"
FT                   /note="KEGG: vap:Vapar_0014 serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34237"
FT                   /db_xref="GOA:E6UXP3"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0014"
FT                   /protein_id="ADU34237.1"
FT                   /translation="MKQQTTIFKGTVLAVLMAAAGGAMAQATSIPAQPDPSVGGQASTM
FT                   TPAGVANPPQRPDNSMPASREAVKAEARVQNRNNANSMVPKGEATTTVNHQPNAMPRPT
FT                   GEQSRAEVSQQARKVKPQFGEKGERPEVPTNPTEKTGTPK"
FT   sig_peptide     14461..14538
FT                   /locus_tag="Varpa_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 26"
FT   gene            complement(14986..15564)
FT                   /locus_tag="Varpa_0015"
FT   CDS_pept        complement(14986..15564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0015 protein of unknown function
FT                   DUF1520"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34238"
FT                   /db_xref="GOA:E6UXP4"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0015"
FT                   /protein_id="ADU34238.1"
FT                   /translation="MISLRQRIVWASLLGSAALASSGAFAQAPAATTTPAAPAAAVAQA
FT                   DTTAAPKAQHKRMDPAQRMERMKEHRAKRLAALKDKLKLTAAQESAWTTYTTANQPPAG
FT                   ARPQRMDRAEFAKLTTPERLERMQTRQAERSAMFAKRAEATKTFYAALSADQKKTFDAE
FT                   TVHAGGHGHRGHGGHRGHDGQRDAAPVKS"
FT   sig_peptide     complement(15484..15564)
FT                   /locus_tag="Varpa_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 27"
FT   gene            complement(15717..16790)
FT                   /locus_tag="Varpa_0016"
FT   CDS_pept        complement(15717..16790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0016"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="KEGG: vap:Vapar_0016 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34239"
FT                   /db_xref="GOA:E6UXP5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0016"
FT                   /protein_id="ADU34239.1"
FT                   /translation="MSPTIRKGQAPETLQRAQFHDRFMQPFQDPAFKAESDSLQRIELI
FT                   AWEAYQEGRKAPVTRKAGPGYADPDYDLSVDWLEAKARIDAAQAVWGQPQTRSRVLLVN
FT                   GSPRNDGTCPGEISKTWRLTELAREVLEGSGVEADVLDLSHLTSEYGRHIHPCKACVST
FT                   AMPLCHWPCSCYPNHSLRQTGDWMNEIYERWVAAHGVILLTPTHWYQATSPLKLMIDRL
FT                   VCADGGNPDPTSTHGKKPEEAKALELQGWGYPKHLEGRVYGVVVHGDVAGVESVRRNLT
FT                   DWLDWMGLVDAGAQARLDRYIGYYEPYATSHDALDEDTDVQEEVRNVARAVARAVGELR
FT                   AGKLQSPDRGLKQPRPK"
FT   gene            complement(16880..17776)
FT                   /locus_tag="Varpa_0017"
FT   CDS_pept        complement(16880..17776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0017"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: vap:Vapar_0017
FT                   pirin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34240"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP6"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ADU34240.1"
FT                   /translation="MGRMTKNANHPTEPVATPRGLDHIVAGVSTSDGDGVKLTRVLQQP
FT                   LQKRLDPYLMLDAFGSDNPGDYIGGFPNHPHRGFETVTYMIAGRMRHRDSAGHEGLLEN
FT                   GGVQWMTAGRGLVHSELPEQEEGLMEGFQLWLNLPAKDKMREPWYRDIQSEEIPEYTTA
FT                   EGVHVRVIAGTSHGIEGAVLRAHTEPLYLDLTLPPGAEFAQPLPADHNVLVYVFRESLW
FT                   IAGSEVPTRRMAILANDVGSDGVVLRAGATNHSPARALLIAGRPLHEPIAQYGPFVMNT
FT                   QEEVKQAVHDFQNGQLG"
FT   gene            complement(17865..19295)
FT                   /locus_tag="Varpa_0018"
FT   CDS_pept        complement(17865..19295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0018"
FT                   /product="Carotenoid oxygenase"
FT                   /note="PFAM: Carotenoid oxygenase; KEGG: bbt:BBta_5477
FT                   putative carotenoid oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34241"
FT                   /db_xref="GOA:E6UXP7"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP7"
FT                   /inference="protein motif:PFAM:PF03055"
FT                   /protein_id="ADU34241.1"
FT                   /translation="MNDVTLPRNAPPPNMAPIDFETELGPLPLQGVLPEGLRGTLVRNG
FT                   PNPVVPDPKAHWFAGDGMLHSFTLADGQVHYRNRWLRTDLWRAATEGRDLTSSFQKARV
FT                   SDGPPPQHDGTGNTNVIAHAGRLLALEEAHLPIGFELPTLATLGATDFDGALSGAFTAH
FT                   PKTDPRTGELLFFGYGTPAKLSNGMSFGVISPEGRVTRFEHFEAPYASMVHDFMATDRH
FT                   VMFPIMPLTASMERAQSGRPPYAWEPEYGTRVGLMPRDGSTADIVWWRGPSCYAFHVMN
FT                   AWEADGSLFADVMQFATPPLFPKPDGSPASEITPQSWLVRWQFDLSNPSREFTQTRISD
FT                   VPGEFPRIDDRFAGLPYRHGWYTCHAETTPGGPPRLYAGLAHIDHAKPGTERDMYMFPA
FT                   PEVVSEGVFVPRSPDAEEGDGWLLATVWRSATNTSDLVIFDARALAKGPVCTVSLPHRV
FT                   PVGFHGNWFGEEHTEERT"
FT   gene            complement(19406..20197)
FT                   /locus_tag="Varpa_0019"
FT   CDS_pept        complement(19406..20197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0019"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vap:Vapar_0018 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34242"
FT                   /db_xref="GOA:E6UXP8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU34242.1"
FT                   /translation="MSSMPSVADIEAIERATVAAVSPEASEELDGWLLPFDGGTVKRAR
FT                   SAVPLHRSAVDAGTLDRIEDRYDSRQVVPALRLADADCFDSLRAELERRHYVEDHPTCV
FT                   QIGTARQMRQVAAAGTGAGAGAGALADVDRAPDDAWAALFLGEGFDPVDGAHRVRALAR
FT                   AKGSLYASVRENGRTVAAGAMAFRHGWASVHGMRTDKAHRGRGLAGRVLAGLAQGALTK
FT                   GFERVFLQVDAQNHPALSLYRRAGFQTHWQYRYWQRQQWPR"
FT   gene            complement(20194..21462)
FT                   /locus_tag="Varpa_0020"
FT   CDS_pept        complement(20194..21462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0020"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; KEGG:
FT                   vap:Vapar_0019 glycosyl transferase family 51"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34243"
FT                   /db_xref="GOA:E6UXP9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP9"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ADU34243.1"
FT                   /translation="MKKTLRFVLFGLLALVLTALVAIFLIVKIALAPAAGEWSTPVKAG
FT                   PLNFEIGVPTAMRLATSPWFAPRLDGHSLDTRFGTVRFSWKEAAGLQELRCEPCSVEVP
FT                   ALGTQPIKVERLVATVRRDGNTLTGTFEATPGTTETEMLQGTWEGRLAPKNLHLSAKVQ
FT                   DAPIARWYAVLVPALPELQRARIGGTLAVSAQLVLPEATFSVQPVISQFTVEGLGTETM
FT                   LGARTSCGPSAKLANDSWLARAVIAAEDQRFFTHAGYDITEILASIDNNQKEGQTKRGG
FT                   STLTQQLAKLLVTGSDRTAERKLREMLYAVEMEQTLGKARILQLYLDNAPWGGTLCGAE
FT                   AAARRYFKRSARTLEPAQAVWLAAMLHKPQAVLEQWRRDGQIDPDRTKWVADSVRGISR
FT                   NQREALLKSVAAAKYIAPEANTQ"
FT   sig_peptide     complement(21397..21462)
FT                   /locus_tag="Varpa_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.782 at
FT                   residue 22"
FT   gene            complement(21473..22042)
FT                   /locus_tag="Varpa_0021"
FT   CDS_pept        complement(21473..22042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34244"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0020"
FT                   /protein_id="ADU34244.1"
FT                   /translation="MSTPFFERWFANHFINRIGHKTAFALAMLLCMLWSTAGALRAPAA
FT                   PEAMAASHEWPSQWDGVPLRPLALSEVEQRFADRFPGAIGRMTDGTQTLVMREVKQPTR
FT                   MLHPAADCYRALGYRIEQARLERDAQARLWRCFVAQRHGAQKIRVCERIVDAQGTAFTD
FT                   TSAWYWSAASGQSTGPWQAVTVARPM"
FT   sig_peptide     complement(21923..22042)
FT                   /locus_tag="Varpa_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.589 at
FT                   residue 40"
FT   gene            complement(22023..22952)
FT                   /locus_tag="Varpa_0022"
FT   CDS_pept        complement(22023..22952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0022"
FT                   /product="Exosortase EpsH-related protein"
FT                   /note="PFAM: Exosortase EpsH-related; KEGG: vap:Vapar_0021
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34245"
FT                   /db_xref="GOA:E6UXQ1"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ1"
FT                   /inference="protein motif:PFAM:PF09721"
FT                   /protein_id="ADU34245.1"
FT                   /translation="MSLATLAHRHPRIVDWGIHIDRTPAAGWLGLQFAALAPTWAWMVQ
FT                   RMRDGSDDPLGLVALVALAALAWQCRRELRASPRLGWLALAGAGTVLATVLRSGLGVVP
FT                   ALPPLAAGLVAVLALACGLLAFLPRRVAALPVTGLAVLALPLLSSLQFYAGYPLRVVTA
FT                   EASRWLLAPGFDVAREGTSLMVDGRLVIVDAPCSGVQMVWLGYFTACAVALWARRSDKA
FT                   FLRRLPMVGVLVLAGNVVRNSVLIAFEGAGHALAPWAHNALGLVVLAAVCGCIGRLMVP
FT                   ARAVPEPADHPVPGLITTQGARHVDTVL"
FT   gene            complement(22971..25040)
FT                   /locus_tag="Varpa_0023"
FT   CDS_pept        complement(22971..25040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0023"
FT                   /product="NAD(+) ADP-ribosyltransferase"
FT                   /EC_number="2.4.2.30"
FT                   /note="PFAM: Vault protein inter-alpha-trypsin
FT                   domain-containing protein; von Willebrand factor type A;
FT                   protein of unknown function DUF1555; KEGG: vap:Vapar_0022
FT                   vault protein inter-alpha-trypsin domain protein; SMART:
FT                   von Willebrand factor type A; Vault protein
FT                   inter-alpha-trypsin, metazoa"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34246"
FT                   /db_xref="GOA:E6UXQ2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="InterPro:IPR013694"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ2"
FT                   /inference="protein motif:PRIAM:2.4.2.30"
FT                   /protein_id="ADU34246.1"
FT                   /translation="MDATTTPRPGRWLWLATVSLATAGFIAMGVRPVHAQEAPAGPRLK
FT                   TESPYFFVKSDDPSVDRLPLKGTEVAVKISGVIADVTVTQTYRNEGQRAIEAKYVFPGS
FT                   TKAAVSGLNVRLADRLITAQIREKQQAQIEYDTAKKEGKTAALLEQHLPNVFLMNVANI
FT                   LPGDDVKVELRYTELLVPQSGNYEFVFPTVVGPRYNSPQSENAQAKWAAQPTLHAGAAP
FT                   STSFKLKATIDTPMGLKEVRSTTHAIDVKKSDEDQHADIALAADGRPADNRDFVLDYRL
FT                   AGEKIESGLMLYKGQGENAENFFLAMVEPPKAVAASAISPRDYIFVVDISGSMHGFPLD
FT                   TAKTVLERLIGGLRPSDTFNVLLFSGSNKMLSPKSVPATRANIEQALATIKNYSGSGST
FT                   ELIPALKRVYAEPKEENVSRTVVVVTDGYVTVEREAFDLVRSNLSKANVFAFGIGSSVN
FT                   RSLMEGIARAGMGEPFIITDPVQAPEQAARFRRMVESPVLTSVKATFGGLDVYDVEPQA
FT                   LPDVLGERPVIVFGKWRGEAKGRVIIEGRSASGPYRQEVRIDDRTRLDTAALRTLWARH
FT                   RIQSLSDQESLEGSAAFKERITELGLKYSLLTQYTSFIAVDKVVRNAAPQNSVDVNQPL
FT                   PMPQGVSDLAGPALGAEVPSTPEPETLGALAVVLSMLAMLRRRARRNDARRFTS"
FT   sig_peptide     complement(24933..25040)
FT                   /locus_tag="Varpa_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.817 at
FT                   residue 36"
FT   gene            25245..26708
FT                   /locus_tag="Varpa_0024"
FT   CDS_pept        25245..26708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0024"
FT                   /product="Inner membrane CreD family protein"
FT                   /note="PFAM: Inner membrane CreD family protein; KEGG:
FT                   vap:Vapar_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34247"
FT                   /db_xref="GOA:E6UXQ3"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ3"
FT                   /inference="protein motif:PFAM:PF06123"
FT                   /protein_id="ADU34247.1"
FT                   /translation="MLQFLKALQTSVLAKVAGLFFLTLLLCIPLAEIDSINNARGESQR
FT                   EAAQELAATYASSQTMIGPLLLVPYVERWMEPLRDAQGKVIGQEQRSKEMVHAVFPDKL
FT                   HIEGSMTPQERYRGIFKIPFYTLNATLTGGFTAFDPKVLPHSENDSKIEFKAPFIAFNV
FT                   SDLRGLDGSPALVMGGEALRFKQRVPGLADNAWFADGIHAPVTGAALAAWQANTPLTFE
FT                   MKLGLVGQDTLAIAPIADDTTAHLTSPWAHPSFGGRFLAAQRNVTPQGFDAQWRISSLV
FT                   TSAREQVRAGLSGRVDGNDAAAVATASSARPQRNLGPLQTFDVSLAQPINVYSMSTRAG
FT                   KYGMLFIGLVLMAAFMFELFRKLRLHPIQYGLVGLSIALFFLLLLALSEKFAFWIAYAA
FT                   AASASVALLAVYFSAVLGGWKRGLSFGAFIALLYGALYGLLASESNALLLGALLIFGML
FT                   ATLMLVTRKVDWYALSRRAEPIAPVAQGA"
FT   gene            26705..27997
FT                   /locus_tag="Varpa_0025"
FT   CDS_pept        26705..27997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0025"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: azo:azo0701 putative beta-hexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34248"
FT                   /db_xref="GOA:E6UXQ4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ4"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ADU34248.1"
FT                   /translation="MKLLRSALGALGWLALAALWFWAWHLKDPHLRFMRAWELPTLLGA
FT                   LGVGAVIAWRFGRRALRPVSLGLVFAALLTALGNEAASLHHRAAVPASSGPLAQMLGAH
FT                   FIVGYDDAKDLHELARKGLIGGVFITGRNVKGRTAIELRKEIDDLQALRREAGLPPLIV
FT                   ATDQEGGAVSRLSPLIERQPGLSTLIDADVPEAELAQRAHAYGAQQGRSLAALGITLNF
FT                   SPVVDLRTGREPGRWDLHTRIDERAISADPALTTQVALAYEQGLESAGVRGTLKHFPGL
FT                   GGVTEDTHHFAATLRTPVARLATHDWKPFQDVSRNSSAAIMLGHVVVPELDAVYPVSFS
FT                   RKIVQQLIRGEWGYQGLLVTDDLTMGAAYNRGLCDATVRALDAGVDLVLIAFDHDKYFD
FT                   AMHCAQQAAQRGALDLPMLERSGARRLQPLR"
FT   gene            28009..30411
FT                   /locus_tag="Varpa_0026"
FT   CDS_pept        28009..30411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0026"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="KEGG: vap:Vapar_0024 penicillin-binding protein, 1A
FT                   family; TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34249"
FT                   /db_xref="GOA:E6UXQ5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ5"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ADU34249.1"
FT                   /translation="MFKRSSPSRPDDGATPDERNARWRLIGKWSAIVVGSGALVVLVAS
FT                   IVAVVAIYPKLPDISELADYRPKLPLRVYSTEGTLIGEFGEERRNLTPFASIPKVMKDA
FT                   VLAVEDARFYDHGGVDYKGFVRAAVASLKGGRKQGASTITMQVARNVYLSSERTLSRKT
FT                   YEIMLAFRLEQQLTKDQILEIYLNQIYLGNRAYGFAAASEAYFGKPLQNVTIAEAAMLA
FT                   GLPKAPGANNPVANPRRARARQLYVIDRMQETGFITAEQAAEAKKEELHLRDAADPNRL
FT                   HAEYVAETVRQMMYTQYGDSIYTSGMKVYTSLVAADQAAAYKSLRKGIMDYERRQVYRG
FT                   PEKFVDLPTEQKEVDEAVDDALAEHPDNGDVIAAVVLDANAKEISAVRANGEAIQITGE
FT                   GLKPAQSGLAAKAPPNIKIRRGAVIRMAKTPKGTWEITQLPEVEGAFIAMDPRSGAIKA
FT                   LVGGFDFGKNKFNHVTQAWRQPGSSFKPFIYSAALEKGFTPATVVNDAPLYFDAAANGG
FT                   QPWEPKNFEGTYEGPMPLRTALMKSKNLVTLRVLQSIGAPYAQDWVTKFGFDKDKQPAN
FT                   LPMGLGAGSVTPMQMAVGYSVFANGGYRVNPYLVTRITDMKDKVIMETEPPVLDEARRA
FT                   IPARNAFVMDSLLQSVVKGGTAFKAHQALKRDDLYGKTGTTNDSFDTWFAGFQPTRVGI
FT                   AWIGYDTPRQLGVRGETGGSLSLPIWIGYMQSALQGVPVTQPTAPPGVVSIDGEWYFDD
FT                   FTPGHNVASLGLENAEQAPPPVEELTGAPIGAPPPPEERNRILDFFR"
FT   gene            30489..31094
FT                   /locus_tag="Varpa_0027"
FT   CDS_pept        30489..31094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34250"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ6"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0025"
FT                   /protein_id="ADU34250.1"
FT                   /translation="MEILTLVALLLVGAYILKSRDQRQRIALLGSHLGQYQIEKLMESL
FT                   TQGYLRCLGEDDPERRQQIWSLLDTTEEKLSSQFDSFAAGFARLPEADTRVSKLPIAIP
FT                   YAHKLFPSTTFDLREALNIHARGIAGVMKNASSRPAKSKAFTMSAELFLMQHTCHWFCK
FT                   SKTVASARMLARHQTSYEQLLDAVSPETRRAYGTLTGQ"
FT   gene            complement(31088..32527)
FT                   /locus_tag="Varpa_0028"
FT   CDS_pept        complement(31088..32527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0028"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: vap:Vapar_0026 sensory histidine kinase CreC;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34251"
FT                   /db_xref="GOA:E6UXQ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34251.1"
FT                   /translation="MTRRTRIFIGILLIYTAGIAFLLYRVVSDIDPRYRESAEESLVET
FT                   SQLMASLVEQDVIAGAINTGRLEPLFRTVYAREFSAQIYNLHKSQVELRVYVTDRSGRV
FT                   MFDSLGRHLGADYSQWSDVSRTLAGLYGARTSRDVDGDPRTSVMYVGAPIRWNNEIVGM
FT                   VSVGKPVQSFGQFVEDARARTLWVGVGSGLALLLLAVIVSVWLVRPFGLISDYWTWVRA
FT                   QRTLSFSRMARRAVDAVRTGFSEMRDALTGRNYVADYVQTFTHEVKSPLSAIRGAAELL
FT                   QEPSMPHAERERFLKNIERETQRIQEIVDRMMELTALETRRALERTEPVPLASLIDDIA
FT                   ISAQPAAAKRNIRLLVNIRTEASTEGDPFLLRRAISNLLDNAIDFSPPDSEVLLTLETT
FT                   SKLARVTVRDHGPGIPDYAQEKVFQKFYSLARPHSQKKSTGLGLAFVKEIASLHRGRIE
FT                   LGNATRGGAVATLTLPLLSHH"
FT   gene            complement(32524..33318)
FT                   /locus_tag="Varpa_0029"
FT   CDS_pept        complement(32524..33318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0029"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: vap:Vapar_0027 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34252"
FT                   /db_xref="GOA:E6UXQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU34252.1"
FT                   /translation="MSFKPRILIAEDESGIADTLQYVLKSDGFTPVWCATAEEAIAQFA
FT                   EEPPALAILDIGLPDLNGFELFKRLRALNQSQGGPEVPMLFLTARSDEIDRVVGLELGA
FT                   DDYIAKPFSPRELVARVRTILRRSTRNSPGGPGTAAGPGNGVPPQISPPAPPTAPQTPP
FT                   MPFALDNERMQIRYYGRLLELSRYEYGLLRLLVQRPGRVFTRDELLEHVWDDASDSFDR
FT                   TVDAHIKTLRAKLKAVAPDVEPIRTLRGTGYALNEELPAKAS"
FT   gene            33888..34832
FT                   /locus_tag="Varpa_0030"
FT   CDS_pept        33888..34832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34253"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0028"
FT                   /protein_id="ADU34253.1"
FT                   /translation="MTPSETKAIVTLSLLAAFVDGEKHERERAEIKRIAEGLSQADGLN
FT                   LPTLYQDVLMKRVSLASVAGELTSSESKQLAYEMAVCVCDADGAQSEAERMFLADVRTS
FT                   LGLDASAARFSEQAEEIAAVPVAAAAGTAVASVAAPNVPDSAELDKSILNASILNGALE
FT                   LLPETLSTMAIIPLQMKLVYRIGQAHGYQLDSGHIKDFLATVGVGLTSQYLEQAGRKLL
FT                   GGLLGKMGGGLLRGLGNQAVSSGMSFASTYALGHVAKRYYGGGRTLSTQMLKDAFSGVV
FT                   KEGQSLQTQYLPAIQEKARTLDAGKVLSLVRGA"
FT   gene            complement(34834..35235)
FT                   /locus_tag="Varpa_0031"
FT   CDS_pept        complement(34834..35235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0031"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; KEGG: vap:Vapar_0029 transcriptional
FT                   regulator, MerR family; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34254"
FT                   /db_xref="GOA:E6UXR0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR0"
FT                   /inference="protein motif:TFAM:TIGR02044"
FT                   /protein_id="ADU34254.1"
FT                   /translation="MTVQVAIGEAARLSGVSARMVRHYEGLGLLPAVARTDSGYRQYSE
FT                   ADVHTLRFIKRSRDLGFSMEEIAELVGLWHNRRRASSSVKRVAEKHLGELEQRIADMQS
FT                   MRNTLAHLVHCCHGDARPDCPILDDLGKA"
FT   gene            complement(35232..35426)
FT                   /locus_tag="Varpa_0032"
FT   CDS_pept        complement(35232..35426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0032"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: vap:Vapar_0030 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34255"
FT                   /db_xref="GOA:E6UXR1"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR1"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ADU34255.1"
FT                   /translation="MSQKFQVSGMSCGHCVNAVQNAVQTVDPEAQVTVDLETGHVDVLS
FT                   EQPRKDIVAAIENAGYAVQ"
FT   gene            35575..37827
FT                   /locus_tag="Varpa_0033"
FT   CDS_pept        35575..37827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0033"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: vap:Vapar_0031 heavy metal translocating
FT                   P-type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34256"
FT                   /db_xref="GOA:E6UXR2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR2"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADU34256.1"
FT                   /translation="METLQQHPSAATANATTLDLSVGGMTCASCVMRVERALKNVPGVQ
FT                   AVSVNLATESARVVTTDAEDMDARLRRAVRAAGYEPRAASSAADEAAALSPWHGVGPVA
FT                   IGLALSIPLLAPMLGDPFGQDWMLPPWLQLLLAAPVQFWLGARFYRAGWHAAKARTGNM
FT                   DLLVALGTSAAFGLSLWLWWRSATGEHAGHGEMPHLYFEAAAVVITLVLLGKWLEARAK
FT                   RQATSAIRALQQLRPEVAHLVGARGESDVPLAEVMVGDRLAVRPGERVPADARVIEGQS
FT                   EVDESMLTGEPLPVAKGPGDALTGGAVNGDGRMVIEVSAIGAESVLARIIRLVEDAQAA
FT                   KAPIQRLVDKVAAVFVPVVLVIALLTLAGWLIAGAGIETALIYAVAVLVIACPCALGLA
FT                   TPVAVMAGTGVAARHGILIKDARSLEIAHRVDTVAFDKTGTLTLGRPVLTALLPVASIE
FT                   ATENQLLATAASLQGGSEHPLARAVLAAAVQRGVQAPPLGAMQAMPGRGVRGEVNGATW
FT                   AIASLRWCRELDAMPAEAEVESLQAQGATVSALLRFDEAGAAHVQALLAFADEPKPQAA
FT                   EAIRTLRARGLRVVMISGDNLRAAQAMAARLGIAIEDVRADVLPADKAAQVSALRRDGH
FT                   VVAMVGDGANDAPALAAADVGIAMAPSGGGTDVAMEAAGITLMRGDLALVAQAFELSAR
FT                   TVAKIRQNLFWAFAYNVAGIPLAAFGLLSPVVAGAAMALSSVSVMANALLLRRWKP"
FT   gene            complement(37953..38435)
FT                   /locus_tag="Varpa_0034"
FT   CDS_pept        complement(37953..38435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0034"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vap:Vapar_0032 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34257"
FT                   /db_xref="GOA:E6UXR3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU34257.1"
FT                   /translation="MRRLATLEDLHAVFTLYMHEKVVPYLGYDPMPLEEFRPIYQEMLE
FT                   SRRFFVYELDGRVAGFYRATRYPGRVQHVASLGTLAVDPTLHGKGVALAMVSQAIDELK
FT                   AAGVKRIELCVESDNAPGLRFYEKLGFQREGTLRKFYKRASDAEAIDDHMMALLFD"
FT   gene            complement(38484..39611)
FT                   /locus_tag="Varpa_0035"
FT   CDS_pept        complement(38484..39611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0035"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: ajs:Ajs_3693
FT                   YhhN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34258"
FT                   /db_xref="GOA:E6UXR4"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR4"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ADU34258.1"
FT                   /translation="MHRLVVLVVPVFALLMACEFAWGWFKRRNTYRFSDTLGSLSQGLL
FT                   SQALAVCTQLFQIGLYAMVYPLVAIWTRPAFWNSAIGWIVAVLLFDFCDYWLHRAGHES
FT                   AVFWAAHSVHHQSQQFNFSTALRQESMVAFLGWAFYLPMAVVGVPPEQFGIAGLIVLVY
FT                   QFWIHTEHIGKLGWFDRVFSSPSNHRVHHAVNDGYVDRNYGGMLVVWDRMFGTFAEENE
FT                   RAVYGTRKALASFDPVRAILGPYVPLVRDSWHTRRWRDKLAVWFKPPGWRPADVAARFP
FT                   EAPFSLDEAMHIHDPALTRVQVVSASIHFIGWIGVTLAFLWGADDLVFRTGLELLALAI
FT                   AGFWTIGAVLDSRIRLRWAWCAQCALLAFSVALLA"
FT   gene            complement(39647..40948)
FT                   /locus_tag="Varpa_0036"
FT   CDS_pept        complement(39647..40948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0036"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: vap:Vapar_0033
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34259"
FT                   /db_xref="GOA:E6UXR5"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR5"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ADU34259.1"
FT                   /translation="MSSGAAHAVLAASAARAASAPVRVSGMGFVTPIGRTVEAFDDALF
FT                   AGRSAVRAQTLEIKGMDPMSLAVAACDFDSNGVRSTSRLPLDRGTAMALAAAQDAATQA
FT                   GLGADSVDPERLGIFWGSGLAGAGAFDTTTSALYGEQKRMRPTTVLTVMPNAAVAELAL
FT                   RFGARGSAIAYACACASSAVAIGEAMRAIRGGWIDVAIVGGHDAMLTPGVMASWHAMRV
FT                   MAPPPADAPSSACRPFSGDRAGFAIGEGAAALVIESEAHARARGANAAPFVLAGYATNC
FT                   DGTHITNPDSAGQVRAMRAALRDAGIKASDIGHINAHGTATSAGDAAEAASIREVFGNA
FT                   TPVSATKAIHGHVLGGGGAIELIAALRALAREALPPIANLQVPDAAFDLDFVRGEAREA
FT                   KGIRYALSNSFAFGGTNAVIVAGLSSDASGATDR"
FT   gene            complement(40945..41229)
FT                   /locus_tag="Varpa_0037"
FT   CDS_pept        complement(40945..41229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0037"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   vap:Vapar_0034 phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34260"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR6"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ADU34260.1"
FT                   /translation="MFSSPTFNSIATILETDFKVDRSAISPATVLTDLGLDSLALMEFV
FT                   FAVEDAFHLRIPEDRLDPREAGITLQRLCEVIDTESSGVVAPAAEVAHA"
FT   gene            complement(41268..42128)
FT                   /locus_tag="Varpa_0038"
FT   CDS_pept        complement(41268..42128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34261"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0035"
FT                   /protein_id="ADU34261.1"
FT                   /translation="MSARDASDELSLVPPEVQRTAVVLLHGLCSTPDELLTVQSALRAR
FT                   GYAAHPLSIDGYSFDANAPMQRAAPYERWLDAIQAQVKALRKQHDRVMLVGISAGSSLA
FT                   LGAAIRCGRDVDALVLMSTTLRFDGWAIPRTQFLLPLAFYTPLGRLWQYRERPPYGVKN
FT                   ERVRAWIERELRHRKISRAGCSVLGVDHLREHDRLIRHVRRNLNAVQCDNVLALHAQQD
FT                   EVASVANLGILARGLRCRAFRTVVVANSYHMITIDNDRQQVVRETVSFADAVAHGTMPA
FT                   HPLYA"
FT   gene            42267..42956
FT                   /locus_tag="Varpa_0039"
FT   CDS_pept        42267..42956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0039"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: vap:Vapar_0036 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34262"
FT                   /db_xref="GOA:E6UXR8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU34262.1"
FT                   /translation="MRILLVEDDAVLRDVMLRSLADAGHRVDVSTNVEDADHLWRVQPF
FT                   DAVLLDLNLPATASPTSGLASGLTALRQARARGDRTPVLVLTARGRTEERIAGLDAGAD
FT                   DYLGKPFDLAEVEARLRALVRRAKGTEDIVLLGQLKLDRKARRFSTAGGPLDLPAREFE
FT                   VLWELMSPPGRTVSKRALSDKLSSFDESLGDNALEAFISRLRKKLLGTGASIRTLRGIG
FT                   YLLEAEV"
FT   gene            42953..44332
FT                   /locus_tag="Varpa_0040"
FT   CDS_pept        42953..44332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0040"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: vap:Vapar_0037 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; Two-component sensor kinase
FT                   domain-containing protein; histidine kinase HAMP region
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34263"
FT                   /db_xref="GOA:E6UXR9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34263.1"
FT                   /translation="MTDSTAAPIAPSLTRRVLRNVLVPLALTWMLGAVIALVIANYFSE
FT                   RAFDRGMLDDAYALSANVQAGERGIELLLTPREVATVLFDQVDKIYFSVQRLDGTLISG
FT                   ESDLQAPLPVNGARYRFSDVTYQGKAMRAVTLDHDAEPGIAMPYRVVIAQTTLSRTALV
FT                   RQLLGFALAPQILLLVLLAVWLWYGIRSDLRPLGDLQRALDRRDVRDLSPVVVAQTSRE
FT                   LQRLGNAVNSLFERLGHSVQAQREFVGNVAHELRTPLAGIRALAEYGLAQHDTTVWREQ
FT                   LERVSERQARASHLIDQLLALALAEEARTSLARAPVRLDVLAEQTVLRHLARADARGVD
FT                   LGARGLDDGVVVMANEALVEGILDNLIDNALRYGGRTITVELAGRTLSVIDDGPGIPLE
FT                   AQRDLMQRWAQGPAGEKLGQGSGLGLSIVSRYAELLGAELRLEAAEPVGLRVSVAFGEV
FT                   A"
FT   gene            complement(44464..45213)
FT                   /locus_tag="Varpa_0041"
FT   CDS_pept        complement(44464..45213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0041"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: psa:PST_3589 glyoxylase I family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34264"
FT                   /db_xref="GOA:E6UXS0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS0"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADU34264.1"
FT                   /translation="MQFARIHHVAIICADYARSRRFYAEVLGLRVVAENYRAARASYKL
FT                   DLALPDGSQIELFSFPEAPARATRPEAQGLRHLSFEVHDVQAAADELAAQGIAVEPLRV
FT                   DEYTGRRSTFFADPDGLPLELYEAAPAENLDALLLKLEGALHLREVRASAAQIEELLDD
FT                   DFRELGVSGMEWTRSAIIDALRDEAFSERTMSEFRVQRMAPDIALVTYRAHRAAIPERA
FT                   AADSLRSSLWRLRRGRWRMVFHQGTPL"
FT   gene            complement(45219..45695)
FT                   /locus_tag="Varpa_0042"
FT   CDS_pept        complement(45219..45695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0042"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pag:PLES_52491 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34265"
FT                   /db_xref="GOA:E6UXS1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU34265.1"
FT                   /translation="MSSAAPWVLRRADASDAASVAACAIEAFRHYIPRLGLTPIPMTRD
FT                   YGAAIANAQVWVATQQDEVIAALVLDITDEGFLVDVIAVRPAHQGTGVGRALLELAERE
FT                   ALRQGHDSIYLFTNEKMTENRALYERIGYVEYRRLVLAERTRVFLRKPLNKTKD"
FT   gene            complement(45692..46177)
FT                   /locus_tag="Varpa_0043"
FT   CDS_pept        complement(45692..46177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0043"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: vap:Vapar_0038
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34266"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS2"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADU34266.1"
FT                   /translation="MARIAQRLAALGLVLPPTVTPPPGVVLPFQFVRLIGRRAIVSGHG
FT                   PLNADGSIASPLGKLGREVSVDQGYAAARLTALAMLGSLQRALGDLDRITAWTRVFGMV
FT                   ASAPGFDKQPAVINGFSDLILDLFGPDVGAHARSAVGMAELPFNIPVEIEGEVEFDA"
FT   gene            complement(46247..47350)
FT                   /locus_tag="Varpa_0044"
FT   CDS_pept        complement(46247..47350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0044"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   vap:Vapar_0039 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34267"
FT                   /db_xref="GOA:E6UXS3"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS3"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADU34267.1"
FT                   /translation="MSTLFDPVQAGDLKLANRIVMAPLTRNRSPNAVPPDLAVTYYAQR
FT                   ATAGLLITEATAISHQGQGYSDVPGLYGTEQLDSWKRVTEAVHAKGGKIVVQLWHVGRV
FT                   SHTELQPDGGKPVAPSAITAKTKTVLIKDGVPTFVETSEPRALDAAELPGIVHAYAVAA
FT                   RSAVETAGFDGVEVHGANGYLLDQFLKDGSNKRTDDYGGSIQNRARLLLEVTRAVVDAV
FT                   GGGKTGIRLSPVTPANDVHDSDPQPLFTYVVKQLAQLNLAYIHIIEGATGGPREIEDRP
FT                   FDYEALKAAYREAGGKGAWMVNNGYDKPLADEAVKEGDDLVAFGKPFISNPDLVRRLRE
FT                   NAPLNELDKATMYGGGAKGYTDYPALG"
FT   gene            complement(47447..49276)
FT                   /locus_tag="Varpa_0045"
FT   CDS_pept        complement(47447..49276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0045"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   vap:Vapar_0040 protein of unknown function DUF1446"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34268"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS4"
FT                   /inference="protein motif:PFAM:PF07287"
FT                   /protein_id="ADU34268.1"
FT                   /translation="MKDSSNTNERIVRIGGASGFWGDSSVGAPQLVASGKIDYLVFDYL
FT                   AELTMSILAGARLKKPELGYATDFVSVAMKSVLRDVVKQGIRVVSNAGGVNPQGCADAL
FT                   AALAKEQGIELKIAVVSGDDVSALLPQLRQAQPPVRELQSGAALPERVLTANAYLGARP
FT                   IQAALDAGAQVVITGRCVDSAVTLGVLMHEFKWQPGDHDLLAAGSLAGHIIECGCQATG
FT                   GLHTDWDTVPDWPHIGYPIVECSADGSFVVTKPAGTGGKLVPAVVGEQMLYEIGDPAAY
FT                   LLPDVTADFTQVRIEQAGEHRVRVHGARGRAPTTTYKVSATYVDGFKTAAQLTIVGFDA
FT                   AAKARRTGEAILARTSELFAQFGFGPYSATHIEMLGAESCYGPHANAQVLQTREVVLRL
FT                   AVTHPRKEALELFAREVAPAGTSWSPGTTGAGGGRASVSPSIQQYAFLLDKSQVQASVN
FT                   VDGQRIDVPRTLAPAAADMPAPRPAGATPHEAAPEAADTVEVPLIRLAWARSGDKGDTS
FT                   NIGVIARHPALLPLLRDQLTEARVAEWLAHLVKGRVTRYEVPGIDAFNFVCEEALGGGG
FT                   MASLRNDPLGKGMGQILLAVPLRVSAALLALVS"
FT   gene            complement(49273..50055)
FT                   /locus_tag="Varpa_0046"
FT   CDS_pept        complement(49273..50055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0046"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   vap:Vapar_0041 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34269"
FT                   /db_xref="GOA:E6UXS5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS5"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU34269.1"
FT                   /translation="MAETSSTIELREEMRGPVMWLTIDREERRNAINAAVLARLSDALA
FT                   RANADAAVRAVVITGTGTRAFCAGADLQSGTSFKFDYAEPYQGFANLFRQARQSTVPLI
FT                   ARVNGACMAGGMGIMAMCDMAVASSSAVFGLPEVKVGLFPAQVLSVLDGLLPRRVLAEM
FT                   CITGEPITAAQALEHGLINRTSDDVDESIDWLLGRMLDKSPAAIRRGLYTMKKIEAMAF
FT                   EESMAFTESQIGLFALTEDAAEGQLAFREKRKPQWSGR"
FT   gene            complement(50203..50811)
FT                   /locus_tag="Varpa_0047"
FT   CDS_pept        complement(50203..50811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0047"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   vap:Vapar_0042 glutathione S-transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34270"
FT                   /db_xref="GOA:E6UXS6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS6"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADU34270.1"
FT                   /translation="MKLYYSPGACSLSPHIALHEAGLAFEPVMASTKSHKLQDGTDYYG
FT                   INPLGYVPMLELDDGTRLREGPAIVQYIADLAPTKNLAPANGTLQRYRLQEWLTFIGTE
FT                   MHKGYSPLFNPNMPEEAKTIFKDKLKSRYEWLDGQLADKQYLMGEHFSVADGYLFTVTN
FT                   WTKPTGVDISAFANVQAWHARVAARPAVQEAMKAEGLLK"
FT   gene            51014..51199
FT                   /locus_tag="Varpa_0048"
FT   CDS_pept        51014..51199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0048"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   vap:Vapar_0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34271"
FT                   /db_xref="GOA:E6UXS7"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS7"
FT                   /inference="protein motif:PFAM:PF07043"
FT                   /protein_id="ADU34271.1"
FT                   /translation="MLKYAIIFAVISLVAGLLGFGGVAAGAAGIAKLLFGLFLVLAVLF
FT                   VVLAALGVGAVKKALD"
FT   sig_peptide     51014..51097
FT                   /locus_tag="Varpa_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.442 at
FT                   residue 28"
FT   gene            51358..52245
FT                   /locus_tag="Varpa_0049"
FT   CDS_pept        51358..52245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0049"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: pol:Bpro_0068 transglutaminase-like; PFAM:
FT                   transglutaminase domain-containing protein; SMART:
FT                   transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34272"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS8"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADU34272.1"
FT                   /translation="MHISHIDAQLDYEVTAPAHMLLNIEAARSGAQAVVEETLTIEPPT
FT                   EMQVFCDEGSGNRFIRFDAKPGSLKIGYRATVQRSHVHVPPDLCEVPVNEVPDEVLHYM
FT                   MPTRYCESDLMSRCAQQLFGELPPGIGRVQAIVDWIHDSIAYEPGSTDSTTTAREVFVE
FT                   RAGVCRDFAHLGITFCRALNIPARLVVGYVWFDEPPQDFHAVFEAWLGGQWVLFDPTRM
FT                   APVDRLVRVGTGRDAKDVAFCTIFGAVRMTDKKLVVRELQDESVPPPAAPAPSGALVGI
FT                   EKPVPVTQLAETTA"
FT   gene            52422..54380
FT                   /locus_tag="Varpa_0050"
FT   CDS_pept        52422..54380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0050"
FT                   /product="glucose inhibited division protein A"
FT                   /note="KEGG: vap:Vapar_0045 tRNA uridine
FT                   5-carboxymethylaminomethyl modification enzyme GidA;
FT                   TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34273"
FT                   /db_xref="GOA:E6UXS9"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS9"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ADU34273.1"
FT                   /translation="MLYPEEFDVIVVGGGHAGTEAALAAARMGAKTLLLSHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRVLY
FT                   KAAIRHRLENQPNLSLFQQAVDDLMVEGDRVVGAVTQVGIAFRARTVVLTAGTFLDGRI
FT                   HVGLDNYQAGRAGDPPAISLSARLKELKLPQGRLKTGTPPRLDGRSIDFSKCTEQPGDG
FT                   MPGGAGPMPVFSFMGRADMHPRQMACWITHTNARTHDIIRSGFDRSPMFTGKIDGVGPR
FT                   YCPSVEDKINRFADKESHQIFLEPEGLTTNEYYPNGISTSLPFDIQYQLVRSMPGLENA
FT                   HILRPGYAIEYDYFDPRELKSSFETRSVKGLFFAGQINGTTGYEEAAAQGLFAGINAAL
FT                   QCRGEDAWLPRRDEAYLGVLVDDLITKGVTEPYRMFTSRAEFRLQLREDNADMRLTEAG
FT                   RKLGLVDDARWDAFSRKRDAVSRETERLKSIWVNPRNLPAAESERVLGKAIEHEYNLAD
FT                   LLRRPDVNYETLMSLDGGKYSASSALSETEIEQIEISAKYSGYIERQHDEVERAAHFEN
FT                   LRLPADFDYGQVKALSFEVRQKLDKHRPETLGLASRISGVTPAAISLLMIHLRKGGHKA
FT                   FARDAATEAAAEPQSAE"
FT   gene            54377..55018
FT                   /locus_tag="Varpa_0051"
FT   CDS_pept        54377..55018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0051"
FT                   /product="methyltransferase GidB"
FT                   /note="KEGG: vap:Vapar_0046 16S rRNA methyltransferase
FT                   GidB; TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34274"
FT                   /db_xref="GOA:E6UXT0"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT0"
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /protein_id="ADU34274.1"
FT                   /translation="MSAPIDTLRAGAGALGVTLSDRQGEQLLAYGTLMLKWNKVYNLTA
FT                   VRDPAGVMTHHLLDSLAVIAPLQRQYPEQGRLLDVGSGAGLPGVIIAIMRPDIDVSCLD
FT                   AVAKKAAFVQQVAVELELPNLRGLHARVELLEGSYNVISSRAFASLPDFFNGSKHLLPA
FT                   DGVWLAMKGKMPGDELAVLPPEVAVFHVEQLTVPGLDAERCIVWARKASV"
FT   gene            55133..55747
FT                   /locus_tag="Varpa_0052"
FT   CDS_pept        55133..55747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0052"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   vap:Vapar_0047 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34275"
FT                   /db_xref="GOA:E6UXT1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT1"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADU34275.1"
FT                   /translation="MFGIADYGAFVVAIILFLLIPGPGNLALITSTSKGGIRGGLAATT
FT                   GLIVGDQCLLWAAVAGVSAVLAAYPTAFKAVQWLGAAYLAWLGFKMLLAKPGSAPILNI
FT                   KPGHFFRQAFMITLLNPKAIVFYMAFFPLFVDPARHQGLITFGAMAVTIAALTFLYGLT
FT                   STLLTHFLAERIRANRRISGTLEKLAGVFLIAFGVKLAISR"
FT   gene            55766..56680
FT                   /locus_tag="Varpa_0053"
FT   CDS_pept        55766..56680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0053"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /note="KEGG: vap:Vapar_0048 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34276"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT2"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0048"
FT                   /protein_id="ADU34276.1"
FT                   /translation="MAKIFCIANQKGGVGKTTTTVNLAAGLAKVGQRVLMIDLDPQGNA
FT                   TMGSGIDKRELELTVYDVLLESASVAEARVKADKLVEGGCGYDVLGANRELAGAEVEMV
FT                   ALDRREKRLRTALAAVGAEYDFVLIDCPPSLSLLTLNGLCAAHGVIVPMQCEYFALEGL
FT                   TDLVNTIKQVHANLNKNLQIIGLLRVMFDPRITLQQHVSEQLKSHFGDKVFDTVIPRNV
FT                   RLAEAPSYGLPGVVFDPAARGSQAFIAFAQELVEKLPPASAFASGAVAPPIAPVDRMAP
FT                   DLAIPEDVLAPAPASDATPEKSL"
FT   gene            56723..57268
FT                   /locus_tag="Varpa_0054"
FT   CDS_pept        56723..57268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0054"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   vap:Vapar_0049 protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34277"
FT                   /db_xref="GOA:E6UXT3"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT3"
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /protein_id="ADU34277.1"
FT                   /translation="MTVSRILLLPGWQNSGPGHWQTIWESIHGDRRVEQHDWMRPLRGD
FT                   WSARLEEEVLAAPGPVAFAAHSLGCILVAAWAAHSRNTHKVAGALLVAPGDVEREDLRQ
FT                   LIPGWAPIVRQPLPFSSVLIAANDDPYCEASRSRQLAKDWGARFIDAGKGGHLNAESGL
FT                   GDWPEGRQLLNDISKDKN"
FT   gene            57268..58209
FT                   /locus_tag="Varpa_0055"
FT   CDS_pept        57268..58209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0055"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: vap:Vapar_0050 ParB-like
FT                   partition protein; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34278"
FT                   /db_xref="GOA:E6UXT4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT4"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ADU34278.1"
FT                   /translation="MATKKPKGLGRGLEALLGPTAAPAADHGNSGTEEGAAPPNPTTLM
FT                   LDQMVAGVYQPRTRMDEGALYELAESIKVQGIMQPILVRRLDAESAAAKNAEYEIIAGE
FT                   RRFRAAKLAGLESVPVLVRDVPNEAAAAMSLIENIQREDLNPLEEAQGLQRLVAEFGLT
FT                   HEMAAQAVGRSRSAASNLLRLLNLAEPAQQMLMAGDIDMGHARALLSLDRGTQITAANQ
FT                   IAAKKMSVRETEALVKKLAAEFTLTPSRRGNSGEKSRDLQRVEEELADLLTAEVEVRIK
FT                   KRTKRGESGELAIHFGSIEALNGLIERIRRTA"
FT   gene            58330..59223
FT                   /locus_tag="Varpa_0056"
FT   CDS_pept        58330..59223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0056"
FT                   /product="peptidoglycan-binding domain 1 protein"
FT                   /note="KEGG: vap:Vapar_0051 peptidoglycan-binding domain 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34279"
FT                   /db_xref="GOA:E6UXT5"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0051"
FT                   /protein_id="ADU34279.1"
FT                   /translation="MKFTQFPLAAIAVGALLLTGCAATDMQMGSQSAKTMATGSAAGSA
FT                   TAGESSQLERCESPLGTVSLIENQSAGWYTILTGEYRLPPTANLLRLLVQQSNCFIVVE
FT                   RGAAGMNAMTRERALQQSGEMRGGSNFGRGQMVASDYGLSPEIVFSNSDAGGIGGALGG
FT                   LVGGGRGRALAAIGGSMQTKEASALLTLIDNRSGVQVAASEGSASKTDFGAFGGLAGRS
FT                   GAGGLGGYTNTAQGKVIAAAFMDAFNQMVRSLRNYKAQTVRGQGLGGGGRLGVDGGAAP
FT                   SQTYVPPEQAPARRRK"
FT   sig_peptide     58330..58401
FT                   /locus_tag="Varpa_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.342 at
FT                   residue 24"
FT   gene            complement(59307..60731)
FT                   /locus_tag="Varpa_0057"
FT   CDS_pept        complement(59307..60731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0057"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   vap:Vapar_0052 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34280"
FT                   /db_xref="GOA:E6UXT6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT6"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADU34280.1"
FT                   /translation="MNAPTQTSHLMPALHLRDVPASLIDGLKARFGANCSTAMAVRTQH
FT                   GRDESSFDAPPPSAVVFAESTQDVADAVKLASEHSVPVIPFGVGSSLEGHLLAVQGGIS
FT                   IDVSRMNKVLSINADDLTVTVQPGVTRKQLNEEIKSTGLFFPIDPGADASIGGMTATRA
FT                   SGTNAVRYGTMRENVLALEVVTAAGEVIRTGTRAKKSSAGYDLTRLMVGSEGTLGVVTE
FT                   VTLRIYPLPEAVSAAICSFPSIEAAVRTTIETIQLGVPIARVELIDVNTVRMVNAYAKL
FT                   NLREEPMLLMEFHGSPAGVKEQAETVQELASGHGGNAFEWASTPEERTRLWTARHNSYF
FT                   AAVQSRPGCRVISTDTCVPISRLADCLLDSVAEADASGIPYFLVGHVGDGNFHFGYLLD
FT                   PNVPEERVKAEALNHALVTRALALEGTCTGEHGVGLHKMDFLVTEAGVGAIDMMRTIKR
FT                   ALDPKNIMNPGKIFSL"
FT   gene            60814..61314
FT                   /locus_tag="Varpa_0058"
FT   CDS_pept        60814..61314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34281"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0053"
FT                   /protein_id="ADU34281.1"
FT                   /translation="MNPTTLSALAAFPAQLEAHYAAVPEAFRHWVPPSWEGVPSEAFTA
FT                   IEQLCHVRDIEIEGYHVRFRRTLSEDRPTLASIDSEPLAIERNYGAADAKQVLADFRLA
FT                   RVQTMEIVSSLTDAQLARTAVFEGYGPLTMRSLIHYLCSHDQQHLAGLQWLAGKIDAST
FT                   VPA"
FT   sig_peptide     60814..60870
FT                   /locus_tag="Varpa_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.630) with cleavage site probability 0.603 at
FT                   residue 19"
FT   gene            61329..61931
FT                   /locus_tag="Varpa_0059"
FT   CDS_pept        61329..61931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0059"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; KEGG:
FT                   vap:Vapar_0054 ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34282"
FT                   /db_xref="GOA:E6UXT8"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT8"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ADU34282.1"
FT                   /translation="MGNRLSQIATRTGDDGTTGLGDNTRVPKDHLRVHAMGDVDELNSQ
FT                   IGVLLCEPMPEAVRELLVDVQHQLFNLGGELSMPGFTLLKPEALLQLDNALADHNAALP
FT                   RLAEFILPAGTRAASLAHVCRTVARRAERAVVALGATAELNDALRQYLNRLSDLLFVLA
FT                   RVLNRMDGGDDVYWKSERMARAAADANVANDEEGSPS"
FT   gene            61928..62278
FT                   /locus_tag="Varpa_0060"
FT   CDS_pept        61928..62278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34283"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0055"
FT                   /protein_id="ADU34283.1"
FT                   /translation="MKMPTHTIALAAAFLLLPTAAVHAQSADNPPKAERAHTLKPPPRN
FT                   SKVVNGVQRGTNAAGRGIDRAEDATRRGVNNVSARASRPVRNVGEAFGRKLAPGSSGRA
FT                   APPPVGPQGNAP"
FT   sig_peptide     61928..62002
FT                   /locus_tag="Varpa_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 25"
FT   gene            complement(62471..63082)
FT                   /locus_tag="Varpa_0061"
FT   CDS_pept        complement(62471..63082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0061"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   vap:Vapar_0057 lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34284"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU0"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADU34284.1"
FT                   /translation="MCGVPAAAALAACGKRKPSTAALKSDARVLAIGDSLTFGYGASPD
FT                   ASWPVKLGEITGWQVENAGVNGDTSAGALQRLPSLLAAGSYDGILIGIGGNDMLRGVSA
FT                   SATRDNIAALVKEAREHTPHVALLATPAPDAMRAFVGSLSDAPFYEEVAKSGQALLVAN
FT                   VYSSVLSDASLRSDRIHANAQGYAKVAQLLADQFKAAGWR"
FT   gene            complement(63180..63596)
FT                   /locus_tag="Varpa_0062"
FT   CDS_pept        complement(63180..63596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0062"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   smd:Smed_0141 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34285"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU1"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADU34285.1"
FT                   /translation="MATAQKSLCPINLALEVFGDRWSLLIVRDMMFAGKRHFREFLQSE
FT                   EGISSNILTERLGKLVEYGVLSKTDDPTHKQKAIYSLTPMGIDLLPVVTQIGIWGRKYT
FT                   PATKESGAPAAALEKGGPALQKTMRTALRRAHLS"
FT   gene            63712..64302
FT                   /locus_tag="Varpa_0063"
FT   CDS_pept        63712..64302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0063"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: mlo:mll1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34286"
FT                   /db_xref="GOA:E6UXU2"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU2"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADU34286.1"
FT                   /translation="MRKLILQMQMSVDGYVSPANGNIDWQVWGWGDRWAWDDKLKAYFN
FT                   AVFEGVDTILLSRKIVEEGYLDHWGRAAKNYPANPQFAFAQKVVDAQKVVLTDKLEASR
FT                   WERTVIARGGMAEEVNALKREEGKDILVIGGVGFASSLVNEGLVDEFQFFVNPMAVGAG
FT                   RSVFHDQRKGHKLRLLGSVGYECGVVVNRYAPQ"
FT   gene            64427..64870
FT                   /locus_tag="Varpa_0064"
FT   CDS_pept        64427..64870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34287"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0059"
FT                   /protein_id="ADU34287.1"
FT                   /translation="MNINSKSMAVAAAALAMCMAAGSAFAQDRRFDGRPGDDRNGRAEQ
FT                   RHDDRRGDRNFDRRGPHRDYRGNQDFRDGRQFDRRGFPQPHAEWRRGGRVPAEYRGRNY
FT                   VVNDYRAYRLQPPPRGYQWVGVGGDYVLAAIATGLIAQIIAGQ"
FT   sig_peptide     64427..64507
FT                   /locus_tag="Varpa_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(64947..65210)
FT                   /locus_tag="Varpa_0065"
FT   CDS_pept        complement(64947..65210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34288"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0060"
FT                   /protein_id="ADU34288.1"
FT                   /translation="MASTPQQQQQQIRAAQKAADAAERRERLKRALPATVELLQSRQAD
FT                   RIDDNDIDAYVSLNWLEWHGGGLRLTITGRNVCAQSASTALA"
FT   gene            complement(65348..66292)
FT                   /locus_tag="Varpa_0066"
FT   CDS_pept        complement(65348..66292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0066"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0061 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34289"
FT                   /db_xref="GOA:E6UXU5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34289.1"
FT                   /translation="MNFQQLRSVREAVRCGFNLTEVAHTLHTSQPGVSRQIRELEEELG
FT                   IELFVRAGKRLTGLTEPGGHVLPIIERMLLESSNLRHAGQEFVAQQSGLLSIAATHSQA
FT                   RYAMPVAVQEFRAQFPNVKLHLHQGSPKQIAQMLIDGEADVGIATEALGDYPQLVALPC
FT                   YRWTHSVIVPPGHPLLDAPLSLEALTRYPLITYDTGFTGRSRIDEAFEARGLQPNIVLA
FT                   AMDADVIKTYVTLGLGVGIVAGVAYEAERDTQLRAIDAGRLFGINLTKLAVRRGNYLRK
FT                   YVYAFIESFAPTLTRAIVEKALGDEAKASHYEI"
FT   gene            66465..67067
FT                   /locus_tag="Varpa_0067"
FT   CDS_pept        66465..67067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0067"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vap:Vapar_0062
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34290"
FT                   /db_xref="GOA:E6UXU6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU34290.1"
FT                   /translation="MDAKTQKSELTRAAIVGAALDLALAEGLEAISLQVIASRLGLSKS
FT                   GVFSRVGSREALQKAVIEEYGRGFLADVFVPAMQKPKGLARLNEIVARWIARTRDVEAQ
FT                   TGCLYVAGAFEFDDREGELRDVLLGEITRWRAALRRTVTLAIEAGELKADTEPAQLVSE
FT                   INGIMMNQLHDARFLRDPHTADRAAQTWQRLLSSYLA"
FT   gene            67145..67258
FT                   /locus_tag="Varpa_0068"
FT   CDS_pept        67145..67258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34291"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0063"
FT                   /protein_id="ADU34291.1"
FT                   /translation="MLIIALCLAIYAVALGVETARDTLRSLPRSNQDWVWY"
FT   sig_peptide     67145..67195
FT                   /locus_tag="Varpa_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.365 at
FT                   residue 17"
FT   gene            67280..68188
FT                   /locus_tag="Varpa_0069"
FT   CDS_pept        67280..68188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0069"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   vap:Vapar_0064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34292"
FT                   /db_xref="GOA:E6UXU8"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADU34292.1"
FT                   /translation="MTSTPAPSNYYGASRLMRAMRFGLGASQRLWPALGVRAAYRVFGT
FT                   PLPPKWLYRGQHPGTDWRHEAWSFEDASVGIYHLAAQDSGAESAPVVLLVHGWGGHAGQ
FT                   MLPLAQALAAVGLRPVLLELPAHGRSEGTATNGAQFARAIDYVTARLAADGRALRAVVA
FT                   HSLGANALAYAAGRGLPAERIVLLAPPASPREYTRYFAHAFGLSEQTRAAMQRMFEARE
FT                   GVLMPQFEPALAGPRIAQPTLIVHDRDDRVNRFADGEAYRDAIPRAQLFVTQGWGHRRI
FT                   LKEEAVLAQVTQFLVQPSAVM"
FT   gene            68261..71206
FT                   /locus_tag="Varpa_0070"
FT   CDS_pept        68261..71206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0070"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="KEGG: bur:Bcep18194_B0391 hypothetical protein;
FT                   PFAM: Sel1 domain protein repeat-containing protein; SMART:
FT                   Sel1 domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34293"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU9"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADU34293.1"
FT                   /translation="MGNRSWLYLEHRLSGADNGAEHQKTSADEIAEANNNFPVLWQLLL
FT                   ADGAAGDAIDDQRVFGDAGTDNLASDAHAALARIRQLHAFVEQHPMLHALPQIALQFEA
FT                   LALHLAELIDEVPADSAPRFSANLDELSWLGGETEGEGFIERNRRECNERWAEVRRCID
FT                   SGNHPGVDAALGIQRFADWEAWAWQFGFGGLSHPYFDGYEAPRDERFADFEPEEDDDED
FT                   GYERPDYDNHLGGELWRFEVDGRWGVMRLVHDEDGDGGASHRTTVVEPAWDDIRYAGGS
FT                   DPRLLWISQGERSGLLLADAEAPRVLLEPELDEVWDFEDDIATALVGDHIGLLRTDGSW
FT                   LLEPSVDEVWSFVEGRVRARVGERIGYIDLQGEWAIAPRFEEAEDFTPFGLAPARGDEG
FT                   GWGLVRADGEWAAPPDFEQLQWRHDWEAFEATRDGKSGLLDAQGRVVIEPVYEQVDLLE
FT                   EYPIEFLTSEDNDPANERNAEARPKRFAVERADGVCGLVDGRGRVLVPFDYGRFETLEP
FT                   LTGQERAHAMARRDLVRVASKGGRTAKNAPWLRGIYDVAAGRELVPCRHRTLQPLAWGT
FT                   QDIGWLVADPMPRSAKVEKGQLAVGVLRGDGTVLHPQANPWIAAAVSVADSWLVAAVRS
FT                   DLCKRWGAGEPVKAVRNDSGLYVWLHADGREQPHAEHMAARHAAGDLRAAYELACHLRD
FT                   GEGIEADPREALRWMARAAGVREPGDAPATASSDGLPVAMCELSKMLRWDTAGLGADAQ
FT                   LGRAWLLHAIAHGGADDAATQAQLGYMLCEGEGGERDLEGGVRHYELAAEKNNTMALYN
FT                   LGLAYKLGEPGEPDLARAIGYFRRGHEAGDTAATMQLGRTLCLHAGALAEQGHGEAEVN
FT                   VLHAEALYARQKVAEDSTQREQGWACYELGWMRFRGQGAPEDAAAAERWLLAGAALDDC
FT                   EENLESQRACTEVLAETFYGDPDSPLFDEDKAREWTQRLQALPATTPDAPA"
FT   gene            complement(71181..72131)
FT                   /locus_tag="Varpa_0071"
FT   CDS_pept        complement(71181..72131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0071"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: rme:Rmet_4336
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34294"
FT                   /db_xref="GOA:E6UXV0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXV0"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ADU34294.1"
FT                   /translation="MTSTAPSSTAPTRAPSGTRRRHWWWHFEVPTLALAAALYGAWAAL
FT                   LWWHAALPGWALFLLGGFLAQLHSSLQHESIHAMRHLPKWLRHAVVWPPLTLWLPYPFY
FT                   NRGHSAHHVNFHLTHPERDDESAYHSAPAWAGYGPVRRWIYIANQTIAFRVVLGPFLRL
FT                   WKLARFEAGRVRAGDFSRLPTWSWHALSVAPVLYFVIGICGMGFGEYLLYVVYPGMMLG
FT                   SLRTFTEHRWADTPHERVAIVESNVVFGLLYLFNNLHHVHHRAPTMPWYEIPVYFRRHR
FT                   AEVLAANGHFYYRGYGEIVRRHLFRPVFTPVHPAW"
FT   gene            72267..73916
FT                   /locus_tag="Varpa_0072"
FT   CDS_pept        72267..73916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0072"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: rme:Rmet_4338 rhodanese-like protein
FT                   sulfurtransferase; PFAM: Rhodanese domain protein; SMART:
FT                   Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34295"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXV1"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADU34295.1"
FT                   /translation="MNSSASTTLAPVLLQALLLAEPAGELALLDVRETRWFVQRHPNLA
FT                   RNAPLSGLELQVGAFVPRRSTPVVLYDDYNAPDGPAQAAVAVLARLGYTDVRTLDGGLQ
FT                   RWVTEGLPAIDGYGTLVKAFGDLARLHYGTPSLSVDALRARRREGLPATLIDARPRAEF
FT                   EFLSLPGARNHAGTELALRRFEADDAEHVWAINCFSRTRGIIGATTLRLLGRAPDAVFV
FT                   EDGVMAWGLQGAPTVQNAVPDDELPPESPEVLRRTADELLERFALPVADAAQLASWCAD
FT                   DTRSLYIFDVRPTADPAFADTAVQQVPGGQLFMHFENLVGTRGARIVLIDDPAHRLRAA
FT                   VTSFWLTQLNQAEVYVYDGALSPEQAPPAQAVTVSDAPSPLDAEALAQLRRNGAVTVID
FT                   VGASLDYERGHLPGALYMLPASLGPLASHAVAGRTLVFTSPDGAAARRVARDAQQRWPG
FT                   SGAVFTWLRGGTEAWKASGRPLSTAFVPAQLLTPFDDDWGSVMRVFGPRRDAVWVDYLA
FT                   WERALAARVLQDPSVRFRFFPTGQVPDRAARS"
FT   gene            complement(73879..74151)
FT                   /locus_tag="Varpa_0073"
FT   CDS_pept        complement(73879..74151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0073"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="KEGG: vap:Vapar_0065 cell division topological
FT                   specificity factor MinE; TIGRFAM: cell division topological
FT                   specificity factor MinE; PFAM: Septum formation topological
FT                   specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34296"
FT                   /db_xref="GOA:E6UXV2"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXV2"
FT                   /inference="protein motif:TFAM:TIGR01215"
FT                   /protein_id="ADU34296.1"
FT                   /translation="MSFLSFLLGEKKKTASVAKERLQIILAHERSSLSGKKRPDYLPEL
FT                   QRELVAVISKYVSINPDDIKVHLETQDNLEVLDIKIELPDPAPAR"
FT   gene            complement(74154..74969)
FT                   /locus_tag="Varpa_0074"
FT   CDS_pept        complement(74154..74969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0074"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; KEGG:
FT                   vap:Vapar_0066 septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34297"
FT                   /db_xref="GOA:E6UXV3"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXV3"
FT                   /inference="protein motif:TFAM:TIGR01968"
FT                   /protein_id="ADU34297.1"
FT                   /translation="MAKIVVVTSGKGGVGKTTTSASFASGLALAGKKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEANLSQALIKDKQCENLFVLAASQTRDKEALTQEGVEK
FT                   ILNDLAAMDFEYIVCDSPAGIETGAMMAMHFADEALVVTNPEVSSVRDSDRILGMLSSK
FT                   TKRAKEGGDPIKEHLLITRYNPNRVAGGQMLSLEDIQDILRIKLIGVIPESESVLHASN
FT                   QGVPAIHDKDTDVAQAYSDVVARFLGEEKPMRFVDAEKPGFFKRIFGGK"
FT   gene            complement(75022..75789)
FT                   /locus_tag="Varpa_0075"
FT   CDS_pept        complement(75022..75789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0075"
FT                   /product="septum site-determining protein MinC"
FT                   /note="KEGG: vap:Vapar_0067 septum site-determining protein
FT                   MinC; TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34298"
FT                   /db_xref="GOA:E6UXV4"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXV4"
FT                   /inference="protein motif:TFAM:TIGR01222"
FT                   /protein_id="ADU34298.1"
FT                   /translation="MADVSAARTKAVFEFKSATLPLIAVILKTSDLDVLAEALDAQLAD
FT                   SPDFFEQEPVVIDLSQLPEHDEAGEATAQIDFAALRSLLARHQTQPIAVRGGNDTQNAA
FT                   ARAAGLSLAAMPSAPAPRPPAPPAEAPAEAPQIIREVPVPANGTLLIDKPLRSGQQVYA
FT                   RGGDVVVTAVVSFGAEVIADGNVHVYAPLRGKAIAGARGNTEARIFSTCMEAQLVAIAG
FT                   IYRTNEVPLPDPVLGKSAQVRLDGKKLVIDAIP"
FT   gene            complement(75948..77231)
FT                   /locus_tag="Varpa_0076"
FT   CDS_pept        complement(75948..77231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0076"
FT                   /product="uracil-xanthine permease"
FT                   /note="KEGG: vap:Vapar_0068 uracil-xanthine permease;
FT                   TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34299"
FT                   /db_xref="GOA:E6UYX0"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX0"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ADU34299.1"
FT                   /translation="MFNWTEKPVSTLADGAVIGPDERLPWLQTGAMGIQHVIAMFGATV
FT                   LAPILMGFSPNIAILMSGIGTLIFYFVTGGKVPSYLGSSFAFIGVVIAASGYAGKGPNA
FT                   NIAVALGGIVACGVVYILIGALVQAIGTGWIERFMPPVVTGAVVAVIGLNLASVPIKNM
FT                   AASNFDSWMQAVTFLCVGLVAVFARGMLQRLLILVGLILATVVYAVLTNILGMGKPVDL
FT                   SDIANAAWFGLPTFTTPVFTANAMLLIAPVAIILVAENLGHLKAVTAMTGRNLDPYMGR
FT                   AFIGDGIATVVSGAAGGTGVTTYAENIGVMAATRIYSTAVFVVAAVIALVLGFSPKFGA
FT                   LIQAIPLPVMGGVSIVVFGLIAIAGAKIWVDNKVDFSQNKNLIVAAITLIIGTGDFTLK
FT                   FGDFALGGIGTATFGAIILYALLGKTKN"
FT   gene            complement(77364..77786)
FT                   /locus_tag="Varpa_0077"
FT   CDS_pept        complement(77364..77786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0077"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   vap:Vapar_0069 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34300"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX1"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADU34300.1"
FT                   /translation="MRIWKKEISVEELTRNHVGTAVSTLGMEFLEVGDDFIRARVPVDE
FT                   RTRQPYGILHGGVSVVLAETLGSCGAHYSAPEGDRAVGLDINANHIRSVTSGWVIGTAR
FT                   PVHRGRSTQVWQIDLTNEAGELTCVSRITMAVLQPR"
FT   gene            77871..79214
FT                   /locus_tag="Varpa_0078"
FT   CDS_pept        77871..79214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34301"
FT                   /db_xref="GOA:E6UYX2"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX2"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0070"
FT                   /protein_id="ADU34301.1"
FT                   /translation="MKHPLRRWLLGIAAVLLLGIGALVWFVSSRLPSDEEVAVRISEGF
FT                   EKRFGVGLKVGGAHWALLPTPVLVLSDIATDQPRPVTLRRVTAQLKLTELLHRVIAVDE
FT                   LEIESLVLPRESVRAFRGKGPKPHEGGNVIALPAPWTLAPIPLEQLRWRDVVWIDRRDI
FT                   ALAYDGEVAFDPRWRPRQARIERAGATPPARLRLDREAGQDRWRTRIDVGGGTWNGVAL
FT                   FEMPAGGKLRVSAELDPRQVDIEGLVQAFGRRTSVAGKVNGHSTLVAEADEANELGALI
FT                   RSMHTRTTFSVRPATLTKVDIAKAVTTAGISRGGTTPLDELTGTLDTQGTENGIVMRYT
FT                   NLKARSGVLTASGNLQLFNRKMEGDIAVDLVDGVVGVPLKIGGSVSDPEVSLTGGALAG
FT                   AAVGSAVLPGVGTAIGARVGQQVEKLFGGGEPEKKPAPKPRKPPASQR"
FT   gene            complement(79236..81044)
FT                   /locus_tag="Varpa_0079"
FT   CDS_pept        complement(79236..81044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0079"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pna:Pnap_0164 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34302"
FT                   /db_xref="GOA:E6UYX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34302.1"
FT                   /translation="MHILWTYLRPHARLALLALLLAGISQVLALVDPIIFGKIIDRYAI
FT                   HRDGKTEQELVSGVLSLLALAVGVAIASRLAKALQEYITRLVVQKFGTQIFNDGLRQVL
FT                   RLKFPEFEDLRSGETLSMLQKVRADSERFINAFINTAFAAIVGIGFLVWYAVTKHWLLV
FT                   PVFLIGVLVLGGLTGLLSREIKSQQRSITRETNRNSGFITESLRNIELIKSLGLTFPEI
FT                   RRLQAQTTRIFALEMQKVKRIRLLSFLQGTTLSLLKLAVLFALLWLIFRDVLSTGELIA
FT                   MQFISVAIFAPLQELGNIILAYREAEASLLNFEALMQKPIERRPESPISIGPVTHLRFA
FT                   DVSFRHKGATDNALDDVSFEAGLGDTIAFVGPSGSGKSTLVKLLVGLYTPASGEVFYND
FT                   ISTRDLRYNQARRQIGFVTQETHLFAGTIRENLQLVKPDATDQEILEAMRQASCAYLAE
FT                   KSPEGLDTPIGERGMKLSGGEKQRLSIARALVREPRLLIFDEATSALDSLTEEQITATV
FT                   REISARSTQITILIAHRLSTIMHAGTIHVLEKGRIVESGTHAALVEGKGLYYAMWRQQI
FT                   GERPVPRVQEAETVAAIEPPGEAEPA"
FT   sig_peptide     complement(80955..81044)
FT                   /locus_tag="Varpa_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.925 at
FT                   residue 30"
FT   gene            81230..81388
FT                   /locus_tag="Varpa_0080"
FT   CDS_pept        81230..81388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34303"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU34303.1"
FT                   /translation="MGCLAQRNQGGGRRPGDIRFAVYPVGGIAAPNNPDKTYENALITA
FT                   GTVSTAV"
FT   gene            complement(81340..82728)
FT                   /locus_tag="Varpa_0081"
FT   CDS_pept        complement(81340..82728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_0285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34304"
FT                   /db_xref="GOA:E6UYX5"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX5"
FT                   /inference="similar to AA sequence:KEGG:Daci_0285"
FT                   /protein_id="ADU34304.1"
FT                   /translation="MIEAALLNQILVATGMGLVGAIVFAAIGLVSGTDETTTLAPLTLL
FT                   VVLLGVPPEGVFTFFLAAAVAKHMTHAVPTALLGIPGDTMATPLLQDANVLRNLGVPHI
FT                   ALRKMVSGAIIAAFIAVPLAVLFAVLLAPYGAAITKAAPWIFVVAAVAIAYFSSGRWAS
FT                   VATLVPFVMVIVALQALTGKYGVKLSISYFLGIAIGPLVADLFSVISPAARARMKRDKV
FT                   RTFSLAPDVKGWTGYFPNPFKVLDRTQVKWTFATATISSATFVFSPVAMTVVLGELVGS
FT                   RIKHAYHRLTTTLAARNGVTEATYIAEALIPLIAIGLPLSPVAAGPAAPLFNAPPVFTI
FT                   DSATGQTHNLHNLLNHWEFLGYGMLAVVLAALVAYPFTMNFARRAALFVSRKVSHEAII
FT                   ATFVGLIVVISVWEGQLLGLLVILTMGLLGGLLSRAIGFNTGVQFMGYYTAVLTVPAVI
FT                   KAFS"
FT   gene            complement(82725..83177)
FT                   /locus_tag="Varpa_0082"
FT   CDS_pept        complement(82725..83177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_0286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34305"
FT                   /db_xref="GOA:E6UYX6"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX6"
FT                   /inference="similar to AA sequence:KEGG:Daci_0286"
FT                   /protein_id="ADU34305.1"
FT                   /translation="MNADSATPTRWRLVEIWGDTADLGHLAWSIVIGVAVSLTGYLVAS
FT                   RVLASVVSTPELARAYAMLAGLGGCVVSGVICAKLFAPKREVVEGTDPDPRWREEVLAE
FT                   LAGEHGDLGSVDDLPPSVAREMKELEIYDLFASYKPRAKSIEGAAS"
FT   gene            complement(83272..84558)
FT                   /locus_tag="Varpa_0083"
FT   CDS_pept        complement(83272..84558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0083"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /EC_number="1.1.1.88"
FT                   /note="KEGG: dac:Daci_0287 hydroxymethylglutaryl-CoA
FT                   reductase, degradative; TIGRFAM: hydroxymethylglutaryl-CoA
FT                   reductase, degradative"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34306"
FT                   /db_xref="GOA:E6UYX7"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX7"
FT                   /inference="protein motif:TFAM:TIGR00532"
FT                   /protein_id="ADU34306.1"
FT                   /translation="MVADSRIPNFRALTPAQRFAHIAKAASLTDDEVALLAQPGALSVD
FT                   RANGMVENVIGTFELPLGVAGNFTVNGRDYLVPMAVEEPSVVAAASFMAKLAREGGGFE
FT                   ASSTGPLMRAQVQVIGITDPYGARLALLRAREEILAVANSRDKVLIDLGGGCRDIEVHV
FT                   FGDTPRGAMVVMHLIVDVRDAMGANTVNTMAEAVSPLVEKLTGGTVRLRILSNLADLRL
FT                   ARARVRLAPAVLATRERSGEEVVEGVIDAYTFAAIDPYRAATHNKGIMNGVDPVIVATG
FT                   NDWRAVEAGAHAYACRSGRYTSLTTWEKDTTGALVGTIEMPMPVGLVGGATKTHPLARL
FT                   ALKILDVKSAQELGEVAVAVGLAQNLGALRALATEGIQRGHMALHARNIALVAGATGDE
FT                   IDSIAKQMAAEHDVRTDRAVALLEALRKK"
FT   gene            84696..86081
FT                   /locus_tag="Varpa_0084"
FT   CDS_pept        84696..86081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0084"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="KEGG: dac:Daci_0288 transcriptional regulator; PFAM:
FT                   regulatory protein GntR HTH; aminotransferase class I and
FT                   II; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34307"
FT                   /db_xref="GOA:E6UYX8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX8"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADU34307.1"
FT                   /translation="MTTIADSLADTLARQIASGAYKAGDKLPSLRELAQLHGYAKNTVV
FT                   AAFELLVSRGLVEPRRGSGYFVLAQSTTPKPPEEDAGSLGRAMDIVWLMREQLKTQPDA
FT                   VAVGDGFPPVEWLADVRLDKYHPKVVRTGLGALFRYGSRFGYAPLRDHLVRKLADFGIG
FT                   AEPRQIVLTHGANEAMDIVIRYFVPPGGKVLVDDPGYYPLFGKLKLAGAQMLAVPRLAD
FT                   GPDLDVLEQLLIAERPRLFFTQSLAHNPTGSDISPAKAFRVLQLAQKYDLLIVENDPLA
FT                   DFKPTALPRLSALDQLERTIYIGSFSKSFSAALRVGFIACGADLASDLADLKALIHVSS
FT                   SEYSERTVDVILSEGHYQRHLNRLQNRLGEATRSALQLFDSVDTEVFARTPQSLYIWAA
FT                   LPGVADSLAFAKELLPRKIVMAPGRIFSVDSTQVSRWSRFNVGAMADPRFAKALRTALR
FT                   RRV"
FT   gene            complement(86086..86868)
FT                   /locus_tag="Varpa_0085"
FT   CDS_pept        complement(86086..86868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0085"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rsl:RPSI07_mp0572 putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34308"
FT                   /db_xref="GOA:E6UYX9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYX9"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU34308.1"
FT                   /translation="MAMEYVSYDTDRAVCTLTLNRPDKRNAVNGIVAAELREAFERFDA
FT                   DDALRVAILTGAGGHFCAGADLGAVGNPDERNELDPEGGGSGPMGPTRMALSKPLIAAV
FT                   NGYAVAGGLELALLADLRVADDDAVFGVFCRRWGVPLIDGGTVRLPRIVGMGRALDMIL
FT                   TGRPVSATEALAMGLVNRVTPPGGALAAARELALQIAAFPQQCMLTDRRSAYEQWDLPL
FT                   AEALRREGAQGVPIVFAEGEAGAARFAGGAGRHGTFKG"
FT   gene            86948..87754
FT                   /locus_tag="Varpa_0086"
FT   CDS_pept        86948..87754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0086"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /note="PFAM: PaaX domain protein domain; PaaX domain
FT                   protein; KEGG: rpe:RPE_1212 PaaX domain-containing protein,
FT                   C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34309"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY0"
FT                   /inference="protein motif:PFAM:PF08223"
FT                   /protein_id="ADU34309.1"
FT                   /translation="MEKICNVPVAIPSAPELILDLLVAHSGMLSAQSLCRAGALMGIGE
FT                   STLRVGLTRLASDGKIERSERGSYALNRAGPALSRAVDGWRQRGAQAVAWRNDWLAVHD
FT                   AGVPRSDKTAWRHHGLALSLRGFAPLQAGLHIRPDNLRGGLAAERGQLQGLGLSSKALV
FT                   FRLADMDEATQAAARKLWNVRALTAGYQRLQTGIERSEKRLDKLSLEAAVRESLLLGRA
FT                   VIAHLIRDPLLPAELMSPAPRTALQAVTRRYQDKARKLWRAWFAEA"
FT   gene            complement(87779..87886)
FT                   /pseudo
FT                   /locus_tag="Varpa_0087"
FT   gene            complement(87908..89716)
FT                   /locus_tag="Varpa_0088"
FT   CDS_pept        complement(87908..89716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0088"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   vap:Vapar_0071 feruloyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34310"
FT                   /db_xref="GOA:E6UYY1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY1"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADU34310.1"
FT                   /translation="MTDFLHDESLIAPPRTVRIDFDDGSFALRSPQTLKPYARCIGEWI
FT                   ERWARETPDALAFAERDESGEGWRKLDYRALRHAVGSVAQGLLDLKLPAGQPIVILSDN
FT                   AIDHAVLMLATMHIGRTACSLSSAYSRMAKDPSRLHGMLKALGPSLIYASDAKVYGGAL
FT                   AGCGVEAVTVFSRNADTHPGAMSFDQLLAAKETPAVMDAFAAILADTHAKYLLTSGSTG
FT                   KPKVVINTHRMLCANQQMMAQTWRFLVEEKPVLVDWLPWSHTFGANHNLHMVLCHGGAL
FT                   YIDEGRPAPGLIEKTVRNLREVKPTLLFNVPRGFDMLLPFLEADDALATEVFSRLRLAF
FT                   YAAAALAPSTWQRLEAVAQRVRPTRPLWLTTSWGATETSPAITSAHWKLDGAGCIGAPL
FT                   PGLELKFVPNGQKLEMRVKGVSVFPGYRDAPRETAEAFDEEGYYRIGDAGFLANAAEPA
FT                   HGVIFNGRVAEDFKLSTGTWVSVGTLRVKLVSMLAPHVQDVVLTGHDLDEIGMLVFASP
FT                   QAASLSPEALAERIAGVLRALRDEGAGSSQCPACALVLAEPPSLDAGEITDKGYINQRA
FT                   VLARRAADVARLHAADPDPQVVRLRG"
FT   gene            complement(89718..90704)
FT                   /locus_tag="Varpa_0089"
FT   CDS_pept        complement(89718..90704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0089"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain-containing protein;
FT                   KEGG: vap:Vapar_0072 3-hydroxyacyl-CoA dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34311"
FT                   /db_xref="GOA:E6UYY2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY2"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADU34311.1"
FT                   /translation="MDDEGREPLRAVEIMTHLNVQRVAVVGTGVIGASWTAYFLAQGLD
FT                   VNATDPSPGAEDRLRAAVAQHWPTLERFGLAEGASVDRLRFHDSLEDAVSVADFVQENG
FT                   PERMDFKIDLFRRMDAAAPPETILASSSSGLAISGVQSGCAHPQRVVLGHPFNPPHLIP
FT                   LVEVIGGEKTSADTIERTMAFYAAIGKRPIHVKREVKGHIANRLQAALWREAFHLVNEG
FT                   VASVADIDTAIAHGPGLRWAVMGPFMNLHLSGGAGGIEHVLAHLGGPIEDWWKDLGAPS
FT                   MTAELKQKVAAGVAEELGARRTSDLEAARDTLLLNLIRAKADTGKLD"
FT   gene            complement(90659..91873)
FT                   /locus_tag="Varpa_0090"
FT   CDS_pept        complement(90659..91873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0090"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   ctt:CtCNB1_0215 putative substrate-binding periplasmic
FT                   (pbp)"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34312"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY3"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34312.1"
FT                   /translation="MNITLSRTALAVALGAAFTTTGASAQVSDDTIRIGFISDMSGIYR
FT                   DYDGPAGAEAIRMAIADMGGAIDGRKIELVTADHQNKPDIAAAKAREWFDVQKVDMLIA
FT                   GVNSGAAIAMAGVAADKKKPYFVVGSGASSLTNEYCSPYTVHYAYDTVAMARGTATAVV
FT                   KAGGKSWYFVTADYAFGAALQTDAAKIINASGGTVAGSVKHPLGASDFSSFMLQAQGSK
FT                   AQVLALANAGGDTVNAIKSAAEFGISKNMKLAGMIITINDVHALGLKTSQGMYLTDSWY
FT                   WNQSPEARTWARRFFDKHKRMPSSFHAGDYSAALQYLQAVKAAGSDDADKVMAQLRKTK
FT                   FNDMFVKGGWLRDDGLMVHDMQLMQVKTPDESKEPWDYYKVVEPIRGEAAWTTKAESRC
FT                   ARWKS"
FT   sig_peptide     complement(91796..91873)
FT                   /locus_tag="Varpa_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 26"
FT   gene            complement(91928..92851)
FT                   /locus_tag="Varpa_0091"
FT   CDS_pept        complement(91928..92851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0091"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   vap:Vapar_0074 protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34313"
FT                   /db_xref="GOA:E6UYY4"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY4"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ADU34313.1"
FT                   /translation="MSSKRKVIVTIAPTGGMAHKSQNPHLPTQPAEIAADVLRCWNAGA
FT                   SVVAIHARRPDDGATCNAEVYRDINSRIRAGGCDIVINNSTGGGVHGDMVKPLAGDRWE
FT                   IAWEERIKGMDAGAEMCTLDATTLNLSFEGKQILMDTPITKGRELAAGMKARGIKPEWE
FT                   VFSPTHILQDTTTLIGEGHDGEPYFINLVMNVHRNFQNAMPYSPRFLQMMVDTLPKGSI
FT                   FCVSGIGPSQLEANVAALLLGGHARVGLEDNLYFRQGELATNVQLTERIVRVIRELDME
FT                   VATPAEARQMMGLPRTGTPRPEFAMG"
FT   gene            92976..93689
FT                   /locus_tag="Varpa_0092"
FT   CDS_pept        92976..93689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0092"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: vap:Vapar_0075 putative transcriptional
FT                   regulator, Crp/Fnr family; PFAM: cyclic nucleotide-binding;
FT                   SMART: cyclic nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34314"
FT                   /db_xref="GOA:E6UYY5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY5"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADU34314.1"
FT                   /translation="MATKKAEPPITAASLTIPQLLQGSAWFPLLDATARDRVLDEMREV
FT                   EVAAGAALCRRGDTPLHWYGTLEGLLKWSITSSDGRSVTFGGLSVGSWFGEGTLLRAVP
FT                   RSADIIALRPSRVAQLPLETFEWLHRTQRGFDHFLLQQINERLHWFMGNYAAHRLLDAD
FT                   SQVARALAGLFHPWLHPGSEPYLQTSQEEIANLSGVSRQRCNAALNRLKEAGFLRIEYG
FT                   GITVIDLDGLRRFIE"
FT   gene            complement(93711..93935)
FT                   /locus_tag="Varpa_0093"
FT   CDS_pept        complement(93711..93935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0093"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="KEGG: vap:Vapar_0078 4-oxalocrotonate tautomerase
FT                   family enzyme; TIGRFAM: 4-oxalocrotonate tautomerase family
FT                   enzyme; PFAM: 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34315"
FT                   /db_xref="GOA:E6UYY6"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY6"
FT                   /inference="protein motif:TFAM:TIGR00013"
FT                   /protein_id="ADU34315.1"
FT                   /translation="MPFVNLKITRDGVTREQKTQVIAEFTEVLERVLKKPPEWTHIVIE
FT                   EIDTDDWGFGGVTTTEYRKRLAEAAKKAQ"
FT   gene            complement(93974..94717)
FT                   /locus_tag="Varpa_0094"
FT   CDS_pept        complement(93974..94717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0094"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0079 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34316"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU34316.1"
FT                   /translation="MQDSTSPSTVVITGASSGIGLGLAAAYLERGFNVVANARTDERLA
FT                   AAAKQLGNPDRFLGVAGDIALRATAEQLIDRAVARFGHVDVLINNAGIFNAKPFVDYTE
FT                   EELDQLVATNLKGFVYASQAAAKHMIPRRKGHIVNITAGIALQPNLKVPALVPVLVKGG
FT                   INAATRALALELSPHNIQVNAVAPGIVDTPMHPAENHGFLSGLAPAGRIATVREIADAV
FT                   LYLTGAGFTSGVVLAVDGGASAGTW"
FT   gene            94825..95736
FT                   /locus_tag="Varpa_0095"
FT   CDS_pept        94825..95736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0095"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0080 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34317"
FT                   /db_xref="GOA:E6UYY8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34317.1"
FT                   /translation="MQRQFGDILLGSIELFCLAAETGGFTSAALAAGVTPAAVSRSISR
FT                   LEKRLGLRLFVRTTRSVRLTDAGRSYFAQCRQALAQLAEAEREVMGQQAQPSGTLRISV
FT                   PTTYGHHRILPMLPAFRERYPDIRLHVHLSNRNIDFVEEGYDMAVRVRAQPDSTLIARH
FT                   LEDAALVVVATRKYLKAAGTPRTPDDLAAHECIQFELPSSGRRISWLFKEEGQDREVLA
FT                   DSAYSCSDDVLGGVTLAKSGAGLFQTYRFVVQKELADGSLVEVLKPFAGRSRPYTLLYP
FT                   DGRHAPLRMRVFIDFLMAQRAA"
FT   gene            complement(95898..96599)
FT                   /locus_tag="Varpa_0096"
FT   CDS_pept        complement(95898..96599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0096"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0083 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34318"
FT                   /db_xref="GOA:E6UYY9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYY9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34318.1"
FT                   /translation="MLIVRDLNTYYGNSHILRGVHAGIPTATSVGLLGRNGMGKTTLIR
FT                   SMMGYVRPASGEVQVDGRTVTGWPPEKMARLGIGYVPEGRGIFPNLSVRENLVMSERAG
FT                   IDGRRAWTFDRVMATFPRLAERLSHGGQQLSGGEQQMLSIGRALMTNPRLLILDEATEG
FT                   LAPLIVAEIWRVIGEIRSTGIATLIVDRDYRKVLAHTDLAVVMEKGQIVRHGASADLLA
FT                   EPQALEELLGV"
FT   gene            complement(96599..97345)
FT                   /locus_tag="Varpa_0097"
FT   CDS_pept        complement(96599..97345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0097"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0084 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34319"
FT                   /db_xref="GOA:E6UYZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34319.1"
FT                   /translation="MNALLSVEGLTRRFGGLTAVNAVTLDLHVGEVHAVIGTNGAGKST
FT                   LINMLSGEIEASEGRIALDGIDITQRAQSRRARDGVGRSYQRTTIFPEFSVHENCRLAA
FT                   QAATARPWAIWQASQRCAASNAAADSALEAAGLSNESLRIAGALSHGAQRQLEVAMCLA
FT                   TNPRVLLLDEPLAGMGAEETDRMLTLLARLKATHAILLVEHDMDAVFRIADRITVMVNG
FT                   TVIATGDPTSIRENPEVRTAYLGEDH"
FT   gene            complement(97470..98423)
FT                   /locus_tag="Varpa_0098"
FT   CDS_pept        complement(97470..98423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0098"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0085 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34320"
FT                   /db_xref="GOA:E6UYZ1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34320.1"
FT                   /translation="MMKKGAFLVPLACALLIGIAGPLMGNYASDFVVKVMILSIFALSL
FT                   ELLVGMTGLVSLGHAAFYGIGAYVTVLASGSEGGNFALLLPMAVGAAALYALFVGALSL
FT                   RTRGVYFIMVTLAFAQMAFFVFHDTKVGGGSDGIYMYVRPAIGALDLENRTVLFYVVLA
FT                   SLVFTYGLLALIRRSRFGAALAGIRVNEQRMRAAGFPVYGYKLAAFVLAGALAGLAGFL
FT                   LASRDGVVNPELMAWHNSGEVLLMVILGGLGHLRGAVIGAIAFTLLKEIFSTHAVMGPL
FT                   ADHWQLTLGIAIIVFVAWLPKGLIGLVNRISPKEAA"
FT   sig_peptide     complement(98346..98423)
FT                   /locus_tag="Varpa_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.815 at
FT                   residue 26"
FT   gene            complement(98420..99292)
FT                   /locus_tag="Varpa_0099"
FT   CDS_pept        complement(98420..99292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0099"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0086 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34321"
FT                   /db_xref="GOA:E6UYZ2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34321.1"
FT                   /translation="MDFGTFLVQCLNSVQYGLLLFLVASGLTLIFGIMGVINLAHGSFY
FT                   MIGAYLAFSLAPLFGDQFLLMLVAGVVLAAIFGYLLEWAFFSYLYQRDHLQQVLMTYGL
FT                   ILVFEELRSIFVGNDVHGVKVPAWLDGSFALGNVMSYPWYRLFASAACIVLAVGLYWVV
FT                   NRTRLGMMIRAGASNRDMVRGLGIDVKRLYRIVFAAGVALAALAGMIAAPMSSVYPNMG
FT                   ASVLIICFVLVVIGGIGSITGALLASLLVGFVDTFGKVFFADLSGIGIYLLMAIVLIWK
FT                   PEGLMGRRP"
FT   gene            complement(99487..100662)
FT                   /locus_tag="Varpa_0100"
FT   CDS_pept        complement(99487..100662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0100"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0087 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34322"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ3"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34322.1"
FT                   /translation="MTTIRTARLALTAIAFAALASAAGAQGTGKLKVGLMLPYSGTYTA
FT                   LGVAIENGFKLYVDEQGGKLSGREIEYFKVDDESDPAKATDNVNKLIKRDNVDVIVGTV
FT                   HSGVAMAMAKAAKESGTVLIVPNAGADAVTGPMCAPNIFRSSFSNWQPAFAMGEVAAKQ
FT                   QGKKKAMTITWKYAAGDESVNGFKEGFEKNGGKVDKQLTLPFPNVEFQALLTEIAAAKP
FT                   DAVYAFFAGGGAVKFVKDYQAAGLNKTIPLYGPGFLTDGTLDAQGDSAQGMLTTLHYAD
FT                   GLNTARDNAFRVAYAKSFKLQPDVYAVQGYDAAQMLGVGLAATKGDISKKAEFTGAIEK
FT                   AKIDSPRGTFTMSKSHNPVQDIYLRKVDGKENKLVSTAIKGLADPARGCRM"
FT   sig_peptide     complement(100585..100662)
FT                   /locus_tag="Varpa_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.693 at
FT                   residue 26"
FT   gene            complement(100659..101474)
FT                   /locus_tag="Varpa_0101"
FT   CDS_pept        complement(100659..101474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0101"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   vap:Vapar_0088 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34323"
FT                   /db_xref="GOA:E6UYZ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADU34323.1"
FT                   /translation="MSSSQTDFATIAWRGRAVQIECAWIASERTDAPLIVFLHEGLGSV
FT                   AMWKDFPAQICEAANARGLVFSRPAYGRSTPREDNEIWDVDFMHRQAHEVLPALFAALK
FT                   LDHEKPWLFGHSDGGSISLLYASRFPERVSGLVVLAPHIFVEDVTVANIELARTAYLST
FT                   DLPKKLARYHDSADSAFWGWNRIWLHPPFRDWNIEAELDAIRCPVLAIQGIDDEYGTLA
FT                   QIRGIAARVGGGCELVEIPECGHSPHRDQPERVTVATASFITKNRRQTP"
FT   gene            complement(101614..103161)
FT                   /locus_tag="Varpa_0102"
FT   CDS_pept        complement(101614..103161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0102"
FT                   /product="benzoate-CoA ligase family"
FT                   /note="KEGG: vap:Vapar_0089 benzoate-CoA ligase family;
FT                   TIGRFAM: benzoate-CoA ligase family; PFAM: AMP-dependent
FT                   synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34324"
FT                   /db_xref="GOA:E6UYZ5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ5"
FT                   /inference="protein motif:TFAM:TIGR02262"
FT                   /protein_id="ADU34324.1"
FT                   /translation="MSLPARFNFAEHLFALNRGRAGRAAYIDDRGTLSYGQLEDRARRL
FT                   AAALKAAGVRREERVLLLMLDTNDWPVSFLGCLYAGIVPVAVNTLLTPEDYAYMLDHSR
FT                   AQAALVSGALLPTLQDAMGRGAHELQALIVSQPTGPLPDNAQAFDDALAKVEPLAAPVN
FT                   TASDDPGFWLYSSGSTGKPKGTVHTHANLWWTAELYGKPVLALTEDDVCFSGAKMYFAY
FT                   GLGNALTFPLTVGATVVLMAERPTPDATFRRWTEHKPTVFFGAPTGFAGMLASPRLPAR
FT                   ETVALRMCSSAGEALPGEIAQRFKAHYGCEIIDGIGSTEMLHIFISNRPGDVRYGTTGK
FT                   PVEGYEVELRGEDGRPVPDGEVGDLYIRGPSSALMYWNNREKSRDTFQGGWTKSGDKYT
FT                   RDADGYFTYAGRSDDMLKVSGIYVSPFEVEATLMQHPSVLEAAVIGKEDAEGLTKTKAF
FT                   VVLKDGSAATEDELKAFVKERLAPYKYPRFLEFVSELPKTATGKIQRFRLREREKQA"
FT   gene            complement(103204..104754)
FT                   /locus_tag="Varpa_0103"
FT   CDS_pept        complement(103204..104754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0103"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: vap:Vapar_0090
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34325"
FT                   /db_xref="GOA:E6UYZ6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ6"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADU34325.1"
FT                   /translation="MTDLLSNHVAGRWQSGSGAGTPLFDPVLGTELARVDATGLDLPEA
FT                   FSFAREQGGNALRALTYRQRAGLLGAIVKVLQANRDAYYEIAIANSGTVKNDSAVDIDG
FT                   AIFTLGQYAKWGDALGDVRALCDGDAVKLGKEPVFQSQHLQVPTHGVALFINAFNFPSW
FT                   GLWEKAAPALLSGVPVIVKPATATAWLTQRMVRDVVDAGVLPAGALSVICGSSAGLMDQ
FT                   LQPFDVVSFTGSAETAAVIRSHPAVAARSVRANIEADSLNSALLLPGATPGSDAFNLLV
FT                   REVVREMTVKSGQKCTAIRRILVPAEVYDAAAEAIGAKLAGVTVGNPRNESVRMGSLVS
FT                   RAQLNAVRDGLDALAAQTTVLHDSRSKPLIDADPAIAACIGPVLLGARDADAAQRVHDV
FT                   EVFGPVATLLPYRDLAHGIALAHRGQGSLVTSLYGSDDAALAQAALAVAPSHGRVHVIT
FT                   PEVAQAHTGHGNVMPMSMHGGPGRAGGGAELGGLRALDFYHRKSAVQASPGVLAALGL"
FT   gene            complement(104751..105224)
FT                   /locus_tag="Varpa_0104"
FT   CDS_pept        complement(104751..105224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34326"
FT                   /db_xref="InterPro:IPR032345"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0091"
FT                   /protein_id="ADU34326.1"
FT                   /translation="MASKEAFHQLIAGLTAEIAGRPLDAQLDQWLNATHGAGSASFEQL
FT                   RQACIGGVAEGWLCEREGGGIKYGRVFKAEDALHRFSVDVVDMQDIAGPHHTHPNGEID
FT                   LIMPLADSAAATFDGRPAGWCVYGPGTAHRPTVAQGRALVLYLLPEGQIKFTQ"
FT   gene            105421..106359
FT                   /locus_tag="Varpa_0105"
FT   CDS_pept        105421..106359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0105"
FT                   /product="transcriptional regulator, XRE family with
FT                   shikimate kinase activity"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; helix-turn-helix domain
FT                   protein; KEGG: vap:Vapar_0092 anaerobic benzoate catabolism
FT                   transcriptional regulator; SMART: helix-turn-helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34327"
FT                   /db_xref="GOA:E6UYZ8"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ8"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ADU34327.1"
FT                   /translation="MNEHVDAVLATAPESGTNAAPAGEAKNPLLAALGDRVRNLRAQRG
FT                   LTRKAVAVAADVSERHLANLEYGIGNASILVLQQVAGALHCSLAELVGDITTSSPEWLL
FT                   IRELLENRSEADLRRVRVALGELLGTASVDSARHRRIALVGLRGAGKSTLGQMLADDLD
FT                   VPFVELSREIEKLAGCSVREIHDLYGTNAYRRYERRALEEAIQIYGEVVIATPGGIVSD
FT                   PATFNELLAHCTTVWLQAAPEEHMGRVAAQGDMRPMAASKEAMDDLRRILDGRAAFYSK
FT                   ADLRVDTGGKTVQQAFEALRTAVGTVVREAA"
FT   gene            complement(106391..108859)
FT                   /locus_tag="Varpa_0106"
FT   CDS_pept        complement(106391..108859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0106"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="KEGG: ctt:CtCNB1_1959 TonB-dependent siderophore
FT                   receptor; TIGRFAM: TonB-dependent siderophore receptor;
FT                   PFAM: TonB-dependent receptor; TonB-dependent receptor
FT                   plug"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34328"
FT                   /db_xref="GOA:E6UYZ9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ9"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ADU34328.1"
FT                   /translation="MHAQPHHPAAPFPRNRLRLALRLACAMALSTAGPLALAQAANPAP
FT                   ARGANAVYDIPASPLAAALNQFAQQAGVAIALDAGKLRDLRSPGLKGRYGVEDGFAALL
FT                   AGSGQALGRTSAGYLLVPAAETAPPAAAPARPRQETTANQTLGEVTVTANQLGEITEGT
FT                   RSYTPGAIATATRLVLSPRETPQTVSVVTRQQMDDFGMTSIDDVIRATPGVSIVTYDSE
FT                   RTEYYARGFAIQNFQYDGIPMRRDSAYSAGNTLTDTSIYDRVEVLKGATGLLTGSGEPG
FT                   ATINLVRKKPTRAFQGQLSASAGSWNTYRTEADLSGALNESGSVRGRVVAALQDRHSQL
FT                   DHYKRSSKVFYGVLEADLTPSTLLTVGADYQDNDPKGSTWGGIPIFNSLGNFNSMPRSF
FT                   NNGARWSGWGQYTRTGFSTLEHQFGNGWVAKVQYNHQINGYDALLGAAAGGNPNPLDGS
FT                   GTSMWLGKYVGRTTSDALDAYASGPFKLLGREHELVVGASIARRRWKNDGYNFPGYQTN
FT                   VSGYYGWTGQVPFPVSSATPDFSDNEVTRERGLYAATRLNLSDRLKLIAGARVSSYRNK
FT                   DIDRSGEVAPYAGLIFDLTPQLSAYGSYTTIFMPQSSQDVNGRTLDPQDGKNQEVGLKG
FT                   SFLDGKLNASLAYFHLEQNNYPEATGGLTPRGGQAYRAIQGVVAKGVEAEVSGELAPGW
FT                   QLHAGFTHKVAKQDRKKVSTLEPEDQFSLYTTYRLRGALQGWTLGGGARWQSKSWGDAS
FT                   NPVLGTTTFTTDAYWLFDLMARYEFSPRLSATLRVNNALDKKYMTVFSWYSTYTWGEPR
FT                   SVNVNLVYKF"
FT   gene            complement(108940..109968)
FT                   /locus_tag="Varpa_0107"
FT   CDS_pept        complement(108940..109968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0107"
FT                   /product="anti-FecI sigma factor, FecR"
FT                   /note="PFAM: FecR protein; KEGG: neu:NE1095 putative
FT                   transmembrane sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34329"
FT                   /db_xref="GOA:E6UZ00"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ00"
FT                   /inference="protein motif:PFAM:PF04773"
FT                   /protein_id="ADU34329.1"
FT                   /translation="MNRAATEGSTVDIDAIAMQAAEWIVRLTADDSAERECAREGFDAW
FT                   KQADPRHAAAAAGMERLLGQLQTVRESSGGHARPAHAALTASATEARPRQSRRRRQAGA
FT                   TLSLAVVLGLSWMLLRACPPAYLLADMRTATGDTRAQVLPDGSRISLDTGSAVNLHYDA
FT                   GQRGIELVRGAIRVEVAPDAARPFVVRTPQGSIRALGTRFIVRRDGETTELTMLESRTT
FT                   VQAGKGAEARVIGPGQRVRITEVGIGPAEPVDVRSVDNAWTRRQLVADDRPLSEVLDEL
FT                   DRYHPGGIVYDRARTQGIRVSAVLPLDDTTRALQLLVDSFPQLRVRTLTSYLVLVDTTD
FT                   PS"
FT   gene            complement(109965..110489)
FT                   /locus_tag="Varpa_0108"
FT   CDS_pept        complement(109965..110489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0108"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: ppf:Pput_0844 ECF subfamily RNA polymerase
FT                   sigma-24 factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34330"
FT                   /db_xref="GOA:E6UZ01"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ01"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADU34330.1"
FT                   /translation="MSFPDTRLQPQLGDFYRAHHGWLTAWLRRKLGCAHSAADVAQDTF
FT                   VRVLASRETLRMLGSIEKPRAFLCTTAGRLLIDRARRQRIEQAYLAELALAMEGCAHPS
FT                   PKETLMAMQALAQIAAALDGLQPKPREAFLLHYLDGMTHTAIAESLGVSDRMVRKYLAL
FT                   ALLHCRVEFVQ"
FT   gene            110736..112412
FT                   /locus_tag="Varpa_0109"
FT   CDS_pept        110736..112412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0109"
FT                   /product="benzoyl-CoA-dihydrodiol lyase"
FT                   /note="KEGG: vap:Vapar_0093 benzoyl-CoA-dihydrodiol lyase;
FT                   TIGRFAM: benzoyl-CoA-dihydrodiol lyase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34331"
FT                   /db_xref="GOA:E6UZ02"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR017633"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ02"
FT                   /inference="protein motif:TFAM:TIGR03222"
FT                   /protein_id="ADU34331.1"
FT                   /translation="MSADTSLQPPPRVDYRTAPDQYRHWSLSFDGAIARLVLDIAEDGG
FT                   IRPGYKLKLNSYDLGVDIELNDALNRVRFEHPEVRSVIVTSGKDRIFCSGANIFMLGVS
FT                   GHAWKVNFCKFTNETRNGIEDSSKHSGLKFLAAVNGACAGGGYELALACDEILLVDDRS
FT                   SAVSLPEVPLLGVLPGTGGLTRVTDKRHVRHDLADIFCTSVEGVRGQRAVEWRLVDAVA
FT                   KPAQFAAAVQDRASQLAAGSDRPAGGKGVALTRLERTDSADGISYSHVDIQIDRSKRTA
FT                   TITVKAPTGAQPADIAAIEAAGAAWWPLAMCRELDDAILNLRTNELDVGTWLLKTEGEA
FT                   AAVLASDAVMLANKDHWLVRETIGALRRTLARLDVSSRSLFALVEAGSCFAGTLAELAF
FT                   AADRTYMLALPDDAERAPKLVLDEFNFGFFPMVNDQSRLQRRFYEEAAPLDAARAAAGK
FT                   PLDADEALKLGLVTAAPDDIDWDDEIRIAIEERAAMSPDALTGLEANLRFASKENMATR
FT                   IFGRLTAWQNWIFNRPNAVGEKGALKVYGTGEKAGFDMNRV"
FT   gene            112444..113871
FT                   /locus_tag="Varpa_0110"
FT   CDS_pept        112444..113871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0110"
FT                   /product="benzoyl-CoA oxygenase, B subunit"
FT                   /note="TIGRFAM: benzoyl-CoA oxygenase, B subunit; KEGG:
FT                   vap:Vapar_0094 benzoyl-CoA oxygenase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34332"
FT                   /db_xref="GOA:E6UZ03"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR017635"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ03"
FT                   /inference="protein motif:TFAM:TIGR03225"
FT                   /protein_id="ADU34332.1"
FT                   /translation="MSTINYSEKIPNNVNLGEDRTLQRALEGWQPNFINWWDDVGPEGS
FT                   TNHDVYLRTAVSVDPQGWAQFGHVKMRDYRWGIFLNPGDANREIHFGDHKGEKAWQDVP
FT                   GEHRANLRRIIVTQGDTEPASVEQQRHLGLTAPSMYDLRNLFQINVEEGRHLWAMVYLL
FT                   QKHFGRDGREEADALLQRTSGDENNPRILGAFNERTPDWLAFFMFTYFTDRDGKFQLSA
FT                   LAESAFDPLARTTKFMLTEEAHHMFVGESGVSRVIARTAQMMNELKTDDAQKIRAAGCI
FT                   DLGTIQRYLNFHYSVTIDLFGADQSSNAAIFYSSGLKGRYEEGKRTDDHILKGQTYKVL
FT                   EVKEGQLVEKDVPMLNALNEVLRDDFIKDSVAGVGRWNKVLEKAGIPTRLVVPHKAFNR
FT                   QIGALAGIKMSPEGRVVNEVEWAAKRDEWLPSSEDFAFVASLMGRVVEPGKFAGWISPP
FT                   VMGINRQPVDFEYVRFG"
FT   gene            113997..115286
FT                   /locus_tag="Varpa_0111"
FT   CDS_pept        113997..115286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0111"
FT                   /product="benzoyl-CoA oxygenase/reductase, BoxA protein"
FT                   /note="KEGG: vap:Vapar_0095 benzoyl-CoA
FT                   oxygenase/reductase, BoxA protein; TIGRFAM: benzoyl-CoA
FT                   oxygenase/reductase, BoxA protein; PFAM: oxidoreductase
FT                   FAD/NAD(P)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34333"
FT                   /db_xref="GOA:E6UZ04"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR015701"
FT                   /db_xref="InterPro:IPR017634"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ04"
FT                   /inference="protein motif:TFAM:TIGR03224"
FT                   /protein_id="ADU34333.1"
FT                   /translation="MDMAVEAGVIKQHLIDPEICIRCNTCEATCPVNAITHDDNNYVVR
FT                   ADVCNGCMACISPCPTGSIDNWRTMPLVRAYTIEEQLTWEELPAELTPEELEAAGISAD
FT                   VGDEAGASAAPSPTQAQAAVEPIEAVFNSAQYGATVPPWSAAHAYTNLFPPKTPTIATV
FT                   VGNFNCTEAGFESETHHIVLDFGVVPFPVLEGQSIGIVPPGVDAIGKRHHARQYSVASP
FT                   RNGERPGYNNVSLTVKRVTEDHQGDPVLGVCSNYVCDLKVGDTVQVVGPFGASFLMPNH
FT                   PKSHIVMICTGTGSAPMRAMTEWRRRLRKSGKFEGGKLMLFFGARTQQELPYFGPLQSL
FT                   PKDFIDINLAFSRTPGQPKRYVQDLMRERAADLAALLKDGTSHFYVCGLKSMEEGVVLA
FT                   LRDVATEAGLDWDTLGASLKREGRLHLETY"
FT   gene            115297..115740
FT                   /locus_tag="Varpa_0112"
FT   CDS_pept        115297..115740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0112"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   vap:Vapar_0096 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34334"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ05"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADU34334.1"
FT                   /translation="MKFADFHAGQVIEAGPYVLTEEELVRFAKDYDPQWFHTDAEAAAH
FT                   SAFGGLIASGWHTCAIAMRLVVETALKGSESFASPGLEHVRWPNPVRPGDALRLVAEVI
FT                   EVRRSEKRPTLGILRWRWRLFNQRELMVLDVEVTSLFRLEAPS"
FT   gene            115847..116308
FT                   /locus_tag="Varpa_0113"
FT   CDS_pept        115847..116308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0113"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="PFAM: protein of unknown function UPF0074; KEGG:
FT                   vap:Vapar_0098 transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34335"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ06"
FT                   /inference="protein motif:PFAM:PF02082"
FT                   /protein_id="ADU34335.1"
FT                   /translation="MKRDSKLSAVLHVLLHMAEMDGPITSESLAAAMHTNPVVVRRIMA
FT                   GLRQAGFVSSAKGHGGGWVLSCSLARVTLGDIHNAVGAPALLAMGNRTESPGCIVEQAV
FT                   NAALDDAFDAAEALLLKRFNSITLADLSKDFHRRMTGGGFTQKDIEHAL"
FT   gene            116298..117206
FT                   /locus_tag="Varpa_0114"
FT   CDS_pept        116298..117206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0114"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: vap:Vapar_0099
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34336"
FT                   /db_xref="GOA:E6UZ07"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ07"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADU34336.1"
FT                   /translation="MRYDALVVGGSFAGLSAAMQLARARKNVCVVDAGAPRNRFAAAAH
FT                   GFFGQDGVPPLKMISDARAKLLAYPNVTLIEGRVASAQADGAGGFVASLDDGDRQLSAG
FT                   KLLLAFGVQDGFPDGIAGVRERWGTSVLHCPYCHGYEFSGRRLGVLIEAPHPPDHAMLI
FT                   AEWGPATLFLNGNNTVEEEARAKLQARGVTVEPGRIVALEGPAKDLSGVRLEDGRIVPV
FT                   DALFMVPRTRPSSPIAEQLGCAFDDGPAGPVIRTDAMKMTTVPGVYAAGDVAMPMHNAT
FT                   LSSADGVMAGTSMHRAMVFGA"
FT   gene            117272..117347
FT                   /locus_tag="Varpa_R0001"
FT                   /note="tRNA-Gly1"
FT   tRNA            117272..117347
FT                   /locus_tag="Varpa_R0001"
FT                   /product="tRNA-Gly"
FT   gene            complement(117401..118723)
FT                   /locus_tag="Varpa_0115"
FT   CDS_pept        complement(117401..118723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0115"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="TIGRFAM: fumarylacetoacetase; KEGG: vap:Vapar_0100
FT                   fumarylacetoacetase; PFAM: Domain of unknown function
FT                   DUF1969; fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34337"
FT                   /db_xref="GOA:E6UZ08"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ08"
FT                   /inference="protein motif:TFAM:TIGR01266"
FT                   /protein_id="ADU34337.1"
FT                   /translation="MIELNHTHDVDARSWVDAANVAGSDFPIQNLPYAVFRRIGSPEPF
FT                   RGGVAIGDQVLDLAALAAGSHADGLALDAARVAALPALNDFFALGPAAWQALRHLVFAL
FT                   LRSDAPAATVDDLRKCLVPQSEVEYTVPARIGDYTDFYTSIDHALNITRLFNPEGDVTP
FT                   NFRWIPTAYHGRVSTIGVSGQRFHRPMGQTLAPGAKAPTYHACARLDYELELGVWIGEG
FT                   NAAGEPIPLERAEEHIFGICLLNDWSARDIQFWEMAPLGPFLAKNFATTISPWIVTMEA
FT                   LAPYRQAWTRPSSEPQPLDYLESKSNRESGAIDIRLEVWLESEKAREGKSGPSRLSRTS
FT                   FKHQYWSVAQMVAHHTMGGCQLNPGDLFGSGTISGPGEGEAGAIIELTRAGQSPVALAN
FT                   GEQRGFLEDGDAVLLRGWCEKPGHARIGFGESRGTVLPAKG"
FT   gene            complement(118743..119549)
FT                   /locus_tag="Varpa_0116"
FT   CDS_pept        complement(118743..119549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0116"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: vap:Vapar_0101
FT                   cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34338"
FT                   /db_xref="GOA:E6UZ09"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ09"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ADU34338.1"
FT                   /translation="MPRKFVDLSIFLENDVLSDPPAFAPKIQYFTHEQTYEQIEPFFPG
FT                   LKKEDLPDGEGWAVELVQLSTHNGTHLDAPYHFHSTMDKALGEKKPAIAIHDVPLEWCF
FT                   QPGVKLDFRHFADGYVVTAADVEAELKRIGHTLSPLEIVVVNTRAGKRYGSNDYVSAGA
FT                   GMGYEATMYLLERGVRLTGTDAWSWDAPFVHTAKKYGETQDASLIWEGHKAGRDIGYCH
FT                   IEKLHNLEVLPPTGFFISCFPHKIRGASAGWTRAVAIFDDALMASV"
FT   gene            complement(119618..120409)
FT                   /locus_tag="Varpa_0117"
FT   CDS_pept        complement(119618..120409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0117"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0102
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34339"
FT                   /db_xref="GOA:E6UZ10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ10"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34339.1"
FT                   /translation="MNSNDRAPSSLNWLGSFAVLCALIALWWVASNAGWVSRVFLPTPQ
FT                   ATFASLLEGLNLSGGSGNGELLAFTQATVGRMVEGWLLASLFGVVLGAAIGVSPAVRAW
FT                   IQPTLEFIRPLPASALLPLAISIFGLNPGMVLFVVAFGAMWPVLLATVHGFAAVEPRLA
FT                   EVARCLQMSRAAYIWKMGLPNAMPDILAGMRLALTIALIVAVVGEMIASQSGLGQAILL
FT                   AARAFRASDLFAGIVLLGLIGFVSNALLAFAEKRLLRWQQP"
FT   sig_peptide     complement(120308..120409)
FT                   /locus_tag="Varpa_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.834) with cleavage site probability 0.818 at
FT                   residue 34"
FT   gene            complement(120406..121176)
FT                   /locus_tag="Varpa_0118"
FT   CDS_pept        complement(120406..121176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0118"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0103
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34340"
FT                   /db_xref="GOA:E6UZ11"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ11"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34340.1"
FT                   /translation="MTEGRLFRWLRPWVFPALLVGAFEWYARRAAALGSDALAPPSAAA
FT                   KAFAGAALDGSLWQATGFTLGTAALGLLIGAVLGIALGLVLGLSRRAAQLGSVSIEVLR
FT                   PVPSVALIPLAMLAFGFGVRMELAIVAFATFWPLLVLVQSAVQQIEPRLLEVSRVLGLS
FT                   ARERAFKIVLPAIVPRLFVALRLGVAVALVVAVTVEIAANPNGMGYAMMIAQQSFDPAL
FT                   MLAWLGWIGVVGFAVNAGMVLLQRTVARRMGVMA"
FT   gene            complement(121169..121948)
FT                   /locus_tag="Varpa_0119"
FT   CDS_pept        complement(121169..121948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0119"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0104 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34341"
FT                   /db_xref="GOA:E6UZ12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ12"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34341.1"
FT                   /translation="MHATPFLRFDGVAIRLGGREILSPTSFDVARGEFVCIVGPSGCGK
FT                   TTLLRAASGLVTASAGEVRRNGVKMTEPSREVAFVFQDYGRALLPWRTVEGNVSLALEA
FT                   AGVPAAERSPRIADVLGKVGLAKHAQKFPVQLSGGMQQRAQIARCLAQKPELMMMDEPF
FT                   GALDALTRQSLQDELARLVRDDGLTVLFVTHDLEEAIYLGDRVIALQANPGPGRPSLAR
FT                   MIDVKIPRPRDQLTTKEHPEYLQLRRELFAFIEQGHD"
FT   gene            complement(122023..122970)
FT                   /locus_tag="Varpa_0120"
FT   CDS_pept        complement(122023..122970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0120"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="KEGG: vap:Vapar_0105 NMT1/THI5 like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34342"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ13"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0105"
FT                   /protein_id="ADU34342.1"
FT                   /translation="MMKRRTLLSALAAASASAALPSRAQQSHPKIVFGYTAVTDFASVF
FT                   VAAEEGYFKKRGLDVELKFIPLNSTIPAALQSDSLQIGGPTPSVFLQAVDGGLDLVLVA
FT                   GGGLTSKTITGFGLVARAGSGIKSPQDCVGKKIGVPGLGAFLHVTFRAWLKDSGVDYRK
FT                   VNFVEASFPQHADLLRGGSVDAVVSADPFMSRITESGAGYVASYYSTFLPENNQTIVHA
FT                   AKREWVAKNPATARAFREALVESGGFMQQAKNDAKVRAAIGKYIKLPPDVLAKVQVSPP
FT                   GPVVTEKQLGYWTGLMKEQDMLKTNIDVAKLIAK"
FT   sig_peptide     complement(122896..122970)
FT                   /locus_tag="Varpa_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 25"
FT   gene            complement(122967..123701)
FT                   /locus_tag="Varpa_0121"
FT   CDS_pept        complement(122967..123701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0121"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vap:Vapar_0106
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34343"
FT                   /db_xref="GOA:E6UZ14"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ14"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU34343.1"
FT                   /translation="MNTRTPTARRSAPRAAAITAEAGRPDRRQAILLAAEKLFAQHGYH
FT                   AVTIRQIAEEAGVPLALVGYYFGPKHELFHAIFEHWSHTIEERLTRLAEVNNDPDDACT
FT                   LPSIIEAFTTPVLALRASAEGEYYALLVARELYHATEEADRVLRGYFDPLAAAYIDALH
FT                   VALPHATRGQVAWGYQFALGALLHHLNDSRIERLSRGENKRADPAVAPMLVNFIVGGLR
FT                   AALPKPKTPRTQQKTPTRRQKT"
FT   gene            123802..125805
FT                   /locus_tag="Varpa_0122"
FT   CDS_pept        123802..125805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0122"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="KEGG: vap:Vapar_0107 acetoacetyl-CoA synthetase;
FT                   TIGRFAM: acetoacetyl-CoA synthase; PFAM: AMP-dependent
FT                   synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34344"
FT                   /db_xref="GOA:E6UZ15"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ15"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ADU34344.1"
FT                   /translation="MPVPNVPNIPQIRLYQNWLREQRGLSFDTYDALWRWSVTDLDAFW
FT                   QSIWDYAGLQSPTPHTAVLAEARMPGARWFPGAQVNYAREVLRHADAAHAAGMPAIVSD
FT                   NELGEVRELSWPEMRRQVAAVALTLKSLGVQRGDRVAAYMPNVPETMVAFLACSSIGAI
FT                   WSVCAPDMGTAAVADRFRQIEPKVLIAVDGVHYGGKPLDRSAVLQELRAQLPSVKKLLL
FT                   VKTSFAASPVAHDVDWTEATARNDGEVGAFEPEWLPFDHPIWIVYSSGTTGLPKPIVHG
FT                   QGGILLTMHACGLHNDVGASYGANNFGERYHWYSSTGWVMWNSQLSGMAFGATICIYDG
FT                   NPAGSKEKPDWGVLWRFVARHKVSFFGAGAAYFTNCMKAGIVAKECGDLSRVRALGSTG
FT                   SPLPEEVQRWGSQQILDAGSKDVWWCNISGGTDFCGAFVGGNRELPEVPGQMQCRELGH
FT                   AVEAWNEQGQPVIGEVGELVCTKAIPSMPLYFWGDEGNARYVSSYFDTYPGVWRHGDWI
FT                   KIGEDGGCVIYGRSDATINRQGLRMGTSEIYSAVEGLPEVLDSMVVDLEYLGRDSYMPL
FT                   FVVLRPGVALDEAMRTRLNNAIKTSLSPRFVPNDIFQVAEIPRTLSGKKQELPIKKLLL
FT                   GQPIEKVVNREAMANPGSLDWYVAFAAERASA"
FT   gene            125805..126260
FT                   /locus_tag="Varpa_0123"
FT   CDS_pept        125805..126260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34345"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ16"
FT                   /inference="similar to AA sequence:KEGG:Bpro_0121"
FT                   /protein_id="ADU34345.1"
FT                   /translation="MSRMKRRTSLLMLSAAAGASMLSACASSTPASKPAGAASLRVSGT
FT                   VAYRERIALDPAAEVVVQLLDVSRMDAPSVTLAEQRIKANGKQVPFAYELQVDAARIDP
FT                   RMRYAVSARILRGEQLLFINDTQYPVLTQGSGTTANLVLVRVTPSPR"
FT   sig_peptide     125805..125885
FT                   /locus_tag="Varpa_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.922 at
FT                   residue 27"
FT   gene            complement(126268..128235)
FT                   /locus_tag="Varpa_0124"
FT   CDS_pept        complement(126268..128235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0124"
FT                   /product="adenylate/guanylate cyclase with integral
FT                   membrane sensor"
FT                   /note="KEGG: vap:Vapar_0108 adenylate/guanylate cyclase
FT                   with integral membrane sensor; PFAM: adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; histidine kinase HAMP region
FT                   domain protein; Cache domain protein; SMART: adenylyl
FT                   cyclase class-3/4/guanylyl cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34346"
FT                   /db_xref="GOA:E6UZ17"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ17"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ADU34346.1"
FT                   /translation="MNSSGSPDVAGKPPFESAGAHTSPPPTVGPEAPPRRSRRFRVDVG
FT                   TIVSAVALAQSLLLVSLGYWGSQRLVSNIGTSAHRAAHDRTEDKVLAFLTKAESVVGAI
FT                   GSAPSLSPAGEHSERTAELLWTLLQQSPELDSVYVANENGQMLMALRYPVPAIRHIARG
FT                   AEFTTETWQYKRPLGAELDAQQRFATQRIESFRSSYDPTRRSWFQQANKMQGPIWTQPY
FT                   VFAAAQELGVTYALPSERRYTEGSPKALVVAGDVSLGRLSEFVRLFSSNGYGHSALLSA
FT                   DHKVLARSDLPGVLHQLDAPTGVLGTLHAQMHLHMATDGTPDGNGDSTFPFDFEGKRYL
FT                   VQTSLIPSTGWELVSWVPEDMVLGDLRRAVLWGLLLALVFLALALFMSLKLSKLVTSPV
FT                   ENLSRIARRIGLLELDNLPREPSRVLEIQHLDQALDDSARSLKAFSKFVPVNVINQLVA
FT                   EGHALAPSGSARRVTVMFTDVEGFTSISESLPIDVLVGMLTEYFNLATGVFARYGGVVD
FT                   KFIGDGIMVLWGAPADMKDAEYRACLAALQLHAQMGELNSKWRARGLPEFRTRIGIHTG
FT                   VVIAGVLGSNDRLSYTAFGDVINVASRIEGINKQLGTQTLMSEDTFAGLKGRLSTRRIE
FT                   ELVELRGRQTRMVLYELMKL"
FT   gene            complement(128426..129172)
FT                   /locus_tag="Varpa_0125"
FT   CDS_pept        complement(128426..129172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0125"
FT                   /product="Protein of unknown function DUF2086"
FT                   /note="PFAM: Protein of unknown function DUF2086; KEGG:
FT                   vap:Vapar_0109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34347"
FT                   /db_xref="GOA:E6UZ18"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ18"
FT                   /inference="protein motif:PFAM:PF09859"
FT                   /protein_id="ADU34347.1"
FT                   /translation="MLAARRDTAGMTTTHPSRIDALDWPRIETDLATRGCATTGQLFTP
FT                   KECAQLAAMYDEGGHHFRSRVVMQRHGFGEGEYQYFANPLPPLITAWRSALYERLAPLA
FT                   NAWASAMGQAADYPPDHAAYLARCHAAGQLRPTPLLLRYDEGDYNCLHQDLYGDLQFPL
FT                   QLTVLLSRPGEDFTGGEFVLTEQRPRMQSRAEVVSLAQGEAVIFAVNQRPVAGTRGTYR
FT                   VTMRHGVSRLRSGRRHTVGLIFHDAR"
FT   gene            129312..131087
FT                   /locus_tag="Varpa_0126"
FT   CDS_pept        129312..131087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO2981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34348"
FT                   /db_xref="GOA:E6UZ19"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ19"
FT                   /inference="similar to AA sequence:KEGG:SPO2981"
FT                   /protein_id="ADU34348.1"
FT                   /translation="MPGSIFLHGIALANYRGIGSDIVRIGPFQRFNFFVGPNNSGKSTV
FT                   LNFISQHLSTHVSSPPRGSRNQPVSLRPLDKNTKTNEDVVMGIGLPMSKAREQLEHIFN
FT                   EEPYDWHSHMNAIEYLLEFFQEENILWFQRGADPSKPLAPIPLNRLPSVEEITNASRVN
FT                   IKGLWSRLTRQSGGGPNLWVGESINRLLSLIDISLPAVALIPAIRQISERGQDFSDWSG
FT                   KGLIEELARHQNPDYSERLKIEKFEAVNSFVRVVTANSSARIEIPYDRQHILVHMDDKV
FT                   LPLHALGTGIHEVIMLAAFCTLLEQQIVCIEEPEIHLHPLLQRRLVQYLADQTSNQYFV
FT                   ATHSASIIDATEAAVFHVSNKSATTKIEPALTSAAKFQVCRDLGYRASDILQTNAIVWV
FT                   EGPSDRIYLNHWIVARDSTLREGTDYSIMFYGGRLLSHLAATDDVEVGDIEKDLEALIE
FT                   VRRLNRHLCVVIDSDKSSKDSPINSTKRRVIAELHRHGGIGWVTEGREIENYVEKEEMS
FT                   IALREVYGERFGRRLKSGQFEHVLPFVKADGKIFKEVDKVAVARATCKKPANLDILDLK
FT                   MRVEEIVAFIHEARE"
FT   gene            131194..131700
FT                   /locus_tag="Varpa_0127"
FT   CDS_pept        131194..131700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0127"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: sme:SMc04177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34349"
FT                   /db_xref="GOA:E6UZ20"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ20"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ADU34349.1"
FT                   /translation="MSTSKRPPADQGTNDWQLPWDGGCRCGQVRFRITAPPLLSMACHC
FT                   AGCQRMSASAFSLSLAIPTPGFEVVAGEPVIGGLHGDSHHFCCPHCKSWMFTRTEGMDE
FT                   FVNIRPTMLDRHEWFVPFMETWTDEKLPWVTTPAVHSFGKLPDFAAFPALIQAYAQEGA
FT                   RPGKA"
FT   gene            complement(131711..132652)
FT                   /locus_tag="Varpa_0128"
FT   CDS_pept        complement(131711..132652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0128"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: pfl:PFL_1558 AraC family transcriptional
FT                   regulator; PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34350"
FT                   /db_xref="GOA:E6UZ21"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ21"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADU34350.1"
FT                   /translation="MRAMTTRDSRSEYEWRMHKVLTHIDDHLDEPLELAALADVAHFSA
FT                   SHFHRLFAAWAGETLGDYIRRRRVEVAALRLATQPHLSVLEAAVSVGFGSGEAFTRAFR
FT                   AHFGSAPSAWRAAHDGSPPCDDPSRDSNPDQIALHGFTKNGSPLRNPAHEEPPVNVQLI
FT                   TRPPVTIAYLRYTGPFGAPVGAFWATKVAPWICAHDLWSHARYGISHDDPSITAPEHSR
FT                   YDACVEVPDNFVTDGGFHKTVLPGGRYVSLRFQGLPAEINDAWMRLMRDWLPASGFQFD
FT                   SRPAFEYYGPGMAFDEKTGAFECDICIPIAPL"
FT   gene            complement(132655..133557)
FT                   /locus_tag="Varpa_0129"
FT   CDS_pept        complement(132655..133557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0129"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0117 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34351"
FT                   /db_xref="GOA:E6UZ22"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ22"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34351.1"
FT                   /translation="MRRKIPPLQTLVCFDAAARHESYTRAAQELALTQSAVSRQIGTLE
FT                   AFLGVALFRRTRHGVALTASGAAYARQITKRLEAMERDTLDAMAHQGEGGSLSLAAVPT
FT                   FATRWLMPRLKGFAALQPDVVVHIETRTRPFLFADAEFDAALYAGTPAQVENWAGTRAL
FT                   LLMHEDVVPVCSPSLLPRGKAVAPAVISKMPLLQQSTRPDGWRQWFDAQQIDAPNARGG
FT                   PRYELFSILAAAASHGLGVALMPTMLVADELARGELVVACARPLSGERNYYLVTPERAD
FT                   QRPLLKFFSDWLLEQARQG"
FT   gene            133743..134942
FT                   /locus_tag="Varpa_0130"
FT   CDS_pept        133743..134942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0130"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: vap:Vapar_0118 acyl-CoA dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34352"
FT                   /db_xref="GOA:E6UZ23"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ23"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADU34352.1"
FT                   /translation="MAAKAQFHWDDPLLLDQQLTDEERMIRDAANAYCQERLAPRVIEG
FT                   FRTGETDPAIFREMGALGLLGPTIPEQYGGPGLNYVAYGLIAREVERVDSGYRSMASVQ
FT                   SSLVMVPIFEFGTEAQKQKFLPKLATGEWIGCFGLTEPDHGSDPGSMVTRAKKVPGGYS
FT                   LSGAKMWISNSPIADVFVVWAKEVSESGTVGPIRGFVLEKGMKGLSAPAIHGKVGLRAS
FT                   ITGEIVMDGVFCPEENVFPEVQGLKGPFTCLNSARYGISWGAIGAAEDCWHRARQYTLD
FT                   RKQFGRPLAANQLIQKKLADMQTEITLGLQGSLRLGRMKDEGTASVEITSIMKRNNCGK
FT                   ALDIARLARDMMGGNGISDEFGVARHLVNLEVVNTYEGTHDIHALILGRAITGIAAFAN
FT                   "
FT   gene            134953..136188
FT                   /locus_tag="Varpa_0131"
FT   CDS_pept        134953..136188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0131"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: vap:Vapar_0119 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34353"
FT                   /db_xref="GOA:E6UZ24"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ24"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ADU34353.1"
FT                   /translation="MTKPAALDGIKVLDLSRVLAGPWCTQILADLGADVIKIERPGVGD
FT                   DTRTWGPPFIKDADGNDTDQASYFTACNRNKRSVTVDMATAEGQALLQQMAAQADIVVE
FT                   NFKTGGLKQYGLDQESLRAANPRLIYCSVTGFGHDGPYAERAGYDLMIQAMTGMMSITG
FT                   RPDDVPGGGPLRVGVALTDLFTGVYASTAILAALQVRDRTGEGQHIDMALLDVGMAILA
FT                   NQASAFLNTGKAPQRQGNTHPSLAPYQDFPTLDGSMLLAIGNNGQFARFCEAAAHAEWA
FT                   ADARFATNTLRVKHRGVLIPMMEELTRTRTTADWVTLLEDKAVPCGPINDIAQAFDDAQ
FT                   VKARGLAVTLPRDAGDGIASITGVASPLRLSATPPVLRHAPPALGQHTREVLAEFGIDA
FT                   ARFDALRSAGVV"
FT   gene            136205..136636
FT                   /locus_tag="Varpa_0132"
FT   CDS_pept        136205..136636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0132"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: vap:Vapar_0120
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34354"
FT                   /db_xref="GOA:E6UZ25"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ25"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADU34354.1"
FT                   /translation="MTDSMRTPPFSVLRIDHVVLRVKDADRAIAFYCDVLGCTVEKRRD
FT                   DLGLVHLRAGTNLIDLVTPEGPLGKQGGALAGKEGRNVDHLCLRIEPFDEAAIRALMAQ
FT                   HGVPVHGEVQNNFGAEGNGPSIYISDPDGNSVELKGAAG"
FT   gene            136881..137270
FT                   /locus_tag="Varpa_0133"
FT   CDS_pept        136881..137270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0133"
FT                   /product="SNF2 superfamily protein"
FT                   /note="KEGG: vap:Vapar_0383 SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34355"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ26"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0383"
FT                   /protein_id="ADU34355.1"
FT                   /translation="MKTTKLLLAAAAATALSAFAGGASAEEYQGVLQFQSTASRAAVRA
FT                   DAVVAAHSADQYAEGASSGVPVAIASATDRATVRTQAVAAARAGDQYAEAASAGTVPRL
FT                   SSTLDRATVRAQAVAAAHGIGALGL"
FT   sig_peptide     136881..136958
FT                   /locus_tag="Varpa_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 26"
FT   gene            137352..137948
FT                   /locus_tag="Varpa_0134"
FT   CDS_pept        137352..137948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_6358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34356"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ27"
FT                   /inference="similar to AA sequence:KEGG:Vapar_6358"
FT                   /protein_id="ADU34356.1"
FT                   /translation="MTSHPFAARIAARLSFAVGTAALLAACGTRQPAPPEPPPPEATAR
FT                   NSVVMSAVTYGATAKGIQLKKEDDACDVPASLKQAVQDQLLEPYEYLLAPPPTANAEGA
FT                   PVLKVEITDLLANAGGLYGGPKIVQLRGTLERKGEAPARFTAERQMFIYFGMPRSTCSM
FT                   VGVVTYALGEDIAKWLQKPVDGALLGELSTTAGKR"
FT   gene            complement(137955..138413)
FT                   /locus_tag="Varpa_0135"
FT   CDS_pept        complement(137955..138413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34357"
FT                   /db_xref="GOA:E6UZ28"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ28"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0121"
FT                   /protein_id="ADU34357.1"
FT                   /translation="MPYAILLFLHLVAAAFWVGGMATMHFAVRPAAVATLEPPLRLRTM
FT                   AAALRRFFVGVDASVTLLFVSGVSMILLAGGFRSVHWRIEAMMSIAIVMAGIYVYIRAS
FT                   VFKALRRAVEESAWPVAAARLNTVRKLVSLNLALGVAVFAVATIGRAG"
FT   sig_peptide     complement(138312..138413)
FT                   /locus_tag="Varpa_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.675) with cleavage site probability 0.400 at
FT                   residue 34"
FT   gene            138510..139340
FT                   /locus_tag="Varpa_0136"
FT   CDS_pept        138510..139340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34358"
FT                   /db_xref="GOA:E6UZ29"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ29"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0122"
FT                   /protein_id="ADU34358.1"
FT                   /translation="MTRTVAQKRADFRALHEQGCFVIPNPWDTGSARYLQGLGFKALAT
FT                   TSSGHAWSQGFADGAQSRDTVLAHLRDIVAATDLPVNADFENGFASDAQGVAESVRLAV
FT                   ETGVAGLSIEDSTGDATNPLFPIDVAVERLRAARRAIDAAGGDTLLVGRAENFFAGRPD
FT                   LDDTIARLKAYAEAGADCLYAPGIKTREQIAAVVAAVAPKPVNLLVGGVSDLTMKDIAE
FT                   LGVRRVSVGGGLARAAWGGFDRAARALAEHGRFDGFEGAAAGADLNGFFGRFSS"
FT   gene            139357..139935
FT                   /locus_tag="Varpa_0137"
FT   CDS_pept        139357..139935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0137"
FT                   /product="uracil-DNA glycosylase superfamily"
FT                   /note="KEGG: vap:Vapar_0123 uracil-DNA glycosylase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34359"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ30"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0123"
FT                   /protein_id="ADU34359.1"
FT                   /translation="MDALLTEIRDCRACAAHLPLGPRPVVQTSATARLLLVGQAPSVTV
FT                   HTTGVPWNDKSGEQLRRWLGIDREVFYDATRVALMPMGFCYPGRGTSGDLPPRRECAEL
FT                   WQARLLAEMKQVELTLLIGQYAQRHFLGAARKAGVTETVEAFAEYGPRFIPLPHPSPRN
FT                   TGWFKHHPWFESDVLPVLRERVRQALAQR"
FT   gene            complement(139936..141627)
FT                   /locus_tag="Varpa_0138"
FT   CDS_pept        complement(139936..141627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34360"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ31"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0132"
FT                   /protein_id="ADU34360.1"
FT                   /translation="MPQLKTPAPLSIELTSPQSVNGKRAAFQSLWLLVRMQHAHDAEGG
FT                   LVRLADLRGEVSDASTLRMVVSRAFRDFKTWNIEVGWGEDTQREPRFLNAERRSQGPFW
FT                   LPAAEAKRMRVLVEGRAATAAEVASFLGLRSRKRHAAEPGSPPPDAVHLQDAAFWKQLV
FT                   ASQQAARQGRLMTPVAPMADSSATGLPVSALESIRLAGTLAATDFQRALVTLNEAMLWR
FT                   RLGDNEQARRRLQALKKQRLAHHVAGNDYLGAMECIVSAWCAYTARDLPLAQSLLSGMA
FT                   EDAARGLVLRHHPDVRFEWCNLWALVCRSRALGLSADDKPAAAALAEESLQRFGEALAA
FT                   AFESHSFDAAQHVAANMGMAAWLFDRVGLSDLPALAHDGHADTTRRAVQWIAFSEWLCG
FT                   HTDGQGRSAWNAIYLMRIARGHCRPDKQPTLAQFRMQKPLDPAAISRLAGPLADAFDAA
FT                   HWPARWVDVAQARLADHQAGRRRYPGLQHCSLLFEHAWYAAHAGDLKAAEQSLGVLREA
FT                   LPQLVPSDRAYFTESWNDTLPAELVLESKPPRRPAARKKAVGRTAR"
FT   gene            complement(141695..141889)
FT                   /locus_tag="Varpa_0139"
FT   CDS_pept        complement(141695..141889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0133 protein of unknown function
FT                   DUF1127"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34361"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ32"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0133"
FT                   /protein_id="ADU34361.1"
FT                   /translation="MTAPKPSTFHQRLMHALHDWRRRAAQRRRSRADSRHLTGMSDHEL
FT                   RDLGIGRSEVRELIDRNRY"
FT   gene            141980..142870
FT                   /locus_tag="Varpa_0140"
FT   CDS_pept        141980..142870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0140"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0134 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34362"
FT                   /db_xref="GOA:E6UZ33"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ33"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34362.1"
FT                   /translation="MRQLNLDQLRTLIAIADLGTFSAAAKALHLAQPTVSLHISELESR
FT                   LGAQLVVRGSRTVTPTAAGAALVERGRRLLRDTDEAIDAVKRQTEGRTGRVRLGTSTGV
FT                   VVDLLPQVLEALGTVHAGIDVEVSILGSNDAMARLAAGTLDIGLVAMPQPPGRDLVVTP
FT                   WRDQAMMAFVPQRWKAPKRVTPAWLAAQPLIFNDATTHMYRLTMEWFAGAGFAPRARIE
FT                   LNYDAAIQSLVAAGYGASLLPLQHTADDALNQRMQVLPITPKLTRRLGIAHRLPGVIDG
FT                   ATQSVLKVLTTFRQL"
FT   gene            complement(142861..143898)
FT                   /locus_tag="Varpa_0141"
FT   CDS_pept        complement(142861..143898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0141"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: vap:Vapar_0135 acylamide
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34363"
FT                   /db_xref="GOA:E6UZ34"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR023719"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ34"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADU34363.1"
FT                   /translation="MRHGDISSSSDCVGVAVVNYKMPRLHTKAEVLDNARKIGEMLVGM
FT                   KRGLPGMDLVIFPEYSTHGIMYDTKEMYDTAATVPGEETAIFADACRRANVWGVFSLTG
FT                   ERHEQHPDKAPYNTLILMNNEGEIVQKYRKIMPWVPIEGWYPGDRTYVSDGPKGMKISL
FT                   IVCDDGNYPEIWRDCTMRGAELVIRCQGYMYPAKEQQILVSKAMAFMNNTYVAVANAAG
FT                   FDGVYSYFGHSALIGFDGRTLGECGEEEMGINYAELSMSLIRDARRNGQSQNHLFKLMH
FT                   RGYTGLINSGDGDKGVADCPFDFYKQWINDPKGAREQVESFTRRTIGTAECPIEGLPNE
FT                   GSNQS"
FT   gene            complement(144093..144593)
FT                   /locus_tag="Varpa_0142"
FT   CDS_pept        complement(144093..144593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34364"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ35"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0136"
FT                   /protein_id="ADU34364.1"
FT                   /translation="MTEPIDSANPDTPALQQDRFWQDRGWTARIIKNEEDDGWAVEMTR
FT                   DGDPEPALVGPWTMGRDKKNPKPMDGPAFSTLVKTAAEVIRRHEQQLHATLNKSVTVTA
FT                   RDGRRIRVALAIVPDEDNPSATLSAHDDEDDSELASVNVSPAFKLTSGSATSWIEADFA
FT                   RPR"
FT   gene            complement(144590..145543)
FT                   /locus_tag="Varpa_0143"
FT   CDS_pept        complement(144590..145543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0143"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpl:BURPS1106A_A2577 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34365"
FT                   /db_xref="GOA:E6UZ36"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ36"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34365.1"
FT                   /translation="MTSNIGWELYRSFLGVLREGSLSGAARALGITQPTVGRHVAALEA
FT                   ALGVVLFTRSQVGLMPTEVALALQGHAEAMESTAASLERAATSQGEEGGKIRGVVRISA
FT                   SEVIGVEVLPPIVARLREAHPALKVELVLTNRVQDLLRREADIAVRMVRPKQEQLVARR
FT                   VGQIELGFHARKDYLARRGTPRKQEDLAAHAVIGYDQPSAFVRNAGKALPGYGRDAFSL
FT                   RTDSDLAQLALIRAGAGIGICQAGLARRDAALVRLMPRAFSMKLETWITMHEDLRNSPR
FT                   CRVAFDALVDGLQAYIDPPVQGTRGKIGRARTQASE"
FT   gene            145639..146637
FT                   /locus_tag="Varpa_0144"
FT   CDS_pept        145639..146637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0144"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="KEGG: ctt:CtCNB1_2542 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34366"
FT                   /db_xref="GOA:E6UZ37"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ37"
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_2542"
FT                   /protein_id="ADU34366.1"
FT                   /translation="MAHDNNTVLVLGATGGIGGEVTRQLRQAGWTVRALQRGMAQPVKQ
FT                   EEGITWLRGDAMDRQAVMEAAKGCSVIVHAVNPPGYRNWAQLVLPMLDNSIASAKAEGA
FT                   TIVLPGTVYNYGPDAFSGLIREDAPQKPVTRKGAIRVELERRLEAASRNGARVLIVRAG
FT                   DFFGPKAGNNWFSQGLVKAGLPVKAVSYPGNANTAHQWSYLPDVARTMVALLARRDRLE
FT                   PFARFHMAGHRDTDGTQMSNAIRNVVARRTGITPRVTAFPWWLLALASPFVTTLREMRE
FT                   MRYLWQTPVLMDNAKLVAFLGHEPHTPLEEAVEASLEGMGCLGGAPMAVTA"
FT   gene            complement(146744..147676)
FT                   /locus_tag="Varpa_0145"
FT   CDS_pept        complement(146744..147676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0145"
FT                   /product="Glutaminase, core"
FT                   /EC_number="3.5.1.2"
FT                   /note="TIGRFAM: Glutaminase, core; KEGG: vap:Vapar_0137
FT                   glutaminase; PFAM: Glutaminase, core"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34367"
FT                   /db_xref="GOA:E6UZ38"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ38"
FT                   /inference="protein motif:TFAM:TIGR03814"
FT                   /protein_id="ADU34367.1"
FT                   /translation="MMSFQHVLDDIVATLRPELGQAGTVASYIPALARVDARQFGIALR
FT                   TCEGEEAFAGDGEVPFSIQSVSKLFTLTLAMQRMGDALWERIGREPSGNPFNSLVQLEN
FT                   EQGKPRNPFINAGAIAVADRLVSQAAANGGSAKADILALMGGLCGEPIAFDEEVARSEA
FT                   DTGFRNVALANFMKSFGKIDNDVGTVLDTYFHQCSLRMSCRQLARAAAFLCRDGAHPID
FT                   GEPEITGERQTRRINALMLTCGTYDAAGDVAFSIGLPCKSGVGGGIVAVVPDKLTLCVW
FT                   SPALDATGNSLLGMKALELFVTRTGLSVF"
FT   gene            complement(147685..148593)
FT                   /locus_tag="Varpa_0146"
FT   CDS_pept        complement(147685..148593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0146"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: vap:Vapar_0138 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34368"
FT                   /db_xref="GOA:E6UZ39"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ39"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU34368.1"
FT                   /translation="MIQRKTHLDSLAIGLLIACCAFWGLQQILIKTTVTEVPPMWQASI
FT                   RMVGATVLLWLWCASRGVPLFKRDGTLWPGLLAGALFAGEFAGIYLGLQHTSASRLTVF
FT                   LYTAPFWVSLLLPRWVPAERLRGFQWLGLFIAFSGVVLAFSEGFGHMSSSQLIGDAMGL
FT                   AAGMLWGLTTLTLRTTKLATASAEKTLFYQVAVTAAVCPVLSLALGETWSFSYSSWAWT
FT                   SIGLQTVIGAFASYLTWMWLLRHYPATQMSSFTFLTPLFALVFGVVLLKEPLTLQLMVA
FT                   LAGVALGIVLVNRRSAVQRTA"
FT   gene            148841..149938
FT                   /locus_tag="Varpa_0147"
FT   CDS_pept        148841..149938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0147"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain"
FT                   /note="KEGG: bge:BC1002_5269 Rieske (2Fe-2S) iron-sulfur
FT                   domain protein; manually curated; PFAM: Rieske [2Fe-2S]
FT                   iron-sulphur domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34369"
FT                   /db_xref="GOA:E6UZ40"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ40"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADU34369.1"
FT                   /translation="MISPLSPATQLPVSAYFDEALLRREQDEIFNKWPRYAGHSLLVPA
FT                   LNDYCVLPHHHNGLAMVHGEQGIQLFSNVCRHRQATILQGRGNSKRLSCPMHRWTYDNS
FT                   GVLIAAPKFTELPCMQLERFQTTAWKGLHFIGKTDAINELVNLPRDVKGLLDFESSYFG
FT                   HMEVHECNFNWKTFLEFYLEDYHVASFHPGLGHFVSCDNLRWFFGANWSAQMVSFHKRL
FT                   EQPGNSEIYRAWHQAVRTYYADDLPSIGAMWLLIYPNVMIEWYPLVTVISTVFPKGTGR
FT                   CVNVVEYYHPLDLKMRPDGDAMASLAASAYLETAVEDNQIGERIHEGRFALMSRRTSEY
FT                   GPYHENLEAGMVHFHQFLRDQLNCI"
FT   gene            150051..150383
FT                   /locus_tag="Varpa_0148"
FT   CDS_pept        150051..150383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0148"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   rxy:Rxyl_1319 small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34370"
FT                   /db_xref="GOA:E6UZ41"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ41"
FT                   /inference="protein motif:PFAM:PF00893"
FT                   /protein_id="ADU34370.1"
FT                   /translation="MGTQAFSWLVLAMSVAAEVAGTIALRYADGFSRPLPSLVVGVSYA
FT                   IAIWLMAIAVRHLEIGMAYAIWAGGGAALIALTGVVWFGESMTPSRAIGVTMIIIGVVV
FT                   LNLETR"
FT   sig_peptide     150051..150110
FT                   /locus_tag="Varpa_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.431 at
FT                   residue 20"
FT   gene            150418..151098
FT                   /locus_tag="Varpa_0149"
FT   CDS_pept        150418..151098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0149"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: hha:Hhal_1869 putative transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34371"
FT                   /db_xref="GOA:E6UZ42"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032350"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ42"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU34371.1"
FT                   /translation="MELNTETRLHGLLIRRARELGKTLKMMAIEAGLARSGLYKLADGT
FT                   IRDPSVHTLLRLAAAMEVSPIALIRLYGDINAPAGVRDRGGSSLGRAQGLNDSRDAAML
FT                   NADVTIPHHAVVNGGEVFEKVWEVQNVGEVFWMGRRLVRVDRSCSRIDADLSAESRLHL
FT                   ASAAREIVIPNTPPGGVVRLSARFSAPRENCSIASVWRIEDQALRPCYGTGFFLGVIVT
FT                   VIDR"
FT   gene            complement(151130..151648)
FT                   /locus_tag="Varpa_0150"
FT   CDS_pept        complement(151130..151648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0150"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG: vap:Vapar_0139
FT                   transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34372"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:E6V058"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ADU34372.1"
FT                   /translation="MRTAALVPVLLLAAQTAVAQQQAQDAAGTAPKQNWFDDPYFQVSA
FT                   GLAACAVPEGPFYTAEERRVQTHSRLERGTSCWLAGKCADSNAYRYDKPLAPKVRAALL
FT                   AVPGVRSGSVWVMVQRRWVYLQGCVPTPELAKRLERAARAVPDVETVVPDLMIGTRGKP
FT                   PYPVAMPIR"
FT   sig_peptide     complement(151589..151648)
FT                   /locus_tag="Varpa_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 20"
FT   gene            complement(151648..152157)
FT                   /locus_tag="Varpa_0151"
FT   CDS_pept        complement(151648..152157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0151"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="KEGG: vap:Vapar_0140 flavin reductase domain protein
FT                   FMN-binding; manually curated; PFAM: flavin reductase
FT                   domain protein FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34373"
FT                   /db_xref="GOA:E6V059"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E6V059"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADU34373.1"
FT                   /translation="MTTPRRAQPPTFSPDEFREALGMFATGVTIVTACAADGTLVGLTA
FT                   NSFNSVSLTPPLVLWSLARAAGSMPALSTGSHYAVNILAASQKQLAERFATKNIDRWAD
FT                   VEFTRGIGGAPVLVGAAASFECFNRSRYDEGDHVIFVGEVERCTHDAGASPLLFHGGRF
FT                   YTEHPL"
FT   gene            complement(152199..153146)
FT                   /locus_tag="Varpa_0152"
FT   CDS_pept        complement(152199..153146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0152"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cti:RALTA_A0206 putative
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34374"
FT                   /db_xref="GOA:E6V060"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V060"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADU34374.1"
FT                   /translation="MQLRQLQHLVALAEQGSFGRAAQAAHLSQPAFSRSIDMLEDKLQA
FT                   RLVDRAYGTVRFTQAGELVLARARELIADAQQIQRDVLQLQGLSIGSLAVGLGPFAAST
FT                   LGRMALSLMAQRHPQLLMRMEVADTVTLSERLHRRQLDLFIADTRDLKKQPGLKLARLP
FT                   DLPVSFFVQPKHPLRRLKQVTLEKAMAYPLAGPNLPAEVAAHFERHVQRDTRGDGRDER
FT                   GVFNVTCDDAGTLRHLALTANAVILAPHALHAPALNTDTDTDALVPLPVAGFAGMQTHY
FT                   SLVTLAGRTPSAAATVYTRLVTELMAPFKRPAGR"
FT   gene            153254..155227
FT                   /locus_tag="Varpa_0153"
FT   CDS_pept        153254..155227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0153"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   sce:YOL164W Bacterially-derived sulfatase required for use
FT                   of alkyl- and aryl-sulfates as sulfur sources"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34375"
FT                   /db_xref="GOA:E6V061"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:E6V061"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADU34375.1"
FT                   /translation="MTPSSFSMALVALACTFGSAQALAQIAPKPPEAATLKANADMAKT
FT                   LPFANRQDFEDAMRGFIGTVPDALVPGAGPRPAWSMKPYDFLKANEPADTVNPSLWRQA
FT                   QLNAIHGLFRVTDRVYQVRGFDIANMTIVEGDTSLIVIDPLLTAETARAALALYYQHRP
FT                   RKPVGTVIYTHGHADHFGGVKGVVDEADVAAGKVQVIAPSGFMETAVAENILAGNAMSR
FT                   RSQYQFGTLLPPGARGQVDTGLGKALARGTITLIAPTSTVDKTTEERTIDGVQVVFQLV
FT                   PGSEAPSEMLMYLPQFRVLNMAEDVTHTMHNLYTIRGAEVRDGNLWAKYIDQARVAFAG
FT                   KTDVLIAQHHWPTTGQARIADLLKKQRDMYKFINDQSLRLLNQGYTAADIAETLRMPAS
FT                   LEEEWSARGYYGTLRHNAKAVYQKYLGWYDANPANLNPLPPVDYAKKTVQYMGGADAVV
FT                   ARALDDFQKGEYRWVASAMSQVVYADPTNRAARELGADALEQLGYQSEAGTWRSAYLVG
FT                   AMELRNGVPKIPGGSSSNADTLKAVSNDLFFDFLGVRLDAAKAEGKTMVINWNFTDSNQ
FT                   QFVLTLENSALTHIAGQQAGADATVTLSRATLDAITLKETSFPAAVLTGKVKIDGDRAK
FT                   LGELMAMLDTFEPMFPVVEPRK"
FT   sig_peptide     153254..153328
FT                   /locus_tag="Varpa_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.949 at
FT                   residue 25"
FT   gene            complement(155235..156464)
FT                   /locus_tag="Varpa_0154"
FT   CDS_pept        complement(155235..156464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0154"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   vap:Vapar_0141 nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34376"
FT                   /db_xref="GOA:E6V062"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:E6V062"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADU34376.1"
FT                   /translation="MLNGLWLGFFGMAALAALVRWLVGGDPTVFAALVESLFTMARLAV
FT                   EVMVLLFGTLTLWLGFLRIAEAAGLVGWLARLLGPLFRRLMPGVPAGHPALGLITMNFA
FT                   ANALGLDNAATPIGLKAMRELQRLNPDPVTATNAQILFLVLNASSLTLLPVTIFMYRAQ
FT                   QGAPDPTMVFLPILLATSASTLVGLLTVAIAQRLRLWDPVVLAYLIPGALLLGGFMALL
FT                   GTLSAAAIASLSSLMGNLALFGVILVFLAAGAIRRIKVYECFIEGAKEGFDIAKNLLPY
FT                   LVAMLCAVGVLRASGALDFILGGLRWLVTAGGWDSRFVDAMPTALVKPFSGSAARAMLI
FT                   ETMKSQGVDSFPALVAATIQGSTETTFYVLAVYFGAVGIQRARHAVSCALLAELAGVVA
FT                   AIAVCYWFFG"
FT   gene            156535..158112
FT                   /locus_tag="Varpa_0155"
FT   CDS_pept        156535..158112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0155"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: vap:Vapar_0142 phospholipase
FT                   D/transphosphatidylase; PFAM: phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34377"
FT                   /db_xref="GOA:E6V063"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E6V063"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADU34377.1"
FT                   /translation="MRASLIRGFTALVGVLAAAWLTGCVSLPPPEPRAPVTAFTDVANT
FT                   ELGQLAAKGVPGDSTALSGFRLLPEAAFAFDARISLARHAEKSLDVQYYLIQKDDVGLL
FT                   FLKELREAAARGVRVRLLVDDLYTAGEDEVFSSFSAFPNVEVRLFNPLPSRADSLATRL
FT                   LFSLTDFGRINHRMHNKMLIADNSFAVSGGRNIGNEYFMRSTAANFIDMDVISSGAVVR
FT                   QMSEGFDRYWNSSHAWPIERIAPLRTTPEAAQQRFDAIVRTAVPDVPIRPRDVLNKSPV
FT                   GEQLITGKIDRYWALGTLFVDDPEKITRKADDAYAGSVTEGALSVINSARREVKIGSPY
FT                   FIPGTRGMEMMKKAIESGGRITVITNSLGATDEPLAYAGYERYRADMLKIGVTIYEIAP
FT                   MLTARSGQFGDFGKTISRLHAKLAVIDDERFFVGSMNLDHRSAAVNTEVGLVIDSPELV
FT                   ADYNKLMNSQRINLGYRLRLAPNGRRVQWLEYDDAGGDIVHEDEPGEFLWLRFKNWLLL
FT                   PIVGEELL"
FT   gene            158199..159356
FT                   /locus_tag="Varpa_0156"
FT   CDS_pept        158199..159356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0156"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   dia:Dtpsy_3030 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34378"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V064"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34378.1"
FT                   /translation="MTVPEQRVFLAPPTTSRRRVLTGLAATAAAGLGMPAFAQGKPIRI
FT                   GTTFDNSSVEKANGQGLFQGSSAFFNALNKAGGLNGTKVELVMADDTFKPDVAKANALA
FT                   FEKDSSVLALLHPLGTRQTSEVMDAVPGMAVVGPITGTVALRKKTAPNTFWVRVNYDQE
FT                   VEKLVTTAAVLGQTRIGLVHSNDPLGQSVLAAFKAALAKAKLEPAVIATTPNTTSMEVS
FT                   PAAEAIAKAKPQVVIIGLAGTAPVFMKALRDAGGNSSAYGLSITASALAAMGDLARGLG
FT                   FVIVVPSPYSTKFEIVRRYQADMVANGTKDFSLTSLEGYINAAVLAEGLRRAGGSPTRA
FT                   SVMAGLASIENFDLGGLKINYGRTNREGGHFVDVAVIGSRGQMLS"
FT   sig_peptide     158199..158315
FT                   /locus_tag="Varpa_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.981 at
FT                   residue 39"
FT   gene            159455..159820
FT                   /locus_tag="Varpa_0157"
FT   CDS_pept        159455..159820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_0403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34379"
FT                   /db_xref="GOA:E6V065"
FT                   /db_xref="UniProtKB/TrEMBL:E6V065"
FT                   /inference="similar to AA sequence:KEGG:Daro_0403"
FT                   /protein_id="ADU34379.1"
FT                   /translation="MVLDFCISFGLAAPVVLSVVLYQVGHRAVAQGRVGPVTASLVYGL
FT                   CVAALPLAVWWGVHALAEFYIVGEGTSFWKSVLQIGLAFLMYAYLCISWALSFVAACLA
FT                   TWRFTVCAKRLKQEALA"
FT   gene            complement(159836..160558)
FT                   /locus_tag="Varpa_0158"
FT   CDS_pept        complement(159836..160558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0158"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pol:Bpro_5146 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34380"
FT                   /db_xref="GOA:E6V066"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V066"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34380.1"
FT                   /translation="MPEVLAFDQVTAGYGNAVVLDRLGFSLQQGESLAILGRNGVGKTT
FT                   LLETLMGNTRVMQGAIRWQGTDITRWPPHQRVRAGLGWVPQEREVFPSLTVEENLTVIA
FT                   RLGGWNLKRVYDFFPRLRERRGNYGNQLSGGEQQMLAIGRALMTNPKLLLLDEPMEGLA
FT                   PIIVEELSAAIRRLCESEGLASIVVEQHPVLALEMTHQAIVLERGTVVHAGPSAGLAAD
FT                   KGLLEGLLGVGIAEDVAG"
FT   gene            complement(160551..161318)
FT                   /locus_tag="Varpa_0159"
FT   CDS_pept        complement(160551..161318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0159"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pol:Bpro_5147 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34381"
FT                   /db_xref="GOA:E6V067"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E6V067"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34381.1"
FT                   /translation="MTPTATHTLRTRDLGIRFGAFQAVSEVNLSLEPGSRQALIGPNGA
FT                   GKTTLINLLTGVFKPTSGSIHMGERDITRLSGDKRARMGLARTFQINTLFPSLTPLLSV
FT                   VLAISEREGLGATWWRPLKGCTAVFDEAHALLGTLKLDSLSDVPVSELAYGKQRLLEIA
FT                   LALAAKPRILLLDEPAAGVPEDESGELFAAIAALPDDISVLFIEHDMKLVFRFSRRISV
FT                   LVGGRILTEGTPAEIGADPRVRQVYLGSSHHHA"
FT   gene            complement(161315..162277)
FT                   /locus_tag="Varpa_0160"
FT   CDS_pept        complement(161315..162277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0160"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pol:Bpro_5148 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34382"
FT                   /db_xref="GOA:E6V068"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V068"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34382.1"
FT                   /translation="MKAFAVSPAQLRIAEVAFWLALASSFFLLPDKLTLMSQIMIFGLF
FT                   AVSLDMALGYAGILTVGHAAFFGAGAYAAGLLAKYGWSEPLTGLAFALVVSGLLGYALS
FT                   YLVVRGADLTRLMITIGVCVLLYELANRLSGITGGTDGLQGVVIAPVLGFFEFDLYGKT
FT                   AFGYAFGVVLAMFLLVRLVLRSPFGLALRGIHDSRKRMTAIGSPVEARLRMAYAFSAAV
FT                   AGVAGALLAQTTQFVGIESIGFNRSAEVLIILVLGGTGRLYGGMIGAIVYMLVHDWFAD
FT                   MNPQYWMFWLGIFLIAAVMLGRGGIMGALSRFVRTGKAR"
FT   gene            complement(162274..163134)
FT                   /locus_tag="Varpa_0161"
FT   CDS_pept        complement(162274..163134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0161"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pol:Bpro_5149 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34383"
FT                   /db_xref="GOA:E6V069"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V069"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34383.1"
FT                   /translation="MGIVIFDGVAYGMLLFLIGVGLSITMGLMNFVNLAHGSFAMVGGY
FT                   AASLLMNHWGLGFGLSLAAAFVSAALVGAVLEFVFYRRLYRAHPLDQVLLSIGVVFVSI
FT                   AAFTYFFGPTMQPFTLPPSLDGQVAIGGLEVGRYRLFLIVCGVAVLAALLLVLGKTRYG
FT                   AMVRAAVDNQRVAGGTGIHVQRLFFLTFSLGCGLAGLGGALSLGMLGLEPSFPLKYLVY
FT                   FLMVVCVGGAGTVTGPFIAALLVGIVDVAGKYYWPEAGAFLIYVFMIVMLLVRPNGIVA
FT                   KKGLA"
FT   gene            complement(163170..164369)
FT                   /locus_tag="Varpa_0162"
FT   CDS_pept        complement(163170..164369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0162"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pol:Bpro_5150 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34384"
FT                   /db_xref="GOA:E6V070"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V070"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34384.1"
FT                   /translation="MTTMTKRTVLSTLLLAGFGMLGSVAAHAADEPLRIGLIATYSGPY
FT                   ADYGRQFDAGIALYLKEHGGKVGGRTVEIVKKDTAGPAPDAAKRIAQELVVRDKVSILT
FT                   GLDFSPNAYAVGAIATQAKIPTIVMNAASSAITNSSPYIARLSFTVQQVTDPMARFMLK
FT                   EGIKDAYTVVADYASGVDAETAFKKTFTAGGGKVSGEVRTPMNNPDFSAYVQRIKDAKP
FT                   QAVFFFFPSGVMPPAFLKVWKERGMEQAGIKLYATGEATDDSYLDATGDVALGLVTSHH
FT                   YSFAHNSPKNQKFVKDFAADNGAKLRPSYFAVTAYDAMAAIDLTLQKTKGDASGDKFMD
FT                   ALRGLRFESPRGPIEVDPLTRDIVQTVYIRKTERVNGQLVNVEFDKFDRVKDPAKESSN
FT                   "
FT   sig_peptide     complement(164283..164369)
FT                   /locus_tag="Varpa_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            complement(164418..164741)
FT                   /locus_tag="Varpa_0163"
FT   CDS_pept        complement(164418..164741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0163"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: pol:Bpro_5152 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34385"
FT                   /db_xref="GOA:E6V071"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E6V071"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADU34385.1"
FT                   /translation="MPTIHYILKDGSTRAVDAKIGASVMETAIRGNVRGIDAECGGCCS
FT                   CATCHVYVDEAFADLLPPPDDMESALLEVVASERQPNSRLSCQLTVTAAFDGLTVRVPE
FT                   SQV"
FT   gene            complement(164757..166211)
FT                   /locus_tag="Varpa_0164"
FT   CDS_pept        complement(164757..166211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0164"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   pol:Bpro_5153 L-glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34386"
FT                   /db_xref="GOA:E6V072"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E6V072"
FT                   /inference="protein motif:PFAM:PF00120"
FT                   /protein_id="ADU34386.1"
FT                   /translation="MSSSNTNTFVDRFGLWSDDQHAQARELVRRIDSDEVDLVRFAWPD
FT                   QHGILRGKTLVATEARSALWEGVNLTSTLLAKDTSHKTVFPVFTTNGGFAIEGLQGGAD
FT                   FTIVADPATFKVLPWAPRTGWILCDAYMADGKPCPFATRQVLQRAVRQLDDLGLDFIAG
FT                   LEVEFHVFKLDDARMDLADSGQPGEPPRVSLLSHGHQYLTELRYDRVDGLMELLRSNLI
FT                   ALGLPLRSLEIEFGPSQFELTFGPTAGVMPADTMVLLRSAIKQICQRNGLHASFMCRPK
FT                   IPNVMSSGWHLHQSLRRKSDGVNAFMPETEGQDLSEIGMHYLGGLKAHACGAAALASPT
FT                   INGYRRYRPFSLAPDRAIWARDNRGAMLRVLGGVGQSASRIENRVGEPTANPYLYLASQ
FT                   LFSGLDGIRHKIDPGPSADAPYETPAEHLPRSLGDALACLRRDEMLNTQMGKVFIDYLC
FT                   HIKEAEIARFNLEVSEWEHREYFDMF"
FT   gene            complement(166223..167554)
FT                   /locus_tag="Varpa_0165"
FT   CDS_pept        complement(166223..167554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0165"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   pol:Bpro_5154 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34387"
FT                   /db_xref="GOA:E6V073"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E6V073"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADU34387.1"
FT                   /translation="MISAEQNDLITRVGPDAPAGKLLRRYWQPVALADELAGPRPVKPV
FT                   KLMGQDFVLFRDENGQLGMLDRDCPHRGADLAFGRLENGGIRCAFHGWLFDAKGNCLET
FT                   PAEPATSKLCSRIKQSAYPVVEKAGVVFAYIGEGEPPAFPDFDCFVAPDTHTFAFKGLF
FT                   ECNWLQALEVGIDPAHASYLHRFFEDEDTSESYGKQFRGASADSDMPITKVLREYDRPE
FT                   ISVEPAPYGFRLKALRKLSEDTTHVRVTNVVFPQAFVIPMSAEMTISQWHVPVDDTHCY
FT                   WYAIFTSFTGPVDKQQMRDQRLKLYELPDYTSRKNKRNNYGYSIDEQLTETYTGMGDDI
FT                   NVHDQWAVESQGAIQDRTREHLGSTDKGIIAYRRVLVKAIEATLAGETAPMLIDAAQAS
FT                   TMTGPPSIDGIGHVVDEAATETYWQEADRARRLKSDWASARLAA"
FT   gene            167839..168573
FT                   /locus_tag="Varpa_0166"
FT   CDS_pept        167839..168573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0166"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: pol:Bpro_5155 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34388"
FT                   /db_xref="GOA:E6V074"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V074"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADU34388.1"
FT                   /translation="MDSQQSRVLVQLRDMILKGEFVPGERLAEIPLAEKLEASRTPVRL
FT                   ALASLEHEGLIEQSPSGGYQMRRFTSQEVADAIRVRGVIEGFAARLLAEDGASRQLLRD
FT                   LKDCLDAGDRAVNKPTMEIDDYAAYVEMNDRFHKLIVEGCGNLALKRVMDMLGGQPFAA
FT                   PSAMLPMQSSMEEGQQWMRQAHRTHHAMVQAIERGQGSRAQALGEEHVEIARMNLDYAL
FT                   ERPELAAELMPGIKLVSKGRNA"
FT   gene            168662..169285
FT                   /locus_tag="Varpa_0167"
FT   CDS_pept        168662..169285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0167"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pol:Bpro_0153
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34389"
FT                   /db_xref="GOA:E6V075"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:E6V075"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU34389.1"
FT                   /translation="MTTAAAAPAKPSFKEQMLQAREEAIVQTANRLLAEKGFESMTVDE
FT                   VAASVGIAKASLYKHFPSKEDLAAAAMVRLMQRTQDVLASVQVDQKPIDKLRAVVRWSM
FT                   EAQLAGEMPSLPHQNSSLRAALMNNRGYLDRLVAISDTLGGWIQAAQADGTLNPKLPAI
FT                   AVLYTLFARACDPVLGFLKSSGLQSDAEIVDLVLGTCFDGLASR"
FT   gene            complement(169368..170174)
FT                   /locus_tag="Varpa_0168"
FT   CDS_pept        complement(169368..170174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0168"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: vap:Vapar_0143
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34390"
FT                   /db_xref="GOA:E6V076"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:E6V076"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU34390.1"
FT                   /translation="MKLQLLSDLHLESNPRFHAEPIPGADLLVLAGDIGSYQEGSRLPD
FT                   TDFGLGRFSPRNGWPVPVIYVPGNHEYDNADFDETHDRLRALCAELDIQWLERETLVIE
FT                   GIRFVGTTLWADFDALVEPTDGLAEALKKRGKAMRAADFYLEKMATRRHGEIFLSGPLR
FT                   EQALVCQAWLREALAQPFDGTTVAITHFAPTLASADPRYGLTPGTAGFCNSLDELLPNA
FT                   QLWLHGHLHCAFDYVKDGCRVVANPLGYKRNGEQEGYRPDLLIDVK"
FT   gene            170301..170474
FT                   /locus_tag="Varpa_0169"
FT   CDS_pept        170301..170474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34391"
FT                   /db_xref="UniProtKB/TrEMBL:E6V077"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0144"
FT                   /protein_id="ADU34391.1"
FT                   /translation="MFSLLAQVARFFRSSSDSAPASHAATLMESADVRAGRGAHHAQEL
FT                   RAAASAWLSVVR"
FT   gene            complement(170489..171469)
FT                   /locus_tag="Varpa_0170"
FT   CDS_pept        complement(170489..171469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0170"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0145 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34392"
FT                   /db_xref="GOA:E6V078"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:E6V078"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34392.1"
FT                   /translation="MDVNFRTLDLNLLRVFDEVMAERNLTRAARNLSITQPAVSNALRR
FT                   LREVIGDELVRRAGAGVEPTPRALALWPTVRDALRQLQHTLAPGEFDAATADTTFLLAM
FT                   ADATAAELIPGLVQIAEKEAPAISLRVLPLTTRDPRRMLENEEVDMAIGYFPAVIASLA
FT                   ARGQSGVGVPFETQRLYLGQYVCVMRRGHPLANAPLTLDDYCAARHLLVSFSGRPYGFI
FT                   DQTLGAMGRERRIVVTVNQFFTAGRVVANSDLLTVLPRHFVTVTGIDDQLVLRDLPFDQ
FT                   PPVHVDAIWHRRAQHGHAHEWLRTALLRSAAAAFAGSILGQKVPD"
FT   gene            171580..172122
FT                   /locus_tag="Varpa_0171"
FT   CDS_pept        171580..172122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34393"
FT                   /db_xref="GOA:E6V079"
FT                   /db_xref="UniProtKB/TrEMBL:E6V079"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0146"
FT                   /protein_id="ADU34393.1"
FT                   /translation="MTSFVHVDQPTVHPGVRRAEVLFGQIQAARAGAEGARPLIALFIV
FT                   AIAAAVLVVADTLVSNWNEGALLAAWTIFCLAAIALFALFASSVRKSSIASLWQAAAER
FT                   RAANRADARFMETAKNDPRVMQELQAAVWRQQSEGTVPAAAVAKVDALARMSTRSQEAR
FT                   MPTLYEAMRRMNSSRYY"
FT   gene            172901..174423
FT                   /locus_tag="Varpa_R0002"
FT   rRNA            172901..174423
FT                   /locus_tag="Varpa_R0002"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            174508..174584
FT                   /locus_tag="Varpa_R0003"
FT                   /note="tRNA-Ile1"
FT   tRNA            174508..174584
FT                   /locus_tag="Varpa_R0003"
FT                   /product="tRNA-Ile"
FT   gene            174614..174689
FT                   /locus_tag="Varpa_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            174614..174689
FT                   /locus_tag="Varpa_R0004"
FT                   /product="tRNA-Ala"
FT   gene            175017..177888
FT                   /locus_tag="Varpa_R0005"
FT   rRNA            175017..177888
FT                   /locus_tag="Varpa_R0005"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            178033..178145
FT                   /locus_tag="Varpa_R0006"
FT   rRNA            178033..178145
FT                   /locus_tag="Varpa_R0006"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 84.61"
FT   gene            complement(178319..180184)
FT                   /locus_tag="Varpa_0172"
FT   CDS_pept        complement(178319..180184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0172"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="KEGG: vap:Vapar_0147 phosphoenolpyruvate
FT                   carboxykinase; PFAM: phosphoenolpyruvate carboxykinase
FT                   (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34394"
FT                   /db_xref="GOA:E6V080"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:E6V080"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ADU34394.1"
FT                   /translation="MNAPTMKGLTIQAPSYVKNAKLIAWVADMAALCKPESIYWCDGSK
FT                   EEYDRLCQQLVDAGTFKKLNPAKRPNSFLAVSDPTDVARVEDRTFICSNEKESAGPTNN
FT                   WMAPAEMRATLQPLFDGCMKGRTMYVVPFSMGPLGSPIAHIGIELSDSPYVAVNMRIMT
FT                   RMGKAVYEVLGADGEFVPCVHTVGAPLEAGQKDVSWPCNKTKYIVHYPETREIWSYGSG
FT                   YGGNALLGKKCFALRIASNMGRDEGWLAEHMLILGVTNPEGKKYHVAAAFPSACGKTNF
FT                   SMLVPPAGFEGWKVTTIGDDIAWIKPGKDGRLYAINPEAGYFGVAPGTNMLTNPNCMDS
FT                   LNSDVIFTNVALTDDGDVWWEGMEQDTKTLPEHLTDWQGKDWTPQIAKETGAKAAHPNS
FT                   RFTVAATNNPALDDAWDDPKGVAIDAFIFGGRRSTTVPLVTEAHNWVEGVYMAATMGSE
FT                   TTAAAGGQQGVVRRDPFAMLPFAGYNMADYFQHWLNVGKKLEASGAKLPKIYTTNWFRK
FT                   GADGKFVWPGYGENMRVLKWMIDRIEGKKTEGVEHITGVSPRYEDLNWTGLEFSAEQFA
FT                   TVTSIDKAAWQAELKLHAELFQQLSHHLPKELPETKAAIEQRLAA"
FT   gene            complement(180331..180483)
FT                   /locus_tag="Varpa_0173"
FT   CDS_pept        complement(180331..180483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34395"
FT                   /db_xref="GOA:E6V081"
FT                   /db_xref="UniProtKB/TrEMBL:E6V081"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0148"
FT                   /protein_id="ADU34395.1"
FT                   /translation="MSNPTPVEPGHAAAVEKDAVESVVHLMPIVLPLAGGVLMLLLASI
FT                   AVYLA"
FT   gene            complement(180582..181790)
FT                   /locus_tag="Varpa_0174"
FT   CDS_pept        complement(180582..181790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0174"
FT                   /product="threonine dehydratase"
FT                   /note="KEGG: vap:Vapar_0149 threonine dehydratase; TIGRFAM:
FT                   threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34396"
FT                   /db_xref="GOA:E6V082"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E6V082"
FT                   /inference="protein motif:TFAM:TIGR01127"
FT                   /protein_id="ADU34396.1"
FT                   /translation="MRAMVGIEEIRRAAVRLQGQVLNTPCVESRTLSEIVGAQVFLKFE
FT                   NLQFTSSFKERGACNKLVDLSEAGTRGVIAMSAGNHAQGVAYHAQRLGLRALIVMPRFT
FT                   PGVKIERTRGFGAEVVLHGDTLDAARAHALELAEREGLAFVHPYDDEAIIAGQGTVALE
FT                   MLDAVPDLDTLVVAVGGGGLIAGMAVAARDRKPGIEIVGVQTTRFPGMVNAIKGTHHAQ
FT                   GKSTIAEGIAVGTPGVLTQEIIASKVDDLVLVDEGDIEQGVLMLLEIEKTLVEGAGAAG
FT                   LAALIRHPERFKGKRVGLVLSGGNIDPLLLAAIIERGMVRAGRLARVRVSARDVPGSLA
FT                   EITATVAEAGANVDEVHHQRAFTMLAAQNVDIELVLQTRGRAHLASVLTALKDAGFEAE
FT                   EQH"
FT   gene            181898..184222
FT                   /locus_tag="Varpa_0175"
FT   CDS_pept        181898..184222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0175"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: vap:Vapar_0150 AAA ATPase central domain
FT                   protein; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34397"
FT                   /db_xref="GOA:E6V083"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V083"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADU34397.1"
FT                   /translation="MVKRAGVDVVAAAVRGQALPSPGLKEAPVLELMCSHFVLTLAAKQ
FT                   GPRFNVRRDINGLLSLTGRHLVWPAPVLQRLREFLGRRCAGNEAWKGVENFDGRTLLER
FT                   HGVWRGPYEEGTLFFYLDEYAKDQPKDLLSVLAVTRDWLTHALRKQSTLVEKNIDALAG
FT                   LLQLNKAERALLLYGTLARYQRDLRSLLVEFKVNNAPEAYAAIADIAGVNASEVGEALR
FT                   AGSRLERIGLVENLISEHNITDLADLMKVSEKLPPVLMREYRDHNELMAVFTRPSAKSA
FT                   LTPHDFSFVEEDAQMLVTLLRAAVARKEPGVNVLLYGPPGTGKTELAKVVAQAAGLELF
FT                   EVEYADRDGNSLSGRDRYRSLQIAQVFLKGSAQAALLFDEVEDVFPPISTEAAQFMARA
FT                   EQIPSSTSGSVSGKAWVNQILEANPVPTLWVTNRIEQIDPAFRRRFAYHLELKSPPPGA
FT                   REQLVKKTLEGVVVSEAFTAKLAERKGLTPAQIRTAVRFAGLAKTDDASMEGLIERQLR
FT                   NADLALGTLDTGRGERRNVTTYDLDMLNVETRFEIPRIVEALKARGHGTLCFYGAPGTG
FT                   KTALAEHIARAVGRPLIIKQASDLMSKYVGETEQNMAAMFKEAEAEKAVLLLDEADSFL
FT                   QDRRGAQRTYEVTEVNEMLQGMERFNGVFVCTTNLLDRLDQAALRRFTFKIKFKPLTAA
FT                   QRERMFVTEALAGDAALLTGEVKTRLAQLAQLCPGDFAAVKRQTDILAVEFSAAEFLDQ
FT                   LEAEHRIKPEVRESRGMGFVQ"
FT   gene            184274..185899
FT                   /locus_tag="Varpa_0176"
FT   CDS_pept        184274..185899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0176"
FT                   /product="peptidase S41"
FT                   /note="PFAM: peptidase S41; KEGG: vap:Vapar_0151 peptidase
FT                   S41"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34398"
FT                   /db_xref="GOA:E6V084"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041613"
FT                   /db_xref="UniProtKB/TrEMBL:E6V084"
FT                   /inference="protein motif:PFAM:PF03572"
FT                   /protein_id="ADU34398.1"
FT                   /translation="MGSRTTDLRRLPRPGAWAAAAALAIAGLLAGCGGGGGGGGGGGGF
FT                   PIVGGAPPPGGTPPTNGGGGGLVPSSEVAGQCAAPRRGIDPATGTAYPDTAGTVDNEKS
FT                   WVRSWIDETYLWYNEVPATLVAADYATPVAFFNVLKTTATTASGRAKDRFHYIYDTEAY
FT                   RQLSNAGISPSYGIEFAFVRGSRPNRDLRVAFVEPHSSSPAAAQGIARGARILEIDGVD
FT                   VLNGTNTAVINRGVSPQAAGETHTFKLQEGSATRTIDLTAAQVTRTPVQNVKTIDDAGS
FT                   RVGYLLFNDHITTSEAQLIAAVNKLKGDGIQDLVLDMRYNGGGQLNIASRLAYMVAGPS
FT                   QTAGKTFELLTFNDKNPFRLTFAQALTPFIGTSRANQPLPTLGLSRVTVLTSPDTCSAS
FT                   ESVINSLRGIGVTVNLVGGTTCGKPYGFYPKDNCGTTYFAIQFKGVNQAGFGDYGDGFA
FT                   PNANCVVADDFGHQLGDPAEARLAAALTLRSSGACPVPVASSKAVPGIGLDKAEVAPSE
FT                   EQPALLNRSPLRENRLIDPPPNAG"
FT   gene            186066..187256
FT                   /locus_tag="Varpa_0177"
FT   CDS_pept        186066..187256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0177"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: vap:Vapar_0152 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34399"
FT                   /db_xref="GOA:E6V085"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:E6V085"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ADU34399.1"
FT                   /translation="MRKLHKWIGAVFALVAAAVVAGCGGGGDGNGGFGLAPGFGGPPPP
FT                   AQKIIIDSDYNTMSDDGQLGVMAAQLQAEGKVQVMGISVVSGNQWLKQGVADALMSVER
FT                   LGVGDRIGVYVGENYALNHTFADVEAEMAAGAGGDGYLGAWSGPEPKTDADLKPSPDGF
FT                   ATRTLVQRKSAVDFIIDTVKANPNEITILAIGPLTNIALAVKKSPDIIPLIKKIVYMGG
FT                   AIDVPGNTTKAAEFNWWFDPDAAQFVVRLPIPQVVVPLDVTDTVFLTKPIYDRIAHPAK
FT                   PTAVTEVFRKLNGYGFSGTNGFENNPDYTQNIWDTLTLAYLIDPTYATRTVERYVDVVA
FT                   KPGAADNGRSIGYASQPAGPTLQKMTVVQRFDNTRFFELFVDLLTRPVPITLPPAN"
FT   sig_peptide     186066..186134
FT                   /locus_tag="Varpa_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.894) with cleavage site probability 0.355 at
FT                   residue 23"
FT   gene            complement(187275..189170)
FT                   /locus_tag="Varpa_0178"
FT   CDS_pept        complement(187275..189170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0178"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecQ;
FT                   ATP-dependent DNA helicase, RecQ family; PFAM: RQC domain;
FT                   DEAD/DEAH box helicase domain protein; helicase domain
FT                   protein; HRDC domain protein; KEGG: vap:Vapar_0153
FT                   ATP-dependent DNA helicase RecQ; SMART: DEAD-like helicase
FT                   ; helicase domain protein; HRDC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34400"
FT                   /db_xref="GOA:E6V086"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6V086"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ADU34400.1"
FT                   /translation="MSSLAPHPLDAPGSSTSPAEILHEVFGYSQFRGAQQDIVDHVVGG
FT                   GDALVLMPTGGGKSLCYQIPAIARQRAGRGVAVVVSPLIALMHDQVGALHEAGVNAAFL
FT                   NSTLDWEQTQDVERRMLRGEITLLYAAPERVNTPRFLSQLDSLKERGKLSLFAIDEAHC
FT                   VSQWGHDFRPEYRALTVLHERYPGVPRIALTATADDLTRADIVERLQLEEARQFVSSFD
FT                   RPNIRYTIVEKKDATTQLLRFIEREHEGDAGVVYCQSRKRVEDLATTLQGAGINALPYH
FT                   AGLDAAVRQKHQDRFLREEGIVMVATIAFGMGIDKPDVRFVGHLDMPKNIEGYYQETGR
FT                   AGRDGAPADAWMTYGLNDVVNQRRMIDESPAGEEFKQVMRGKLDALLSLAEASDCRRVR
FT                   LLGYFGEKSTPCGNCDNCLNPPNVWDGTDAARKLLSTIYRVQQLSGISFGAGHIMDILR
FT                   GKETEKVKQFGHERISTFGLGAEFSEVQLRGVLRQLIATGALAVDAEAFNTLKLTEGSR
FT                   AVLKGEANVTLRESISSPAERKPRREKVAKGAPSPAAAKLDDTGKKRFEALKAWRAEVA
FT                   KEHNLPAYVIFHDATLASIAERAPATLEDLQGISGIGTKKLEAYGTEVLRVCSAF"
FT   gene            189474..190520
FT                   /locus_tag="Varpa_0179"
FT   CDS_pept        189474..190520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0179"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="KEGG: vap:Vapar_0154 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34401"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E6V087"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0154"
FT                   /protein_id="ADU34401.1"
FT                   /translation="MVKTVNISAPEPAAARQAPRGGQENLGRPGVFLKVASLLAAGACA
FT                   AGMAGTAAAQDTKIALGMSGWTGFAPLSLADKAGIFKKNGLDVELKMIPQKDRHLALAS
FT                   GAIQCAATTVETHVAWNANGVPIVQIFQMDKSYGADGIAVRNDVKTFADLKGKSIGVSA
FT                   PGTAPYFGLAWMLSKNGMSLKDVKVVSLEPQPAAQAFVAGQNDAAMTYEPYLSTVRANP
FT                   AAGKILATTLDYPMVMDTVGCAPTWLKANPKAAAALTKSYFDALDMIKADPAKSNELMG
FT                   SAVKQSGEQFAKSSAYLRWQDKAANQKFFAGELTTFMKEAAAILLEAGVIRKAPEDYAV
FT                   TFDASYVK"
FT   gene            190501..191382
FT                   /locus_tag="Varpa_0180"
FT   CDS_pept        190501..191382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0180"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0155
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34402"
FT                   /db_xref="GOA:E6V088"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V088"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34402.1"
FT                   /translation="MQATSSKALPQQVPPRAASAGAASSQPVVPPVRRRAFAPLEPIGA
FT                   RARVLLGLGFFVVFVLVWSLATLGGFVSPTFLASPPTMVKEGWLLFTEYGFIGDIGMTV
FT                   WRVFGGFLLAAVFAVPLGIAMGTWKTVEAFFEPFVSFCRYLPASAFIPLLILWAGLGEM
FT                   QKLLVIFIGSFFQIVLMVAVTVGGARRDLVEAAYTLGANSRGIVARVLIPGAAPGIAET
FT                   LRLVLGWAWTYVIVAELIGSSSGIGHMITDSQALLNTGQIIFGIIVIGVIGLLSDFAFK
FT                   ALNRRLFAWAAL"
FT   gene            191367..192161
FT                   /locus_tag="Varpa_0181"
FT   CDS_pept        191367..192161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0181"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0156 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34403"
FT                   /db_xref="GOA:E6V089"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V089"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34403.1"
FT                   /translation="MGRTVKNQLSIQGVSRVFTGTKGQSTQALLPIDFEVKENDFVTIL
FT                   GPSGCGKSTLLRIVAGLDFPTTGQVLLDGERIEGPGADRGVVFQSYTLFPWLTVAQNIR
FT                   FGLRERGMSEADQKERSEFFIAKVGLRGFEHHFPKQLSGGMQQRTAIARALANDPKMLL
FT                   LDEPFGALDNQTRVLMQELLLGIWESAQKTVLFVTHDIDEAIFMANRVAVFSARPGRIK
FT                   TEIAVDFPHPRSYTIKTSPEFMDIKARLTEEIRAESMAAAEH"
FT   gene            192172..192909
FT                   /locus_tag="Varpa_0182"
FT   CDS_pept        192172..192909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0182"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM: UbiC
FT                   transcription regulator-associated domain-containing
FT                   protein; regulatory protein GntR HTH; KEGG: vap:Vapar_0157
FT                   transcriptional regulator, histidine utilization repressor,
FT                   GntR family; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34404"
FT                   /db_xref="GOA:E6V090"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V090"
FT                   /inference="protein motif:TFAM:TIGR02018"
FT                   /protein_id="ADU34404.1"
FT                   /translation="MKRDLPTLALYAQVKDHISRKIQDGTWPPGHRLPSEHELVAQFGM
FT                   ARMTVNRALRELVEQGRIVRVAGVGSFVAENKPQSTLLQIANIASEIRQRGHDYRCEML
FT                   AVERIAASPDVAAWLDLRAGDSVFHSACLHLENDTPVQLEERYVNPQVVPDYLEQDFSA
FT                   MPPSEYLVRNVPFDQIEHVVDAVLPNAEQAERLAMDVTDPCLLLTRRTWTRNTPVTWVR
FT                   CLHPASRYSLGSRFRADGNPSFG"
FT   gene            192972..194540
FT                   /locus_tag="Varpa_0183"
FT   CDS_pept        192972..194540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0183"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="TIGRFAM: histidine ammonia-lyase; KEGG:
FT                   vap:Vapar_0158 histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34405"
FT                   /db_xref="GOA:E6V091"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E6V091"
FT                   /inference="protein motif:TFAM:TIGR01225"
FT                   /protein_id="ADU34405.1"
FT                   /translation="MPSNNTAPTDAIDATLTLTPGKVDLAMLRRIQAGGVRLALDPSVL
FT                   DGMQKAEAAVRHIVENDQVVYGINTGFGKLASTRIGNDHLAELQRNLVLSHSVGTGEPL
FT                   AAPVVRMILATKAVSLARGHSGVRPALVDALLALFNAGVTPSIPCKGSVGASGDLAPLA
FT                   HMACVLIGEGEATLADGKKVSGAEAMRSIGLEPFVLGPKEGLALLNGTQVSTALALAGL
FT                   FGAEDVFASALMSGALSLEAIQGSIKPFDARIHAARGQPGQMAVAGAVRTLLEGSEIVP
FT                   SHADCGRVQDPYSVRCIPQVMGACLDNLAHASRVLVIEANAASDNPLVFCDTGEVISGG
FT                   NFHAEPVAFAADIIALAVSEVGAIAERRIALLLDTGLSGLPPFLVRDGGLNSGFMIAQV
FT                   TAAALASENKSLAHPASVDSLPTSANQEDHVSMATFAARRLGDMVNNTAVVVGIEAMAA
FT                   AQGIELKRKLKSSPLVEAEFARIRQNVAFLERDRYLAPDIEAMRLWALKAELPAALLNI
FT                   LPSHS"
FT   gene            194567..196294
FT                   /locus_tag="Varpa_0184"
FT   CDS_pept        194567..196294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0184"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="TIGRFAM: urocanate hydratase; KEGG: vap:Vapar_0159
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34406"
FT                   /db_xref="GOA:E6V092"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:E6V092"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ADU34406.1"
FT                   /translation="MNAPEKFALNNPDAADPRHDPTRVIRAPRGSELNCKSWLTEAPFR
FT                   MLQNNLDAEVAERPQDLVVYGGIGRAARNWECYDQILASLKELNDDETLLIQSGKPVGV
FT                   FKTHENAPRVLLANSNLVPKWGTWEHFNELDRKGLFMYGQMTAGSWIYIGSQGIVQGTF
FT                   ETFVEAGRQHYNNSLAGKWILTAGLGGMGGAQPLAATLAGAVSLNIECQQSSIDFRLRT
FT                   RYVDKQARDIDHAFELIKQHCDAKEAVSIALLGNAADILPELVKRAKAGAHKPDLVTDQ
FT                   TSAHDLINGYLPSGWTVQQWQAAMKDVSQHDALKKAAAKSCAVHVQAMLDFQSMGIPTV
FT                   DYGNNIRQVAFDEGVKNAFDFPGFVPAYIRPLFCEGKGPFRWVALSGDPEDIYKTDAKI
FT                   KELFPENTHTHRWLDMARERIAFQGLPARICWLGLGERHIAGLAFNEMVKNGELKAPIV
FT                   IGRDHLDTGSVASPNRETEAMKDGTDAVSDWPLLNALLNTAGGATWVSLHHGGGVGMGY
FT                   SQHSGVVIVCDGTDAAAKRIERVLFNDPATGVMRHADAGYDIAIATAKKQGLKLPMVR"
FT   gene            196378..197148
FT                   /locus_tag="Varpa_0185"
FT   CDS_pept        196378..197148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0185"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: vap:Vapar_0160 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34407"
FT                   /db_xref="GOA:E6V093"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V093"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADU34407.1"
FT                   /translation="MEVRTASKILPAMTPPTDAPAHNDRALFVLSVLAQSKVAMTAAEL
FT                   VQATGLVKSTLYRQIATLRRWGFVMESDGRYSPGPVSVQLASGFDDNSDLVMAARADMR
FT                   ALVQQSHESVALVTAVNDRVVCLEMIDSEHSLRCSFDRGRSVPASDGASAKCLLAHMPL
FT                   DQRDALLDGLGESAQRRAERAAELDAIREAGHAVTEGEVDAGVWGASAPVLASGRRLRG
FT                   AITLMAPITRVQGMEAALLHMTVVTAARISRALQ"
FT   gene            197192..197938
FT                   /locus_tag="Varpa_0186"
FT   CDS_pept        197192..197938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0186"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: vap:Vapar_0161 extracellular solute-binding
FT                   protein family 3; PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3; ionotropic glutamate receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34408"
FT                   /db_xref="GOA:E6V094"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E6V094"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADU34408.1"
FT                   /translation="MNTRRTLFTVAAAALFGFAGAAHAQGEPLRVATDATFPPMEFVEN
FT                   GKRTGFDVELVEAVGKTLGRKIEWIDIDFKGLVPGLISKRFDMAVSAIYITDERKKVVD
FT                   FTVPYYAGGLVVMVKDGNTAIKAPADINGKKVSVQVGTKSVAFTKEKYPQVQLMEVEKN
FT                   QEMFNLVDIGRADAAVTGKPAAYQYVRTRPGLKVLPEQITTEEYGMAIRKDTPELTKAV
FT                   NGAIEKLKADGTYAQIEKKWFSASAK"
FT   sig_peptide     197192..197266
FT                   /locus_tag="Varpa_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            197946..198614
FT                   /locus_tag="Varpa_0187"
FT   CDS_pept        197946..198614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0187"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: vap:Vapar_0162 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34409"
FT                   /db_xref="GOA:E6V095"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V095"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADU34409.1"
FT                   /translation="MDLDFSPVWQGWPDLLRGALVTVEITACALALGCVLGLIVGIGRL
FT                   NPKRRWIYSVCTAYVAVIRGTPLLVQLFILFFGLPHFGILLPAFLCGVLGLGVYSGAYV
FT                   SEIVRGAIQSIDKGQTMAAQSLGMTPGVAMREIVLPQAVVRMIPPLGNEFIALIKNSAL
FT                   VSLLTIHDVMHEGQKIISVSYRSLEVYLAIALVYFVLTGTMTLVLRHFEQKLRQGGLMR
FT                   "
FT   gene            complement(198668..199633)
FT                   /locus_tag="Varpa_0188"
FT   CDS_pept        complement(198668..199633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0188"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: nde:NIDE1834 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34410"
FT                   /db_xref="GOA:E6V096"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E6V096"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADU34410.1"
FT                   /translation="MNDEIFIGIDVCKAWLDVAQVPALAAGEASAFALRVDNEDGARAV
FT                   LVEQLKRLRPTLVVLEATGGFETSLASQLCLAGVPVAVVNPKRVRDFARAAGILAKTDK
FT                   LDAQVLAVFAQRMRPQVHALPDEAQQELTELVDRRAQLVAMRAQEKARLTTVKPVARKS
FT                   VREHIAWLDARIRQIERDLDGRLKDSPLYRPKYDLLDSVPGVGRVTITTLLSRMPELGT
FT                   LERKRIAALAGVAPFADDSGKRRGQRYIQGGRADVRCVLYMAALSAARCNPVIKAMYER
FT                   LRAAGKPFKVAITACMRKLLVILNAMLKSEQPWRTDPIAR"
FT   gene            199918..200490
FT                   /locus_tag="Varpa_0189"
FT   CDS_pept        199918..200490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0189"
FT                   /product="protein of unknown function DUF886"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   vap:Vapar_0163 protein of unknown function DUF886"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34411"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6V097"
FT                   /inference="protein motif:PFAM:PF05962"
FT                   /protein_id="ADU34411.1"
FT                   /translation="MNDVHRFSRSSLPAMPWKNGGGTTQEIASWPQGAALDSFGWRVSI
FT                   ATIAAAGPFSVFPGIARSIMLLEGDGVRLFTHDGRVEHRLDVPHRPFAFSGEDAIDCTL
FT                   LGGASNDFNVMTRHGQWRADVQVLDRATAIEAAPHGVLLALRGAWRLNDERCTEGEGLH
FT                   WADASLAWQAAPESEDARLVAVRIVPA"
FT   gene            200511..201773
FT                   /locus_tag="Varpa_0190"
FT   CDS_pept        200511..201773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0190"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="TIGRFAM: imidazolonepropionase; KEGG: vap:Vapar_0164
FT                   imidazolonepropionase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34412"
FT                   /db_xref="GOA:E6V098"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6V098"
FT                   /inference="protein motif:TFAM:TIGR01224"
FT                   /protein_id="ADU34412.1"
FT                   /translation="MKPANEYPSADGLWTGLRLATDAGAEAAIVVVEGAIRWVGARSAL
FT                   PAEFAGLAVHNGGDSLVTPGLVDCHTHLVYGGQRANEFAMRLAGATYEEVAKAGGGIVS
FT                   SVRATREADEDTLFAQAAPRLEQLLADGVCAIEIKSGYGLSLEHERKQLRVARRLGEAY
FT                   GVTVRTTFLGAHALPPEYTGRSGDYIDLVCREMLPALAAEGLVDAVDVFCERIAFSLEE
FT                   TEQVFQVAKALGLPVKLHAEQLSDMGGAALAARYGALSCDHIEHLSADGIEAMRQSGTV
FT                   AVLLPGAYYTLRDTHLPPIEALRTAGVPMAVSTDHNPGTSPTLSLLLMVNMACTLFRLT
FT                   VPEALAGVTVHAARALGLEATHGAIAEGMPANFVLWNVRDAAELAYWFGQRPLRTAVRQ
FT                   GRICISFPSPFGRGQGEGLRP"
FT   gene            201770..203221
FT                   /locus_tag="Varpa_0191"
FT   CDS_pept        201770..203221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0191"
FT                   /product="formiminoglutamate deiminase"
FT                   /EC_number="3.5.4.28"
FT                   /note="TIGRFAM: formiminoglutamate deiminase; KEGG:
FT                   vap:Vapar_0165 N-formimino-L-glutamate deiminase; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34413"
FT                   /db_xref="GOA:E6V099"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6V099"
FT                   /inference="protein motif:TFAM:TIGR02022"
FT                   /protein_id="ADU34413.1"
FT                   /translation="MNTTTALSKADGPHPNPLPEGKGARQTLFAADALLPAGWTKNVLL
FT                   TWSDAGRLTQVQSTAQPPAGVQVATGPVIPGMPNLHSHAFQRAFAGLTEHRAEQHDSFW
FT                   SWRTLMYRFAARLGPQHMEAIATWLYAEMLEAGYTSVCEFQYVHHDADGRPYADDATLS
FT                   LALLRAAQKTGIGFTLLPVLYQTSGFGDQPPSEGQRRFVRSTESMLRLLEALKPACDAQ
FT                   GARLGLAPHSLRAVPPEALRDAVAGLEAVDRTAPIHIHIAEQTKEVDDCVAWSGLRPVE
FT                   WLLDHAPVDARWCLVHATHMNDAEYEYAAKSGAVAGLCPTTEANLGDGIFDFSKWRSHG
FT                   GAWGVGSDSHASVNAAEELLMLEYSQRLAKRQRNVGASAAQPHVATALTLEAVQGGAQA
FT                   SGRATGGLAAGQQADFVVLDAAHVALQGLSAPDMLSAHVFASHRTSAIDTVWVAGRKRV
FT                   SGGRHTLHAESVSAFVAARTQLLQD"
FT   gene            203229..204044
FT                   /locus_tag="Varpa_0192"
FT   CDS_pept        203229..204044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0192"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="KEGG: vap:Vapar_0166 N-formylglutamate
FT                   amidohydrolase; TIGRFAM: N-formylglutamate amidohydrolase;
FT                   PFAM: N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34414"
FT                   /db_xref="GOA:E6V0A0"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR010247"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A0"
FT                   /inference="protein motif:TFAM:TIGR02017"
FT                   /protein_id="ADU34414.1"
FT                   /translation="MAFTTAEPAFRFRQGARPLLISMPHVGTHVPPALAARLTDEARHV
FT                   PDTDWHLEQLYDFADELGASVLVATHSRYVIDLNRPPDGASLYPGQSVTGLCPVDTFDD
FT                   TPVYASKDDLPSDAEVAERRDAIWHPYHRQLQAELDRLKAAHGTIALWDAHSIRSVLPR
FT                   FFEGKLPDLNLGTGNGTSCDPALAATLLGIAESATGYTGVLNGRFKGGHITRQYGNPAG
FT                   GVHAVQLEMTQSSYMQEKLPFDYLPAVAAGVQPHVRRMLEAVLAFVEKK"
FT   gene            204052..205044
FT                   /locus_tag="Varpa_0193"
FT   CDS_pept        204052..205044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A1383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34415"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A1"
FT                   /inference="similar to AA sequence:KEGG:Nmul_A1383"
FT                   /protein_id="ADU34415.1"
FT                   /translation="MRTTLRWLPCVLALALAMGVAQARTASTVPLLDDVEAMYVREGSF
FT                   LRSWGLEQLDGVKAKEAAGAPVSGMSLGQLISGLDEESQKEAVQNPARALRKVELGLRA
FT                   SQAWRSRFQEWTNIALTTEGSLHMTRWFLLGEAQDREAAHAIHEAVDDAETRPDWKGSG
FT                   RYFLGARYERLSGWAKDAGRPRFEQIALIDAGIAVNKAGREKYSFDSLIGLNALYGSYA
FT                   YVSGGSALASHLDEWLAYLRTQSPVDQAKSGALLADALFQSGRDAEALPWFDRYAAYWA
FT                   VEPVKPALRATMQESRCFGGLQGEGFRAYARREPARFAAMRERICTGKA"
FT   sig_peptide     204052..204123
FT                   /locus_tag="Varpa_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 24"
FT   gene            205110..206159
FT                   /locus_tag="Varpa_0194"
FT   CDS_pept        205110..206159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0194"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   vap:Vapar_0167 homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34416"
FT                   /db_xref="GOA:E6V0A2"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A2"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ADU34416.1"
FT                   /translation="MKPLVYTRGQALAGILEKRIAILDGAMGTMIQRFKLTEEQYRGER
FT                   FKDFERDVKGNNELLSLTRPDVISDIHEGYLAAGADLIETNTFGATTIAQEDYKMAHLA
FT                   REMNLESARIARAACDKFSTPDKPRFVAGALGPTPKTASISPDVNDPGARNVDFEQLRA
FT                   AYYEQTEALVEGGADVILVETIFDTLNAKAALFAVDEYFDNSGERLPLIISGTVTDASG
FT                   RILSGQTVTAFWHSVRHARPLAIGLNCALGAALMRPYIQELARVAGDTFISCYPNAGLP
FT                   NPMSDTGFDETPDVTSRLLHEFAAEGLVNIVGGCCGTTPDHIAAIGRAVAPVPGRLLNN
FT                   TAGFYSEAA"
FT   gene            206173..206481
FT                   /locus_tag="Varpa_0195"
FT   CDS_pept        206173..206481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A3"
FT                   /inference="similar to AA sequence:KEGG:Bpro_3374"
FT                   /protein_id="ADU34417.1"
FT                   /translation="MGAAGLRFAGLALVMSALAAGCNDTGKPPSWDTLLSGRIADARPD
FT                   CKVSVPLPGKITVACPGLKPAIFDVAPTAAYCQRGPRDCEFAVAQMVLMLPLPSPAP"
FT   sig_peptide     206173..206232
FT                   /locus_tag="Varpa_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.692 at
FT                   residue 20"
FT   gene            complement(206558..207478)
FT                   /locus_tag="Varpa_0196"
FT   CDS_pept        complement(206558..207478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0196"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: vap:Vapar_0169 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34418"
FT                   /db_xref="GOA:E6V0A4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A4"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADU34418.1"
FT                   /translation="MAFSSDNVEVFLAVIDHGSFSAAARALHKVPSAVSMAIAGLEAEL
FT                   NLPLFDRKGREPQPTAAARSLEPQARMLAAQLKQLQVQALALTQGLENRLTLAIAPELL
FT                   AAPWSGPLAELAQEYPLLQVEVLAAPQADALALLHSGRAQLALVFERPSLDGREGFQEV
FT                   GSDTMVAVMAPDHPALVAAAGERLREEHLTNTRQIVVAGRDLATSDPRFVFARHVWRTD
FT                   NALAALSLITAGLGWGWLPRNFARPHVAAGALIEIPFENLSNGLDLWVDVVWSRERPLG
FT                   LGAQRFVALIARDRQAAHAPKNVHP"
FT   gene            207578..208051
FT                   /locus_tag="Varpa_0197"
FT   CDS_pept        207578..208051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0197"
FT                   /product="transmembrane pair domain-containing protein"
FT                   /note="PFAM: transmembrane pair domain-containing protein;
FT                   KEGG: vap:Vapar_0170 transmembrane pair domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34419"
FT                   /db_xref="GOA:E6V0A5"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A5"
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /protein_id="ADU34419.1"
FT                   /translation="MQGLQRRVVYISLYEGIAIVCASAGLALMTDAGLGHSGVLAVAAS
FT                   VVAVIWNLIFNALFERWESRQAVRGRSVRRRIAHAIGFEGGLIAFLVPLFAWGLGVTLW
FT                   QALVMDLGLVLFFLVYTFVFNWGFDRVFGLPRSAQALPSAMPAPRSGASAPAR"
FT   gene            complement(207948..208883)
FT                   /locus_tag="Varpa_0198"
FT   CDS_pept        complement(207948..208883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0198"
FT                   /product="lipase chaperone"
FT                   /note="PFAM: lipase chaperone; KEGG: aav:Aave_4190 lipase
FT                   chaperone-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34420"
FT                   /db_xref="GOA:E6V0A6"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A6"
FT                   /inference="protein motif:PFAM:PF03280"
FT                   /protein_id="ADU34420.1"
FT                   /translation="MAGAAVLAILAGWWLVDGLPPADAPETVVATSTITATAPGGAMPA
FT                   TAQPIGDARPAPDAMLNPSLILIFESALAEAQATGKAAFMAMAPALLAKRLPAELVARA
FT                   MGLLERYIDMQEAMQALPPPEAGDPASLLKTIEARAEVRRRYFAPEEIEGLFGDEIRQD
FT                   ALMADKMAIARDANLTPGEREAAAKRSEEALLTPEQREQRRAFTAQVDVQRQTDAMDAR
FT                   GASAQERFAERSTAYGYEAARQLAALDQENQDWNSRLDQYANAPPDQQAQLRESLFNER
FT                   ERLRLSGALALRSARPVPTAAGRTPGRSPS"
FT   gene            complement(208936..209973)
FT                   /locus_tag="Varpa_0199"
FT   CDS_pept        complement(208936..209973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0199"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: aav:Aave_4189 triacylglycerol lipase; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34421"
FT                   /db_xref="GOA:E6V0A7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A7"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ADU34421.1"
FT                   /translation="MPRKRNSRLLRLAARPVCAALLLGLVGTTTLSQAAITDTPTQVQA
FT                   RVTSSEAKTKNPIVLVHGLFGFDNVLGIDYFYRIPESLAGAGAKVYVAQVSGANSSEIR
FT                   GEQLIQELKNLRALSGNPSLKFNLVGHSQGAPTARYVAAVEPGLVASVTSVGGANGGSK
FT                   VADLLRKIPEGSVSEAVVAETLRLAMLLLGAISGKDPSQLPEVPLNALNSLTTAGGAAF
FT                   DKKFPQGRPAPGSSCDVKSGPAEANGVRYYSWSGVQPLTNAFDASDVAMGGLSLIAFGS
FT                   ETNDGLLAVCSTRLGTHLGDYRQNHLDEVNQLFGLTYIGLWTLFEKKPVQLYQEQAARL
FT                   KSAGL"
FT   sig_peptide     complement(209869..209973)
FT                   /locus_tag="Varpa_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 35"
FT   gene            210246..212993
FT                   /locus_tag="Varpa_0200"
FT   CDS_pept        210246..212993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0200"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="TIGRFAM: methionine synthase; KEGG: vap:Vapar_0171
FT                   methionine synthase; PFAM: dihydropteroate synthase DHPS;
FT                   Methionine synthase B12-binding module cap domain protein;
FT                   cobalamin B12-binding domain protein; Vitamin B12 dependent
FT                   methionine synthase activation region"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34422"
FT                   /db_xref="GOA:E6V0A8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A8"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ADU34422.1"
FT                   /translation="MAQTPQISVPPMKLSGLEPVAIGEGTLFVNIGERTNVTGSKAFAR
FT                   MILNGQFEEALAVARQQVENGAQVIDINMDEAMLDSKVAMVRFLNLIASEPDIARVPVM
FT                   VDSSKWDVIEAGLRCIQGKGIVNSISMKEGVDKFKHEAKLVKRYGAAAVVMAFDEKGQA
FT                   DTYERKVEICERAYRILVDEVGFPPEDIIFDPNIFAIATGIEEHDNYAVDFINAVRWIK
FT                   ENLPGAKVSGGVSNVSFSFRGNDPMREAIHTVFLYHAIKAGMDMGIVNAGMVGVYDDLE
FT                   PELRERVEDVVLNRRPDAGERLVEVAETAKSGAKDESKRLEWRGTPESPVHVNQRLSHA
FT                   MVHGITDFIVEDTEEAYQQILAKGGRPLHVIEGPLMDGMNIVGDLFGAGKMFLPQVVKS
FT                   ARVMKSAVAHLLPYIEEEKLRDEAAGRDVRTKGKIIIATVKGDVHDIGKNIVTVVLQCN
FT                   NFEVVNMGVMVPCHEILARAKVEGADIVGLSGLITPSLEEMQYVAGEMQRDDHFRIKKI
FT                   PLMIGGATTSRVHTAVKIAPHYEGPVVYVPDASRSVSVAQSLLSDQATAYIDEINADYE
FT                   KVRTQHANKKQVPMWPLAKARANKTPIDWTNYVPPVPKFIGRRVFKNFDLTELAKYIDW
FT                   GPFFQTWDLAGPFPAILKDEVVGTEAVRVYADGQRMLKRLIEGRWLSASGIVGFWPANT
FT                   VNDDDIELYTDETRSEVALTWYGMRQQTEKQMIDGVMRPSRCLADFVAPKDSGLKDYVG
FT                   VFAVTAGLGVEKKEKYFIDDLDDYSAIMLKALADRLAEAFAESLHHRSRTDLWGYAPDE
FT                   GLSNEDMIGEKYRGIRPAPGYPACPDHSVKGPMFDLLACADIGMTLTESLAMMPAASVS
FT                   GFYLSHPDATYFNVGKIGHDQLQDQAARRKESESDLERLLAPNL"
FT   gene            213046..214848
FT                   /locus_tag="Varpa_0201"
FT   CDS_pept        213046..214848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34423"
FT                   /db_xref="GOA:E6V0A9"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0A9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0172"
FT                   /protein_id="ADU34423.1"
FT                   /translation="MFAAAHYAALVVFVVSCWGWGRGVLARLAPPSRRDGWLEAAVAVA
FT                   LGVGLFICAFQVLAIFGVFKLGATLAVIAGGVVVAALQLPAWLRERRTLKASAVAVPWT
FT                   YFDRIAMVALVLVALPALIAPLAPPAAFDELMYHLPYAREVAQQGSLGIHEWLRYPWFP
FT                   YNYNLLYAAALQVGDDVLPHFLNALAGGLSVVMIYRLGMLHANRLTACIGAAIWLGLGD
FT                   YSNALIDMGVALFVLTACVSLWWWRESQPVHSGMRWLGLAAFCLGVAAGSKYQALVFMP
FT                   LVALFVVWHERRPKAWALAFVCFLIPCIYWYARNAVMTGDPFNPIGARVFGFSEWIPAD
FT                   YVQQLADVRDHAEMPNALIWSVFLAPFGVLWKRSAAVRAAGWFCFYSLAVWVVTSRYPR
FT                   YLTASFPLLAMTAAIGWQVLFGWIAAGVRRVFGMKAATAEGVPELTNRRSAARVGDWVV
FT                   VLLLAVLAAVSVRQTAGKVAMISPTPETREAFLRKHVPGYAVMDYLRRNPTGRVYQIAL
FT                   NEAIYYGPNPIWGDTLGPWRYADFLLLPPGDMANKLAKLGFTAIVMPDQLVPTLATRAG
FT                   FDTHFAPLFAQDGSRAYRILPTAP"
FT   gene            214845..215843
FT                   /locus_tag="Varpa_0202"
FT   CDS_pept        214845..215843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0202"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   vap:Vapar_0173 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34424"
FT                   /db_xref="GOA:E6V0B0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADU34424.1"
FT                   /translation="MNDVDHAADTVSRRSAAPRIAAVIPCFNEALAIRQVVEGFRASLP
FT                   ADAEIHVFDNNSTDDTAAVARAAGAIVTHVAAPGKGNVVRRMFADVEADIYVMVDGDAT
FT                   YETAAAPRLIQRLIDGNLDMVVGNRIDDGQNALTYRAGHRLGNRMLTGAVVQLFGGGLT
FT                   DMLSGYRVFSRRYAKSFPALSRGFEIETELTVHALELRMPWAEESTAYSTRPEGSHSKL
FT                   STYRDGWRILKTICKLFVSERPLQFFSIIAALLAAGAVALVVPLVVTYMHTGLVPRLPT
FT                   AVLATGAMLGAMLSMVCGVVMHAVTLGRREAKRLRYLAIPGVRNCSSNAPR"
FT   gene            215840..216229
FT                   /locus_tag="Varpa_0203"
FT   CDS_pept        215840..216229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0203"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: vap:Vapar_0174 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34425"
FT                   /db_xref="GOA:E6V0B1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B1"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADU34425.1"
FT                   /translation="MKLGREFLSFAVVGAAGFVVDVAVLYLTAPLLGWYGARVLSFLAA
FT                   ATATWALNRRYTFSARSANASVLREYLGYLVTMLGGAVVNYGAYVLVLHWVTGAWAPAA
FT                   GVALGSCAGLVVNFLSARYLVFRAR"
FT   gene            complement(216374..217573)
FT                   /locus_tag="Varpa_0204"
FT   CDS_pept        complement(216374..217573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0204"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: vap:Vapar_0175
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34426"
FT                   /db_xref="GOA:E6V0B2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B2"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADU34426.1"
FT                   /translation="MAEIAAGAKSGKVVIKNIGLLLSGDIDKPILDADTIVVNDGLIVA
FT                   VGKEKDCDLEGAKTVIDAKKTCVAPGLIDSHVHPVFGDWTPRQGQIGWIDSTMHGGVTT
FT                   MISAGEVHLPGRPKDIVGLKALAITAQRAFDNFRPGGVKVLAGAPVIEKGMVESDFKEL
FT                   AEAGVGLLGEVGLGSVKAGYEAKEMVAWARKYGIQSTIHTGGPSIPGSGLIDKDVVLEA
FT                   DADIIGHINGGHTSLPEAHVCELCEKSSRAIEIVHNGNEKVAIAAAKAALELKCPHRVI
FT                   LGTDGPAGSGVQPLGILRMVAMLSSIASIPAELVFCFATGNTAKIRKLNCGLIEVGRDA
FT                   DFVFMDRAQHSPAPGLLESVQLGDIPGVGMVMIDGIVRCGRSRNTPPATEIPVVVSGAH
FT                   "
FT   gene            complement(217528..218307)
FT                   /locus_tag="Varpa_0205"
FT   CDS_pept        complement(217528..218307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0205"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vap:Vapar_0176
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34427"
FT                   /db_xref="GOA:E6V0B3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU34427.1"
FT                   /translation="MADSRTASKTSKATKPQRRTGVREAAAQATRDSILKSATKVFAKY
FT                   GYDGGSVEKISKAAKSYDRMIYYYFGSKEGLFIAVLEGIYQRMDDAEAAIALDASRPVE
FT                   ALTEVIRFVLGYYRKNPEFVTLLNTENLHKGRHISKSLRAREYSSRAVAIIAEILASGS
FT                   AQGLFRKDLVARDIYLLIASTGYFYTSNRHTLTAFLGEPLESPEAITHWENFVIETLLR
FT                   TVRADDIQEQQDNIPPHDEDTTKWQKSQPAQSRARSS"
FT   gene            complement(218329..219102)
FT                   /locus_tag="Varpa_0206"
FT   CDS_pept        complement(218329..219102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0206"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="KEGG: vap:Vapar_0177 oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; PFAM: oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; Oxidoreductase
FT                   FAD-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34428"
FT                   /db_xref="GOA:E6V0B4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B4"
FT                   /inference="protein motif:PRIAM:1.18.1.2"
FT                   /protein_id="ADU34428.1"
FT                   /translation="MSAFSEERVLSVHHWTDRLFTFTTTRDPALRFSNGHFTMIGLKVN
FT                   NKPLLRAYSIVSPNYEEHLEFLSIKVEEGPLTSKLQHIQVGDTIIVGRKPTGTLLIDYT
FT                   LPAKRLYLFGTGTGLAPFMSIIRDPETYEKFEQVILVHGVRQVDELAYHDLVTDHLPKH
FT                   EILGEMIEKQLLYYPTVTREEFRNQGRITDLIESNKLTDDLDLPPLNVEEDRVMLCGSP
FT                   GLLVDLKHILEKRGFKEGNTSTPGDFVVERAFAEK"
FT   gene            219419..221044
FT                   /locus_tag="Varpa_0207"
FT   CDS_pept        219419..221044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0207"
FT                   /product="6-hydroxynicotinate reductase"
FT                   /note="KEGG: vap:Vapar_0178 6-hydroxynicotinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34429"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0178"
FT                   /protein_id="ADU34429.1"
FT                   /translation="MTEHTKTDGLPGMDMPVVAEAGASAFGKAPPRNEKMSTAKVECNA
FT                   CPVLCQISDGRTGACDRYANREGVLVRVDPVVLLRREIASEAPTLVPFDRPAADKSEVI
FT                   EAGAPDWNGDLLHADEVFVTGVGSSTTYPDYKPAPFIVASKAQGVDMVTVVTEGIFSYC
FT                   SFKVKIDTDRFLGSEQANVRYRGEVVGHVTTAEYGSQMLSLGGVHHLTGGSKKEGRMTA
FT                   ELMQFLGNKKAVECTIDGGSTLVIQAGKAPIVNGVEEQRMRVGCGSAAVGIFARQFAGV
FT                   ADEVVVVDDHITGVLTEHQAGRCLDMAPSGIQMLGRKSTPGRYFQVANPGNGWGGTDIA
FT                   DPLAIIEGWEEGVARPGLRLLMTSTTGEHAQWYVLDDALKPVELEMPAEVKRIVDRIGE
FT                   NCEPSLCTVLFLGGAGGSLRAGVTENPVLLTRAIKRALVNVTCGGAPAYVWPGGGITVM
FT                   ADVMRMPDNSFGTVPTPAIVAPIEFSMRRADYEALGGHMEHIFSLEQALARGAWQEDGA
FT                   PLARQWLAMDAANPWPLGHAPMLG"
FT   gene            221048..221956
FT                   /locus_tag="Varpa_0208"
FT   CDS_pept        221048..221956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0208"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: vap:Vapar_0179
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34430"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR007183"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B6"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADU34430.1"
FT                   /translation="MSAQRSALDSSRWHFNHGPIDIVAEAHGDPYAVAAAHDAAWARFG
FT                   HVLDELVRELPLLRLPVTDKLRPRGVVGQRMWDACAAFSPMFITPMAAVAGSVAQELIA
FT                   FYDRPGIERAWINNGGDIAVHLAPGHSARVGVFADIARFDWRNHSNSILTTDGQFELHA
FT                   DEPVRGVATSGWRGRSFSLGIADSVTVLAATAAQADAAATVIANAVDVDDALIQRKPAS
FT                   ECKDDSDLGDALVTVDVPSLAPSQVKSALDTGAICAKVLQKGGLVWAALLVCQGQFRHV
FT                   EPLCSKSLQTVLPKSLGSVFA"
FT   gene            221977..222618
FT                   /locus_tag="Varpa_0209"
FT   CDS_pept        221977..222618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0209"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   vap:Vapar_0180 protein of unknown function DUF1185"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34431"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B7"
FT                   /inference="protein motif:PFAM:PF06684"
FT                   /protein_id="ADU34431.1"
FT                   /translation="MIDIRRVFTHVEHIHHEFGPRADTPLVRGAIGAVLTNPFAGRYEP
FT                   DILPMMALLDPVGVDMAHKLHAAMDVPLEQIATYGKGAIVGADGELEHGALWHVPGGYA
FT                   MRELLGWKGSRVAYTQGVAEEKSGQPANALSIVPSTKKVGPPGAALDVPLTNINASYVR
FT                   GQFDAIEVRVPGAPAADEIVFILAMSTGYRVHARVGGLLAKDISKWDGLR"
FT   gene            222658..223242
FT                   /locus_tag="Varpa_0210"
FT   CDS_pept        222658..223242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0210"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   vap:Vapar_0181 protein of unknown function DUF1185"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34432"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B8"
FT                   /inference="protein motif:PFAM:PF06684"
FT                   /protein_id="ADU34432.1"
FT                   /translation="MTANIRKLVIQVDEVRKEMGQDVTPPTRRAVAIAVIENPYAGRYS
FT                   ENLDELIAIGEELGALLGQKAVKALGIEPGQAQSYGKAAIVGERGELEHAAAILHPKLG
FT                   APLRVAVEKGAALVPSAKKQGTLGTAIDVPLGHKDAAFVRSHFDAIEARVSDAPRANEI
FT                   VVAVAVTDSGRPLPRIGGLQASEIKGEDGLR"
FT   gene            223309..224514
FT                   /locus_tag="Varpa_0211"
FT   CDS_pept        223309..224514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0211"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0182 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34433"
FT                   /db_xref="GOA:E6V0B9"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B9"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34433.1"
FT                   /translation="MNPLRLAFCAASVVTLATALVPAHAQGVIKIGEINSYKAQPAFLE
FT                   PYKKGMELAVDEINAKGGINGKKIELISRDDNANPGDAVRVAEELISREKIDVLAGAFL
FT                   SNTGLALTDFAKQKKFFYLAAEPLTDKIVWSNGNKYTYRLRPSTYMQVAMLVPEAAKLK
FT                   KKRWAIVYPNYEYGQSSAATFKTLLKAAQPDVEFVTEQAPPLGKVDSGSVVQALADAKP
FT                   DAIFNVLFGADLSKFVREGNTRGLFKDREVVSVLTGEPEYLDPLKDEAPNGWIVTGYPW
FT                   NGVKTPEHKAFLDAYQAKFKDYPRLGSVVGYSAIHSIAAGIKKAGGTDTEKLVAAFKGL
FT                   QVDTPFGKINYRAQDNQSTMGAYVGKTKNDGGKGVMVDYVYLDGAKFQPSDDEVKKMRP
FT                   AD"
FT   sig_peptide     223309..223386
FT                   /locus_tag="Varpa_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            224595..226529
FT                   /locus_tag="Varpa_0212"
FT   CDS_pept        224595..226529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0212"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0183 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34434"
FT                   /db_xref="GOA:E6V0C0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34434.1"
FT                   /translation="MSFSGFVVQLLNGLAGASSLFLVAAGLSLIFGVTRIVNFAHGSFF
FT                   MVGIYVAYTLVEKLGSTLGFWPALLIAALAVGVLGALIEVLLLRRIYKAPELFQLLATF
FT                   ALVLVIKDAVLWLWGPDELLGPRAPGLKGSIEILGRQFPSYDLFLIVVGPLVLGLVWLL
FT                   LTRTRFGTLVRAATQDREMVSALGVNQAWLFTAVFALGALLAGLGGALQLPREPATLEM
FT                   DLNTIGAAFVVVVVGGMGSLPGAYVAALLIAEIKAVCIWLGVVQIFGVDVSFSKLTLMV
FT                   DFLVMAIVLVWRPWGLFGRPQAPSRYVGMQEEPLRRPSNAYLIAAAVLALMLAVLPFLT
FT                   VNSPYTMVLMIDLLIAALFATSLHFIMGPAGMHSFGHAAYFGLGAYGAALLVRSLHLPM
FT                   EIALIVAPVVAALGALVYGWFAVRLSGVYLAMLTLAFAQITWAITYQWDSFTGGSNGLT
FT                   GVWPSEWLSNKQAYYWLTLVLVGAGVWWLRRVLFSPFGYALRAGRDSVLRADAIGIDVK
FT                   RMQWMAFVIAGTVAGLAGALYAFSKGSISPESLSVGKSVDGLVMVLLGGIQTLAGPVVG
FT                   AVTFTWLHDTVARNTDYWRAMLGAIILILVLLFPQGIAGSVKQLADRWRAPKNDESAEA
FT                   DAKLKEVKA"
FT   gene            226526..227323
FT                   /locus_tag="Varpa_0213"
FT   CDS_pept        226526..227323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0213"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0185 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34435"
FT                   /db_xref="GOA:E6V0C1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34435.1"
FT                   /translation="MSLLKVENLGKSFGGVKAVDGISFELPAGELLALIGPNGAGKSTT
FT                   FNMVNGQLKADQGSITLDGHELVGRKPREIWRKGVGRTFQIAETFASLTVVENVQMALL
FT                   SHDHKLFSMWRRAADHKRDEALALLDQVGMKSQADRPCSVLAYGDVKRVELAIAMANSP
FT                   KLLLMDEPTAGMAPKERNSLMALTKDLVIQRGMAVLFTEHSMDVVFAYADRMIVLARGR
FT                   LIAQGKPLEIRDHPKVQEVYFGSGKTFEKKIAEKAAALGVTTA"
FT   gene            227320..228054
FT                   /locus_tag="Varpa_0214"
FT   CDS_pept        227320..228054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0214"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0186 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34436"
FT                   /db_xref="GOA:E6V0C2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34436.1"
FT                   /translation="MSTHEPLLQAKALCAWYGAAQILYDVDLDVRRGEVVALMGRNGAG
FT                   KSTTLKALIGMLAKRRGAVRFLGHDISKSEPHHAARLGLGFVPEDRRVFTDLTVMENLE
FT                   VGKQPARQWADGTEAPLWTPERLFKLFPNLGEMPNRPGGRMSGGEQQMLTVARTLMGNP
FT                   YLVLLDEPSEGVAPVIVEQMANMILELKAQGVSILLSEQNMHFAELVSDRAYVLEKGQI
FT                   RYHATMAELSANEEVRRAYLSV"
FT   gene            228097..228822
FT                   /locus_tag="Varpa_0215"
FT   CDS_pept        228097..228822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0215"
FT                   /product="Nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="KEGG: vap:Vapar_0187 nicotinamidase; PFAM:
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34437"
FT                   /db_xref="GOA:E6V0C3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C3"
FT                   /inference="protein motif:PRIAM:3.5.1.19"
FT                   /protein_id="ADU34437.1"
FT                   /translation="MHRRIVLKSAAALGLVSGLGSFGLSAFAAGKIKPGAKAALIVVDV
FT                   QNCFLDGGTLAVKGGNEVIPVINGLAPAFENIVVTQDWHTAGHASFASTYSGKKPFETT
FT                   KLNYGTQVLWPDHCVQGTEDAALGKALKVPTAQLIIRKGFHKEMDSYSAFEEADHKTAT
FT                   GLAGYLKARGIKTVFVTGLATDFCVAWTAMDARKAGFEAYVIEDATRGIDLNGSLAAAW
FT                   KQMSAKGVKRIQSADIQTA"
FT   sig_peptide     228097..228183
FT                   /locus_tag="Varpa_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            228900..230033
FT                   /locus_tag="Varpa_0216"
FT   CDS_pept        228900..230033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0216"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0188 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34438"
FT                   /db_xref="GOA:E6V0C4"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C4"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34438.1"
FT                   /translation="MVAGGAALALGPGLLRSARAENGVTDTTIRIGQSAVFSGPAKDFG
FT                   VDYRAGIKLYFDRVNKSGGINGRKIELVTYDDAYDPAKTAVNTAKLIDEDKVFALTGFV
FT                   ATGNLAAAMPLAEKAGVPMFAPLVGTTSFRTKVNRYLFHVRAGYDLELRKIISHLSTIG
FT                   ISSIAVVFQDSPFGKSNLATCEQLAAEYKVQVVKTLPLAITAEDAKQVATEISAAKPGA
FT                   VVMIMAGRMVETFIRDYRAGGVGAPLYTLSVGITDAAGSAKRLDGKLAGLVTASIVPPP
FT                   QAQRVPIVADYQRDRAEFGEKIDSYTTLEGYIVARVMVEGLRRAGKTLTRDSFIAGLES
FT                   IGSTRFGDFPIDYSAKNHNGSTFVDLEMYTRDGQLRR"
FT   gene            230011..230511
FT                   /locus_tag="Varpa_0217"
FT   CDS_pept        230011..230511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0217"
FT                   /product="(2Fe-2S)-binding domain-containing protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain-containing protein;
FT                   ferredoxin; KEGG: vap:Vapar_0189 (2Fe-2S)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34439"
FT                   /db_xref="GOA:E6V0C5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C5"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADU34439.1"
FT                   /translation="MTASCGAEPLHLQVNGQAQSLAGVPREASLLHFLRNDLGLNGPKY
FT                   GCGLGQCGACTVHVDGVAARSCVIPAHGVAGRAITTLEGLGMRGRWHPVQAAFQEAQAA
FT                   QCGYCLNGMVMQAAALLARDPHASEARIRSELSGNLCRCGTHIEILDAVQRAAARMSAK
FT                   VNP"
FT   gene            230663..234418
FT                   /locus_tag="Varpa_0218"
FT   CDS_pept        230663..234418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0218"
FT                   /product="Aldehyde dehydrogenase
FT                   (pyrroloquinoline-quinone)., Gluconate 2-dehydrogenase
FT                   (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /EC_number="1.2.99.3"
FT                   /note="KEGG: vap:Vapar_0190 aldehyde oxidase and xanthine
FT                   dehydrogenase molybdopterin binding; PFAM: aldehyde oxidase
FT                   and xanthine dehydrogenase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34440"
FT                   /db_xref="GOA:E6V0C6"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C6"
FT                   /inference="protein motif:PRIAM:1.2.99.3,1.1.99.3"
FT                   /protein_id="ADU34440.1"
FT                   /translation="MTRRADLPQTRAEFLAADGVLLVVRETPVAPAPAKGQPAVIAGNP
FT                   IEGDEILIAVWDDGSVSALNGHVDLGTGIQTALSQIVAEELDLGMPCVRVMLGDTARVP
FT                   NQGATIASASIQIHAQPLRLAAAQARAWLLARAAERLGVAVEALQVRNGVVRVTETPDR
FT                   HVNYADLVAHQRTVLRLDPAAKLKDPADYRIVGTRQARVDIPAKLAGELVFVHDMRVPG
FT                   MLHGRVVRPPYAGADHGDFIGNTLESVDESSIAHIPGIRAVVVIRDFVGIVAEREEHAE
FT                   QALRELRVTWKAWPGMPDLSDVAQALRDNPSTQRLLVDEGDVDGAIASAAKPMQRTYVW
FT                   PYQMHASIGPSCALADWQPADGSGVQLRVWAGSQNPHVLRADLAKLMGVDDVQVDVVRM
FT                   EAAGCYGRNGADDVAADAALLARAVGKPVRVQLTREQEHAWEPKGAAQLMEVDGGLMAD
FT                   GRIAAYDFETSYPSNGAPTLALLLTRTIEPVAQAYEMGDRTARPPYSYDNLRVKVNDMA
FT                   PIVRASWLRGVSALPSSFAHESYIDELATAAGVDPVQFRLRHLNDPRAVELVQATAQKA
FT                   GWRMRTGPQENADGGLGEGGDVLFGQGFAYARYIHSKWPGFGAAWAAWVADVEVNRKTG
FT                   EVHVRCVVVGHDAGLMVNPAGVEHQVHGNVIQTTSRALMEEVKFAPQQDTPSGGAQLPG
FT                   VLPTGVVASREWGSYPIINFRDVPVIEVMHMPRPGEPSLGAGESSSVPGTAAIANAIFD
FT                   ATGVRFRAPPFTPETVLAALNREFLPPPPGAGGGEQRSNGDAAVPPSQPSPGRGRSKTD
FT                   APWPRRKGVWATGAALFIGGIGVIAGLLGWRSSIAPVSLTAPVYSESTIERGRVLAALG
FT                   DCAVCHTAPGGAPNAGGRAMDTPFGTLYTTNLTPDADTGLGRWSFSAFQRAMREGVSRD
FT                   GHHLYPAFPYTAFAKTSDDDLQALYAYFMSMPAVRAETPKSELKFPFSMRPLMAGWNAL
FT                   FHDPAPLQPVATQSAEWNRGAYLVNGLGHCGACHTPRNALGAEQGGSAFLSGAMVDGWE
FT                   APALTHLSKSAVPWDTEELYRYLRNGHTQRHGIAGGPMAEVVRELGQVPDADVRAMATY
FT                   LGSFNPAPAAEPQALAQQAVDNAARTQGQLLGPAQRMFDSACASCHHDGNGPTLLGVNT
FT                   PLALNSSLTSAHPDNLLRTILDGVREPANRDIGFMPAFREALDDRQIAELAGYMRARFA
FT                   PQEPAWTDLPAQVTRARAAKAHGAGH"
FT   gene            234537..235724
FT                   /locus_tag="Varpa_0219"
FT   CDS_pept        234537..235724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0219"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   vap:Vapar_0191 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34441"
FT                   /db_xref="GOA:E6V0C7"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C7"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADU34441.1"
FT                   /translation="MALNLSPATSLPTDADRATLVGRIWQPDVGPVLVAVHEGGLHDLS
FT                   KLAPTMSDLLEAKGSPSAAVRDALKSGKAPRIAALDAVLANSDETARDNAKPWLLAPCD
FT                   LQVIKASGVTFVASLLERVIEEQARGDASKAEATRAAIGKVLGDNLADIVPGSPEAARV
FT                   KEVLIAQGVWSQYLEVGIGPDAEIFTKAPVLAAVGTGADVGIHSGSVWNNPEPEVVLAV
FT                   NSRGETLGAALGNDVNLRDFEGRSALLLGKAKDNNASCAIGPFIRLFDEHFGIADVRRI
FT                   TVGLQVTGPEGFVLEGSSSLTKISRDPLDIVSQAVGIHHDYPDGFMLFLGTMFAPTQDR
FT                   HGPGQGFTHVVGDHVRVGAPELGALFNRVVYADQAPRWTFGLSALMRNLGARGLL"
FT   gene            complement(235749..237290)
FT                   /locus_tag="Varpa_0220"
FT   CDS_pept        complement(235749..237290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0220"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: vap:Vapar_0216 Mg chelatase,
FT                   subunit ChlI; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34442"
FT                   /db_xref="GOA:E6V178"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V178"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ADU34442.1"
FT                   /translation="MSLSLVQSRALLGLEAADVTVEVHLANGLPSFTLVGLAETEVKES
FT                   RDRVRSAIQNAGLEFPNNKKIVVSLAPADLPKDSGRFDLPIALGILAASGQFQGTRLAG
FT                   HEFAGELSLSGELRPVRGALAMALALHTRGVATKLVLPMDSAQEAALVPGGEVYGARHL
FT                   LDVVRQFLPEEDKAAAPEPSDDGWARIYVTPGVAASQYADLAEVKGHVGAKRALEIAAA
FT                   GGHSLLMVGEPGSGKSMLAQRFAGLLPAMSIDEALESAAVASLGGRFATERWMCRPTSA
FT                   PHHTSSAVALVGGGSPPRPGEISRAHHGVLFLDEFPEFARSALEALREPLETGTITIVR
FT                   AARRAEFPARFQLIAAMNPCPCGYLGSSLKSCRCTPDQVSRYQGKLSGPLLDRIDLHIE
FT                   VPAVSAEQLLNSPPGESTESIRSRVVAARERAMQRQGHANQNLQGSAIDKHAELDATAL
FT                   KFIYNAAAKLGWSARSTHRALKVARTIADLASSETVQVMHVAEAVQYRRGLHGVV"
FT   gene            237513..238382
FT                   /locus_tag="Varpa_0221"
FT   CDS_pept        237513..238382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0221"
FT                   /product="Conserved hypothetical protein CHP02001"
FT                   /note="PFAM: Conserved hypothetical protein CHP02001; KEGG:
FT                   vap:Vapar_0217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34443"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:E6V179"
FT                   /inference="protein motif:PFAM:PF09694"
FT                   /protein_id="ADU34443.1"
FT                   /translation="MTHRSAVQALIVLATALTASGAALAQTAPADPAPAPAPSLTGNIS
FT                   LTTNYKFRGQDQDMIGRNDYAKTRGLKPAIQGGFDYAFGDSGFYVGNWNSSVNWLKGNS
FT                   IETDLYGGYKFKAGPVDMDVGALTYIYPGNSAGNTTELYLGATYADETFGSFTAKYSHT
FT                   VSKDYFGYAGNKAGSGLKGRNTGYLNLAYSKEIVPKVTLKAAVGFTNMSSDIRSLGYKS
FT                   YVDYNVGASYDFGNGLSLTGSVQGANKKANYQVVANPGLEIPDFGTFGTTYYSPNKARF
FT                   ILTLTKTL"
FT   sig_peptide     237513..237590
FT                   /locus_tag="Varpa_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            238449..238787
FT                   /locus_tag="Varpa_0222"
FT   CDS_pept        238449..238787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0222"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   vap:Vapar_0218 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34444"
FT                   /db_xref="GOA:E6V180"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E6V180"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADU34444.1"
FT                   /translation="MKLVTAIIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVSDDLVDRVIEAVEGAARTGKIGDGKIFVYNLEQVVRIRT
FT                   GETGREAL"
FT   gene            239062..240360
FT                   /locus_tag="Varpa_0223"
FT   CDS_pept        239062..240360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0223"
FT                   /product="ammonium transporter"
FT                   /note="KEGG: vap:Vapar_0219 ammonium transporter; TIGRFAM:
FT                   ammonium transporter; PFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34445"
FT                   /db_xref="GOA:E6V181"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:E6V181"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ADU34445.1"
FT                   /translation="MMLSTLLVIMMTIPGLALFYGGLVRSKNMLSVLMQVMVTFSLIVV
FT                   LWLIYGYSLAFTEGNAFIGGFDRLFMKGIFDPATGVFAAGATFSKGVYIPELLFAAFQA
FT                   TFAGITCCLIVGAFAERAKFSAVLLFMVIWFTFSYAPLAHMVWFWMGPDAYTAANVVDA
FT                   QNAKAGLIWQWGALDFAGGTVVHINAAVAGLVGAFLIGKRVGYGKEAFTPHSLTLTMVG
FT                   ASLLWVGWFGFNAGSALEAGTSAVLAFMNTFSATAAAVLAWCIGEALMRGKASMLGAAS
FT                   GAVAGLVAITPAAGNVGLMGAIVIGFIAGFACLWGVNGLKKLLGADDSLDVFGVHGVGG
FT                   IVGALLTGVFNTQALGGPGLVGDWVTASVVSNGIGAQVWIQLKGVLLTIVWSGVVAFIA
FT                   FKIADLTIGLRVSEEEEREGLDISSHGETAYNR"
FT   gene            240550..241482
FT                   /locus_tag="Varpa_0224"
FT   CDS_pept        240550..241482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0224"
FT                   /product="SMP-30/Gluconolaconase/LRE-like region-containing
FT                   protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE-like
FT                   region-containing protein; KEGG: vap:Vapar_0220
FT                   SMP-30/gluconolaconase/LRE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34446"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:E6V182"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADU34446.1"
FT                   /translation="MWTSLDNSLCELGESPFWHPEERSLYWLDIPGRAVLRTRGDIGTT
FT                   SATVERWALSTEPGCMAPARSGGLVIALRDGIYRAREWGGELVAMARVEHDVRTMRFND
FT                   GKCDPLGRFWGGSLNEAKDRANAALYCFDARPGTDISPTLSQMANESTTANGLSFSPDA
FT                   RTLYWADTAAHVVCAWDWDAEANALSRARVFHQFDAKPEGWTPDSPVRYEGRPDGATVD
FT                   AEGHYWVAMFEGAQLLRFAPSGEIVASVPVPLQCPTMPCFGGDDLKTLFVTSGRKGRPA
FT                   AEIERLPASGTVISTRVDTPGLPVSFFED"
FT   gene            241725..242654
FT                   /locus_tag="Varpa_0225"
FT   CDS_pept        241725..242654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0225"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0221 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34447"
FT                   /db_xref="GOA:E6V183"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V183"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34447.1"
FT                   /translation="MACARALNRSPERKNQVALQHIPPIQCLLTFEAVARLRHAGRAAD
FT                   ELCVTPSAVSHRIRQLEAHVGFKLFGRSDFSLTADGAAYLANVRTGLAALQATPLANAA
FT                   PRATRLRIAVTPTFSRQFLMPRLELFRNIYPDIELVLQVSIPLLDVTAEQADLEVRYGT
FT                   GAYADCEHRLLLEEEVVPACSPSFLNEFGPFDGFRTAAEIASARLIRSPLEPWGTWFAH
FT                   CGIDQPEPHVGSQFNDLGLVYDAAASGFGVALVRQKMGAAWFESGRLVALSDRAVPSPH
FT                   RHTICWQPGTLERWECAAFVDWLAQSLR"
FT   gene            242785..244287
FT                   /locus_tag="Varpa_0226"
FT   CDS_pept        242785..244287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0226"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   vap:Vapar_0222 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34448"
FT                   /db_xref="GOA:E6V184"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6V184"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADU34448.1"
FT                   /translation="MNAPLTAVQQDSLQKTERQSQVVRALQVHLPAHALIWHAEDTTPY
FT                   ECDGLTAYRQRPLVVALPETEAQVAAVLKTCHQLGVPVVARGAGTGLSGGAMPHALGVT
FT                   LSLAKFNRILKIDPVSRTAVVQCGVRNLAISEAAAPFNLYYAPDPSSQIACTIGGNVAE
FT                   NSGGVHCLKYGLTLHNVLRVRGFTAEGDAIEFGGEALDAPGLDLLALVIGSEGMLAVTT
FT                   EVTVKLVPKPQLARCIMASFDDVRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAVEDFVR
FT                   AGYDLDAAAILLCESDGTPEEVEEEIGRMTAVLRGCGATAIAVSNSEEERMKFWSGRKN
FT                   AFPASGRISPDYMCLDSTIPRKRLADILLAIQEMEKKYNLRCCNVFHAGDGNLHPLVLF
FT                   DANDPDELHRCELFGADILETSVAMGGTVSGEHGVGVEKLNSMCVQFTAAENEQMFGVK
FT                   RAFDPAGLLNPGKVIPTLQRCAEYGKQVVRGGKLPHPDLPRF"
FT   gene            244309..245400
FT                   /locus_tag="Varpa_0227"
FT   CDS_pept        244309..245400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0227"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   vap:Vapar_0223 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34449"
FT                   /db_xref="GOA:E6V185"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6V185"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADU34449.1"
FT                   /translation="MDSALHQIVERIRAATANATPLCIRGGGTKDFYGEALQGDILDTT
FT                   ALTGITSYEPSELVVTVRAGTPLAELEAALAEKGQCLPFEPPHFGSDGTVGGMVAAGLS
FT                   GPARASVGAVRDYVLGATLVNGRGDVLSFGGQVMKNVAGYDVSRVLAGSLGTLGVIAEV
FT                   SLKVLPVAPAEATLEFACSQADALRLLNEWGGRPLPLNASCWFEYAGAGALYLRLRGAV
FT                   AAVEAACTHLGGERKDNARAAADWQALRDQQLPWFDVASGPDALWRLSVPQTAPVLAID
FT                   GNAPLIEWHGGERWYKALPDQAARIREAAHAAGGHATLFRTPASNIPRFDAMSAPIARI
FT                   HRALMQEFDPHRIFNRGRLFADA"
FT   gene            245421..246674
FT                   /locus_tag="Varpa_0228"
FT   CDS_pept        245421..246674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0228"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: vap:Vapar_0224
FT                   glycolate oxidase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34450"
FT                   /db_xref="GOA:E6V186"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6V186"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADU34450.1"
FT                   /translation="MQTELAPEFRDTDEGREAEAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGKAPTRSTQLHLDRCLTCRNCESTCPSGVQYGNLVDIGRKIVDE
FT                   KVPRPAMESAKRWLLKEGLPSPLFGPAMKLAQSVRGLLPDALKAKVPAKQEAGAWPTAT
FT                   HARKVLMLAGCVQPSMMPNINSATARVLDAAGIQVVIAKEAGCCGAVKFHLNDQEGGKA
FT                   QMRANIDAWWPEVERNEVEAIVMNASGCGVTVREYGHLLQHDAAYAAKAARISELTRDL
FT                   SELLPDLLPALKARVRAPEGVVAYHPPCTLQHGQKLRGGVETHLRALGFDVRVAMNESH
FT                   LCCGSAGTYSVLQPELAYPLRDRKLGHLKQLQPTTIASANIGCITHLQSGSGETPVRHW
FT                   VELLDAALDRRPGAQGRA"
FT   gene            246764..247189
FT                   /locus_tag="Varpa_0229"
FT   CDS_pept        246764..247189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34451"
FT                   /db_xref="UniProtKB/TrEMBL:E6V187"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0225"
FT                   /protein_id="ADU34451.1"
FT                   /translation="MSHVIQLPLRRVLLACACVAGAVAAHAQSAMPAWQGAGPTRYVCG
FT                   GIGSDESNAMRGAMKEHPLSLLFARADGAYMASVDVTIKGGDTNSSAAMAFRAGGPVCL
FT                   IDIPDGRYTIDVTTPGGQAKSQTVTVGGGAKTASFRF"
FT   sig_peptide     246764..246847
FT                   /locus_tag="Varpa_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 28"
FT   gene            complement(247210..247698)
FT                   /locus_tag="Varpa_0230"
FT   CDS_pept        complement(247210..247698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0230"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: vap:Vapar_0226 peroxiredoxin; PFAM:
FT                   glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34452"
FT                   /db_xref="GOA:E6V188"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6V188"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADU34452.1"
FT                   /translation="MTSVYDFEANQIDGKPVKLSAFKGKVLLIVNTASKCGFTPQFAGL
FT                   EALHEKYADQGLAVLGFPSNQFGSQDPGTNEEIGAFCTKNYGVSFPMMEKIDVNGSNAA
FT                   PLYQWLTKEKPGLLGLTAIKWNFTKFLIGRDGTVLKRYAPLDTPASLTRDVEAALAAG"
FT   gene            complement(247710..248600)
FT                   /locus_tag="Varpa_0231"
FT   CDS_pept        complement(247710..248600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0231"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: vap:Vapar_0227 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34453"
FT                   /db_xref="GOA:E6V189"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6V189"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU34453.1"
FT                   /translation="MPALALIFNAFVWGLSWFPFRHIESHGLHPLWTTCLIYLAIATVM
FT                   GIVRRHAWKSFTAYPMLAVLGLAAGFTNVGFNWAVTQGDVVRVVLLFYLMPLWSVLLGW
FT                   LLLGERPTGGALARVALALTGVVVVLKAPGTDWPVPSSLPDWLGLAAGFSFAVTNIVLR
FT                   HLRPAPGESRALAMFCGCTFVAGIAALVGTSLGAIASPLQATPGWLGWAVLLGAGFVIG
FT                   NVCLQYGAARLAASATSVIMLSEVLFASVSSVALGASTMDPRILTGGALIVLGAVWAAF
FT                   ARTPARGDDRASAST"
FT   gene            complement(248671..249975)
FT                   /locus_tag="Varpa_0232"
FT   CDS_pept        complement(248671..249975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0232"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_0228 lysophospholipid transporter LplT"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34454"
FT                   /db_xref="GOA:E6V190"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V190"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU34454.1"
FT                   /translation="MKRGFYTIMSAQFFSSLADQALFVVAVDLMRSSGAPEWQRAALVP
FT                   IFAVFYVVLAPLVGAFADALPKGKVMFISNAIKVIGCLMMLFGSHPLLSYSIVGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTIASILLGIVLGGTLVGHAVSSHLLAFDFPL
FT                   IDTGIDSPAEAAISVLILVYMLAAWFNTRIPHTGVEMRPLRSNPEHGFARNLAALLPDF
FT                   WHCNARLWRDRLGQISLATTTLFWGAGGNLKYIVLAWASLALGYNTTQASALTGVVTIG
FT                   TAVGAIVASMRMRLDMATRVIPMGIAMGLMVICMNFIGNVWLAVPFLIILGGLGGFLVV
FT                   PMNALLQHRGHNLMGAGRSIAVQNFNEQACILLLGGFYSVCTGLGLSAYGAISAFGLVV
FT                   AGCMWLIKRWHENNLKKYPEEVEHLLAIARSDKHH"
FT   gene            250169..251269
FT                   /locus_tag="Varpa_0233"
FT   CDS_pept        250169..251269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0233"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; KEGG: vap:Vapar_0229
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34455"
FT                   /db_xref="GOA:E6V191"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E6V191"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADU34455.1"
FT                   /translation="MPRPILATVHTAALRNNLERVRRSALDARVWAVVKANAYGHGIER
FT                   VYEGLRGADGFALLDLAEAERVRALGWRGPVLLLEGVFDARDLELCSRLDLWHTVHCDE
FT                   QIDMLAAHKTLKPQRVFLKMNSGMNRLGFTPERFGSAWTRLNALTQVDEISLMTHFSDA
FT                   DGARGIAHQLEAFERATRDLPGERSIANSAATLRHADQTRGDWVRPGIVLYGSAPDFPL
FT                   HDAAHWQLQPTMTLSTQLLSVQTLKAGDTIGYGSNFTAEGPLTIGVAAVGYADGYPRHC
FT                   NTGTPVLVNGVRTRMVGRVSMDMITVDLTPVPDAKFGAEVTLWGRSASTGAVLPIDEVA
FT                   QAAGTVGYELMCAVAQRVPFAAPTDE"
FT   gene            251266..252015
FT                   /locus_tag="Varpa_0234"
FT   CDS_pept        251266..252015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34456"
FT                   /db_xref="GOA:E6V192"
FT                   /db_xref="UniProtKB/TrEMBL:E6V192"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0230"
FT                   /protein_id="ADU34456.1"
FT                   /translation="MKILSNWRSVRLWETEVERDLHRNHSLRTHGILIGTFTLLLMWGV
FT                   SALQMHLLHVDSLAVRYFLTLGVGYLGYLLVLRWWARRLVEDGVGANLDMGAGDAVDAG
FT                   EFALDVAGSVGRASRASGVGDAADMAGGALELAGASDEGAIIVVPVVAIFLICVAVLFG
FT                   VGSLVLLYFSWDALLAVAIEVAFSYVSARAAVRVAREGWLMAAVRLTWKPLLGALISAV
FT                   ILGALLDHFMPQVNSLPEAVRVLLKTN"
FT   gene            complement(251969..252943)
FT                   /locus_tag="Varpa_0235"
FT   CDS_pept        complement(251969..252943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0235"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0231 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34457"
FT                   /db_xref="GOA:E6V193"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V193"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34457.1"
FT                   /translation="MGTNSFLKVLPEMVTFLRVAELGSFSAAADLLGMTPSAASRQVKR
FT                   LEKEIGVQLLQRTTRQLRLTEPGAEAFARCRELVAVAQGAMDIAQRFSKKPSGLVRISA
FT                   PKAFARRVLHPHILDFLRRYPEVDVQLIVQDRNIDPIREGVDLVVRLTTEPPEGLVARQ
FT                   LMPVAHILCASPRYLEQHEAIAHPRGLVAHSCLSLGEHERDNHWRFRQGDAEEAEVVVR
FT                   GRYVSNHSEVRLEAALADLGVACVPAFMTQEALESGRVVQVLAGWEFQGNYRGHAWILY
FT                   PPSRFTVPKCRVLIDHLLDALATGPEKKLSSSSARRGPPRAAS"
FT   gene            253037..253987
FT                   /locus_tag="Varpa_0236"
FT   CDS_pept        253037..253987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0236"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: vap:Vapar_0232 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34458"
FT                   /db_xref="GOA:E6V194"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6V194"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU34458.1"
FT                   /translation="MDSKQVRGIAPDTWGARKWAGIGAAEVMLLLVAAVWGGSYAVAKQ
FT                   ATQQLPVMEFIALRFGLTFIVLLPALKPLFNAQWRQGLAVGGLLGANLLAIFVCETFGV
FT                   SLTTASNAAFLISLCVALTPFVEWWLLGQRPAQRIFWAAGLSAVGAAMLSATSPANIAV
FT                   GWGDALMVLAAFLRAVMVCMTRRLAGHHAMPALTLTAVQSGVMALGAMAISLLASNGAW
FT                   HMPPATASFWWGMAYLVLLCTVFAFFAQNHAASRSSPSRVSLLMGSEPVFGALIAVYGF
FT                   GETVGVWGWAGGLLIVAAAWWVTMPQKLEARPRIP"
FT   gene            complement(254203..255180)
FT                   /locus_tag="Varpa_0237"
FT   CDS_pept        complement(254203..255180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0237"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="TIGRFAM: 2-dehydropantoate 2-reductase; KEGG:
FT                   vap:Vapar_0234 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34459"
FT                   /db_xref="GOA:E6V195"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V195"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ADU34459.1"
FT                   /translation="MKICIYGAGAIGGWIGAGLAQAGERLNVVARGATLDVLQRDGLSL
FT                   MRADVRTRVPVNAVADPDALGVQDLVVIAVKAPALAAVAERIGPLIGPDTIVLVAMNGV
FT                   PWWFLEGGFGGEITGRRLAAVDPDGAIAKAIPARNVIGCVVHASCSLDGPGVVRHHFGN
FT                   GLIVGEPSGEATPRVQALVELLTRAGINTTLSPQIQKDVWFKLWGNMTVNPISALTGAT
FT                   TDLIMGDDYVRGFISAVMLEAKEIGRRIGIEITQSPEDRHEVTKKLGAFKTSMLQDVEA
FT                   GRSVELDALVTVVRELGELTGVATPFTDALLGLARLRTRQLGLY"
FT   sig_peptide     complement(255112..255180)
FT                   /locus_tag="Varpa_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.794 at
FT                   residue 23"
FT   gene            complement(255203..255994)
FT                   /locus_tag="Varpa_0238"
FT   CDS_pept        complement(255203..255994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0238"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: vap:Vapar_0235 aldolase II superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34460"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E6V196"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADU34460.1"
FT                   /translation="MNTSLATSPSALVHPSIHPDERAAREELAACYRVFAMLGWVEMIY
FT                   NHITVRLPDSVTGGEKQFLINPFGLHYSEVTASNLVKIDLQGKVLDGSSYPVNPAGFTV
FT                   HAAIHDGLPGAHCVMHTHTTAGVAVACLEGGLRQTNFYTAQLHGMVAYHDFEGITIHAD
FT                   EGPRLLQSIGNRNAVILRNHGLLAWGQTLPQTFAILWTLQRACEIQMATFSMGAAIPVS
FT                   EEIAERCTRDALQFSPAHGAGQDVFNALVRQVDRIDPSYRN"
FT   gene            complement(256013..257002)
FT                   /locus_tag="Varpa_0239"
FT   CDS_pept        complement(256013..257002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34461"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V197"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0236"
FT                   /protein_id="ADU34461.1"
FT                   /translation="MSFTRRQILQTTGASALLASIGQQAYAQAGIETATIVTGFAAGGT
FT                   SDTICRRLAQKLSPEYAKAAVVENRTGAGGQIAVTYVKGRPADGVTILQTPTSILTIYP
FT                   HIYKKLPYDPMVDLTPVSIGCIFDFGFAVGPSVPASVKSVPEFLAWAKANPAGANFGSP
FT                   AAGSTPHFIGALLGKKGDVELKHAAYRGTQPAMLDLLGGNISAVSGPIGDITQHLQSGK
FT                   VRILGVSGAKRNRFAPDVPTFGEQGIKDMAHSEWFAFFLPAKASPELVARLNTAMKNAL
FT                   AQKDVIDGLGTFGLEAMSSTPAELTELLKKDTAKWAPIVKEVGFTAEG"
FT   sig_peptide     complement(256919..257002)
FT                   /locus_tag="Varpa_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.943 at
FT                   residue 28"
FT   gene            complement(257133..257603)
FT                   /locus_tag="Varpa_0240"
FT   CDS_pept        complement(257133..257603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0240"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   vap:Vapar_0238 protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34462"
FT                   /db_xref="GOA:E6V198"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E6V198"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ADU34462.1"
FT                   /translation="MMKRMILAAAFATATLFLAACAQPGGSPTAQARQEANRQTVLAFY
FT                   EKGLNQKDADAALQYVGNRYVQHNPTAADGPEGFRKFIAFLREKFPNSRSEIKRSFVDG
FT                   DYVILHVNAVREPGTRGNAIVDIFKLENGKIVEHWDVVQPVPETAANKNGMF"
FT   sig_peptide     complement(257535..257603)
FT                   /locus_tag="Varpa_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.778 at
FT                   residue 23"
FT   gene            complement(257629..258459)
FT                   /locus_tag="Varpa_0241"
FT   CDS_pept        complement(257629..258459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0241"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /EC_number="4.1.3.39"
FT                   /note="TIGRFAM: 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase; KEGG: vap:Vapar_0239
FT                   2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; PFAM:
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34463"
FT                   /db_xref="GOA:E6V199"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR012689"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E6V199"
FT                   /inference="protein motif:TFAM:TIGR02311"
FT                   /protein_id="ADU34463.1"
FT                   /translation="MHTPINTFKQAMLAGEQKIGLWVGLADGYVAEILAGCGYDWLLVD
FT                   GEHAPNDVRSVLGQLQGISSAWSAQPESERSHPVVRIPTGDTTLIKQYLDIGAQTLLVP
FT                   MVDTAEQAARMVQGMRYPPEGIRGMGSALARASRWQAYPQYLHEANAQTCLLVQAETVE
FT                   AMKNLDAIAATPGVDGVFIGPADLSASMGFVGQPNHPEVQAVIADAIARILKAGKAPGI
FT                   LSTTEEQARKWLAAGALFVAVGVDTIVLTAAAKQLAAKYKNAAGAASGAVPNGY"
FT   gene            complement(258473..259276)
FT                   /locus_tag="Varpa_0242"
FT   CDS_pept        complement(258473..259276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0242"
FT                   /product="2-oxo-hepta-3-ene-1,7-dioic acid hydratase"
FT                   /EC_number="4.2.1.80"
FT                   /note="TIGRFAM: 2-oxo-hepta-3-ene-1,7-dioic acid hydratase;
FT                   KEGG: vap:Vapar_0240 2-oxo-hepta-3-ene-1,7-dioic acid
FT                   hydratase; PFAM: fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34464"
FT                   /db_xref="GOA:E6V1A0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012690"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A0"
FT                   /inference="protein motif:TFAM:TIGR02312"
FT                   /protein_id="ADU34464.1"
FT                   /translation="MLSSDTIAKLAAELHESEKSRVQVEHFSKRFPEMTVEDGYAVSRA
FT                   WVKHKIAEGRTVKGHKIGLTSRAMQQSSQIDEPDYGTLLDDMFFAQGGDIPFTRFIAPR
FT                   IEVELAFILGRTLQGPGVTIFDVLAATDYVVPAIEIIDARIEQFDRHTKAPRKVFDTIS
FT                   DNAANAGIVMGGRPVKPDAVDLRWVSALLYKNGVIEETGVAAGVLNHPATGVAWLANKL
FT                   APWDERLEAGEVVLAGSFTRPTTALPGDTFHADYGPLGAISFRLV"
FT   gene            complement(259289..259696)
FT                   /locus_tag="Varpa_0243"
FT   CDS_pept        complement(259289..259696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0243"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /note="PFAM: 5-carboxymethyl-2-hydroxymuconate isomerase;
FT                   KEGG: vap:Vapar_0241 5-carboxymethyl-2-hydroxymuconate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34465"
FT                   /db_xref="GOA:E6V1A1"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A1"
FT                   /inference="protein motif:PFAM:PF02962"
FT                   /protein_id="ADU34465.1"
FT                   /translation="MPHLVILYTPNIEAETDMSALCRTLADTMLKQRDEADKPVFPIGG
FT                   TRVLAYPAAHYAVADGKADYAFVYLNIRMAAGRSEAVKKKAGDELLADVRAHFAPIFDQ
FT                   RHIGITLQIDESPGQVYDGKHSNLHPLFNKT"
FT   gene            complement(259711..260538)
FT                   /locus_tag="Varpa_0244"
FT   CDS_pept        complement(259711..260538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0244"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: dac:Daci_0103 extradiol
FT                   ring-cleavage dioxygenase class III protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34466"
FT                   /db_xref="GOA:E6V1A2"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A2"
FT                   /inference="protein motif:PFAM:PF02900"
FT                   /protein_id="ADU34466.1"
FT                   /translation="MSLVFAGVCSHAPGITGRAHLADPAVKDEFHAQFHRFGEAMRATK
FT                   PDAVIVIAAEHFANFFMNNMPAYAIGMADSYEGPIEDPKWLGIEKTKVPGDAALSQRLI
FT                   REVMQTVDVAYAEEWKFDHGIMVPLHFLTPAFDTKVIPVNINCQGPPLTPLHRAWAFGE
FT                   ALRRACDNAPERIALVGTGGISHWPATPDSGKVNAEWDAEFMRRWCANDREALLSQDDY
FT                   NDEATYREAGQGGFEIRTFLSVAAAARGKGEIFHMKAIPIFAVTCTAAVMSVA"
FT   gene            complement(260535..260870)
FT                   /locus_tag="Varpa_0245"
FT   CDS_pept        complement(260535..260870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0245"
FT                   /product="Extradiol ring-cleavage dioxygenase LigAB LigA
FT                   subunit"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase LigAB LigA
FT                   subunit; KEGG: dac:Daci_0104 extradiol ring-cleavage
FT                   dioxygenase LigAB LigA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34467"
FT                   /db_xref="GOA:E6V1A3"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A3"
FT                   /inference="protein motif:PFAM:PF07746"
FT                   /protein_id="ADU34467.1"
FT                   /translation="MSLYAMQKFLFALNREAEVQRRYLDGGDARAALLCAYDFNDEERE
FT                   AIATGDIGKLYVLGCNGQLLMHFAPLLGIAWADYLEAMREGVRKYGPVRAGIYAMTTGT
FT                   NEKVAGV"
FT   gene            complement(260877..261860)
FT                   /locus_tag="Varpa_0246"
FT   CDS_pept        complement(260877..261860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_0105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34468"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A4"
FT                   /inference="similar to AA sequence:KEGG:Daci_0105"
FT                   /protein_id="ADU34468.1"
FT                   /translation="MNTSRRALLQGAAALAALPSLAPFAHARGDWPNKPVRIVVPFPPG
FT                   GTTDFVARLMAVELGKTLDQAVIVENKPGAGTVIGVDSVAKSAPDGYSFVCVANSFTAN
FT                   QTLVRKLPYDTQKDLRPVALMGMSEHVLATHPSSGLKTLADLRNQAKAKPGTLSFASFG
FT                   NGTSAHLSGEQLKLQMGLDIVHVPYKGQGPALTDLLGGQVTMMFGNWPEFRGQIQSGKL
FT                   VALGMATAQRSQYAPAIPTLAEQGVAIESNSWNGLLAPAGTPDAIVLRMNDEVNRALAG
FT                   PAVTEAFRKGGIASLSGTPERFAAFIQSEIAKYGDVIRKANIQIEG"
FT   sig_peptide     complement(261777..261860)
FT                   /locus_tag="Varpa_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.844 at
FT                   residue 28"
FT   gene            complement(261857..263323)
FT                   /locus_tag="Varpa_0247"
FT   CDS_pept        complement(261857..263323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0247"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /note="KEGG: vap:Vapar_0243
FT                   5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase; TIGRFAM: 5-carboxymethyl-2-hydroxymuconate
FT                   semialdehyde dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34469"
FT                   /db_xref="GOA:E6V1A5"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A5"
FT                   /inference="protein motif:TFAM:TIGR02299"
FT                   /protein_id="ADU34469.1"
FT                   /translation="MQQINHLIGGKSVTGKDYFETVNPATQEVLAEVASGGEAEVNAAV
FT                   AAAKEAFPKWAGMPAPERAKLIRKLGDLIAAHVPEIAQTETNDCGQVIAQTGKQLIPRA
FT                   ADNFYYFAEMCTRVDGHTYPTPTHLNYTLFHPVGVCALISPWNVPFMTATWKVAPCLAF
FT                   GNTAVLKMSELSPLTAARLGELALEAGIPPGVLNLVHGYGKEAGEPLVAHPDVRAISFT
FT                   GSTATGNRIVKSAGLKKFSMELGGKSPFVIFEDADLDRALDAAVFMIFSNNGERCTAGS
FT                   RILVQQSIYADFAAKFAERAKRITVGDPLDEKTIVGPMISQAHLAKVRSYIELGPKEGA
FT                   TLLCGGLDAPSNLPDRVQRGNYVMPTVFADVDNRMKIAQEEIFGPVACLIPFKDEADAI
FT                   RLANDIQYGLSSYVWTENIGKAHRVAAAVEAGMCFVNSQNVRDLRQPFGGTKASGTGRE
FT                   GGTWSYEVFCEPKNVAVSMGSHHIPHWGVA"
FT   gene            complement(263341..264327)
FT                   /locus_tag="Varpa_0248"
FT   CDS_pept        complement(263341..264327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34470"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A6"
FT                   /inference="similar to AA sequence:KEGG:Bpro_3347"
FT                   /protein_id="ADU34470.1"
FT                   /translation="MNARKKTLAVALVALTASMLAPDAPAQTAAYPTKPVRWVVGYPAG
FT                   GGTDFLARTVGAQVSQQIGQPVLVDNKPGAGAIIASENVARAPGDGYTVFSADNGVLVY
FT                   NPALYKKLPYDAEKDFALVGMMGRSPLVITAAPNAGVADAKALIAALKASPGKFSIATP
FT                   GTGSPHHLALELFQREAGVSMLHVPYKGGAPALQDLMGGQVPLMMLDLPSGVSAVKAGK
FT                   VIPLLAMSAERIPQLPNVPTAKELGYANVEAYTWQGLVTPAATPKEVQAKLGTELQKAM
FT                   GDAGVKQKLYDAGWEARPADATEMTRYADAERKKWHALIKARDIKLD"
FT   sig_peptide     complement(264241..264327)
FT                   /locus_tag="Varpa_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.501 at
FT                   residue 29"
FT   gene            complement(264371..265141)
FT                   /locus_tag="Varpa_0249"
FT   CDS_pept        complement(264371..265141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0249"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit"
FT                   /note="KEGG: vap:Vapar_0244 4-hydroxyphenylacetate
FT                   degradation bifunctional isomerase/decarboxylase,HpaG2
FT                   subunit; TIGRFAM: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase,HpaG2 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34471"
FT                   /db_xref="GOA:E6V1A7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012684"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A7"
FT                   /inference="protein motif:TFAM:TIGR02303"
FT                   /protein_id="ADU34471.1"
FT                   /translation="MKHARVIHEGREHTGIAHEFNGQPDAAVRLEDGRVVPQEQLTWLP
FT                   PLAPTARPRTILALGLNYADHAKELEFKAPEEPLVFVKGQSTLIGHRQLTHRPAGVQFM
FT                   HYECELAIVVGKTARHVKRDDAYDFIGGYTVANDYAIRDYLENWYRPNLRVKNRDTCTP
FT                   LGPWFVDAADVSDPMALALRTTVNGTVTQQGNTRDMIFDAPFLIEYFSRFMTLSPGDLI
FT                   LTGTPDGVVDCEPGDVIVTDIEHIGALINTIDAA"
FT   gene            complement(265138..265773)
FT                   /locus_tag="Varpa_0250"
FT   CDS_pept        complement(265138..265773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0250"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   vap:Vapar_0245 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34472"
FT                   /db_xref="GOA:E6V1A8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A8"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADU34472.1"
FT                   /translation="MSTPHFLPMGTVYGTLLNFRAEVEALAPQMTQLPYKAPPKAPVLY
FT                   VKTANTWSTHGSAIAVPSSVPEVEIGASIGMVIGAEGDIEGFVLMNDLSIPHASFFRPP
FT                   VKFKCLDGFLGIGPAMRDAQEVADPANFRAEVRINGELKQSIDFSQLVRPAQQLLADVG
FT                   EFMTLAHGDVLLLGCDAGRPLARAGDRIEISAPGFETLINTLVQETAA"
FT   gene            complement(265770..266204)
FT                   /locus_tag="Varpa_0251"
FT   CDS_pept        complement(265770..266204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0251"
FT                   /product="homoprotocatechuate degradation operon regulator,
FT                   HpaR"
FT                   /note="TIGRFAM: homoprotocatechuate degradation operon
FT                   regulator, HpaR; PFAM: regulatory protein MarR; KEGG:
FT                   vap:Vapar_0246 transcriptional regulator, MarR family;
FT                   SMART: regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34473"
FT                   /db_xref="GOA:E6V1A9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A9"
FT                   /inference="protein motif:TFAM:TIGR02337"
FT                   /protein_id="ADU34473.1"
FT                   /translation="MSTTFTHRNLPRLLLQAREAVMAHTRPSLREHALSDQQWRVLRVL
FT                   GEHGAVDTGRVAREAFILGPSLTGVLARMERDNLITRARDPADQRRTVVEATPHGMKLV
FT                   KRLGTSIEAHYDWMEKSLGKAKLTQLYGLLDELIALEQPS"
FT   gene            266307..267695
FT                   /locus_tag="Varpa_0252"
FT   CDS_pept        266307..267695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0252"
FT                   /product="DNA repair protein RadA"
FT                   /note="KEGG: vap:Vapar_0251 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34474"
FT                   /db_xref="GOA:E6V1B0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B0"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADU34474.1"
FT                   /translation="MAKDKTTFVCSECGGTSPKWLGKCPSCGAWNTLIEQVAGSNAPAN
FT                   NRFGTQFSPLAGVSELATLSEIEATDIARTPTGIDELDRVLGGGIVSGGVTLIGGDPGI
FT                   GKSTLLLQAVDALQRAGQNALYVTGEESGAQVALRSRRLGLDHSQVQVLAEIQLEKIIA
FT                   TLDATRPAIAVIDSIQTVYSDQLTSAPGSVAQVRECAAHLTRFAKTSGTAVVLVGHVTK
FT                   EGALAGPRVLEHMVDTVLYFEGDTHSSFRLVRAIKNRFGAVNEIGVFAMTERGLKGVAN
FT                   PSAIFLSQHAEPVPGSVVLVTLEGTRPMLVEIQALVDNGGPSPRRLSVGLDRDRLAMLL
FT                   AVLHRHAGVACMDQDVFVNAVGGVRISEPAADLAVMLAITSSLRGKPLPKGFIAFGEVG
FT                   LAGEVRPAPRGQERLREAAKLGFSIAVVPKANAPRKGSKEIEGLTIHPVERIEEAMDVV
FT                   RRLD"
FT   gene            complement(267753..268208)
FT                   /locus_tag="Varpa_0253"
FT   CDS_pept        complement(267753..268208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ncr:NCU02768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34475"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B1"
FT                   /inference="similar to AA sequence:KEGG:NCU02768"
FT                   /protein_id="ADU34475.1"
FT                   /translation="MNISRSATIVRLTLAATLTAAALSGCYVVPIAQPAPAAPPSQAYA
FT                   VAPGPIAQSFSARLYPSNAEAARYGTVAGTVTNDMNGRGHFNAQIGGEQFQGEATRVAG
FT                   SRGAGVANASGNRGGNLSCQYTMNSATLGSGQCVLNSGPAFTMHIGG"
FT   sig_peptide     complement(268110..268208)
FT                   /locus_tag="Varpa_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.477 at
FT                   residue 33"
FT   gene            268403..268831
FT                   /locus_tag="Varpa_0254"
FT   CDS_pept        268403..268831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34476"
FT                   /db_xref="GOA:E6V1B2"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B2"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0252"
FT                   /protein_id="ADU34476.1"
FT                   /translation="MRAMNFQKLLVPVGGIVLLGLAWRSYGWAGVALTGGVIVMFLLLH
FT                   FNRAMQVLKRAADRPVGYVASAVMLNAKLKQGATLMHVIAMTRALGELRSPADTQPELY
FT                   RWTDTGGSYVDAVFNGGKLQSWEMTRPEAAPEEETPAS"
FT   sig_peptide     268403..268492
FT                   /locus_tag="Varpa_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.709) with cleavage site probability 0.631 at
FT                   residue 30"
FT   gene            complement(268828..269772)
FT                   /locus_tag="Varpa_0255"
FT   CDS_pept        complement(268828..269772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0255"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rpf:Rpic12D_1450 transcriptional regulator,
FT                   LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34477"
FT                   /db_xref="GOA:E6V1B3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34477.1"
FT                   /translation="MKLQQLRVLLAVAQNGSIHEAARSLHITQPALSKTIAELERELGV
FT                   TLMLRTTRGVNLTAYGTALVRRASLVEQELRHALEDIEAIRGRDEAQLNIGFTAVASGG
FT                   PLPNAMASFRQRFPNVALRAYEQRPQQLFEGLREGRLDLALVSTCNGPGTNVFQWEPLF
FT                   SLSMHVAVRTGHPLRRVRKLRTLLEADWLVLDPIDEPGSPLVSTMRVNGLEMPKRMVQS
FT                   ASNLLGLQLATQTDLVSMWSDSVFHDAGAVRMQPGLLERLPITDEVPDFDVYLVYRSAD
FT                   LMTHMCAEFTKEVRHHAKVNPLWRRPRRKAAAD"
FT   gene            269902..271251
FT                   /locus_tag="Varpa_0256"
FT   CDS_pept        269902..271251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0256"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reu:Reut_A3288 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34478"
FT                   /db_xref="GOA:E6V1B4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU34478.1"
FT                   /translation="MSEAALPASQMGGAPPTAAAPSSPADTVQAKGKHKGKQTQFRLIA
FT                   ACSLGNALEMYDFTVYSFFALLIGKLFFPSDSPYGSLLLAVATFGIGFVMRPLGGVVIG
FT                   SYADRKGRKAALTLTIGLMVAGTLCIALAPTYASAGVFGSLMILAGRLLQGFSLGGEIG
FT                   AATSMLMESGGIRGRGFRVSWQLASQGIAAVLGALTGAALYAALPQASLESWGWRLPFL
FT                   FGLLIAPVGFYIRANLEETHQGGRHESSPMGRLLREHGGTVLKGIFSITAGTAAMYLVV
FT                   FFMPTYMIRVLHMPPSLSLLSGCATGITMFAVALLAGRLADRLPNRKPLVIGSLVLGVL
FT                   AVYPAFWLINHYPSVPLVLCLSVLLTAIVNLGTTPLFLILLEMLPIGVRASGISVIYSV
FT                   GVTVFGGSSQFIVTWLLATTGNPMSPAFYMMACGVLSICALVSLRARRAD"
FT   gene            271303..272517
FT                   /locus_tag="Varpa_0257"
FT   CDS_pept        271303..272517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0257"
FT                   /product="amidohydrolase"
FT                   /note="KEGG: rpf:Rpic12D_1452 amidohydrolase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34479"
FT                   /db_xref="GOA:E6V1B5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B5"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADU34479.1"
FT                   /translation="MTRELSLQTSRLLSRLLPQADVDTQAFIDIRRQIHANPELGFEVG
FT                   ATGELVANLLREWGYEVHTGIGKTGIVAQLKVGSGTRRLGIRADMDALPIVEATGLPYA
FT                   SKTHGRMHACGHDGHTAILLAAAKALAKRRDFDGTLNLIFQPDEENLCGARAMIEDGLF
FT                   ERFPCDAVYALHNAPGVPVGSFLVIEGPVTLSSDVADVTIKGVGGHGAMPHLSRDPVPA
FT                   AAAVVTALQTVVARNVTPGDTAVVSVGFIRGGATHNVIPQSVALGLNVRAARPETRAVV
FT                   EQRIREIVSLTAQAHGVEAEIDYRQLVPPVVNTAAECRLMAQVCAELVGAEHVVTEAPK
FT                   GFAGSEDFAWMLAELPGCYVLLGNGEGEFGGCMVHNPGYDFNDQVLPLGAACWVRLAQT
FT                   YLAKT"
FT   gene            complement(272642..273643)
FT                   /locus_tag="Varpa_0258"
FT   CDS_pept        complement(272642..273643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0258"
FT                   /product="exonuclease RdgC"
FT                   /note="PFAM: exonuclease RdgC; KEGG: vap:Vapar_0253
FT                   recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34480"
FT                   /db_xref="GOA:E6V1B6"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B6"
FT                   /inference="protein motif:PFAM:PF04381"
FT                   /protein_id="ADU34480.1"
FT                   /translation="MSVFKNVIVYRIEPAWSQTLAEAEEGLGKHRFEPCGPSQEKSAGW
FT                   AEPRGEAGGPLVESIDGQWLVEYMIESKQVPGSVVRRKLDERCAQIEATTGRKPGKKEK
FT                   KELKEDITLELLPMAFTRSARVAVWIDKAEHRLVINSGNASRADEVVTSLVKSLDGFAV
FT                   ALINTQIEPAAAMANWLLTQEPPAGFTIDRECELKASDDSKAVVRYAKHPLDIEEVQKH
FT                   ITDGKRPTRLALTWDDRVSFELTHGMLIRKIVFLEGTGDGAAGGKKEDNYDADVAIATG
FT                   ELGQLVPALLDALGGEAAFGAAPADEAPKPAAKAAVPTTPVDAAEEEEDAPF"
FT   gene            274043..274996
FT                   /locus_tag="Varpa_0259"
FT   CDS_pept        274043..274996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0259"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="KEGG: vap:Vapar_0254 branched-chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34481"
FT                   /db_xref="GOA:E6V1B7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B7"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ADU34481.1"
FT                   /translation="MSSIPPSLDDRDGKIWMDGELVDWRDAKIHVLSHTLHYGCGAFEG
FT                   VRAYKTADGGTSIFRLAEHTERLFNSAKILRMKIPFSQEQLNEAQKQVVRENKLESCYL
FT                   RPLIWIGSEKLGVSPKGNKIHAMVAAWSWGAYLGEEGMRRGIRVKTSSYTRHHVNITMT
FT                   QAKSVSNYTNSILANMEALDDGYDEALLLDASGFVSEGAGENIFVVKGGVVYTPDLSAG
FT                   ALNGITRNTILHICKDLGLELVQKRITRDEVYISDEAFFTGTAAEVTPIRELDRIEIGN
FT                   RGDGGSRGPITEKIQSAFFDIVNGKNPKYAHWLTKV"
FT   gene            275005..275214
FT                   /locus_tag="Varpa_0260"
FT   CDS_pept        275005..275214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0260"
FT                   /product="Zinc finger, CHCC-type"
FT                   /note="PFAM: Zinc finger, CHCC-type; KEGG: vap:Vapar_0255
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34482"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B8"
FT                   /inference="protein motif:PFAM:PF10276"
FT                   /protein_id="ADU34482.1"
FT                   /translation="MSTNAVVELLAKELNHQGGVFCPSPKADMKLWNSHPKVYLDVART
FT                   GEAKCPYCGTVYRLKAGEAVSARH"
FT   gene            275232..275648
FT                   /locus_tag="Varpa_0261"
FT   CDS_pept        275232..275648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34483"
FT                   /db_xref="GOA:E6V1B9"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0256"
FT                   /protein_id="ADU34483.1"
FT                   /translation="MTLRGLLWRFAAAYVVLLIVVGVALNLAGASSSTGGNMAALLGTV
FT                   AWVCMDSAKKNGRYFTPEEKKRAVLGMLVIDMAIQAAVTVAVGLFAGATGLSLGPALLV
FT                   LLFVGVLHALVIWFFVGFAGKQHAAAEARRNKIG"
FT   sig_peptide     275232..275351
FT                   /locus_tag="Varpa_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.206 at
FT                   residue 40"
FT   gene            complement(275650..276705)
FT                   /locus_tag="Varpa_0262"
FT   CDS_pept        complement(275650..276705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_4463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34484"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C0"
FT                   /inference="similar to AA sequence:KEGG:Pmen_4463"
FT                   /protein_id="ADU34484.1"
FT                   /translation="MRRILATLILLLACTFGAHAAPAVVQGLVHGSGPEAQRFPWVRTD
FT                   DAKVADRINQFLFIDTFEAMAPARAAEGLRGVDAKNWERLPNLGYAVLRNDGRVLSLRV
FT                   EGEGCGAYCESFSVGHAFDATTGRHLSPGDLFTAEGLADMARKIQANNAARLRKEIAAL
FT                   GNKARSKEEAREDKIALYTECLTSRQDPVYQKIEGMRGMEIDAKGVLFTQGRCSNHAMR
FT                   ALDDLDDLSTRFTPAQLGPWLTAYGRALLLGEGAAPAPASPFDQVLHGTIDARLPVTLR
FT                   LEALRSDGSVAATYFYDRYRKAISVFGKYQNGVLLLEESSDTRLRLKPDGAGLRGEWIS
FT                   GQKTLPMVLAP"
FT   sig_peptide     complement(276643..276705)
FT                   /locus_tag="Varpa_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(276710..277927)
FT                   /locus_tag="Varpa_0263"
FT   CDS_pept        complement(276710..277927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0263"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: vap:Vapar_0257
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34485"
FT                   /db_xref="GOA:E6V1C1"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C1"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADU34485.1"
FT                   /translation="MFWGLVVFMPVGVTYLSAILLLLAMLLAGGYAERFARLRANPLWW
FT                   PVVAYLAWTLLVLAFGPHYPETGSNLFHGVRIGLTILMAMALTREEAIWALRGFLLIAA
FT                   LNILLIVLHYAIGFPVWSPLRGVVMEVGNKSISNALLFSVVAATAAVWGIAQTAGHKPL
FT                   RAIPAFLLMLGLGFVVALPLTSRTSVLALLLVVPVVCIHQWRNHLKMLVSALVLGAVVI
FT                   GAALYQLPQLQHKVETGVQEIEEAQTGAVFHGSWVIRYYMYRDTGLMIADRPLTGWGIG
FT                   GWTSQWHKRGPALFADSNMPHNDFLWVGAQGGLPALLSLLVIMVAAVWQAWRRPDIAGR
FT                   FALAATLIALIASSVNSAMRDAQIGLALLWIAMVYLRLAQEKNDPAPWRDLWPWRRPNL
FT                   NTNPTA"
FT   gene            complement(278105..279304)
FT                   /locus_tag="Varpa_0264"
FT   CDS_pept        complement(278105..279304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0264"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: vap:Vapar_0258 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34486"
FT                   /db_xref="GOA:E6V1C2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34486.1"
FT                   /translation="MLRKLYSGHLYVRIWLAVVGGVVILTLMANWIVREAAEAERERLA
FT                   PVPRHVVVLDAQDRTIGSGTALRVPGQGLEFDVTLSDGKAITLRVAPRERATGTGGFAP
FT                   WRTPFGLGWMIALVGVAVALGVYPIVRRITQRLETLQRGVQRWGDGDLSVRVTEEGQDE
FT                   VADLSKRFNASAERIEQLVRSHKSLLANASHELRSPLTRIRMGLELMGEHPSPKAREEI
FT                   SRNIGELDQLIDEILLASRLDASEADMGTIEAVDLTGLAAEECSQVNAELDLAEGTDNA
FT                   ALTVPGVSRLLRRAIRNLLENARRYGAGSISVELGSANGFATVRVNDRGPGVPPALRER
FT                   IFEPFYRLPGASERNGGVGLGLALVKSIAERHGGTVRCEDAPEGGASFVIRLPVAATAH
FT                   "
FT   gene            complement(279311..280033)
FT                   /locus_tag="Varpa_0265"
FT   CDS_pept        complement(279311..280033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0265"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: vap:Vapar_0259 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34487"
FT                   /db_xref="GOA:E6V1C3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU34487.1"
FT                   /translation="MKRMSTPQLLMIEDDARLAQMVGEYLTQSGFAFNHAGDGASGLEQ
FT                   LQQHAPDLVILDLMLPDTDGLEVCRRIRALPGPISKVSVLMLTAKGDPMDRIIGLEIGA
FT                   DDYLPKPFEPRELLARIRAVLRRRSENATESEASTVMRFGTLEIDRNARTVSVAGALAD
FT                   LTSYQFDLLVAMAERAGRVLTRDQIMEAVRGRELEAFDRSIDVHMGRIRAAIEVDAKNP
FT                   KRILTVRGVGYVFAKQQD"
FT   gene            complement(280087..281736)
FT                   /locus_tag="Varpa_0266"
FT   CDS_pept        complement(280087..281736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0266"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: vap:Vapar_0260
FT                   monooxygenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34488"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C4"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADU34488.1"
FT                   /translation="MTDTALDSFDAVIMGGGLAGLTLAIQLKQRFGDLKVLVLERRTHP
FT                   VPHAAHKVGESSVEIGAHYFDTVLGLKAHMDEAQLRKFGFRFFFSEGRSDIDNVTEIGA
FT                   SRYLAVPSYQIDRGIFENFLAEEAVRHGVRFVDSALVRRIDLAADPATPHRIEWTRGEE
FT                   THATEARWLIDACGRAGMLKRKLGLAEPNAHDVNAVWFRIGERIAVDDWSDNAEWRERC
FT                   NPQARWLSTNHFVGAGYWAWLIPLASGSHSVGIVADPALHPLDTIDTFEKAMAWFATYQ
FT                   PRLYEALDGKRHLLQDFAFLRHFSHGCKQVFSGERWAMTGEAGLFLDPFYSPGSDFIAI
FT                   ANTYITDLIAQDRAGRPLEARAQLYDQIYHSFYESTLALYQDQYPLFGDPEVLPVKVIW
FT                   DYAYYWGVLAQIFFQRRLTDLPALGSLKDELQHCQRLNVAVQRLMRDWSASSNKSNPAA
FT                   MLDQAAMPWFAELNRSLKDTLDDAGFKDRIRASTVMLRQLAGEILGRARTADPDVEAGA
FT                   LLALLEENRGKTPATTARDAMLFAAPPVDTHA"
FT   gene            complement(281741..282622)
FT                   /locus_tag="Varpa_0267"
FT   CDS_pept        complement(281741..282622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34489"
FT                   /db_xref="GOA:E6V1C5"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0261"
FT                   /protein_id="ADU34489.1"
FT                   /translation="MSTTATPPTPPMPPMPPTLYIEGPAFWTPTLPGWDAARAAFRGEG
FT                   ALADPPAKRPSPQVLAPAERRRAPDTVALALEVAAAAMAASGRNAADVPCVFASAHGDL
FT                   SINDYMCGTLASDPKMLSPTKFHNSVHNAAVGYWTIGTGCMAASNAVSAYENSFASGLL
FT                   EAAVQCAADQEPVLLVGYDTPTVGALTSVTESRGMLAVAMVIAPVRTERSVAALQWSLA
FT                   SHGAAGDDAAATYTPLRSEAAKSLVAINPMAQALGLFESLAHVEGEDEPAFGLQLSPTL
FT                   SLRLQLRPPPKD"
FT   gene            complement(282619..283827)
FT                   /locus_tag="Varpa_0268"
FT   CDS_pept        complement(282619..283827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0268"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: vap:Vapar_0262
FT                   3-oxoacyl-(acyl carrier protein) synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34490"
FT                   /db_xref="GOA:E6V1C6"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C6"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ADU34490.1"
FT                   /translation="MLSRISPLQISAYTATSAVGVGKAPLAEALENSRSGLRANDFGDA
FT                   PLPTWIGRVEGLEDVRLPEPLASWDCRNNRLAWLGLQADGFLEAVAAARKKYGASRVAL
FT                   ILGTSTSSIGETELAYTQLDGNGMFPPDQRRAAVHTPHSLAMFVRQVLGLEGPAETIST
FT                   ACSSSAKVFASAERLIRLGLADAAVVGGVDTLCGSVLFGFNSLELVSTEPCRPFDAGRD
FT                   GISLGEAAGFALVERVQGGADAAPLRLLGYGEASDAHHMSTPHPEGLGAERALDEALLR
FT                   AGLPPEAIDYINMHGTASQKNDEVEGALVARRFPATTHASSTKGFMGHTLGAAGIVEAV
FT                   ISLLAIERGLKPGTVGTRTIDEGFGPQIRLAPEHGEVRYALSNSFGFGGNNCSLVFGKA
FT                   DAA"
FT   gene            complement(283973..285358)
FT                   /locus_tag="Varpa_0269"
FT   CDS_pept        complement(283973..285358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0269"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_0263 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34491"
FT                   /db_xref="GOA:E6V1C7"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU34491.1"
FT                   /translation="MDNPGLMSAPPLETPTTPSPSWRDTLKVYLEPATLRMLALGFSAG
FT                   LPLLLVLGTLSFRLREAGIDRTTIGYLSWVGLAYGFKWVWAPLVDRMPLPPLTTLLGRR
FT                   RGWLLLAQALVIVGLVGMAMNDPRNGLAPLVWCALLVAFGSATQDIALDAFRIESAETR
FT                   KQAALAAAYQTGYRLAMIWAGAGVLWVAAWAEVAPAVAATGAAAYQNGAWKTAYLVMAA
FT                   SMGVGVLTVLLSPEPVRLVLPKAKNAAEWLQNVLIDPFADFIRRYKWQAALILALIAIY
FT                   RISDVVMGIMANPFYVDMGFTKDEVATVSKIYGVVMTLVGAFVGGVLSMRLGVMRVLML
FT                   GAVLSAASNLLFAWLASRGHDLTALIAVVSADNLAGGIASAAFIAYLSSLTNISYSATQ
FT                   YALFSSLMLLLPKFIAGYSGAFVDAYGYSQFFTATALLGVPVLLLVALASRLTTTTSAA
FT                   DRQ"
FT   gene            285419..286291
FT                   /locus_tag="Varpa_0270"
FT   CDS_pept        285419..286291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0270"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: vap:Vapar_0264
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34492"
FT                   /db_xref="GOA:E6V1C8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C8"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADU34492.1"
FT                   /translation="MCTRCERPISAASAASPASPWQPRRAFLLAAAGAATTALGGPAFA
FT                   QVNVGNASVARNLVPADKIEAAGVQQYGQLLAQARAKNALAGDNNAQLQRLRAIAQRLI
FT                   PFATPWNTRAREWKWEVNLIGSKQINAFCMPGGKIAFFTGILEQLKLSDDEVAMVMGHE
FT                   MAHALREHARARMAKSAGTGAALSIGAQLLGLGQVGDIAARAGTQLITLKFSRSDETEA
FT                   DLVGLELAARAGYDPKASVSLWNKMATASKNQGGLSFLSTHPSGTDRIAKLEANIPKVE
FT                   SLYRNAKRS"
FT   sig_peptide     285419..285556
FT                   /locus_tag="Varpa_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.859) with cleavage site probability 0.855 at
FT                   residue 46"
FT   gene            286517..288232
FT                   /locus_tag="Varpa_0271"
FT   CDS_pept        286517..288232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0271"
FT                   /product="allophanate hydrolase"
FT                   /note="KEGG: vap:Vapar_0265 allophanate hydrolase; TIGRFAM:
FT                   allophanate hydrolase; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34493"
FT                   /db_xref="GOA:E6V1C9"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C9"
FT                   /inference="protein motif:TFAM:TIGR02713"
FT                   /protein_id="ADU34493.1"
FT                   /translation="MVHEYDPLTAAAWIAKFPTPVAGAETADTPGVTLPLAGLRFAVKD
FT                   NIDVAGVPTTAACPAFDRRPTAHAAVVQRLLEAGASLAGKTNLDQFACGLNGTRSPYGE
FT                   VPNAFDARYVSGGSSSGSAYVVAAGEVDFALGTDTAGSGRVPAGLNNIVGLKPSRGLLS
FT                   TFGVVPAAQSADCVSIFARTVALAVDVMLAASGHDPRDPYSRDIAMHRKPLPARFNFGV
FT                   PDTLSFFGDTVAEEAFRDAQAKLVALGGTAVTIPYAPLAEAAALLYESALVAERYAAVR
FT                   EFFDAHADEVIEPVRSILASGKKYVAADVFDAQTRLRAIAQQVEPMWRDIDVLLVPTAP
FT                   THYTREAMRADPVVLNRNLGAYTNFVNLLDYAALSVPSSLRADGLPFGITLIGPSGSDL
FT                   ALADLGQRYHHATGLAQGATGQPLPAPRPVPGLMAPVPQTLAIAVVGAHLSGMPLNGQL
FT                   TERGATLLRATTTSPAYRLFALPGTTPPKPGLQRSAEGGAAIALEVWAVPIAQVGSFLA
FT                   LIPPPLGLGSVELADGSWVHGFICEGHALADGQDVTHHGGWRAYVASRATTPSN"
FT   gene            288254..289258
FT                   /locus_tag="Varpa_0272"
FT   CDS_pept        288254..289258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0272"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="KEGG: vap:Vapar_0266 NMT1/THI5 like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34494"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0266"
FT                   /protein_id="ADU34494.1"
FT                   /translation="MSTFDKSSASRRQLLQAGIGAAGLAVLAAPAIVRAQAAPKLRIGY
FT                   WPVAAGLPFFAAVDRGYFKEAGLDVEPLKFAAAQQIMEGMLAGRCDGSANGTGSANLAI
FT                   GEIAQPGLFKIFCTNPSNAKFVLDEFIVAKDSPVKTVAELAGKKVASGPGIQNVTLCKT
FT                   MLERAGAKGAVVSELPIGQHVAALAAGQVDACYTLEPTGTVGRMNGTTRVIEAGVVARY
FT                   ILGDPMAPWHGGAASLTSEFIKKNPEVAKKYIAAYARGVELVRTKPDDARQHMKGYTAI
FT                   EGKLTAEVPLASYMLYNEFKPSDVAYFQKFYDLFTEKGIFEKKVPVDALLYKA"
FT   sig_peptide     288254..288361
FT                   /locus_tag="Varpa_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.607 at
FT                   residue 36"
FT   gene            289261..290088
FT                   /locus_tag="Varpa_0273"
FT   CDS_pept        289261..290088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0273"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0267
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34495"
FT                   /db_xref="GOA:E6V1D1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34495.1"
FT                   /translation="MADASTTTAAPWTPPASLNAAVPKPPLRDRLLPFIGPVALFIAWD
FT                   LVVRLGFIKPILLPSPADTIAALITGLAGGPLLTDFAMTVWRTLQAFVIAAVVGVPLGV
FT                   LLGSNEKAYRSVEFLIDFFRSTPSSALIPLFLLIFGVSDVNKIAIAAFGALLIVVFNSA
FT                   YGVINARKQRVMAAKVMGASRWQVFKDVLIWESLQPSFVGLRSAVSMALVIVIVAEMFI
FT                   GSDTGLGHRIIDAQQVLNVKSMYAAILAAGALGYALNILFLLAERRIVHWSGR"
FT   gene            290085..290918
FT                   /locus_tag="Varpa_0274"
FT   CDS_pept        290085..290918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0274"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0268 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34496"
FT                   /db_xref="GOA:E6V1D2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34496.1"
FT                   /translation="MKVTQDIVINGPVYADVPKPVFKPGPAGTHITIRGLTKYFAGWPL
FT                   YENFDLDIPKHKIVSVFGPNGCGKSTLINMIAGLVPIDAGEILFDGKQRKDTKIGYVFQ
FT                   NYREAMFPWMRTIDNIAYPLKLEGRSKAEVDRRMEELVASFDVKFDLKRFPYELSGGQQ
FT                   QTASIMRALAPNPEVLFLDEPFSALDFEMTLFIREKLQEVFMQTGTTMLLVSHDLEEAV
FT                   YLADEVLLLTKRPTKVAEILRYGDARPRTVETLSTESFVATKKLSLDIFQREVRR"
FT   gene            290915..291295
FT                   /locus_tag="Varpa_0275"
FT   CDS_pept        290915..291295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34497"
FT                   /db_xref="InterPro:IPR024507"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0269"
FT                   /protein_id="ADU34497.1"
FT                   /translation="MTLEINIPEVHAEVSAVFARYEEALVTNQRAVLDELFWNSPHTLR
FT                   YGFSENHYGHADISAFRASLPVQSPPRELLRTVITTYGHYFATANVEFRREGSREIGRQ
FT                   SQTWIRTADGWRVAAAHVSLPV"
FT   gene            291345..292463
FT                   /locus_tag="Varpa_0276"
FT   CDS_pept        291345..292463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0276"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; Twin-arginine
FT                   translocation pathway, signal sequence, subgroup; KEGG:
FT                   vap:Vapar_0270 basic membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34498"
FT                   /db_xref="GOA:E6V1D4"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D4"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ADU34498.1"
FT                   /translation="MTTPLNRRDSLKSLAALGAAGTLGGWSALASAQAKPLTVGVIYVG
FT                   ARDDYGYNQAHAMAAAEIKKLPGIKVVEEENVPETAAVQKTMAGMISQDGAKLLFPTSF
FT                   GYFDPHILAVAPKYPDVRFSHCGGLWTEGKHPKNAGSFFGYIDECQFLNGVIAAHMTKS
FT                   NKIAFVAAKPIPQVLRNINAFTLGARSVKPNITCSVIFTGDWSMAVKEAEATNSLADQG
FT                   CDVFTMHVDGPKVVVETAAKRGKMVCGYHASQAKLAPNAYLTGAEWNWLTAYKTAIEAA
FT                   QAGKPHPNFLRGGLKEGYVKMSAYGPMVPDAAKKQADDIKAKMIAGTFDIFKDGIKDNK
FT                   GAVVVPAGKVLKQTDLELEKMNYLVEGVIGQA"
FT   sig_peptide     291345..291443
FT                   /locus_tag="Varpa_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.564 at
FT                   residue 33"
FT   gene            292475..293566
FT                   /locus_tag="Varpa_0277"
FT   CDS_pept        292475..293566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0277"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0271 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34499"
FT                   /db_xref="GOA:E6V1D5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34499.1"
FT                   /translation="MPMPMPMPSPMRSALKEFALPVFAIAAALLLFGVLVAFAGVDPVE
FT                   VWATLFKGAFGDWFSWQNTLQRAAPLMLTALCVALPARAGLIVIGGEGALVLGGLACAA
FT                   LAHAVPLPGNVVGTAIVCVAGALAGALWIVLAGWLRQYRGINETISSLLLAYIAIGIFK
FT                   HLVEGPLRDPASLNKPSTYALNDGLLIGGIGGSDVHWGLAIGVVACLGLGWWLRATASG
FT                   FSVRVVGGNPRTAQLVGLPATRLILGSCALGGACAGLAGAVEVAAVHTNANASLIAGYG
FT                   YAGILVSFIARHNPVAIVPVAILFGGFGAAGSLLQRRLGLPDASVLVLQGIAFVLILAS
FT                   EGLRMIDWKALRARLFRASGSPA"
FT   sig_peptide     292475..292594
FT                   /locus_tag="Varpa_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.964 at
FT                   residue 40"
FT   gene            293715..294638
FT                   /locus_tag="Varpa_0278"
FT   CDS_pept        293715..294638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0278"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0272 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34500"
FT                   /db_xref="GOA:E6V1D6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D6"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34500.1"
FT                   /translation="MTADQWIALVAGIVGGALRVGAPFLFVSLGECLTEKSGRINLGLE
FT                   GVLVLSAMAAFGGAYLTDSAWLGVLIGAMAGAVLALLHGLLCSLDRVNDVATGIALMLL
FT                   GTGLAFYLGKPLIQPQAPQIPAIPLGFWSDNTVVRSALQLNALVPIGVALAVLLWWGFA
FT                   RTRAGLLVRMAGDSAQATRALGYSVSGLRIAATTAGGFIAGLGGASLTLFYPGSWNEGI
FT                   SSGQGLIAVALVIFARWSPLRCVGAAFLFGGAGAIGPALQSIGIGWGYHLFNTVPYVLT
FT                   LVILVLTCKPGSAAIGSPGELSSTRN"
FT   gene            294644..295636
FT                   /locus_tag="Varpa_0279"
FT   CDS_pept        294644..295636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0279"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bra:BRADO7112 formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34501"
FT                   /db_xref="GOA:E6V1D7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR022843"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D7"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADU34501.1"
FT                   /translation="MSGLGGLNKSAHGVVVGLVQLQLPNVKTPADLAAQTQRICDMVGK
FT                   ARRNQSTMDLVVFPEYALHGLSMDTNPEIMCTLDGPEVAAFKRACIEHRIWGCFSIMEA
FT                   NPGGNPYNSGLVIDDQGEIKLYYRKLHPWVPVEPWEPGNLGIPVCDGPNGSKLALIICH
FT                   DGMFPEMAREAAYKGADIILRTAGYTAPIRHAWKITNQANAFCNLAYTASVCLCGSDGS
FT                   FDSMGEGMFCNFDGTVLVEGGGRVDEIITAELRPDLVREARTGWGVENNIYQLYHRGYV
FT                   AVKGGAQDCPYTYMHDMAAGTYRLPWSADVKVTDGTSCGFAPPERNYQG"
FT   gene            295645..296358
FT                   /locus_tag="Varpa_0280"
FT   CDS_pept        295645..296358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0280"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   vap:Vapar_0273 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34502"
FT                   /db_xref="GOA:E6V1D8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D8"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADU34502.1"
FT                   /translation="MTTAAATTAERHVAAEPYAWPYNGDLRPENTALIVIDMQTDFCGK
FT                   GGYVDVMGYDLSLVQAPIQPIARTLAALRPLGFHIIHTREGHRPDLADLPANKRWRSRQ
FT                   IGANGVGIGDDGPCGRILVRGEPGWELIPELAPLPGEVVIDKPGKGSFYATDLELILRT
FT                   RGIENLILAGITTDVCVHTTMRDANDRGFECLLLSDCTAATDHGNHLAALKMITMQGGV
FT                   FGAHTTSQQLLAALG"
FT   gene            296366..297940
FT                   /locus_tag="Varpa_0281"
FT   CDS_pept        296366..297940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0281"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0274 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34503"
FT                   /db_xref="GOA:E6V1D9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34503.1"
FT                   /translation="MSAVPHAIGALPAGSGALALDTYELTKRFGAFTAMDRVTMRVEPG
FT                   TVHALLGENGAGKSTLVKCVAGFQRAEEGSILIDGREQDIANPIVARALGIGMVYQHFT
FT                   LAPGMTVAENLLLAGGKTPALIDWKTKRAELKAFLATTPFSLDLDVRPSELAAGEKQKL
FT                   ELLKQLYLKPRLLILDEPTSVLTPQEADEVLGHVREFARSGLCTVLIITHKFREVMAYA
FT                   DSVTVLRRGKAVHHCRVADTSPAQLAQAMMGGEDAAVATPASSPAIRKPVADAAPIALK
FT                   VEGLKAQGDRGTLALHDLSLAVRAGEILGVAGVSGNGQRELVEALVGQRPRLAGRVSVM
FT                   GQPYNARRAENRSLKVRSLPEEPLRNACVGDLSVAENMALRDFDRPPLSRGGVLNFPYW
FT                   RSRAREWIAEYGVKTQGEGAPIRSLSGGNVQRAVLARELAGDINVLIAANPVFGLDFAA
FT                   VAEIHERIVQVREKGGAVLLISEDLDELLELADRIVVMSEGQIVFETSAAGAERHVIGA
FT                   HMGGGHH"
FT   gene            297952..298623
FT                   /locus_tag="Varpa_0282"
FT   CDS_pept        297952..298623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0282"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   vap:Vapar_0275 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34504"
FT                   /db_xref="GOA:E6V1E0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E0"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADU34504.1"
FT                   /translation="MRIEQANPFAYEFEIRNTALVLIDMQRDFIEPGGFGETLGNDVSL
FT                   LEAIVPATQAALAAWRKAGGLVVHTREAHKPDLSDCPPVKRNRGNPSLRIGDEGPMGRI
FT                   LVAGEPGNQIIDGLAPIDGELVIDKPGKGMFYATGLHKVLQQRGITHLLFGGVTTEVCV
FT                   QTSMREANDRGYDGLLLEDCTESYFPAFKAATLDMIRAQGAIVGWTAPSAALLAALSHA
FT                   T"
FT   gene            298652..299398
FT                   /locus_tag="Varpa_0283"
FT   CDS_pept        298652..299398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0283"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: vap:Vapar_0276 transcriptional regulator, GntR
FT                   family; PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34505"
FT                   /db_xref="GOA:E6V1E1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E1"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADU34505.1"
FT                   /translation="MSTVRPRPAPSAPAPAADTAVFRTRADEVYAQLKRDVAEFILVPG
FT                   DRFTENEISDRLGVSRTPVRQALFRLQQEGFVEVLFRSGWRVLPFDFDQFEQLYDLRMV
FT                   LETTAVHRICEADHRVDRSLLDMLAGIWLVPVAERSTDTAQVAQWDEAFHCSLVAAAGN
FT                   AEMARVHSDVTDRIRIIRRLDFTQQPRIEATYDEHAKILKAIRANRGDQAAMLLRAHIE
FT                   TSQAEVRKITLHQVHLARHAGKTAPR"
FT   gene            complement(299443..300405)
FT                   /locus_tag="Varpa_0284"
FT   CDS_pept        complement(299443..300405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_5386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34506"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E2"
FT                   /inference="similar to AA sequence:KEGG:Vapar_5386"
FT                   /protein_id="ADU34506.1"
FT                   /translation="MRFIAKTLTTLLVAASAAAAHAWPDQPITLVVPYTPGTGIDLVAR
FT                   QLSARLPALLGQPVIVENLAGASGNIGSEKVARAKPDGYTLLVQVNTLVMNRSLYKSLS
FT                   YDPVADFAPASLTSWGTLLLVTNPNVQKATSVAQMVSAAKAEPAKLTYATPGVGTPHHL
FT                   SMALLMQGTGTDLLHVPYKGTAGAVTDLLGGRIDYMFLPVHVALQHIQAGKLKAIATGS
FT                   SKRLPQLPDVPTLAEAGVTADNVDMWYGVLAPKGTPPDVVARLNKEIAAVLKQPDVAKS
FT                   FESQGMVPASSTPGEFGALVKKDAERWAGVVKRGNITAD"
FT   sig_peptide     complement(300337..300405)
FT                   /locus_tag="Varpa_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            complement(300449..301690)
FT                   /locus_tag="Varpa_0285"
FT   CDS_pept        complement(300449..301690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0285"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   vap:Vapar_5387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34507"
FT                   /db_xref="GOA:E6V1E3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E3"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADU34507.1"
FT                   /translation="MNDKQVIILGAGIGGLTLALSLHQAGIACRVYEAVPELEPLGVGV
FT                   NLLPHAVRELTELGLLPQLDKVGVRTKESIFFTEHGQLIFQEAAGEHAGYDWPQFSIHR
FT                   GDLQTVLLEETLKRLGPDSVVCNHRCTGVTQDAGGVTVHFADAPAVRGAVAIGCDGIHS
FT                   ALRKQLYPNEGAPRYSGVNMWRGTARWKPFLSGASMVRAGWLAVGKMVIYPIRNDIDAE
FT                   GHQLVNWVAEIHAPQPAMRDWSRAGRLEDFLPAFADWHFYWLDVPALIRASDTILEYPM
FT                   VDQDPLPRWTHGRLTLLGDAAHPMVPRGSNGAGQAIIDARFLAGALKDLGVGTAALEDY
FT                   DRARVKATTNVVLTNRSNPPDAILREVFERSGGKRFGQIEDVVSHAELQAISDNYKRVA
FT                   GYDPVALKARASYL"
FT   gene            301790..302704
FT                   /locus_tag="Varpa_0286"
FT   CDS_pept        301790..302704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0286"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_5388 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34508"
FT                   /db_xref="GOA:E6V1E4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E4"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34508.1"
FT                   /translation="MNLSTRQMRAFLQVARLGNFTRAAEQAHITQAGLSILIREMEKQL
FT                   GCRLFDRTTRVVTLTPAGRRLLPVVERLVTDLDDVAAQLGAEGDEARQTLRIAATPLVS
FT                   SHLLPQVFNTFRQAHPQVSLRLFDADLRDVEAMVTAGDADMGLGFFFKAAAGLERTPVG
FT                   RFHLMRVASSSADEVDEAPAIGTAPWSALRSAELIGLPPGNPIQKVIDQHLVATIGRAD
FT                   AQRPTFNFFGTLISMVEAGFGTAVMPTFALAACRRHRVRTDVLVKPKVGLDFYRIAKRG
FT                   THETEAMQAFVATLEKALPALSR"
FT   gene            complement(302714..303517)
FT                   /locus_tag="Varpa_0287"
FT   CDS_pept        complement(302714..303517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0287"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; KEGG: vap:Vapar_0277
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34509"
FT                   /db_xref="GOA:E6V1E5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E5"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ADU34509.1"
FT                   /translation="MFKLTSLNLNGLRSAATKGVADWVAELAPDCICMQEIRVQASDIE
FT                   GRFEEMAGLKGHFHFAEKKGYAGTAIYTKHAPSQVIVGWGDAEFDAEGRYLELRFDTPK
FT                   RKFSVISCYFPSGSSGEERQLAKFRFLKGFFPHLVALKKEREFVLCGDINIAHQQIDLK
FT                   NWRSNQKNSGFLPEERAWMTKLLDAGAEGAGLVDVYRMLKPETTDEAYTWWSNRGQAYA
FT                   NNVGWRLDYHLATPKTAALARTEQIFKTIKFSDHAPITVDYDFTL"
FT   gene            303531..304214
FT                   /locus_tag="Varpa_0288"
FT   CDS_pept        303531..304214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0288"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; KEGG:
FT                   vap:Vapar_0278 orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34510"
FT                   /db_xref="GOA:E6V1E6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E6"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADU34510.1"
FT                   /translation="MAVDGEKSSAVAQDFVQFARDAGVLRFGEFKTKAGRMSPYFFNSG
FT                   LFDDGAKIARLAGFYADRLIESGLEFDMIFGPAYKGIPLGATVAAELARRGRNYPFAYN
FT                   RKEAKAHGEGGNLVGAPLQGRVLIVDDVMSAGTAVRESIAAIQAAGATPHAVAIALDRQ
FT                   EKATENGVDVDHSAVQYVRNQLGLSVIAIATLDDLLSYLSGDAAADLGAHRERVLAYRT
FT                   RYGAH"
FT   gene            304228..304923
FT                   /locus_tag="Varpa_0289"
FT   CDS_pept        304228..304923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34511"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0279"
FT                   /protein_id="ADU34511.1"
FT                   /translation="MRTRDHGKPHRLLAAASFFLVAFAAVGVAHAQGKDVPAGSIYTCT
FT                   DAQGRTLTADRPIPACNDREQRELSPSGLTRRKIEPTYSAREMAEREDRAREAAVQAAK
FT                   ATDERRRERALLVRYPSPASHDRERKEALSQVDAVIQAAQKRIAELSEDRQKIDEELEF
FT                   YKKDTSKAPGAMRRKLEDNTQSVAVQNRFIAEQEEEKKRVNARFDEERGRLKPLWGPAP
FT                   SAAAAAASR"
FT   sig_peptide     304228..304323
FT                   /locus_tag="Varpa_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 32"
FT   gene            complement(304966..306456)
FT                   /locus_tag="Varpa_0290"
FT   CDS_pept        complement(304966..306456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0290"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="KEGG: vap:Vapar_0280 glutamyl-tRNA(Gln)
FT                   amidotransferase, B subunit; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, B subunit; PFAM: GatB region; Asn/Gln
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34512"
FT                   /db_xref="GOA:E6V1E8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E8"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ADU34512.1"
FT                   /translation="MSETVNTFEAQQQGRPTGPLVRGYEVIIGFETHAQLSTNSKIFSR
FT                   ASTAFGAEPNTQACAVDLALPGTLPVMNKGAVERAIKLGLALGSHVAPRSVFARKNYFY
FT                   PDLPKGYQISQFEIPVVQGGSVSFFLGEEKKTVRLVRAHLEEDAGKSLHEDFIGQSGID
FT                   LNRAGTPLLEIVTEPDMRSTAEAVAYARELHKIVTWIGICDGNMQEGSFRCDANVSVRK
FT                   PGDKLGTRREIKNLNSFKFMQQAIDYEIRWQIEEIEDGRKVEQATVLFNPDTGETRAMR
FT                   AKEDSADYRYFPDPDLPPLVIAADWIERVRGEMPELPRAMAERYVRDHGLSEYDAAQLT
FT                   QSLALAHYFDEAVKAGATPKLASNWITGEMARRLNAKEIGIEAAPVSAQQLGQLVKRIA
FT                   DGTLPNNAARQVFDALWIGEGSDVDAIIEAKDLKPMADTGALDAILDEVIARNAKNVEE
FT                   YRGGKEKALNGLVGQVMKASGGKANPAQVTELLKAKLG"
FT   gene            complement(306458..307951)
FT                   /locus_tag="Varpa_0291"
FT   CDS_pept        complement(306458..307951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0291"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="KEGG: vap:Vapar_0281 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34513"
FT                   /db_xref="GOA:E6V282"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E6V282"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ADU34513.1"
FT                   /translation="MSGEQQLHQMGVVALAKALAERKVSAVEASQAFLGRMKAHESLGT
FT                   FVDVNEEVTLAQARKADALLAAGNAPALAGVPIAHKDIFVTTDFATTAGSKMLAGYRSP
FT                   FDATVVRRLAEAGAVTLGKLSCDEFAMGSANENVAVPAVGHDKAVPVRNPWNRDRIPGG
FT                   SSGASAAAVAARLAPAATGTDTGGSIRQPASFCGVTGIKPTYGRASRYGMVAFASSLDQ
FT                   AGPMARSAEDCALLLSAFCGPDLDRDSTSIDKPAEDFGRALNDSLEGLRIGVPKEFFGE
FT                   GVAPGVRAAIDAALAQYEKLGAKRVEVSLPRTELSIPVYYILAAAEASSNLSRFDGVKF
FT                   GHRAKQYKDLSDMYEKTRAEGFGDEVKRRIMIGTYVLSHGYYDAYYLQAQKVRRMIADD
FT                   FQQALKQCDVIAGPAAPTTAWKIGEHGDDPVADYLADIFTLPASLAGLPGMSVPAGFDG
FT                   GMPVGLQLIGNYFGEAKLLNAAHRFQQATDWHTRTPEGF"
FT   gene            complement(307951..308250)
FT                   /locus_tag="Varpa_0292"
FT   CDS_pept        complement(307951..308250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0292"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; KEGG: vap:Vapar_0282 glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34514"
FT                   /db_xref="GOA:E6V283"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:E6V283"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ADU34514.1"
FT                   /translation="MSLDASDIARIASLARLQLASDESERMLSQINGFFDLVERMRSVD
FT                   TAGIEPLAHPVAAIEDITLRLRDDVVSEPDNREANQKSAPAVEAGLFLVPKVIE"
FT   gene            308464..309507
FT                   /locus_tag="Varpa_0293"
FT   CDS_pept        308464..309507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0293"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: vap:Vapar_0283 rod shape-determining protein
FT                   MreB; TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34515"
FT                   /db_xref="GOA:E6V284"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E6V284"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADU34515.1"
FT                   /translation="MFGAFRRYFSTDLAIDLGTANTLIFARNKGIVLDEPSVVAIRHEG
FT                   GPHGKKVIQAVGREAKAMLGKVPGNIEAIRPMKDGVIADFVITEQMIKQFIKMVHPRTL
FT                   LTPSPRIIICVPCGSTQVERRAIKDAAEAAGATSVYLIEEPMAAAIGAGLPVSEASGSM
FT                   VVDIGGGTTEVGVISLGGMVYKGSVRVGGDRFDEAIINYIRRNYGMLIGEPTAEVIKKT
FT                   IGSAFPGSEVKEMEVKGRNLSEGVPRSFTISSNEVLEALTDPLNNIVSAVKNALEQTPP
FT                   ELGADIADRGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGCGIALERMDRL
FT                   GSIFTSE"
FT   gene            309594..310571
FT                   /locus_tag="Varpa_0294"
FT   CDS_pept        309594..310571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0294"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="KEGG: vap:Vapar_0284 rod shape-determining protein
FT                   MreC; TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34516"
FT                   /db_xref="GOA:E6V285"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:E6V285"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ADU34516.1"
FT                   /translation="MPLGTLDRTAPPLFNQGQSALSKLIFFGALSLFLMVADARFHIVQ
FT                   PIRATLGAVLYPVQWVALKPVQLMMGGGRYLEDLQTAQRNEADARKALMMQAQRASQAD
FT                   TLAQDNARLRELLELRQTTATPGRAAEVLYDAADPYTRKIVIDQGLAHGVAAGSPVIDA
FT                   HGVLGQVTQVLPLTSEVTLVIDRDLAIPVQNTRTGVRSVAFGDASAHGGGLELRFMAAN
FT                   ADLQEGDLLSTSGVDGIYPAGLPVAKIERIERRADSGFARIYCVPLASVTAARYVLVLE
FT                   PTGAPTAPPPAAPATTQRKRAEGKPGAGKNEKKPAAPAGAGGGR"
FT   gene            310568..311089
FT                   /locus_tag="Varpa_0295"
FT   CDS_pept        310568..311089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0295"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="KEGG: vap:Vapar_0285 rod shape-determining protein
FT                   MreD; TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34517"
FT                   /db_xref="GOA:E6V286"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:E6V286"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ADU34517.1"
FT                   /translation="MIKRPGQQQLLLPVSPLFMWTSLVVALLVNMIPIGRAAWMPDLLA
FT                   LVIVFWGVHQPSRVGIGAAFVFGLCMDVHQASMLGQHALSYTTLGFFAITIHRRLLWYP
FT                   VLSQALQVLPLFALSQLIEVITRMIGGGVFPGWSVLISPGVEAALWPLASALLLAPQRR
FT                   TPEPDENRPL"
FT   gene            311144..313114
FT                   /locus_tag="Varpa_0296"
FT   CDS_pept        311144..313114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0296"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein 2; KEGG:
FT                   vap:Vapar_0286 penicillin-binding protein 2; PFAM:
FT                   penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34518"
FT                   /db_xref="GOA:E6V287"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E6V287"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ADU34518.1"
FT                   /translation="MTEIRNVAADLARFKRRVIVIGLAVLFAFGLLSSRLIYLQVTRHE
FT                   DLAEQAESNRTAIVPVVPNRGLILDRNGIVLASNYSAYTLEITPSKVNDVEETIDNLTQ
FT                   VLEVSPRDRRRFKRLREDSRSFDSIPIRTRLSDEEVARFAAQRYRFPGVEIKARLFRNY
FT                   PNGETGAHVLGYIGRINQREKTAMEDWEEEEQANYKGTDYIGKLGIEQSYEKTLHGQTG
FT                   VEQMETSAGGRAIRRLASHPATPGNTVMLSLDIKLQKLVEDMFGDRRGALVAIDPKTGE
FT                   VLAFVSKPTFDPNLFVEGIDTESWKELSESLDKPLLNRALRGTYPPGSTYKPFMALAAL
FT                   QTGKRGASVVVNDPGYFNFGGHRFGSPEGNLGGVDMRRSIQLSSNIYYYSLANEMGVDL
FT                   IHDFMKPLGFGQITGIDLGGEVRGVLPSTEWKRNAYKRPEQKKWYAGETISLGIGQGYN
FT                   TFTMLQLAQATAIVADGGIKRKPHLVLATRNTVSGQVVPLPQPPPENLGYTAANVAVIR
FT                   EGLTSVVTSGTARSVFAGAGYQAAGKTGTAQAVTQAQNTKYNARALEEHQRDHALFMAF
FT                   APVSDPKIAVAVIVENAGWGAGAAAPIARRVFDYWLMDQYPSEADMAAIKIGKAGAPMG
FT                   KPRVASEVAWPVATTTPATAP"
FT   gene            complement(313252..314520)
FT                   /locus_tag="Varpa_0297"
FT   CDS_pept        complement(313252..314520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0297"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="TIGRFAM: fumarylacetoacetase; KEGG: vap:Vapar_0287
FT                   fumarylacetoacetase; PFAM: Domain of unknown function
FT                   DUF1969; fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34519"
FT                   /db_xref="GOA:E6V288"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6V288"
FT                   /inference="protein motif:TFAM:TIGR01266"
FT                   /protein_id="ADU34519.1"
FT                   /translation="MTALNATHDPKLRSWVASANEAGTDFPIQNLPFGRFRTAGSSEAF
FT                   RIGVAIGDQVLDLKAAGLVDTDDMNALMGASVKDRQALRAAISAGLAEGSDKQAAWSKA
FT                   LLAQAKAEMTVPCRIGDYTDFYTGIHHATTIGKLFRPDQPLMPNYKWVPIGYHGRASSI
FT                   GVSGQVFKRPQGQTKAPDAAEPSFGPSKRLDYELELGFLVGQGNALGEPIAIGEAEEHL
FT                   FGVTLLNDWSARDLQAWEYQPLGPFLAKNFASTLSPWIVTMEALAPFRARFERPAGDPQ
FT                   PLPYLDAPSNREAGALDITLEVLLQTAKMRAEGIAPARLTRGNTTEAAYWTAAQLITHH
FT                   TVNGCNLQPGDLLGSGTLSGPKPDEAGSLMELTLGGKQPITLPNGEKRTFLEDGDTLVM
FT                   RGYCERAGAVRIGLGEVSGTVAG"
FT   gene            complement(314678..315655)
FT                   /locus_tag="Varpa_0298"
FT   CDS_pept        complement(314678..315655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34520"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V289"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0288"
FT                   /protein_id="ADU34520.1"
FT                   /translation="MMKNAFALTRRAAALALLAAPLLTHAADFPSKPIRFIVPYTPGGT
FT                   TDLVARTVGQKVSEKLGQPVLIDNRGGAGGNIGMDAVAKAAPDGYTIGFGAISTNALNP
FT                   HIYKSMAFDPRKDFTAISLLGTSTIVLEVPAASPIKSVPDLIAAAKKNPGLPYATAGAG
FT                   TSMNLAGVMFAQMTGTELVHVAYKGSGPAITDMLGNNIGLMFDNLPASLPHIQAGKLRA
FT                   LAVAGPARSPSLPDVPTMAEAGLKGYALDPWFGVYGPANLPAPVVKALNEAFVEALAMP
FT                   DVKAKLQQAGFSPRGSTAQELATLTQTEYQRLGDVARKAGMTAD"
FT   sig_peptide     complement(315575..315655)
FT                   /locus_tag="Varpa_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(315652..316959)
FT                   /locus_tag="Varpa_0299"
FT   CDS_pept        complement(315652..316959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0299"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /note="TIGRFAM: homogentisate 1,2-dioxygenase; KEGG:
FT                   vap:Vapar_0289 homogentisate 1,2-dioxygenase; PFAM:
FT                   homogentisate 12-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34521"
FT                   /db_xref="GOA:E6V290"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6V290"
FT                   /inference="protein motif:TFAM:TIGR01015"
FT                   /protein_id="ADU34521.1"
FT                   /translation="MTDIPATERRYLGGFGNEYASEAVPGALPQGRNNPQRGPFDLYTE
FT                   LLSGTAFTAPRHENRRTWLYRRQPSVVSGRYQPYAQPHWTTGGAREIALPPEPMRWHPM
FT                   PLDGAAEADFIDGMHTVAANGDAESQVGIGSLMYLAGRSMDKRAFVNADGEMLVVPQQG
FT                   RLVITTELGVLDVKPGEIAVLPRGMVFKVALPDGLSRGYVCENYGAHFRLPELGPIGSN
FT                   GLANARDFQAPVAAFEEDGGAYELVKKFAGRFWKAPTKQSPFNVVAWHGNLAPVKYDTA
FT                   RFMAIGSISFDHPDPSIFTVLTSPSDTPGTANCDFVIFPPRWMVMENTFRPPWFHRNLM
FT                   SEFMGLVLGEYDAKPGGFKPGGASLHNCMVPHGPDEEAFDKATHADLKPHKLDNTLAFM
FT                   FESRFRFIPTNFALKSPALDTDYADCWAGLKDQFKP"
FT   gene            complement(317002..317193)
FT                   /locus_tag="Varpa_0300"
FT   CDS_pept        complement(317002..317193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34522"
FT                   /db_xref="InterPro:IPR021233"
FT                   /db_xref="UniProtKB/TrEMBL:E6V291"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0290"
FT                   /protein_id="ADU34522.1"
FT                   /translation="MQALITTPNLEAPDDFYEALIAAHQGLSTEESHAFNARLALVLAN
FT                   HIGSLAVLREAFEAARGS"
FT   gene            complement(317207..318928)
FT                   /locus_tag="Varpa_0301"
FT   CDS_pept        complement(317207..318928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0301"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   vap:Vapar_0291 FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34523"
FT                   /db_xref="GOA:E6V292"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V292"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADU34523.1"
FT                   /translation="MIDYQSLRFDYRRHADQDAAPPAHHPVVIVGAGPVGLTLAIDLAL
FT                   RQVPVVLLDNDNTLSSGSRAICFAKRSLEVFDRLGCGDRMVDKGVSWSVGKVFFHDEQV
FT                   YRFDLLPEPGHERPAFINLQQYYVEGYLVERAAALPLIDLRWNNKVTGIEQRDEGAVLT
FT                   VETPEGNYQLAAGYVAACDGSRSNLRQLLGQEAKGRTFRDRFLIADITMDAGPPPGRPK
FT                   ADAPPSGGQRGHEVPSVGGDILPTERRFWFDPSFHPGQSVLLHKQADGMWRVDFQLGWD
FT                   ADPVEERKPENITPRVRALLDSIGFADVQFQIGWASVYTFACQRMERFRHGRVLFAGDS
FT                   AHGVSPFGARGANSGVQDADNLAWKLAAVLKGDAPDALLDSYASEREYAADENIRHSTR
FT                   ATDFITPKSEVSRLFRDAVLELTKRHAFARTLVNSGRLSVPAVLRDSPLNTVDADAFKG
FT                   AMVPGAAAADAPAVRADGSTGWLLRECHGQQFTALVFGAGEAAERSAEVLKAFDAPLHI
FT                   VRVQGTTPEGELATQRYDAQPGTVYLLRPDQHVCARWRQPTPANIRAAIDRALARA"
FT   gene            complement(319075..320034)
FT                   /locus_tag="Varpa_0302"
FT   CDS_pept        complement(319075..320034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0302"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: vap:Vapar_0292 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34524"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E6V293"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0292"
FT                   /protein_id="ADU34524.1"
FT                   /translation="MSQAKKFASQADMEEKKITFSQISEHAWAYTAEGDPNTGIVIGDD
FT                   CVLVADTQATPAMAADVVRRIREVTDKPIKYVVLTHYHAVRVLGAAGYGAEHILASQDT
FT                   RDLIVERGEADKASEIGRFPRLFQNVETVPPGLTWPTMTFAGKMTLWLGKLEVQLIQLG
FT                   RGHTKGDTVVWLPGEKTLLSGDLVEFGATPYAGDAYFQDWPQTLDNIAALQPAALVPGR
FT                   GAALTTPAEVAEGLTGTRNFISDVYASVQEGVKAGRDLNTVYKDTYAKLKPKYSQWVIF
FT                   DHCMPFDVSRAYDEASGHADPRVWTAERDIEMWKALEG"
FT   gene            320183..321088
FT                   /locus_tag="Varpa_0303"
FT   CDS_pept        320183..321088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0303"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: vap:Vapar_0293 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34525"
FT                   /db_xref="GOA:E6V294"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V294"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADU34525.1"
FT                   /translation="MTKDSSHTGDSSDPPETDRSAQRGIQSIEVGGQLLRALVHHGRPM
FT                   ALKDLAREAEMTPAKAHPYMVSFGRLGLIEQDRASGHYLLGPLALQLGLISLQQADPVH
FT                   IATPLLSPLALQIGHTVALAVWGARGATIVRTAESPSPVHVTMRHGTVFSLTNTASGRI
FT                   FAAYLDADAVRQLLEEERQRQKPRKGAAAEPAAPAGGMPAVQPLPSWSDFERQLKEVRA
FT                   HGISRSDGEVIKGVSAMAAPVFDHTGAIVLAVTAIGPAGVFDTAWDGELSRALKACAGA
FT                   VSQRLGAPAAGPSGSSKPER"
FT   gene            321085..321840
FT                   /locus_tag="Varpa_0304"
FT   CDS_pept        321085..321840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0304"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: vap:Vapar_0294 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34526"
FT                   /db_xref="GOA:E6V295"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E6V295"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ADU34526.1"
FT                   /translation="MTRPDATDTTSISSPLAAAIALLRDARRIVVFSGAGLSRASGIPT
FT                   YRDADGLWKSQNALQFSHAEDLKRDPAGFTKFWGQRMSVVESATPNPGHRALAQLQRLR
FT                   PATRLVTQNVDGLLTQAGGLDVLELHGSLRRWRCDHCGNRSGPWPFHRCLRCGSHARPD
FT                   VVMFGEMLNPGVLLEAQVAAQESDLFMVVGSTTIVYPAAELPELAMARGSRLITLNLEP
FT                   LPHLDDSAAVVLRGTSEDLLPRLLAGLGG"
FT   gene            complement(321859..322353)
FT                   /locus_tag="Varpa_0305"
FT   CDS_pept        complement(321859..322353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0305"
FT                   /product="pentapeptide repeat-containing protein"
FT                   /note="KEGG: vap:Vapar_3355 pentapeptide repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34527"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E6V296"
FT                   /inference="similar to AA sequence:KEGG:Vapar_3355"
FT                   /protein_id="ADU34527.1"
FT                   /translation="MSSLQIIQDHDKWRKGTGGAPAGLAGESDGNVYLGLDLGLITFTS
FT                   STFKSSRFGTTSFVDAVWTACRFTGCSFSRCDMQRIKVNGCSFVGCTFAASQLRASIFS
FT                   DCTFSHCNLISLNFDASHWSRVKLLDCRGQQVSAADLVGEQVDFTGSRFEDMQFTNARI
FT                   N"
FT   gene            complement(322536..322757)
FT                   /locus_tag="Varpa_0306"
FT   CDS_pept        complement(322536..322757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0306"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34528"
FT                   /db_xref="GOA:E6V297"
FT                   /db_xref="UniProtKB/TrEMBL:E6V297"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0295"
FT                   /protein_id="ADU34528.1"
FT                   /translation="MNATRIVGILLIVAGIAGLGLGGFSFTKETHQAKLGPLEFSVKEK
FT                   QTVNFPAWAGVAAIVVGGALVLLGGKKS"
FT   sig_peptide     complement(322674..322757)
FT                   /locus_tag="Varpa_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.934 at
FT                   residue 28"
FT   gene            complement(322815..323489)
FT                   /locus_tag="Varpa_0307"
FT   CDS_pept        complement(322815..323489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0307"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   vap:Vapar_0296 protein of unknown function DUF330"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34529"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:E6V298"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ADU34529.1"
FT                   /translation="MKTTTHPLASALAGLGIALLVAGCGALPDKPARAKLYDFGPGVSA
FT                   MATAPAAAASPALPMLALAEIEANTRLDGTQILYRLGYADTNELRPYGQSRWSQPPAQL
FT                   LRQRLRDSLAERRTVLGPEESATLARSKGEVPDTLRISLDEFSHYFDSPASSAGLVRLR
FT                   ATLIRGGTGGDRVLGQKTFTVRRPAPSADAPGGVKALAAASDAAVAEVTQWMDALQRQP
FT                   RQ"
FT   sig_peptide     complement(323409..323489)
FT                   /locus_tag="Varpa_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.452 at
FT                   residue 27"
FT   gene            complement(323505..324461)
FT                   /locus_tag="Varpa_0308"
FT   CDS_pept        complement(323505..324461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0308"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: vap:Vapar_0297 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34530"
FT                   /db_xref="GOA:E6V299"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E6V299"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ADU34530.1"
FT                   /translation="MENKAHALAAGAFVLGLLAVLVGLVIWFTRDNTVRNVYELSTRDA
FT                   VSGLQPQAMVRYRGIAVGKVASIDFDPKVKGNVRVRITVDQRVPLTTSSFATLSYQGVT
FT                   GLAFIALDDKGESQVALKPNDDDPPRIPLKPSMLAQLQDRGEAIINQVEEVTKRANQLL
FT                   SDPNQKRAADALENIAAASASANTLLKTLDNTVKTGLNPALEKLPDTLGTVKKAASDVS
FT                   RVANNFNTTVGRLNAPDGPVERLSDGTKALAQAVDSFNAATLPRVNRVADDTSHAVRRL
FT                   GRAADSINDNPQSLLFGNGGAAAGPGEPGFSAPAARP"
FT   gene            complement(324471..325328)
FT                   /locus_tag="Varpa_0309"
FT   CDS_pept        complement(324471..325328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0309"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0298 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34531"
FT                   /db_xref="GOA:E6V2A0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34531.1"
FT                   /translation="MNTAVNNSSSSSDPTVVDIRKLWTVFKNADGEQVVHRDLNMHIDR
FT                   GEVLSLVGGSGTGKTVLLRQILGLEKPTQGVVEVLGQQPGELSASGAANVGMLFQHGAL
FT                   FSAFSVLENIAFPLRELKLLPDELIRHAALVKLQMVGLEPQHANKSPSDLSGGMIKRVA
FT                   LARALIMDPPLLLLDEPTAGLDPEASDSFCNLLRGLHRELGLTVVMVTHDLDTLFDLST
FT                   RIAVLADQKVIVSGTAREVIAYPHPFIHEYFLGGRGQRALEALHDKPATEQHAPRPEAA
FT                   RAER"
FT   gene            complement(325325..326491)
FT                   /locus_tag="Varpa_0310"
FT   CDS_pept        complement(325325..326491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0310"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   vap:Vapar_0299 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34532"
FT                   /db_xref="GOA:E6V2A1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A1"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ADU34532.1"
FT                   /translation="MPSATQTADAPAADSAWPRVAQQEQEGRQWTVATGRWTALGMSSL
FT                   PAWQALSKSLAAAPPADDRAWDLRPIEQLDHIGAQLLWEHWRHEWPATLEMEAQHKAVL
FT                   DQVAQYTVATPVEPPKTLADRIRTFSHNGPRAMVVARDFIGLIGQLAIDVGTLIRAPHR
FT                   APWRDFSGHLYQFGATALHITALVGLLIGVVLAYLISQQLRNYGAEAFVVNILGLSLVR
FT                   ELGPVLAAVLIAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRVLALAIAMP
FT                   LISLWTSMAALLGGMLAADAALDISPAYFLSALPRAVPIANLWLAMAKSAVFGILIALI
FT                   GCYFGMKVKPNTESLGRGTTSSVVTSITAVILVDALFAVLFKGIGFRG"
FT   gene            complement(326627..327541)
FT                   /locus_tag="Varpa_0311"
FT   CDS_pept        complement(326627..327541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0311"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0300 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34533"
FT                   /db_xref="GOA:E6V2A2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34533.1"
FT                   /translation="MTTAAMDLQILRAFVLAAKEGNVSRAAERLHLTQPAVSLQLKRFA
FT                   EETGLVLFTRTPHGLALTADGAAMLPQAERVLAAVGDLQQAARKLQGTVRGALRIGTIL
FT                   DPEFTRLGVFLRELVEAAPQIETELRHGMSGSVLAQVLRGDLDVGFHLDPGDDDQAATT
FT                   PAPALSVRPLTRFTYRVVAPAGWGPQVQGRDWKALAALPWLATPPESAHHRLLERVFAP
FT                   LGLSPRRVAMVDQEASMLDLLKSGIGLSLVRDSIAIRECQAHGLAMADRVQLDCALRFV
FT                   SLASRRDEPVIASAWDALAKAWN"
FT   gene            327628..329145
FT                   /locus_tag="Varpa_0312"
FT   CDS_pept        327628..329145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0312"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="KEGG: vap:Vapar_3271 methylmalonate-semialdehyde
FT                   dehydrogenase; TIGRFAM: methylmalonate-semialdehyde
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34534"
FT                   /db_xref="GOA:E6V2A3"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A3"
FT                   /inference="protein motif:TFAM:TIGR01722"
FT                   /protein_id="ADU34534.1"
FT                   /translation="MSMNIRNIDHYIAGLPAANASGRTQDVTNPATGAVTGKVGLADAA
FT                   QVSAAVAAAQAAFPAWADTPPIRRARVMFKFLQLLNEHKDELAHLITAEHGKVFTDAQG
FT                   EVSRGIDIVEFACGIPQLLKGDFTDQVSTGIDNWTLRQPLGVVAGITPFNFPVMVPMWM
FT                   FPVAIAAGNTFVLKPSPTDPSPSLLIAELFKQAGLPDGVFNVVQGDKVAVDALLEHPDV
FT                   KAISFVGSTPIANYIYETGAHHGKRVQALGGAKNHMVVMPDADIDQTVDALIGAGYGSA
FT                   GERCMAISVAVLVGDVADKVIPKLIERTKTLKVLNGTNLAAEMGPIVTRAAHERITGYI
FT                   AQGEKEGAKLLVDGRSFDGSVAGEGCGDGFWMGGTLFDHVTPEMRIYKEEIFGPVLSCV
FT                   RVENFKDAVDLINAHEFGNGVSCFTRDGNVAREFSRRIQVGMVGINVPIPVPMAWHGFG
FT                   GWKKSLFGDMHAYGEEGVRFYTKQKSIMQRWPESIGKGAEFVMPTAK"
FT   gene            329174..329782
FT                   /locus_tag="Varpa_0313"
FT   CDS_pept        329174..329782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_5383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34535"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A4"
FT                   /inference="similar to AA sequence:KEGG:Caci_5383"
FT                   /protein_id="ADU34535.1"
FT                   /translation="MQESGWQPIAGRVGHVGGIESFTLDGRHHYFGFDHKRGLVLSPAI
FT                   DDAAAMAHFASRHMQAIYRGRLFGLLGKTGPRDEAFWAEAVEWSENATDLPGQPERALA
FT                   SAQLAASVSKLGLAAQENRIAREFIPDALPCMLLAAAGDGSPDEAEGIQAEVAIVWGRE
FT                   PLPPGREIADVARALQARLNALVDRAQGNWAQIFSMLKS"
FT   gene            329809..331449
FT                   /locus_tag="Varpa_0314"
FT   CDS_pept        329809..331449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0314"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: vap:Vapar_0301
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34536"
FT                   /db_xref="GOA:E6V2A5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A5"
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /protein_id="ADU34536.1"
FT                   /translation="MRDNDNTFDYIIIGAGTAGSLIANRLSADKSKRVLLIEAGRKDDY
FT                   HWIHIPVGYLYCIGNPRTDWLYNTEPDAGLNGRALRYPRGKTLGGCSSINGMIYMRGQS
FT                   RDYDQWADLTGDDDWRWQNVLPAFKKHEDFYLGADELHGAGGEWRVEKQRLRWDILDAF
FT                   AEAAVQAGVPHTTDFNRGSNEGVGYFQVNQKNGWRWNTAKAFLRPTCYGRPNFELWTGA
FT                   QVSRLLFETQPDGTKRCIGAEVWNGSEMATAHAEREVILSAGAIGSPQILQLSGVGPAE
FT                   LLRQHGIDVVLDAPGVGANLQDHLQIRAVYKIDGAPTLNVLASSMLGKAKIGLEYLMKR
FT                   SGPMSMAPSQLGAFTRSSDAYEWPNLEYHVQPLSLDAFGDPLHSFPAFTASVCNLNPTS
FT                   RGSVRIKSKRFEDAPAIAPNYLSTDEDRKVAADSLRVTRRIAAQPALAKYKPEEWKPGV
FT                   QYQTDEDLARLAGDIATTIFHPVGTTKMGADGDPMAVLDAKLRVRGIQGLRVVDAGAMP
FT                   TITSGNTNSPTLMMAEKAAGWILEASRAA"
FT   gene            complement(331459..332526)
FT                   /locus_tag="Varpa_0315"
FT   CDS_pept        complement(331459..332526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0315"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: vap:Vapar_0302 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34537"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A6"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADU34537.1"
FT                   /translation="MSRTQKTFSLRRTLLGAAAVSLLAATGAASAQTKTLYIGMNGGTM
FT                   EKAYTQYVFPAFEKLYGAKVVVVPGTSSDILAKAQANKDRPQMHVMFLDDGIMVRAIGM
FT                   GLCQKQKPNPSLAEIYPAARFKDDMASGVSLGMTGLAYNAKMFKEKGWAAPTSWMDLAD
FT                   PKFKGKVVFQSMSSSSFGLHGFLMFNRIQGGNDKNVEPGFKAWPTTVGPNVLEYIPSSA
FT                   KLSEMVQTGEAAIFPLTPTAVAALKTKGIPVEYAPPKEGAVVLMVGQCVIANNSEPELS
FT                   QKLAEFLLSPLAQANVLQYGAQIPTNPKAPAVGEGATQVADINKWMKTAITIDWESINA
FT                   NRPAWNSRWNKTIEK"
FT   sig_peptide     complement(332431..332526)
FT                   /locus_tag="Varpa_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 32"
FT   gene            complement(332539..333726)
FT                   /locus_tag="Varpa_0316"
FT   CDS_pept        complement(332539..333726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0316"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   vap:Vapar_0303 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34538"
FT                   /db_xref="GOA:E6V2A7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADU34538.1"
FT                   /translation="MSSIRTLRTDVAIVGGGIVGSSAALALRQMGIGVALLERDLCGSR
FT                   SSGVNFGGVRRQGRPLSQLPLAQRAHRIWGRLPSLLDTDGEYLRSGHFKIARSESDMAS
FT                   LERYRAQSLDFDLGLELISAARLRERCPWLGPRAVGGSLCVEDGQANPRLVSPAFALAA
FT                   QRAGAQIFERHKVDEVAHDGAMFMLRSGNALEVHAPVLLNCAGAWAGPLAAQFGEAVPL
FT                   RASHPVMVVTEPLPHFMVWSLGVEGGGIYGRQVARGNLVLGGGRGYALDADRARVDRDA
FT                   IATLATQAIELLPALRHAHFIRTWSGTEGNMPDRQPVLGPSRTTPGLFHGFGFSGAGFQ
FT                   IGPAAGEVLAELVRDGHSSTPIDAFAVDRSFPEEDGEAADEEQTHSPLTSVPTLP"
FT   gene            complement(333723..335135)
FT                   /locus_tag="Varpa_0317"
FT   CDS_pept        complement(333723..335135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0317"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: vap:Vapar_0304 BFD domain protein
FT                   (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34539"
FT                   /db_xref="GOA:E6V2A8"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A8"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ADU34539.1"
FT                   /translation="MTTNAGLQPVIVGAGPAGVRAAEALVAHGLRPLVIDEASRAGGQI
FT                   YRRPPANFIQRTAATLYGFEASRANAVHLAFDTLHDHIDYRPDSLVWNAQGGMLDVLHN
FT                   PTRTTTRVPHGALIVATGATDRVLPVPGWTLPGVYTLGGAQVALKFQGCAIGQRVVFMG
FT                   TGPLLYLVAYQYAKAGAKVAAVLDTARLADQIAATPAMLRQPAVFAKGVYFVAWLRAHG
FT                   VPLHSGVRPLRVIGDDEARRVTGVAWNDGREERTLACDAVGFGYALRSETQLADLLGCR
FT                   FEFAPMHRAHLPVRDAAGRASVEGVYLAGDGAGIMGADAAEWAGERAALALLADRGVAI
FT                   DAARAAALEAKLEGLMGFRRGLERAFPLPHDWAANAPDDLVVCRCENVTAGTLRQTIAV
FT                   NGADEMNRLKALSRVGMGRCQGRMCGVAAAEILAHATGQPLQQVGRLRGQAPIKPIPIQ
FT                   LAVHAASEGAGA"
FT   gene            complement(335132..335437)
FT                   /locus_tag="Varpa_0318"
FT   CDS_pept        complement(335132..335437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34540"
FT                   /db_xref="GOA:E6V2A9"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0305"
FT                   /protein_id="ADU34540.1"
FT                   /translation="MASTASHALLHRVAETGRAAVAFTLDGEPASALAGDTVLTAVLTQ
FT                   AGQLRRNEFSDMPRAGFCMMGACQDCWIATAEGERLRACSTFIAPGMALVTGRSGA"
FT   gene            complement(335438..336232)
FT                   /locus_tag="Varpa_0319"
FT   CDS_pept        complement(335438..336232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0319"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0306
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34541"
FT                   /db_xref="GOA:E6V2B0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34541.1"
FT                   /translation="MSKNGPFALAFNALVITFMLAPLLVVCIVAFTPENTLTIPTTSFS
FT                   LRWFAAVFAHPDFMQSFWNSLWLALASATIATLLAVPAGMAITRYEFPGRDFLNALFLS
FT                   PLIIPHLVLGVALLRLFALVGGTGSFGWLVMAHALIVTPYTLRLVVAALVGFDRSAEQA
FT                   ALSLGASQATVFRRITLPMILPGVTGGWMLAFINSFDEVTMSIFVTSPSTVTLPVRMYM
FT                   YATESIDPLMAAVSALMVAVTAIAMVILDRLYGLDRVLVGRK"
FT   gene            complement(336237..337097)
FT                   /locus_tag="Varpa_0320"
FT   CDS_pept        complement(336237..337097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0320"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0307
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34542"
FT                   /db_xref="GOA:E6V2B1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34542.1"
FT                   /translation="MSGIRNKAAPWWLSGPALLLFTALLLVPLLLTAVLSFNVYDPATG
FT                   PKAGEFTLAHYAHVFTDSYYHGIFWRTFWISALVTLICVVIGAPEAYVLSRMRNPWRSI
FT                   LLLVVLAPLLVSVVVRAFGWSMLLGPEGAVNSLLGLVGIGPVKMLYTEIAVIVALVHVM
FT                   LPFMVIPVWTSLQKLDAGVENAALSLKASPFTTLRRIVLPQVMPGILSGSLIVFGLAAS
FT                   SFAIPGLLGGRRLKMVATVVYDEYLSELNWPLGAAIALTLLAANLIVMLSYNRLVEGRY
FT                   KKALG"
FT   sig_peptide     complement(336996..337097)
FT                   /locus_tag="Varpa_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.294 at
FT                   residue 34"
FT   gene            complement(337094..338221)
FT                   /locus_tag="Varpa_0321"
FT   CDS_pept        complement(337094..338221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0321"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0308 ABC transporter related; PFAM:
FT                   ABC transporter related; Transport-associated OB
FT                   domain-containing protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34543"
FT                   /db_xref="GOA:E6V2B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34543.1"
FT                   /translation="MACTKVSHAIFGSPTKGASMSFLRLTDVTKFYGSTRAVSAMNLSV
FT                   EKGEFVSLLGPSGCGKTTTLQMIAGFEAVSSGRIELAGKDITNAKANTRGLGIVFQSYA
FT                   LFPHMTVADNVSFGLEMRKMPKAERADRVKQALALVHLEPHATRYPRELSGGQRQRVAL
FT                   ARALVIEPPVLLLDEPLSNLDAKLREEMQFELRQIQRKVGTTTVMVTHDQSEAMSISDR
FT                   VVVMEGGCATQIDHPHRVYEHPSTRFISTFVGKANLLNGRVTACSTGSCNVEVGPLAVQ
FT                   VDEDGFKSGAAVLLSVRPEKLQLVTAGRGRLDGTVQERFFLGSQWLYRIATPAGDLMVL
FT                   SPNDGRDALDEGNAVGIDWPAHCTRLLPAEEAVAA"
FT   gene            338371..339249
FT                   /locus_tag="Varpa_0322"
FT   CDS_pept        338371..339249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0322"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: vap:Vapar_0309 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34544"
FT                   /db_xref="GOA:E6V2B3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B3"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADU34544.1"
FT                   /translation="MESNSEAAAASPASSGGVPRVFSVIRALGAVQAEGGRVTQIARSV
FT                   GLTQATTHRLLQSLMAEGMVEQDERSKLYRLSIDFFALAASAGNPGDLRSICRPVLLRL
FT                   CASLGDSIFLLARSGFDAICLDRSEGPFPIRSFTGDIGGRIALGVGQGALAILAFLPEA
FT                   EREEVIRFNLSRVREYGVYDEVYLRTEIERVRQQGYAGRNTGLLEGMAGVAVPILDREG
FT                   RAVAALSVGTIADRLNADRMPTVVELLKREAAAIGPKINPFDATLRRPAQSLAGSPGGQ
FT                   KIALPEAPGPG"
FT   gene            complement(339250..339750)
FT                   /locus_tag="Varpa_0323"
FT   CDS_pept        complement(339250..339750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctt:CtCNB1_3401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34545"
FT                   /db_xref="GOA:E6V2B4"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B4"
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_3401"
FT                   /protein_id="ADU34545.1"
FT                   /translation="MKLIHALYAAIHALMALAFAIASIVLVVIAARAGWGAVMQGLGLP
FT                   TAEAIIEAVGVLAAGVVALQISQTVLEEEVLREAHISAPTRVRRFLSRFMVVIVVAVAV
FT                   EGLVATFKAREAPELMLHAATMLGAVGLLMAGWGLFIRFNRYAEELEPEAMEEAKSEDR
FT                   KLK"
FT   sig_peptide     complement(339649..339750)
FT                   /locus_tag="Varpa_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.535 at
FT                   residue 34"
FT   gene            339978..341516
FT                   /locus_tag="Varpa_0324"
FT   CDS_pept        339978..341516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0324"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: vap:Vapar_0310
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34546"
FT                   /db_xref="GOA:E6V2B5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B5"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADU34546.1"
FT                   /translation="MSEAQAILSVPTEVEQLLQRLGVPRTAYTGGELTVRSPVSGEVIA
FT                   QVPQTTAVEATGAIGRAHEAFKAWRNVPAPRRGELVRLLGEELRAAKRDLGSLVTLEAG
FT                   KIPSEGAGEVQEMIDICDFAVGLSRQLYGLTLATERAEHRMMETWHPLGVCGVISAFNF
FT                   PVAVWSWNAALALVCGDSVVWKPSEKTPLTALAVHAIAQRAIERFGDAPEGLLGLLLGQ
FT                   RDIGEVLVDDHRVPILSATGSTAMGRQVGPKLAARFARAILELGGNNAAIVTPSADLDL
FT                   TLRGIAFSAMGTAGQRCTTLRRLFVHDSVYDQLVPKLAKVYGNVQVGDPREAGTLVGPL
FT                   IDRAAFDGMQKALSESREIGAKVHGGSRVDGIGTQDAYYVRPALVELKSHDGPVLRETF
FT                   APILYVVRYSTLDEAIEWHNAVGAGLSSSIFTLNVREAERFMSSAGSDCGIANVNIGPS
FT                   GAEIGGAFGGEKETGGGREAGSDSWKAYMRRATNTINYSTALPLAQGVTFDIGD"
FT   gene            341615..342523
FT                   /locus_tag="Varpa_0325"
FT   CDS_pept        341615..342523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0325"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: vap:Vapar_0311 extracellular solute-binding
FT                   protein family 3; PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34547"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B6"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADU34547.1"
FT                   /translation="MKKQLKTLATAALLALAFGATATAQQAPTGGTLDKIKASGKVVLG
FT                   VREASPPMAYMLGAGEKYVGYHVELCERVLKDITPNAKLEYMAVTAQNTIPLVQNGTLD
FT                   IGCGPTTNNTARQQQVAFALTTYVSEVRMATRVDSGITTLDQLAGRNVSASTGTTAVQL
FT                   LRKRERAQNVSYNTMLGKDHLESFLLMESGRADAFVLDDNLLAGIIANSKNPAAYRIVG
FT                   DALGSEPIALLFRKDDPAFKTAVDESLRKLMKSGELEKIYTKWFVAAIPPKNTSLNLPM
FT                   SPALKQLLLEPNDKPLEAYAK"
FT   sig_peptide     341615..341689
FT                   /locus_tag="Varpa_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 25"
FT   gene            342520..343737
FT                   /locus_tag="Varpa_0326"
FT   CDS_pept        342520..343737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0326"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   vap:Vapar_0312 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34548"
FT                   /db_xref="GOA:E6V2B7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B7"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADU34548.1"
FT                   /translation="MTDAAVFSPAQRVRAIHVSEILRITDHAQALKRAGRPVIVLGAGE
FT                   PDFDTPENIRHAASQAIARGDTRYTVLDGSPAMKAAVQLKFKRDNALDFAPDEISVSAG
FT                   AKQVIFNALMASLDPGDEVILPAPYWTSYADIVQICGGVPVSVACGEENGFRLTAAQLQ
FT                   AAITPRTRWLFLNSPSNPSGAAYSAAQLKPITDVLLDHSGVWVLADDIYEHILYDGLAF
FT                   ATPVAVEPRLRDRTLTVNGVSKAYAMTGWRVGYGAGPRALIAAMAVVQSQSTSCPSSVS
FT                   QAAAIEALTGPQGIVAERCASFQQRRDFVVAALNRTQGLHCRVPEGAFYTFASCAGVLG
FT                   KRTATGALLQTDSDFCRYLLQDFDVAVVPGSVFGLAPYFRISYATSMAQLEEACARISA
FT                   ACAALT"
FT   gene            343895..345568
FT                   /locus_tag="Varpa_0327"
FT   CDS_pept        343895..345568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0327"
FT                   /product="thiamine pyrophosphate TPP-binding
FT                   domain-containing protein"
FT                   /note="PFAM: thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; thiamine pyrophosphate central
FT                   domain-containing protein; KEGG: vap:Vapar_0313 thiamine
FT                   pyrophosphate protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34549"
FT                   /db_xref="GOA:E6V2B8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B8"
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /protein_id="ADU34549.1"
FT                   /translation="MTSSRTGGQILVDQLITHGVQQLFCVPGESFLAVLDALHDASIDV
FT                   TVCRQEGGATMMAEAQGKLTGKPGICFVTRGPGATNAAAGVHIAHQDSTPLLLFVGQIA
FT                   RDAMGREAFQELDYGAVFGTMAKWVVQIDDPARVPELVSRAFHVATSGRPGPVVIALPE
FT                   DMLTEAAVVADALPYAVTETHPGAAQLAELQQRLSQAQRPVVILGGSRWSEAATQQFAK
FT                   FAEAYALPVYCSFRRQMLMSAEHPCYAGDLGLGANPRMLARIRDADLVLLVGGRLSEVP
FT                   SQGYELFAIPQPKQALVHVHADADELGKLYRPAQGIHATPQAFAEAVSALRPASAPAWQ
FT                   AETKTAREDFLRWSDPAPIRIPGPLQMGEVMQHLREVLPADTIFCNGAGNFATWVHRFW
FT                   PFRAFASQLAPTSGSMGYGLPAGVGAKRLWPEREVVVFAGDGDFMMHGQEFATAVQYGL
FT                   PILVVLLDNGMYGTIRMHQEKHYPGRISATQLKNPDFRGYAEVFGGHGERVTTTEEFGP
FT                   ALARARASGKPAILHCLLDPEAITPASTLQSIRKAALAAN"
FT   gene            complement(345623..346717)
FT                   /locus_tag="Varpa_0328"
FT   CDS_pept        complement(345623..346717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34550"
FT                   /db_xref="InterPro:IPR021259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0334"
FT                   /protein_id="ADU34550.1"
FT                   /translation="MIGIGEAFSPRYAQARQKFLQGCVSAGLTVEPHAHPLKGRDGEDL
FT                   SMDVALDGDANAERLLLVTSACHGVEGHCGSGVQVFALHDAEWRDKAKAQGVAVLYVHA
FT                   LNPHGFSYARRVTHENVDLNRNFIDFSQPVPVNEPYAKLHPLLLPDTWPPTPENQAAVE
FT                   KWIEKHGTTAYQAAVTSGQYQFDDGLFFGGKAPTWSNKTIRGVLRRHAGNAKRIAWIDL
FT                   HTGLGPNGLGERIYAGKDDKTAYARANAWWGTPAAPVTSIYDGSSTSALLRGLMWDAVY
FT                   EECPKAEYTGIALEYGTLPILEVTGALRADHWLHKHPDAPADLADGIRARMVEAFYTDT
FT                   DAWRGQIVSQARQAMFQAVDGLNG"
FT   gene            complement(346714..347919)
FT                   /locus_tag="Varpa_0329"
FT   CDS_pept        complement(346714..347919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0329"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="TIGRFAM: amidohydrolase; KEGG: vap:Vapar_0333
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34551"
FT                   /db_xref="GOA:E6V2C0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C0"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADU34551.1"
FT                   /translation="MKLIDSLVTQAAGIAAVRRDLHAHPELCFQEVRTADVVAGKLTEW
FT                   GIPIHRGLGTTGVVGIVKNGTSNRAVGLRADMDALPVTELNTFAHASKHHGKMHACGHD
FT                   GHTAMLLAAAQHLAKNRNFDGTVYLIFQPAEEGGGGAREMIKEGLFEQFPMDAVFGMHN
FT                   WPGMKAGQFAVSPGPVMASGNKFFVNVIGKGGHAALPQTGIDPVPIACEIVQAFQTVLT
FT                   RKMKPTDSAVISVTTIHAGEANNVIPDNCELSGTVRTFSIEVLDMIEAKMRQIAEHICA
FT                   AHDATCDFRFERYYPPTINTEAEAHFARDVMAGIVGPENVLKQEAAMTSEDFAFMLQAK
FT                   PGAYAFIGNGDGTHRDVHHGEGPCTLHNASYDFNDDLIPLGATCWVQIAEQFLNKPGGN
FT                   VS"
FT   gene            complement(347998..349191)
FT                   /locus_tag="Varpa_0330"
FT   CDS_pept        complement(347998..349191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0330"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: vap:Vapar_0332 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34552"
FT                   /db_xref="GOA:E6V2C1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C1"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADU34552.1"
FT                   /translation="MRTLQIALTATAALCVAACSGTGPSGPAKLLTLDGNPPLVIAHRG
FT                   ASGYLPEQTLEAYAKAIELGADVIEMDLVSTKDGVLIARHDPNLAISTDVAKHARFASR
FT                   KKTIKVDGETQTGWFSNDFTLAEIKTLGGISTDAERPQEFNGKFKIVTFQEIIDFAKAK
FT                   SKETGRTIAIYPETKNPTYFRDLGMPMEDKVVAAINAAGWNSKTAPIYVQSFEPGSLKY
FT                   MKAKGLNTKLIQLIDGDGIDMKTGAMTYAIPVDRPYEWTKAGDTRNFDVMVTPAGLAEI
FT                   KTYADGIGPWKRYIVTIKGSIGPDGKPLDVNKDGKVNDADATSVSPTTLIADAHKAGLF
FT                   VHPFTFRNESRRLAADYNKDGKNEYAIYYKLGVDGVFTDFTDTALAARADYLKSMGR"
FT   sig_peptide     complement(349129..349191)
FT                   /locus_tag="Varpa_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.673 at
FT                   residue 21"
FT   gene            349292..350458
FT                   /locus_tag="Varpa_0331"
FT   CDS_pept        349292..350458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0331"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="KEGG: vap:Vapar_0331 acetylornithine deacetylase
FT                   (ArgE); TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34553"
FT                   /db_xref="GOA:E6V2C2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C2"
FT                   /inference="protein motif:TFAM:TIGR01892"
FT                   /protein_id="ADU34553.1"
FT                   /translation="MPHTLSPQSLALAQSLVRMNTVSENSNLQLIDLAQSHLAALGVKS
FT                   RITYNAERTKANLFATLGEGKPAGVIISGHTDTVPWDGQDWSVDPLSAVVQHERLYGRG
FT                   SADMKSFIAIALSNAKRFLESDSPFAVHFAFSYEEEIGCFGVKELIADMRDAGIKPLAC
FT                   IVGEPTSMVPAIAHKGVYRYKCCVRGKEAHSSLTPKSVNAIEMAARVIGKVRDMAEDFE
FT                   RSEPRYEGFDVPFSTASVGQFHGGIADNVVPRDAEFRYEFRDLPTADAKRMQSDVLAYA
FT                   AGLEPAMKKVAPDAGFKFETICEIPSFLGAANDPVTLLAQRLAGEDRTTLVAFGTEAGL
FT                   FKNAGIPTVVCGPGSIEQAHQPDEFVSLEQLARCELFMERLATSHTIG"
FT   gene            350490..351713
FT                   /locus_tag="Varpa_0332"
FT   CDS_pept        350490..351713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0332"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   vap:Vapar_0330 protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34554"
FT                   /db_xref="GOA:E6V2C3"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C3"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ADU34554.1"
FT                   /translation="MKRVALGLLCAAALLYALASALHAQHPAWGYVAAFAEAAMVGAIA
FT                   DWFAVVALFRHPLGLPIPHTAIIPSNKDRIGAKLAGFICNNFLSTAQVLAKLREFDTAG
FT                   RIADWLARPASGEKLGEWGVAATRYGLTAFDDDRVRDFMGRAAAAGLEKIDLSRLTGQA
FT                   LDALTAGGRHQALLDDVLQQVAGLLEGEEVQAHITEAIAREIKTLRYVGLDQVAAKLAT
FT                   RKIVAAVAHTIGELAAEPDHPMRKRFDHFVDDFVVRLKLDPEFQQRGEQIRAELMAHPA
FT                   LGDYLHGLWGELLAWLDRDLRRGDSTIRQRIASMAGALGTRLQADEAIRHWINEQIEAA
FT                   APLAIERYREDIRRYIEERVGEWNAEEMTVELERHIGRDLQFIRINGTLVGGLVGLAIH
FT                   TATQLLRG"
FT   sig_peptide     350490..350564
FT                   /locus_tag="Varpa_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.879 at
FT                   residue 25"
FT   gene            351832..353541
FT                   /locus_tag="Varpa_0333"
FT   CDS_pept        351832..353541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0333"
FT                   /product="SMP-30/Gluconolaconase/LRE-like region-containing
FT                   protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE-like
FT                   region-containing protein; KEGG: vap:Vapar_0329
FT                   SMP-30/gluconolaconase/LRE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34555"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C4"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADU34555.1"
FT                   /translation="MPRGSFRSAAALVAVLALLGACSTVAPLLPSPTPAVPASTPPSPS
FT                   PTAAGRPASWAAPEALVPPSSFSGVHGLAIDAKGRLLAGSVLGNTLWEVDRTTGAAKVL
FT                   IDAPEGQADDIAVGPQGELAWTNYLMGMLRYRESDAAPMRVLAKDLPGLNSLDFDRKNG
FT                   KLYASQVFLGDALWEIDRAGQKPPRLIKKDMGGFNGFEVGPDGLLYGPLWFKGQVVKID
FT                   PANGNMTVIADGFKIPAAANLDGKGNLWLVDARSGELVRVELATGNKTVAKQLRPSLDN
FT                   LVIAPDGTIYVSNMANNEVQAFNPATGELRTLTSGKVAVPAGLKIDGNDLWVADVFGFR
FT                   QVDVRTGEVRDVFRMQREPELDYPFAVGLSPTRFALTSWFTGTVQLVDRQTLKTVATIH
FT                   GLKAPFDAIPMPDGSVIYAEIATGSITRASGPKFADKSVLASGLNGPVQMVLGQDGALY
FT                   VTEAAGKLLRIPLDASAPLRTIVDGLALPEGVAETPWGTFIVAESAAGRLVEIDPANGT
FT                   RRTIAENLPIGLAPGPALPPPYVVTGVAVGADGTVYVSADRNNAIYRIRAVR"
FT   sig_peptide     351832..351909
FT                   /locus_tag="Varpa_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.637) with cleavage site probability 0.453 at
FT                   residue 26"
FT   gene            353676..354452
FT                   /locus_tag="Varpa_0334"
FT   CDS_pept        353676..354452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0334"
FT                   /product="putative integral membrane sensor protein"
FT                   /note="PFAM: MHYT domain protein; KEGG: vap:Vapar_0328
FT                   putative integral membrane sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34556"
FT                   /db_xref="GOA:E6V2C5"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C5"
FT                   /inference="protein motif:PFAM:PF03707"
FT                   /protein_id="ADU34556.1"
FT                   /translation="MTPLVVGQLLSPEYSLGLVALSFLISFAGSLVALICAGRMVNADG
FT                   KPNLALVACAAVALGGIGIWSMHFIGMLAYRLPVAISYNMPLTIVSLVAAILISGIALY
FT                   LAGGRRKFSKPGWAAGSLLAGVGVCVMHYMGMFAMNMRATMELDMGTVALSVVIAITAA
FT                   AAALWLAFNLRKLSHQIGAAAVMGVAVCTMHYVGMTAASMICTAAAPTDALAIGGSYMG
FT                   LSVFGTAGAVLIFIYWVATGNSLDAPTPQRARPRTS"
FT   gene            354527..356137
FT                   /locus_tag="Varpa_0335"
FT   CDS_pept        354527..356137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0335"
FT                   /product="Methylcrotonoyl-CoA carboxylase"
FT                   /EC_number="6.4.1.4"
FT                   /note="KEGG: vap:Vapar_0327 methylcrotonoyl-CoA
FT                   carboxylase; PFAM: carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34557"
FT                   /db_xref="GOA:E6V2C6"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C6"
FT                   /inference="protein motif:PRIAM:6.4.1.4"
FT                   /protein_id="ADU34557.1"
FT                   /translation="MPVIESRLSSASDTFQANRTGMLALLDQVRAHEARAASASGASAE
FT                   RFAKRGQLLPRERIALLLDTGAPFLPLASLAGLGHDNPDLSKSVPGGGLISGIGQVAGV
FT                   RCMVSASDSGIDAGALQPMGLDKQLRVQEIALENKLPYVQLVESAGANLMQYRVQDFVR
FT                   GGSIFRNLARLSAAGLPVVTVTHGSSTAGGAYQTGLSDYIVMVRDRTRAFLAGPPLLKA
FT                   ATGEIATEEELGGAVMHTHISGLGDYLAEDDRDAIRIARSILGGIDWTRDEAPRAFTPP
FT                   RYDAEDLLGIMPSDGRRPVDMREVIARIADGSEFLEFSEHYGSATVCAHIRLEGHAVGI
FT                   VTNNGPIDSDGATKATHFIQACCQSRTPIVYLQNITGYMVGRAHEEAGIIKHGAKMIQA
FT                   VTNATVPQITLYCGASYGAGNYGMCGRGFAPRFCFSWPNARTAVMGGEQAAKTMAIVME
FT                   AGMARKGAVDTAKIDAMQQQIVERFDRQMSVFTTSAMLLDDGVIDPRDTRAVLAEVLSV
FT                   CRDADARVPQAMQFSVARP"
FT   gene            356134..358086
FT                   /locus_tag="Varpa_0336"
FT   CDS_pept        356134..358086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0336"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein;
FT                   biotin/lipoyl attachment domain-containing protein; KEGG:
FT                   vap:Vapar_0326 carbamoyl-phosphate synthase L chain
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34558"
FT                   /db_xref="GOA:E6V2C7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C7"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADU34558.1"
FT                   /translation="MKGFNKILIANRGEIAVRVMRTARTMGYRTVAVYSSADADAEHVR
FT                   QADQAVWIGESLPAQSYLNIAAIIEAARASGAQAVHPGYGFLAENAGFAEACRNAGLVF
FT                   IGPSPEAIRAMGDKAGAKRLMRAAGVPCIPGYQGEDQSQSTLAAEAARIGWPVMIKATA
FT                   GGGGRGMRLVPSAAAFADLLQSAQSEALNAFGNATVILERAVVAPRHIEIQVFADRHGN
FT                   GIHLGERDCSVQRRHQKVIEESPSPAVSAELRERMGATAVAAAKAIAYEGAGTLEFLLD
FT                   ADGQYWFMEMNTRLQVEHPVTEAVTGLDLVELQLRVAAGEPLPLTQQDVQMNGHAIEVR
FT                   LCAEDPQQGFMPQSGTLAAWRPSPALRIEHALRDGAEVPAFYDSMIAKLVSHGRTRDEA
FT                   RQRLIAGLQDTVALGIATNQEFLRRALSHPVFAEGAATTAFIAEHAEALLAPDAAMEGR
FT                   AALLAALLLQLGERGWPSPLAHTLPNALRFSLNGEVHAARVTPQGAGRFDVAVDATGPE
FT                   RIELLALPGDGVVRFSCGGVSEQAMSVRKSATHLWIHFSGQAFELENLTHVAVPRAGAA
FT                   GGDGLLRASMNGRVIALLAAEGDTVAAGQPLVTLEAMKMEHVHCAPRAGRVAALHVAVG
FT                   AQVAARHVVAEIADA"
FT   gene            358127..359038
FT                   /locus_tag="Varpa_0337"
FT   CDS_pept        358127..359038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0337"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0325 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34559"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU34559.1"
FT                   /translation="MNASSRYRSVFSPGLFDGQVIVVTGGGSGIGRCTAHELASLGAQV
FT                   VLVGRNAEKLQQVQKEIATAGGKASTQAFDIRQEEAVRTAIAEVVAAHGRIDGLINNAG
FT                   GQYITPLAAISAKGWEAVIHTNLTGGFLVARECFVQSMQANGGAIVNIVADMWGSMPNM
FT                   GHSGAARAGMVSFTETAALEWAANGVRVNAVAPGYIASSGMDHYPPEAGDMLRAMRKTV
FT                   PAGRFGNEAETSAAIAFLLSPAASFISGSVLRVDGARPQVRMGWPMALPDAAAQQRPAV
FT                   RAFDGFHLAQTPRVFQDKETND"
FT   gene            359070..360230
FT                   /locus_tag="Varpa_0338"
FT   CDS_pept        359070..360230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0338"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: vap:Vapar_0324 acyl-CoA dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34560"
FT                   /db_xref="GOA:E6V2C9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C9"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADU34560.1"
FT                   /translation="MQYTHEHLEIQKTLRRFIDDEINPHVDEWEAAEIFPAHEVFKKLG
FT                   NLGMLGLNKPEAFGGAGLDYSYAMAMAEALGHVSCGGVPMAIGVQTDMCTPALARFGSD
FT                   ELRREFLAPAIAGDTVGCIGVSEPGAGSDVAGLKSHARKDGDDYLISGQKMWITNSLQA
FT                   DWMCMLVNTSDGPVHRNKSLVMVPMDSPGIEKAKKIRKIGMNSSDTGLIYFDNVRVPQR
FT                   YRIGEEGQGFVYQMQQFQEERLWAAASSLEPMEDCIAQTIEWAQQRHMFGGTLADQQWV
FT                   QFKLAELKTEVEALRALTYRACDLHVQGEDVLELASMAKLKTGRLTRQVSDTCLQFWGG
FT                   MGFTLENRVSRLYRDGRLGSIGGGADEVMLGILAKTMGIAKRPPRG"
FT   gene            360246..361424
FT                   /locus_tag="Varpa_0339"
FT   CDS_pept        360246..361424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0339"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ctt:CtCNB1_1722 acyl-CoA dehydrogenase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34561"
FT                   /db_xref="GOA:E6V2D0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D0"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADU34561.1"
FT                   /translation="MDAELQADRAALADTVRRFAENEIAPNVEAWDDAGEFPRALYTRA
FT                   AELGLLGLGYAEAFGGTPASYSLKLPAWIALARHGKSGGVLASLFSHNIGLPPVVLHAS
FT                   DAVRHEVVPAVLRGEKIAALAITEPGGGSDVAALRTTARRESAGDGDHYVLNGEKTFIT
FT                   SGMRAHWITVAVRTGEGRGAGGISMLLVPGDALGLSRKRLTKMGWWCSDTATLHFDNVR
FT                   VPARYLLGDEGAGFRMIMGNFNGERIGLAAGALGFAQACLDEALAWSRERKTFGAALIE
FT                   HQAVRHKLVDMQMRIASTEAWLEAVSAEGDAHEAAGRFNAPEWVAQVCMLKNHATQTMQ
FT                   FCADQAVQILGGMGFMRGTVSERIYREVKVMMIGGGAEEIMKELAARQLGWL"
FT   gene            361590..361910
FT                   /locus_tag="Varpa_0340"
FT   CDS_pept        361590..361910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0340"
FT                   /product="Stress responsive alpha-beta barrel
FT                   domain-containing protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel
FT                   domain-containing protein; KEGG: reu:Reut_B4139 antibiotic
FT                   biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34562"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D1"
FT                   /inference="protein motif:PFAM:PF07876"
FT                   /protein_id="ADU34562.1"
FT                   /translation="MTEARTMFKHIVMWDLRGESPEEKAEAVQLLKRKFESLRGQIPGL
FT                   LHLEVGVDSSRIAYACDVVLYSEFDSQASLDGYATHPAHLRVREELGDLRIARHQVDYA
FT                   ME"
FT   gene            complement(361922..363187)
FT                   /locus_tag="Varpa_0341"
FT   CDS_pept        complement(361922..363187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0341"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: vap:Vapar_0322 DEAD/DEAH box helicase domain
FT                   protein; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34563"
FT                   /db_xref="GOA:E6V2D2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D2"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADU34563.1"
FT                   /translation="MPFDSLGLAPALVQAAAESGFAAPTAIQAAAIPPILQGRDVRGSA
FT                   QTGSGKTAAFSLPLLQRLAAEPAQSPRRVRALVLVPTRELAAQVGETMRSLAQHLPERL
FT                   KIAIAFGGVSINPQMMSLRGGADIVVATPGRLLDLVEHNALKLGAVSMLVLDEADRLFD
FT                   LGFAEELGRILALLPAQRQNLLFSATFPPAIQSLADGMLRDPAVIDMQGEPGTEPNIVQ
FT                   RVIEVDANRRTQLLRHLLKENEWERVLVFVATQHSAQIVAEKLYKNGVYAVPFHGDIAQ
FT                   GTRTGILAQFKESRWDVVIATDLAARGIDIAQLPVVINYDLPRSPTDYIHRIGRTGRAG
FT                   ESGLAISFVSASTEAHFRLIEKRQGLLLPRERIEGFEPTEVAVPLVDASGTGGIKGKRP
FT                   SKKDKLRAAAQAAQQGESEKND"
FT   gene            363236..363616
FT                   /locus_tag="Varpa_0342"
FT   CDS_pept        363236..363616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0342"
FT                   /product="translation initiation factor SUI1"
FT                   /note="KEGG: vap:Vapar_0321 translation initiation factor
FT                   SUI1; TIGRFAM: translation initiation factor SUI1; PFAM:
FT                   translation initiation factor SUI1"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34564"
FT                   /db_xref="GOA:E6V2D3"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D3"
FT                   /inference="protein motif:TFAM:TIGR01158"
FT                   /protein_id="ADU34564.1"
FT                   /translation="MATTTKSNQASTLVYSTEGGGRMCPDCRAPMAQCRCKELEKARAP
FT                   ATDGIVRVSHETKGRKGKGVTVIKGLALDAAALAAVGKQLKTACGSGGTVKDGVIEIQG
FT                   DHRELVIAALVKQGHTVKRAGG"
FT   gene            363631..363867
FT                   /locus_tag="Varpa_0343"
FT   CDS_pept        363631..363867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34565"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0320"
FT                   /protein_id="ADU34565.1"
FT                   /translation="MNPEDLQRLVTLEMPFGKHKGTLIADLPGNYLTWFAREGFPSGEI
FT                   GRLLHLMHEIDHNGLSDLLKPLRNRPSRRDVSQ"
FT   gene            364051..364467
FT                   /locus_tag="Varpa_0344"
FT   CDS_pept        364051..364467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0344"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="KEGG: vap:Vapar_0319 RNP-1 like RNA-binding protein;
FT                   PFAM: RNP-1 like RNA-binding protein; SMART: RNP-1 like
FT                   RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34566"
FT                   /db_xref="GOA:E6V2D5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D5"
FT                   /inference="protein motif:PFAM:PF00076"
FT                   /protein_id="ADU34566.1"
FT                   /translation="MGKKLYVGNLAYSVRDNDLEQAFGEFGAIVSAKVMMERDTGRSKG
FT                   FGFVEMGSDAEALAAIEAMNGHSLQGRALTVNEARPMEARPPRTGGGGGYGGGAGGGGY
FT                   GGGGGGGGYGGGGGGRSGGGGGGYGGGGGGRGGY"
FT   gene            364673..365161
FT                   /locus_tag="Varpa_0345"
FT   CDS_pept        364673..365161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0318 protein of unknown function
FT                   DUF1468"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34567"
FT                   /db_xref="GOA:E6V2D6"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D6"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0318"
FT                   /protein_id="ADU34567.1"
FT                   /translation="MKIKSQADFFSGVMFTTVGGAFAIGATTYTVGNGARMGPGYFPLM
FT                   LGILLAILGVVIMFQAMVVETTDGDKIGKWAWKPLAFVLGANLAFGILLGGLPSIGLPA
FT                   MGMIIAIYALTIISSMAGTQFKLRDVLVLSTILAAGSYVAFIWALKLQIQVWPTFISG"
FT   sig_peptide     364673..364744
FT                   /locus_tag="Varpa_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.780) with cleavage site probability 0.533 at
FT                   residue 24"
FT   gene            365174..366685
FT                   /locus_tag="Varpa_0346"
FT   CDS_pept        365174..366685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0346"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: vap:Vapar_0317 protein of unknown
FT                   function DUF112 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34568"
FT                   /db_xref="GOA:E6V2D7"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D7"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ADU34568.1"
FT                   /translation="MDLIHNLSIGFGVAFTFTNLLYCLLGCILGTLIGVLPGIGPVATI
FT                   AMLLPATYALPPVSALIMLAGIYYGAQYGGSTTAILVNLPGESSSVVTCIDGYQMARQG
FT                   RAGPALAAAGLGSFFAGCVGTLILAAFAPPLTELAFKFGPAEYFSLMTLGLIGAVVLAS
FT                   GSLLKAVAMIVLGLLLGIVGTDVNSGVARFSFDIPELTDGIGFVVIAMGVFGYGEIIGN
FT                   LSQPDDEREVFTHKVKGLWPTKDDFKRMTPAVLRGTALGSALGILPGGGALLAAFAAYA
FT                   LEKKIKMRPGEVPFGKGNIRGVASPESANNAGAQTSFIPLLTLGIPPNAVMALMVGAMT
FT                   IHNIQPGPQVMTSNPELFWGLIASMWIGNAMLIILNLPLIGMWIKLLTVPYKFLFPAIV
FT                   LFCAIGVYSTNNNTFDVWMVAIFGFIGYLFLKLKTEPAPLLLGFILGPMMEENLRRALL
FT                   LSRGAWSVFVTRPLSAGLLVAAAALLCIVLLPSIKAKREEAFVEE"
FT   gene            367333..368568
FT                   /locus_tag="Varpa_0347"
FT   CDS_pept        367333..368568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0347"
FT                   /product="ammonium transporter"
FT                   /note="KEGG: dac:Daci_2331 ammonium transporter; TIGRFAM:
FT                   ammonium transporter; PFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34569"
FT                   /db_xref="GOA:E6V2D8"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D8"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ADU34569.1"
FT                   /translation="MALVPQASINAADTAWMMTSTALVLLMTLPGIALFYAGMVRRKNV
FT                   LATMAAVVAIAAAVSLTWFTLGYSLAFTPGWPWLGGTGRFWFSGFEYLKEAGQIAVSHV
FT                   APNVPESVYAMFQLTFAIITTALVLGAFVERMRFSAVLWFALLWSVLVYAPVAHWVWEP
FT                   GGWLAQMGALDFAGGSVVHVNAGIAGLVCAYALGPRKGYGREAFEPYSLAMTMMGAGLL
FT                   WVGWFGFNAGSAVAADGRAGLAMLVTHIAAAAGAMSWMIGEWIVRRSPSLLGLCSGLVA
FT                   GLVAITPAAGFVTPLSALAIGAIAGLACYWGATGLKHMLGADDSLDVFGVHGIGGIVGA
FT                   LLTGVFADARISGAAGNVLTQAIAVGSVAIYSAAGTAIVLFLVHVLVGLRVDPESEQLG
FT                   LDLAQHREHLGA"
FT   gene            368587..368889
FT                   /locus_tag="Varpa_0348"
FT   CDS_pept        368587..368889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34570"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0314"
FT                   /protein_id="ADU34570.1"
FT                   /translation="MPSMSESERIALAARLHVALRRKHGRVTDTEWMATNAEYAAEIVR
FT                   MTRAHAAETKDEELDQLATRLELAMEPLARAARLAARQPDGTPPTPPPRYVGGLR"
FT   gene            complement(368952..370079)
FT                   /locus_tag="Varpa_0349"
FT   CDS_pept        complement(368952..370079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0349"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0335 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34571"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E0"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34571.1"
FT                   /translation="MVNRRHFSLAVGTAATLASFRIAQAQTEAPLVLGQSAPFTGPAAQ
FT                   LGIQFHQGAKVFLDQYNAQSGRRNVVIKNLDDGYEPDRCAANTQKLIEEDVFALFGYIG
FT                   TPTSLAALPLAVKDKVPFIAPFTGAMSLREPFQKNVFHLRASYNDETALMVKQLTHLGL
FT                   KKIAVFYQNDAYGKAGLDGVTLALSQLDLKPVAMATVERNSADVAQAVKSIVGAKPDAV
FT                   VQVGAYKACAAFIREARKASYGGTFINLSFVGTQALADELGKEAAGVMVTQVVPSPYNP
FT                   ANAITREFVEAVRKAGGGASANFSSMEGYLAAKVLTEGLRKASGKLTRDSLVAGLESID
FT                   RQQFGGFEVSFSAKNHVGSKFVELSMLTGDGRVRT"
FT   sig_peptide     complement(370002..370079)
FT                   /locus_tag="Varpa_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.975 at
FT                   residue 26"
FT   gene            370140..372209
FT                   /locus_tag="Varpa_0350"
FT   CDS_pept        370140..372209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0350"
FT                   /product="molybdopterin dinucleotide-binding region"
FT                   /note="PFAM: molydopterin dinucleotide-binding region;
FT                   molybdopterin oxidoreductase; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: vap:Vapar_0336 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34572"
FT                   /db_xref="GOA:E6V2E1"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037920"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E1"
FT                   /inference="protein motif:PFAM:PF01568"
FT                   /protein_id="ADU34572.1"
FT                   /translation="MPHATDSLEATTSPAPTTETITVLGACPHDCPDTCALVTTVKDGV
FT                   AVKLQGNAAHSHTGGVLCTKVSRYIERNDHAERLVQPLKRVGPKGSGQFEPVSWDTALD
FT                   DIAAHLRSLRSDPETILPYSYAGTMGLVQGESMDRRFFHKLGASLLDRTICSMAGGEAM
FT                   VHTLGGKVGMRIEFFAEAKLILIWGSNSIASNLHFWRHAQAAKRAGARLVCIDPRKTET
FT                   ADKCDEHIALLPGTDAALALALMHELIVHDWLDHDYIANHTLGWEQLRERALQWPPSRA
FT                   AEVCGIPEAQIVTLAEAYGTTKPAAIRLNYGMQRVRGGGNAARAVACLPALVGAWRGRA
FT                   GGLLLSSSGHFPVDRAALQRPDLLEGRRPRTINMSTIGDALLDAAKPVKAIVVYNSNPV
FT                   AVAPDSAKVVAGFARDDLFTVVLEQFRTDTADYADYLLPATTQLEHWDIHTSYGHTDVL
FT                   LNRPAVAPRGEARSNAWVFRELARRMGFDEPCFSDDDEALCRTAFAENAIDYAQMLTQG
FT                   FTTVKLPEAPFAEGQFPTPSGRCEFFSARLQAMGMDGLPDHVPNWEPAGSSTEFPLAMI
FT                   SPPARNFLNSTFVNVTSLRAIEVEPLLEIHAADAAARGIEDGAMVRVFNQRGEHRCRAE
FT                   VSRRARQGVVHGMGIWWRKFGGDGTNVNQLTSQRLTDIGRGPTFYDCLVQVERA"
FT   gene            372206..373330
FT                   /locus_tag="Varpa_0351"
FT   CDS_pept        372206..373330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0351"
FT                   /product="aminopeptidase"
FT                   /note="PFAM: aminopeptidase; KEGG: vap:Vapar_0337 putative
FT                   zinc protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34573"
FT                   /db_xref="GOA:E6V2E2"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E2"
FT                   /inference="protein motif:PFAM:PF10023"
FT                   /protein_id="ADU34573.1"
FT                   /translation="MRGLSALALAGALFLTGCADLGYYWQSASGHIGIMRAAKPVPEWL
FT                   ADPATSAPLKAKLELTQRIRRFASAELGLPDNASYKSYADLHRPAAVWNVVAAPPYSLT
FT                   LKNWCFPVAGCVGYRGYYSEDAAKAEAEAQRALDLEVAVYPVPAYSTLGWMNWAGGDPL
FT                   LSTFIGYPEGELARLVFHELAHQVLYVPGDTVFNESYATAVERIGGGMWLQREAGEAAR
FT                   REYAQFDGQRQEFRALALNTRRALTQVYESPEAKAKDWPAVEAMKKAAMADFRARYAEL
FT                   KQGWQGPRQNAYDGWVARANNAAFGAQGAYDDLVPAFEALFDREGRDWPRFYTEVRRIA
FT                   ALPTTEERRSALQTATGILQTHSSEDNNNGEHGA"
FT   gene            373323..373637
FT                   /locus_tag="Varpa_0352"
FT   CDS_pept        373323..373637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0352"
FT                   /product="polyhydroxyalkanoic acid system protein"
FT                   /note="TIGRFAM: polyhydroxyalkanoic acid system protein;
FT                   KEGG: vap:Vapar_0338 polyhydroxyalkanoic acid system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34574"
FT                   /db_xref="InterPro:IPR013433"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E3"
FT                   /inference="protein motif:TFAM:TIGR02610"
FT                   /protein_id="ADU34574.1"
FT                   /translation="MPDIHIERNHTLGIAGAREVARQWVQQVEQDYGLECTYTEGKTCD
FT                   VARFSRPGIDGTVEVTADTFKLEATLGFLFSSFSEQIEQKISRNLDALLESPNGGTRFA
FT                   "
FT   gene            complement(373843..374580)
FT                   /locus_tag="Varpa_0353"
FT   CDS_pept        complement(373843..374580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0353"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0339 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34575"
FT                   /db_xref="GOA:E6V2E4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU34575.1"
FT                   /translation="MTTSFDFSRRRALVTGASSGIGRAVALQLAQSGATVTAVGRNAAA
FT                   LDALHAEAGCTPLVIDVSDAAALERALATLPAFDLVVNCAGIALLESALDLQAESFDAV
FT                   MAVNARAAALVASRCGKAMIASGVRGSIVNVSSQASLVALDAHLCYCASKAAMDAITRS
FT                   LCLEFGPHGIRVNSVNPTVTLTPMAAEAWADPAKSAAVLRSIPMGRFAEVGEVVAPILF
FT                   LLSDGASMVSGVALPVDGGYTIV"
FT   sig_peptide     complement(374500..374580)
FT                   /locus_tag="Varpa_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.711) with cleavage site probability 0.616 at
FT                   residue 27"
FT   gene            complement(374577..376103)
FT                   /locus_tag="Varpa_0354"
FT   CDS_pept        complement(374577..376103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0354"
FT                   /product="Xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="KEGG: vap:Vapar_0340 xylulokinase; PFAM:
FT                   Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34576"
FT                   /db_xref="GOA:E6V2E5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E5"
FT                   /inference="protein motif:PRIAM:2.7.1.17"
FT                   /protein_id="ADU34576.1"
FT                   /translation="MKYVIGVDIGTQSTKCLLVGIDGKVHAQASVAYQPETPKPLWAQQ
FT                   DCAVWFDAVCESVRACVAKSGVAATDIAAMCVSSLYGGAGIPVDEAMQPLHPCLIWMDR
FT                   RATAEVDAVNANVDVERLQAITGNGVDSYYGYTKILWVREHLPEVWAKTRYFLPPNSYI
FT                   NRRLTGELAVDHSSAGNIGGVYDAARRTWSEEALGMLGIPARMMPPRLVESSDVVGGLS
FT                   AEWAAKLGLAEGMPLMAGGVDAAVATFCAGVTGSGDHVAMIGTSMCWGFVSPTVDARHK
FT                   LITMPHVYRGADRSYVFGGAITAGAAVTWFRETFCQAEVAEAARTGEDAHALIERKAID
FT                   VPAGAEGLVFLPYLMGERSPIWDAQAKGAFIGLSLAHSRAHLYRAVLEGVSFALQHNIE
FT                   AGRQSGQPLDDRLIVVGGAAHSDLWMQIVADITGYPVFTIEEEVEAALGAAMLAALGAG
FT                   LVDAATAERGWVTLVERARPEPAAQAVYRERFEIYKSLYPALRDAMHRLK"
FT   gene            complement(376125..377255)
FT                   /locus_tag="Varpa_0355"
FT   CDS_pept        complement(376125..377255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0355"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   vap:Vapar_0341 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34577"
FT                   /db_xref="GOA:E6V2E6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E6"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADU34577.1"
FT                   /translation="MSYQKLQPGASGAIGELAAMQAVVCHGPKDYRLETVAMPTIGRNE
FT                   LLISIAACGICASDCKCHSGAKMFWGGDGQPSWVKAPVIPGHEFFGYVEALGEGAAEHF
FT                   GVEKGDRVIAEQIVPCGKCRFCTSGKYWMCEVHNIFGFQRIVADGGMADYMRLPPTSRV
FT                   HKIPDGISLEDAAIIEPLSCAIHTVNRGDIQLDDVVVIAGAGPLGLMMVQAARLKTPKK
FT                   LIVIDLVPERLALAKEFGADVTINPKTENADAIVKGLTEGYGCDVYIETTGAPIGVTQG
FT                   LEMIRKLGRFVEFSVFGSETSADWSIIGDRKELDVRGAHLGPYCYPIAIDLLARGLVTS
FT                   KGIVTHDFPLTEWERAFALANSLDSIKVLLKPQPRS"
FT   gene            complement(377412..378401)
FT                   /locus_tag="Varpa_0356"
FT   CDS_pept        complement(377412..378401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0356"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0342 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34578"
FT                   /db_xref="GOA:E6V2E7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E7"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34578.1"
FT                   /translation="MNATASHPTPPTPQALSGGFFTQLRRSTAFLPLVGLVAISVFMIV
FT                   ATDNFLSWGNLQNIALQSSINAIIAVGMTAAILTGGIDLSVGAVVALSGTLASGMMVQF
FT                   GLPPMLAVPLGLAVGVVIGLFNGYCVAYLRMPPIIVTLATMGIARGIALIYTGGYPIDG
FT                   LPDSFAFLGGGVLAGIKVPILIMLATYLVAYVLLNMAPFGRYVYAIGGNEEATRLSGVR
FT                   VSRYKLLVYALSGFTAAIAGIVQAARVTSGQPGVGVGFELDAIAAVVMGGTSIAGGRGA
FT                   IVGTLVGALLLGVLNNGLNMIGVSPYLQLIIKGGIVLLAIFISREAKR"
FT   gene            complement(378398..379915)
FT                   /locus_tag="Varpa_0357"
FT   CDS_pept        complement(378398..379915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0357"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0343 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34579"
FT                   /db_xref="GOA:E6V2E8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34579.1"
FT                   /translation="MTSFAEGEEMLRLEGVSKRFPGVKALSGIDLSIRKGEVHALLGEN
FT                   GAGKSTLMKILGGIYQADEGRIFIEGSERRFAGYNDAIAAGIGIIFQEFSLIPYLNAVE
FT                   NIFLGRYLKNRFGLMDKAGMKRSAERLFDELGVQIDLDVPICRLSVAQQQFVEIGKALS
FT                   LKARLLVLDEPTATLTPNEAGHLFKIMRELRAKGVAMIFISHHLDEIFEVCDRISVLRD
FT                   GANAGHADVGATDVDALVEMMVGRRIEHNFPPKPQPAPRGRKVLEVPEIQLAKGGPVNS
FT                   FTLHEGEILGFAGLVGSGRTELALGMMGADRVHRKTVLRNGKPVRLKDPTEALENGIGL
FT                   LPESRKVEGLITDFTVRFNISMNNLGKHKSAGLVSQKSEKQSAGELAKRVGVKAPSIET
FT                   RVATLSGGNQQKVVIARWLGHASEVLIFDEPTRGIDVGAKAEIYSLMRELTRQGKAIVM
FT                   ISSELPEIVGMCDRVAVFSGGSIVATLEGDSINSGDIMRHATTGGSQ"
FT   gene            complement(379935..380855)
FT                   /locus_tag="Varpa_0358"
FT   CDS_pept        complement(379935..380855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0358"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: vap:Vapar_0344 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34580"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADU34580.1"
FT                   /translation="MKNLLKTTALTAALVCAASAAQAQAPKQPLRIGMTFQELNNPYFV
FT                   TMKQALEEAAASIGATVVTTDARHDVAKQIGDVEDMIQKKVDILLLNPTDSTGVQSAVR
FT                   SAKKAGLVVVAVDANAQGPVDSFVGSKNTDAGRLACEYLAKSIGEKGDVAILDGIPVVP
FT                   ILERVKGCREALAKYPGIKVVSTQNGKQERATALTVTENILQANKDLKGIFSVNDGGSM
FT                   GALAAIDASGKDVKLASVDGAPEAIKAMQKPGSKFIATTAQYPRDQIRLAIGIALAKKW
FT                   GANVPAAVPVDVKLIDAEGAKTFTW"
FT   sig_peptide     complement(380784..380855)
FT                   /locus_tag="Varpa_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 24"
FT   gene            complement(380983..381873)
FT                   /locus_tag="Varpa_0359"
FT   CDS_pept        complement(380983..381873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0359"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: vap:Vapar_0345 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34581"
FT                   /db_xref="GOA:E6V2F0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2F0"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADU34581.1"
FT                   /translation="MQPDLEIVEVRGDESFTAWAHGYPYRTVRWHFHPEYEIQLIVETK
FT                   GVYFVGDHVGHFEPGNLVLMGPDLPHNWISDVPAGQSVERRGIVIQFPAELMKNMSAAF
FT                   PEFQRIAPLLAESGSGLLFSAETALAAKPVMESLLEARGLRRVILLLSLLELLVDSHDR
FT                   QRLASPAFKPDPKAFMSHAINNVLAHISANLGDELREPMLAELVGQSPSAFSRSFRKHT
FT                   GQSFVRYVNRLRISRACELLTNSEKPVLDVCMDVGFNNVSNFNRQFLLHKRMPPTKFRN
FT                   FHRMQAAASRATNAP"
FT   gene            382190..383437
FT                   /locus_tag="Varpa_0360"
FT   CDS_pept        382190..383437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0360"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="KEGG: vap:Vapar_0346 formyl-CoA transferase; PFAM:
FT                   L-carnitine dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34582"
FT                   /db_xref="GOA:E6V2F1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2F1"
FT                   /inference="protein motif:PRIAM:2.8.3.16"
FT                   /protein_id="ADU34582.1"
FT                   /translation="MTKTTSSQATPTAAGPLAGLKVVELGQLVAGPFAARTLADFGAAV
FT                   VKIEPPGAGDPLRTWRLMKDGTSVWWQVQSRNKRSLALDLREPEAQAIVRQLAAEADVL
FT                   IENFRPGAMEGWGLGPDALLAANPALVMLRISGYGQTGPYRDRPGFGVVAEAMGGLRHL
FT                   TGEPGRVPVRVGVSIGDTLASLHGVIGVLMAMQHRNATVSAQYPKGRGQVIDVALYEAV
FT                   FNCMESLLPEYGEFGAVREAAGSALPGIAPTNAYRCADGGYAIIAGNGDGIFRRLMECI
FT                   GRPDLAADPALVGNAGRVAQVDMLDAAIGDWAAARTVDEVLAALDAAHVPAGRIYTIAD
FT                   IATDPHYAARGMLQQVRMPDGSALAVPGFVPKLSLTPASHRHNAPALGADTDAVLKEIG
FT                   LSAEQIAALHARGIVG"
FT   gene            complement(383522..383779)
FT                   /locus_tag="Varpa_0361"
FT   CDS_pept        complement(383522..383779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0361"
FT                   /product="acyl-coA-binding protein ACBP"
FT                   /note="PFAM: acyl-coA-binding protein ACBP; KEGG:
FT                   vap:Vapar_0347 acyl-coA-binding protein ACBP"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34583"
FT                   /db_xref="GOA:E6V2F2"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2F2"
FT                   /inference="protein motif:PFAM:PF00887"
FT                   /protein_id="ADU34583.1"
FT                   /translation="MSDLNAQFEAAQANSKLLAERPDNPTLLKIYGLFKQATEGDNTAK
FT                   KPSFSDIVARAKWDAWTAQKGASSDEAKQKYIDLIESLRG"
FT   gene            383842..384726
FT                   /locus_tag="Varpa_0362"
FT   CDS_pept        383842..384726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0362"
FT                   /product="dienelactone hydrolase"
FT                   /note="KEGG: hse:Hsero_0947 dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34584"
FT                   /db_xref="GOA:E6V2F3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2F3"
FT                   /inference="similar to AA sequence:KEGG:Hsero_0947"
FT                   /protein_id="ADU34584.1"
FT                   /translation="MKKTSALWCAVLLQLLLLAATSAHGALREEQFDVPVQVSDIYGKR
FT                   VEQSIRVTVFSDDANPVPAPLIVLNHGRAAQSAERAAMGRARYSVASRFFVAQGFVVAV
FT                   PTRIGYGVTGGEDVEASGQCGARRYAPAYEAGLAQTLRVLQVMRARPDVDPARAVIVGQ
FT                   SFGGTIAIAAAAQNPAGVVAAINFAGGGGGNPKTQPQRPCSPEALERLFGHYGKTAHMP
FT                   TLWIYTENDQYFGPTYPQEWFKAFRDAGGKGEFTQFPPYGEDGHALFSRYPEVWQPRVR
FT                   AFLEQVGLMRQRR"
FT   sig_peptide     383842..383919
FT                   /locus_tag="Varpa_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 26"
FT   gene            complement(384737..385573)
FT                   /locus_tag="Varpa_0363"
FT   CDS_pept        complement(384737..385573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34585"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2F4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0348"
FT                   /protein_id="ADU34585.1"
FT                   /translation="MPHPDFKPLSLMSAGPVAANAEPWTPLPYADVPRFDARSVLPHWP
FT                   RLHAGHHLPPPAPDAPLAEGWALYHSGEFERAAAIGLLHGSEGLVLANQATAIYANYLE
FT                   PREATRLAMFRQVIERASAQAAAEPDNCQALYWQAYALGRYSQGISVARALAQGLGTKL
FT                   KGALEHVIALQPAHADAHLALAAFHAEVIDKVGALVGRMTYGVRAETSVELFERGLELH
FT                   PHSPAGMMEYARALLMLHGDSRMAEATQLYEKAAAMTPADARERLDVELARAGLSD"
FT   sig_peptide     complement(385508..385573)
FT                   /locus_tag="Varpa_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.754 at
FT                   residue 22"
FT   gene            complement(385589..386287)
FT                   /locus_tag="Varpa_0364"
FT   CDS_pept        complement(385589..386287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0364"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vap:Vapar_0349
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34586"
FT                   /db_xref="GOA:E6V396"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:E6V396"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU34586.1"
FT                   /translation="MAKKAPRRTAQRILEAALDLFNRFGEPNVSTTLIAGELNISPGNL
FT                   YYHYPAKEELINTLYQGYEAELNELLHASEGVHDVEDAWFFMHTLFELIWRYRFLYRDL
FT                   NDLLSKNRHLETQFQLVLKNKTRAIRQLISGLGRAGHLDIDAHEIDPLAQSMVVVLTYW
FT                   LSYEYVRNPREALEPAHAQGALMRGGHHTLHLLAPYLGREQRRHLLTLSNAYNGEDATH
FT                   NVAPTVDMAA"
FT   gene            complement(386412..386906)
FT                   /locus_tag="Varpa_0365"
FT   CDS_pept        complement(386412..386906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0365"
FT                   /product="poly(hydroxyalkanoate) granule-associated
FT                   protein"
FT                   /note="KEGG: vap:Vapar_0350 poly(hydroxyalkanoate)
FT                   granule-associated protein; TIGRFAM: poly(hydroxyalkanoate)
FT                   granule-associated protein; PFAM: poly granule associated
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34587"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:E6V397"
FT                   /inference="protein motif:TFAM:TIGR01837"
FT                   /protein_id="ADU34587.1"
FT                   /translation="MATQDDDSNNGNDKSSDRIKDSAQQIWLAGLGAFAKMQQEGSKAF
FT                   EALVKDGAGMQKKTQAAAEETLAQAQQRMAGFASEFGTKAAGQWGKLENIFEERVARAL
FT                   EKLGVPSAADMAALQARVEALEAQLKGSAKAAATSRKTTARKTAAPAPAAKKTLRRTKA
FT                   G"
FT   gene            complement(386997..387446)
FT                   /locus_tag="Varpa_0366"
FT   CDS_pept        complement(386997..387446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0366"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   vap:Vapar_0351 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34588"
FT                   /db_xref="GOA:E6V398"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:E6V398"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADU34588.1"
FT                   /translation="MSSITLRFLAEPNTVNFGGKVHGGTVMKWIDEAGYACATSWAKRY
FT                   CVTAFIGSIRFHRPIMIGDLVEVEARLAYTGTTSMNISVEVRSGDMKGGMMEKTTECLI
FT                   VFVSVDSHGRPLPVEAFVPGTPGEMALAERAKAHLDASRAAGATP"
FT   gene            complement(387544..388440)
FT                   /locus_tag="Varpa_0367"
FT   CDS_pept        complement(387544..388440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0367"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0352 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34589"
FT                   /db_xref="GOA:E6V399"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V399"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34589.1"
FT                   /translation="MSKLDLEWLAVFDEVYKTGNVSKAAERLGMAQAAASTALNKLRAH
FT                   FDDRLFTRTAQGMQPTPHAERIYPNLREVLAQLAQAQGNRSSFEPAGAQRRFRICMTDI
FT                   SEVVLLPGLLDHLRHVAPGVHIETEIISTNSGRRLQDGEVDLAVGFMPQLDAGFYQQTL
FT                   FMQNFVCLAAQNHPRIGARLARKRFEAEAHAVVSTSGTGHAIVDTTIARLGLKRDVVVR
FT                   LSSFLSVARIVAHTELLVVVPRILGKVLATQEPVKLLELPFALPDYAVKQHWHERFHAD
FT                   PGNAWLRRTLAQLFSGS"
FT   gene            388570..389667
FT                   /locus_tag="Varpa_0368"
FT   CDS_pept        388570..389667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0368"
FT                   /product="gentisate 1,2-dioxygenase"
FT                   /note="KEGG: vap:Vapar_0353 gentisate 1,2-dioxygenase;
FT                   TIGRFAM: gentisate 1,2-dioxygenase; PFAM: Cupin 2 conserved
FT                   barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34590"
FT                   /db_xref="GOA:E6V3A0"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR011960"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A0"
FT                   /inference="protein motif:TFAM:TIGR02272"
FT                   /protein_id="ADU34590.1"
FT                   /translation="MNSASQSPAKSPAKSAPANAAERSDYYARIRPLNLTPLWESLHAL
FT                   VPREPQTPCVPALWRYDEIRPLLMESAELITAEEAVRRVLVLENPALPGNSSITQSIYA
FT                   GLQLIMPGEVAPSHRHVQSALRFIVDGKGAYTTVGGERTTMYPGDFIITPSWAWHDHGN
FT                   EGIEGVSEPVVWLDGLDIPMLRFFDAGFAENDDAKVQHVARPEGHSLARFGHNMVPVRH
FT                   DHVSATSPIFNYPYARSREALAQLQKQEAPDAWLGHKLRYINPLTGGSPMPTISTNLQL
FT                   LPKGFAGKTHRATDGAVYSVVEGHGIAEIAGQRFEFGPRDTFVVPSWAPLRLLSPVDDV
FT                   VLFSFSDRPVQQAMGILREAFLEDA"
FT   gene            389736..390440
FT                   /locus_tag="Varpa_0369"
FT   CDS_pept        389736..390440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0369"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   vap:Vapar_0354 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34591"
FT                   /db_xref="GOA:E6V3A1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A1"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADU34591.1"
FT                   /translation="MSFVFTPPSIVGLPIVDSDKLFPVRRVYCVGRNYAAHAREMGFDP
FT                   DREPPFFFCKPNDDASVVPVAEGETGKIPYPPLTSNYHYEAELVVAIGKGGKDIPVDQA
FT                   SSHIHSYAVGLDMTRRDLQMKMREAGRPWEIGKAFDFSAPIAPLRTLADVGEINAGAIT
FT                   LTVDGEVRQNSDITHLIWSVNEVIANLSTLFTLQPGDLIFTGTPEGVGAVKAGQTIKVS
FT                   IERLPSLTVRID"
FT   gene            390565..391818
FT                   /locus_tag="Varpa_0370"
FT   CDS_pept        390565..391818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0370"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   vap:Vapar_0355 salicylate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34592"
FT                   /db_xref="GOA:E6V3A2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A2"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADU34592.1"
FT                   /translation="MSAFPSETRHPSVLLVGGGIGGMAAALALARLGVSIDLLEQSAAI
FT                   GEIGAGLQLGPNAFAALDALGVGEAVRRGSVFTDRLVMMDAVDCGEVASVPVGEAFRAR
FT                   FRNPYAVSHRADLHGAIHEAVKQHPLIRFHTSAQVESIDSGAHGVTAVTRDGRRFQADA
FT                   IVGCDGVKSVVRAKLIGDAPRVSGHVVYRAVVPAADMPADLRWNAPVVWAGPNCHLVHY
FT                   PLRHGEQYNLVVTFHSREEEEWGVTDGSKEEVLSYFEGVHARPRQLLDRPTSWRRWSTA
FT                   DRDPVDRWSEGPATLLGDAAHPMMQYLAQGACMALEDAVTLGAAVEACDFDMTAAFKLY
FT                   EAARVARTARVVLSVREMGRLYHAKGVERLVRNSLWIGRTPERFYDAVEWLYAWRPEHC
FT                   LDDAPTSLQPAAAEFSLH"
FT   gene            391874..392860
FT                   /locus_tag="Varpa_0371"
FT   CDS_pept        391874..392860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34593"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0356"
FT                   /protein_id="ADU34593.1"
FT                   /translation="MNFSRTLLTGGLAFTVTVATTGALAQAGDFPNRPVTLVTPFAAGS
FT                   GPDAVLRLVSDKLSRLWNQRVVIDNKPGGGGFIAIDQARRAAPDGYTLLQLDSEHVAAL
FT                   PHLYKSKNFVTLQHFDPVASLFRTPFFVAVGTDSKWKTMGDLIAAAKAEPEGVVYGSWG
FT                   VGSPGHLGAQQLEALTGIRMRHAPYREVSQLYSNVGTGEVPWAFASIPSSQGIYKAGKL
FT                   RYIAVAAPKRIPQMPDVPTMAEAGGPASLEVNSFVSLLAPKGVPAAVKAKINADVAKVI
FT                   ADPEIRARFDTFAFEPLAWSPEEIQRNAEAKSKVYGELVRRGNISLE"
FT   sig_peptide     391874..391951
FT                   /locus_tag="Varpa_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.656 at
FT                   residue 26"
FT   gene            392949..393926
FT                   /locus_tag="Varpa_0372"
FT   CDS_pept        392949..393926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34594"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0357"
FT                   /protein_id="ADU34594.1"
FT                   /translation="MQAQKRALLIACGLAAAALLPLAAHAQAADWPTKPIRLLVGFPGG
FT                   STPDIAARTIAEPLGKALGQPIVVDNKAGASGNIAADQVAKATDDHTLGLVINGNLTSS
FT                   KMLYPKLPYDPVKDFTYLSLIATAPLVLVAQNNLPSGTAFFDAARQAGDKWNYGSVGIG
FT                   SVGHLGMELLKSRVAGFKPEHVPYQGNPQVITAMLGDQVQMGLIPPGVAMPQVRAGKLK
FT                   AIGLTGGRSALVPELPPLSEAGVKDFSLEVWVALLGPANLSKAAQARISRELEVVMKTP
FT                   EVRRKLFEQGWQAVGTSPDGMRTRVTEEAAIMTKIISTRGIKLQ"
FT   sig_peptide     392949..393029
FT                   /locus_tag="Varpa_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.736 at
FT                   residue 27"
FT   gene            393926..395281
FT                   /locus_tag="Varpa_0373"
FT   CDS_pept        393926..395281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0373"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: vap:Vapar_0358 FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34595"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A5"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADU34595.1"
FT                   /translation="MAAQQKTLTEPARELPVFGEYDVVVVGGGPAGIAAAVSAARHGAN
FT                   TLLVERYGFLGGMGTAGGVTNFAGLYGKRNGEMTLLVRGVADDLLDRIGALGGLNKPQD
FT                   GMQGRIRVRSYDTSAYKIAADQLLIDAGVNLLFHAWAAAVIRDGDRIAALVVETKSGRQ
FT                   AIRANAFIDASGDADVAAFASVPFEVGDGHGSGLFPTTMFRVGQVDAEPALAAVGEFKA
FT                   INDLMAEVQQQKPGTYRFPREGAILRPNIDPREWRANVTQIRNAAGRAMNGVDARELTE
FT                   GELEGRRQIAEYFNFMKAEVPGFGHSAIVEIAPQVGIRETRRIEGLYALTGEDILSSAR
FT                   FDDSIGINAWPMEMHADGRIEWAFPRDDNHTYNQLPWRMLVPRTVDNLLVAGRCAAMTH
FT                   EGQSAARASGGCFVMGQAAGTAAASLGSANFADVDVPALQKKLVADGADIDR"
FT   gene            395419..396036
FT                   /locus_tag="Varpa_0374"
FT   CDS_pept        395419..396036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34596"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A6"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_A4715"
FT                   /protein_id="ADU34596.1"
FT                   /translation="MQWGCASTPEGEPVHGKDEVVSFLAAKDGRKVVVAAEKYHYVFDG
FT                   DPSVAALLRWSGRTKVTPSLNGELKVARNNSFEGSYTLVAFDADLTPEDRTFLIQTGFA
FT                   KTDMKYGDRTGPALRYFGTVYGTRYAAAPLKPADTLDFSRSFLIRYVEQETATGPAAQP
FT                   APSPLIYDDGGKLLVGGVPMFIVQGGTDYRCRARFMDICFYK"
FT   gene            396177..397055
FT                   /locus_tag="Varpa_0375"
FT   CDS_pept        396177..397055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0375"
FT                   /product="Choloyl-CoA hydrolase"
FT                   /EC_number="3.1.2.27"
FT                   /note="KEGG: vap:Vapar_0359 choloyl-CoA hydrolase; PFAM:
FT                   acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34597"
FT                   /db_xref="GOA:E6V3A7"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A7"
FT                   /inference="protein motif:PRIAM:3.1.2.27"
FT                   /protein_id="ADU34597.1"
FT                   /translation="MTTDPATAARLVDELVALMQLEPLGGDRFRAQSEDIGTPAVFGGQ
FT                   VLGQSLAAASLTVGADRPVHSMHAYFLLPGEHAPIKYSVDRVRDGRSFTTRHVVARQGE
FT                   RIIFEMSASFQTVDDGVEHQLAMPAVEGPEGLVSELDQRLALGDRLPERWRIKGLEPHG
FT                   IEYRRVEADDLLTPIVRPSESAIWMRAIAPLPDDPVVHRALLAYASDHGLLRAAMLPHG
FT                   LSFMSGQVRPASLDHAMWFHRDFRMDDWLLYVLDSPSASGARGLCRGSLFTRDGRLVAS
FT                   TAQEGMLRIVR"
FT   gene            397088..397699
FT                   /locus_tag="Varpa_0376"
FT   CDS_pept        397088..397699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0376"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bpt:Bpet4536 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34598"
FT                   /db_xref="GOA:E6V3A8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A8"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADU34598.1"
FT                   /translation="MKIFHSPASPFVRKCMVVAHELGIADRIEKLPSAAGPVKRDATIL
FT                   PKNPLGQVPTFLCDDGQVLYDSRVICEYLDAKHSGSLFPADGTQRWARLTELALADGMT
FT                   AAALLARYETMLRPEALRWNDWTEGQLAKVRTGLEWLETAAPSFGDRVDIGTIAFGCTL
FT                   GYMDFRFPSVDWRGEAPNTAKWFEVFNQRASMQATLPAVA"
FT   gene            397980..399056
FT                   /locus_tag="Varpa_0377"
FT   CDS_pept        397980..399056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0377"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: pol:Bpro_2845 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34599"
FT                   /db_xref="GOA:E6V3A9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A9"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADU34599.1"
FT                   /translation="MNEITRVGVDLAKRVIQVFAVNAAGLRVTGRALARDKFLAWCAQL
FT                   PAGCLVAMEASSSAHYWARKLLALGLDARIIAAPHVVPYRLQGKSGKNDANDAAAICEA
FT                   ASRPHMHFVPIKSVEQQSMLCIHRLREGVKADRTACINRIRGLLAEFGLVFAQSPEALR
FT                   QVLPDAMEDASNELGALARLTLQRAYAQWQELDAHLRWCDERIAAHGKASDQVRQAEQL
FT                   LGVGPVTASAVVATVGDFKQFKNGAQFGAWLGLTPRQNSSGGKNNLGRITKRGDAYLRT
FT                   LLIQGAKSIVLTAHRRDDPISRWVQALRERSGWQKAVVALANKNARILWAVFARGRAFD
FT                   AHHVSTKPPGAIAAVIAV"
FT   gene            399505..400218
FT                   /locus_tag="Varpa_0378"
FT   CDS_pept        399505..400218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0378"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0360 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34600"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU34600.1"
FT                   /translation="MSSEAQKKVAVVTAGGSGMGAAAARKLAEDGFRVAILSSSGKGEA
FT                   LAQELGGIGVTGSNQSNDDIKRLVDKVTDTWGRVDVLVNSAGHGPRAPILEISDEDWHR
FT                   GMDVYLLSAVRPSRLVAPLMVKQGGGSIINISTFAAFEPDPVFPTSGVFRAGLAAFTKL
FT                   FADQYAAHNVRMNNVLPGFIDSLPEKEVFRERIPMGRYGKSSEIAATIGFLASEGAGYI
FT                   TGQNLRVDGGITRSV"
FT   sig_peptide     399505..399579
FT                   /locus_tag="Varpa_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.466 at
FT                   residue 25"
FT   gene            400450..401907
FT                   /locus_tag="Varpa_0379"
FT   CDS_pept        400450..401907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0379"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   dac:Daci_0815 sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34601"
FT                   /db_xref="GOA:E6V3B1"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B1"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ADU34601.1"
FT                   /translation="MSSSHSRLRTEWCPSIPRELMAGAVATFALIPEVIAFSFVAGVDP
FT                   AVGLFASFVISLVIAFTGGRPAMVSAAAGSVALVAAPLVHAHGLQYLLAAGVLAGAMQI
FT                   VFGLLRLGVLMRFVSTSVRTGFVNALAILIFAAQMPHFIGANTATWAMVGLGLAVIYLL
FT                   PRITRAVPSPLVCIVVVTLVGHWLDLPLKTVADLGHLPDALPAFAFPSVPFTLDTLRII
FT                   ALPAFAIAMVGLLESMMTASVVDELTDTPSSKNRECSGLGVANVAASFFGGIAGCGMIG
FT                   QTVSNVRYGGRGRLSTLFAGAFLLILMVLLKPWVSQVPVAALVAIMVMVSASTFDWGSL
FT                   RTLVRHPRMSSAVMLATVAVTVATDNLAAGVAVGVLLSGVFFTFKVARLLHVHAEVGEE
FT                   GLRTYRITGQVFFASADMLVDAFDVREIDGAPVHIDVSNAHFWDVTAVAALTKVVERLR
FT                   KHGSVVEVTGLNQASRDLILQLDAAPE"
FT   gene            402017..402628
FT                   /locus_tag="Varpa_0380"
FT   CDS_pept        402017..402628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0380"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG:
FT                   vap:Vapar_0361 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34602"
FT                   /db_xref="GOA:E6V3B2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B2"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADU34602.1"
FT                   /translation="MEIPAPVLKNMDRTIQSYEDSAREYNAIVAGHRPPEIVDALRRMM
FT                   QLVPAGGTVLEIGSGSGQDADFIESLGGVVRRTDAAQAFLDLQAERGKKGELLNVVTDA
FT                   LGGPYGAILAMAVLIHVDREQVAPVLSKVFDALEPGGVFLAGMRIGEGETNGDYQTVYW
FT                   AKDRFAEALEAAGLRLQWDTEWIGRKDVRWAGFLACRPPE"
FT   gene            complement(402636..403376)
FT                   /locus_tag="Varpa_0381"
FT   CDS_pept        complement(402636..403376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0381"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0362 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34603"
FT                   /db_xref="GOA:E6V3B3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34603.1"
FT                   /translation="MSTATTTKTLLEAKSIEAGYGASQVLFGIDLTIGAGEVLALLGRN
FT                   GMGKSTLLKVLTGTLSPMRGDVQFGGAAIGGPNKSMRPDAIARRGVAIVPEGRHVFPNL
FT                   SVDEHLRAFARPRPGSAPRWTVEALYGLFPRLAERKANAGNQLSGGEQQMLAIARALST
FT                   HPRLLILDEATEGLAPVIREEIWHCIATLKSEGEAILVVDKYVQRLLPLADRHVILERG
FT                   RVVWRGDSAALDADRSLWTRYLGV"
FT   gene            complement(403373..404128)
FT                   /locus_tag="Varpa_0382"
FT   CDS_pept        complement(403373..404128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0382"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0363 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34604"
FT                   /db_xref="GOA:E6V3B4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34604.1"
FT                   /translation="MSLFRIEGLVKRFGGLLATDHVSLTVERGEVHALIGPNGAGKTTL
FT                   VNLITGLLKADAGRILLDEIDITKLRDHQRVAAGMSRCFQVTRVFAKETVHDNLMLAAQ
FT                   AHAGSSLRFMAPRATERDLVQRAIALADRVGLGGERDRIAGTLPHGAQRALDVALALAA
FT                   EPKLLLLDEPMAGMGPDESARMVELIESLRESMAILLIEHDMDAVFRLANRLTVLVQGR
FT                   VLMSGTADEVRGHPDVQAVYLGTEAEGHA"
FT   gene            complement(404125..405087)
FT                   /locus_tag="Varpa_0383"
FT   CDS_pept        complement(404125..405087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0383"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0364 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34605"
FT                   /db_xref="GOA:E6V3B5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34605.1"
FT                   /translation="MKLSSRSIGLGLVFLLLAAFPLIAPLFGLDFYIGFVRRVLIVALA
FT                   AASLNFILGFGGMVALGHAGFIGMGAYTVVALSDAGVMSAWVMWPLAALVAGLVAALIG
FT                   TVALRTRGVYFIMTTLAFAQMLYFVVVSLRRYGGDDGYTLMSRPTLLPGLDLGNESNFY
FT                   WVVLVIVALALWWLHRATQSRFGHALMGIRDNETRMRALGYPVFRLQLVAFAIAGAIAG
FT                   LAGALLAGGNGFVSPATMHWTQSATLLVMVVIGGLGRSWGGPVGAIVWLLLEEFLKQHT
FT                   EHWHMPLGLLLIAVALWAPKGLAALARRRQAAPLTKATP"
FT   sig_peptide     complement(405001..405087)
FT                   /locus_tag="Varpa_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.946 at
FT                   residue 29"
FT   gene            complement(405084..406004)
FT                   /locus_tag="Varpa_0384"
FT   CDS_pept        complement(405084..406004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0384"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0365 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34606"
FT                   /db_xref="GOA:E6V3B6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B6"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34606.1"
FT                   /translation="MSGILVLEQLLNGLGYGLMLFLLAAGLTLVFGIMDVLNLAHGSLF
FT                   MSGAYVAAEAHTRTGSFTAAIVIAVAVTVVVALLLEVLLMRRLYTRDHLAQVLATFGVI
FT                   LVADDIVKMAWGPSPVMSPTPAALSGPVNLMDGLPYPAYRLVILIGGLLVALALYLLVN
FT                   HTRIGMRVRAGASDRPMAELMGVRVGRIFNGVFLLGAALAALAGALMGPIVAVQVGMGE
FT                   AILIPALVVLVIGGIGSVRGAFVAALLVGVVDTIGRAFVPMLLRATLPPATAADLGPLF
FT                   AEVAMYALMVIVLIFRPSGLFSART"
FT   gene            complement(406134..407339)
FT                   /locus_tag="Varpa_0385"
FT   CDS_pept        complement(406134..407339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0385"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0366 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34607"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B7"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34607.1"
FT                   /translation="MSHLSPKSPALPRTLVSLLLCGAALGTAASAMAAPVKVGLALDIS
FT                   GPFAALGAEARDGFALGIKQLNGKLGGQDVEFVQADMAGSPDQAKQLVDRMIQRDKIDI
FT                   FSGPIGSNVALAVGPTLFNAKVPYLSANAGPSQFAGAQCNAYFFGTAYQNDQFHEAAGK
FT                   FAQDRGFKKTVLIAPNYPAGKDALGGFKRQFKGQVADELYTKLGQIDYAAELAQLRAAK
FT                   PDSIYFFLPGAMGINFIKQFVGAGLSKDITLVTSGFSADEDVIGAVGEPMLGLFNTSHW
FT                   AHDLDNPANKAFVAAFRKEYNGRYPSVYAAQAYDAILAMDAAVKQSGGNAQNREAVVAA
FT                   LKKANYASTRGAFKYANNHYPIENFYLRVIGKDAQGKVTNKLINTVLTNYGDSYADKCP
FT                   LK"
FT   sig_peptide     complement(407238..407339)
FT                   /locus_tag="Varpa_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 34"
FT   gene            complement(407533..407772)
FT                   /locus_tag="Varpa_0386"
FT   CDS_pept        complement(407533..407772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0386"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="KEGG: vap:Vapar_0367 ATP synthase F0, C subunit;
FT                   TIGRFAM: ATP synthase F0, C subunit; PFAM: H+transporting
FT                   two-sector ATPase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34608"
FT                   /db_xref="GOA:E6V3B8"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B8"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ADU34608.1"
FT                   /translation="MTGFNILPLAVALLIGIAALGSCLGIGLVGQKFLESTARQPEMVD
FT                   VLQTKFFLIAGVTDGAFIIATGIGLWFATANPFG"
FT   sig_peptide     complement(407695..407772)
FT                   /locus_tag="Varpa_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.531 at
FT                   residue 26"
FT   gene            complement(407917..412626)
FT                   /locus_tag="Varpa_0387"
FT   CDS_pept        complement(407917..412626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0387"
FT                   /product="Ricin B lectin"
FT                   /note="KEGG: vap:Vapar_0368 ricin B lectin; PFAM: Ricin B
FT                   lectin; PKD domain containing protein; Laminin G sub domain
FT                   2; SMART: Ricin B lectin; PKD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34609"
FT                   /db_xref="GOA:E6V3B9"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B9"
FT                   /inference="protein motif:PFAM:PF00652"
FT                   /protein_id="ADU34609.1"
FT                   /translation="MKIRYYVMALMVPFVTLLTHAAITGVSPMTTLSNMATAVSEAVAD
FT                   PLPLQGPGLGNLTYTSAELFKPVSMITSPNHPLDPAHSSAYESREVPATYAGRKDYGMN
FT                   AGIMVNGYFLTSFAPDSGLGPGGFLLYDVSNPRQIQLVKKIYEPEARTKEFRETHSFGT
FT                   AKIGGKTYVVLPSINGVEFWDFTDINDIKQVKKLALPGVNSGDYENVAWQLWWQAPYLY
FT                   VASAGRGMFIVDARDPANAVVANRGAGKPNPVPTGELGGFRLGPIFTMGNHMVLTAMES
FT                   NGGFASLDISDPLNPKVLDSIVGTTPFYYATCFDGRNLHVSTRNSGAKMYSYDLSDRSR
FT                   FVAEDNRLVIDEQLYCATQDNYVIQGAQTRIHKVDVSNPLNHVEVGRGSILREDDPNFS
FT                   HSDNGQVAIFGNLVFVGNDHGSGSGFVVHAVDPDIVKPEVKQVSPANGAKQQALTSRIG
FT                   LGMTDNIRPESVNSNTFIVRPVGGNTLAGTYSVQLGIVNFHPEQPLQPGTSYEVFLPAN
FT                   GLKDYAGNAIGADYRSTFNTGNATDINLMHYWTLAGNLSDQIGNNSGTPASGDAFESIG
FT                   MNFANRTAGVPLKNDGVATVLGGTASLSFYMKTTQAGGANSWTAPGIFGRDQPSGADDV
FT                   FWGWLDSNGRIKLSVGNDGGTASTAAVNDGNWHHVVLTRDAASGAQAVYVDGVKTTSAG
FT                   LTGTKGLANKFSVLGQIQGNTALFKGTLAEVRVYGRVLSDTEVNTLRGQAIIGDPGIGG
FT                   GPKLVNGQLVFNPGTLGSSGAQFRWNFGDGTQTAYSNQPNYTYTYTRPGHFTVTLTVKD
FT                   ANGRETFYTYNLTVIVPTTARAPTHTTNIAGDANSVYSVNPDSGTVAAINSETLAKRWE
FT                   VRVGDEAKTLAVGPDGRIWVTVQGEDKLVALNAADGSVSATVPLAYGSGPYGVAFTPDG
FT                   AKGLLTLESKSVLMSFDPSNGATTGAVALEGNLRGIAVSGDAQVAYVTRFKSKMTGGQL
FT                   HKVNLQSMSAMPTIALPVDTTTVDTESRARGVANYLSQVIISPDGTRAVLPSKKDNIVR
FT                   GKFRDGINLSHDQTVRSILSQVNLQTAAEVFAEQIDFDDRAPARAALYSPSGDYLFVAQ
FT                   MEGNRVAIVDPYSRSVRGEINASSAPHGLYLDAARKRLFVNNFLARSVSVHDVASVLAS
FT                   ETAAPVFLQNVSTVAQEPMAAAALRGKQVFYNASDRRMSKDNYISCASCHADAGDDGMV
FT                   WDFTQRGEGLRRTISLMGRRGLGHGKLHWTANFDEVQDFENDIRNEFGGTGFLSNADFT
FT                   ATQDPLGAPKAGKNAQLDDLAAYLTSLNKYMRSPARNADGSLSVDAARGQALFASAQCV
FT                   TCHTGATFRDGQRHDVGTIQLSSGKGMNQPLAGVGFDTPTLLGTWNTTAFFHNGQAATL
FT                   QDVLAGGHGNASSLPPADVVAIREYVRSQDSDPTPTITRIRSNLSNLCVNIKGVSTTSG
FT                   ATAVQWPCGTASNEKFTVTSLTGGYVQFKAEHSGLCLAQSGTATTNAAVVQLACSAGDT
FT                   TQWSLVGGTIKNRASGSCLDVPNASTAQDTALITWTCNGGTNQSWTQLP"
FT   gene            complement(412855..413715)
FT                   /locus_tag="Varpa_0388"
FT   CDS_pept        complement(412855..413715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0388"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   vap:Vapar_0369 deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34610"
FT                   /db_xref="GOA:E6V3C0"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C0"
FT                   /inference="protein motif:PFAM:PF01791"
FT                   /protein_id="ADU34610.1"
FT                   /translation="MSKDKTARLNRLLTNGRCLDIALDHGVCNEPSFLDGLEDMPQVID
FT                   KLVAAGPDALQLNYGQSDLLQDRPGRDKPALVMRIDMGNPYNATLHRVMWAQLQNEHDP
FT                   VLPAVQRDAACVVVNLFMLPNEPDLFRQCVQNIARVRADCDRYGMPLMIEPLVMQSPTP
FT                   GSRYMVDGDAEKIVTLVRLAREMGADIVKADPTSDPKDFHRVVQAARCPVLVRGGGRED
FT                   LSQVFARSRTLLDQGAVGMVYGRNVYQHGNPSAVVSALMAMIHRDASAEAALDIYESGG
FT                   TKQGK"
FT   gene            complement(413759..414751)
FT                   /locus_tag="Varpa_0389"
FT   CDS_pept        complement(413759..414751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0389"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: vap:Vapar_0370
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34611"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C1"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU34611.1"
FT                   /translation="MKSEMKKTTLGPSGIECSAIGLGTWAMGGWMWGGGDNAAAVIAIQ
FT                   ASLDAGVNLIDTAPAYGLGRSESIVGTALKGRRQEAVIATKCGLVWHTQQGTHFFEEDG
FT                   HPVYRFLGRESIFHECEESLKRLQTDYIDLYITHWQDSTTPVAETMDALLDLKKQGKIR
FT                   AIGVSNVNPETLAEYLRYGPVDAAQERYSLIDREIETTLAPLCSEHNVAVLGYSSLALG
FT                   LLAGPIDPEREFKGDDQRASNPRFSAANRATLKAFFEELEPIRAKLGCSFGQMMIAWTV
FT                   ARGTVAVALCGARVRQQAIENAGAGAVELGDEALRLIDAAAKRHLSALA"
FT   gene            complement(414748..415704)
FT                   /locus_tag="Varpa_0390"
FT   CDS_pept        complement(414748..415704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0390"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0371 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34612"
FT                   /db_xref="GOA:E6V3C2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34612.1"
FT                   /translation="MKPANKLTSMREAGLLLIIAVLCIAMSFASPYFLTWDNVRAMLLS
FT                   FSIEGIVVVGMTILLIVGGIDLSVGSVVCFAMVVTGKLFLMGVDPWLASLVAIGMCGLI
FT                   GAMIGGCVTRIGLNHFIASLAFMVIVRGLCLALTQGTPQSLFSLPAEFKFIGQGTLFGV
FT                   PAVILIFLAIVVVSDFVLRRSTLLRRVFYTGSNEKAALYSGIRVGRVKFWVTVLCSASA
FT                   GLAGVIYTARFGAATPTFGMGMELNVIAAAVIGGASLKGGSGTVLGAVLGLALLSVVTS
FT                   SLILLDVSPYWQDVIKGLILLAAVTIDHIMNTRKKTR"
FT   sig_peptide     complement(415615..415704)
FT                   /locus_tag="Varpa_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.885 at
FT                   residue 30"
FT   gene            complement(415779..417299)
FT                   /locus_tag="Varpa_0391"
FT   CDS_pept        complement(415779..417299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0391"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0372 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34613"
FT                   /db_xref="GOA:E6V3C3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34613.1"
FT                   /translation="MSALLELKGISKRFGASRALSGVDFSLHAGEIHALCGENGAGKST
FT                   LMNIIDGIHRPDEGEILLNGQKVVIDGPAHAMRLGIGLVHQEIALCADATVAENIFMPE
FT                   INAGKAAWMNYASFNERAAKVLRRLGQDIDPATPVGDLSISSQQLVEIAKALTLDCKVL
FT                   ILDEPTAALTDNESAALFRVLHDLKAQGIGIIYISHRMAEIFTHCDRVTVLRDGRNVHC
FT                   GPLAGSTPDELVRRMVGRDLGNYYPPKQSASPTAESSGPVLEVNDIADGERVHGVSFAL
FT                   KRGEILGIAGLMGAGRSELAETICGLRIAKRGAVRLNGKTLTIRKYSDALRAGIAYLSE
FT                   DRKAAGVFLDLPIAQNVSSMALSRVSSAWGLLQRSAEHKLAKTLGAKLNLKSDGVAIEV
FT                   SSLSGGNQQKVAIAKLLATNPSVLLMDEPTRGVDVGAKSEIHHILRELANQGVGVIVIS
FT                   SELPEIIGLCDRALVIRDGQVAGELEANEMTEEALLRLASGLCEQETA"
FT   gene            complement(417296..418342)
FT                   /locus_tag="Varpa_0392"
FT   CDS_pept        complement(417296..418342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0392"
FT                   /product="sugar ABC transporter"
FT                   /note="KEGG: vap:Vapar_0373 sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34614"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0373"
FT                   /protein_id="ADU34614.1"
FT                   /translation="MRRNFLKSAAAAGIGLAGASAFAQQQAAAPAAGTGLRGNASDVYV
FT                   MNVMVSGVEYWFPVYEMMKQLGRTLGVKTRYTGTPEYDVNKQLASFEQELARKPAGILL
FT                   HPMNPDPFIEPINRAAAMGIPVVTFAADSPNSKRTSFVTSDNDREGTQAADAIAASLNG
FT                   KGEYAVLENPGQDNHDRRIAAFVNRMKTKHTGMKLVGRAASNQDPNKAYQAVLSLAQAN
FT                   PNLGALFMPEANSALGAAQAKVETKKNIKVMCCDVNAKILDMIKSGDVFGAINPNQGMQ
FT                   GYMGMMMLFLAKNPSLIDPMNDAKRNGTNPMAVPFLDNGLAVVSKANADDFYWDKYLAR
FT                   RGTKGIGE"
FT   sig_peptide     complement(418271..418342)
FT                   /locus_tag="Varpa_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 24"
FT   gene            418522..420069
FT                   /locus_tag="Varpa_0393"
FT   CDS_pept        418522..420069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0393"
FT                   /product="Carbohydrate kinase, FGGY-like protein"
FT                   /note="PFAM: Carbohydrate kinase, FGGY-like; KEGG:
FT                   vap:Vapar_0374 carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34615"
FT                   /db_xref="GOA:E6V3C5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C5"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ADU34615.1"
FT                   /translation="MMPNILIGVDMGSSSLKALALEVGSGRAVALSRMPLPHDRLAGGG
FT                   CEVGAAAIRAALTHVLRDVAHQLGPRAAEVRAMACTGHGAGLYALDANNELVGGRAVAS
FT                   TDQRADARARTLAKSQGARLFEDVGCGPWPGQPTVIAAELLGADAVQRGELRRLLFAKD
FT                   YLGFLLTGEIATDASDASTAGLVSLATGGWSQIAFDASGLTDLGAHNFGPILPSGTVLG
FT                   KLRASEAALCGLPAGIPVAMGAIDLLASMTAICAERRGRAVQVFGTWCVNAVIGPVMEP
FT                   KPAVASIVNFGRTHERLYMENSPSSMANIAWLAGVLALPDARAVVDLAMTVPLGANGLR
FT                   FAPFINGGGGVTAGFVGMKSHHTRADMARAVVDAVAALHVRQTARLAAGGLAVSASTVL
FT                   GGGASDARLVRLLASFLGRPVERCADDETGARGAALYAAMSQGMDDAAEGSALLAPCDL
FT                   IEPDARDARAHADFNADFNELIDSMSPVFTHIAGGAQSAARPPEGARTAARSAEVSP"
FT   gene            420066..421826
FT                   /locus_tag="Varpa_0394"
FT   CDS_pept        420066..421826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0394"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /note="KEGG: vap:Vapar_0375 FAD dependent oxidoreductase;
FT                   PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34616"
FT                   /db_xref="GOA:E6V3C6"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C6"
FT                   /inference="protein motif:PRIAM:1.1.5.3"
FT                   /protein_id="ADU34616.1"
FT                   /translation="MSAWQLPFVRPASLADRHFSTVIVGAGINGVGVFRDLSLQRVDCL
FT                   IVDKGDFGAGASSAPSRMIHGGLRYLENGSFSLVAEATRERNLLLRNAPHLVRPLKTVV
FT                   PLANFFGGLMSSALKFFGRTPPQRTRGLLAVALGLRLYDILGRRQRVMPGHRISRVPTN
FT                   DRGLFRAAIRWTATFFDAWISHPEWLILELIGDACRDQPRSAAANYCRVMGCAGNILTL
FT                   RDELTGALVRVTADTVVNATGAWLDRSAAVLGGAGPRVMGTKGSHLVLDHPALRDALDG
FT                   RMAYFEAVDGRVCIVYPFLDRVLVGSTDIPVEDPDQIVTEPAEVDYLIDVLREVFPNMA
FT                   FGRDHVVYTYVGVRPLARSDADKPGQISRDHSVVVDPPSATRDIPIVGLVGGKWTTFRS
FT                   LAEEATTEVLQLLGRSRTASTELLPIGGGADLPADAAATERFIEKMTASGMGRARALTL
FT                   LARYGSKALPLAQRLAASGDVPLQHAPDYSAAELSYLCLETGVVHLDDLVIRRTLLAIR
FT                   GLVTDAALAEISGIAAEALGWDAARAHKELRTCATALREHHNVRLQAVAPDVEPSFDAS
FT                   LMASSALGQS"
FT   gene            421829..422590
FT                   /locus_tag="Varpa_0395"
FT   CDS_pept        421829..422590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0395"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: vap:Vapar_0376 transcriptional regulator, GntR
FT                   family; PFAM: UbiC transcription regulator-associated
FT                   domain-containing protein; regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34617"
FT                   /db_xref="GOA:E6V3C7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C7"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADU34617.1"
FT                   /translation="MNSPNDTLSTVLDRNSESPLWAQFRDAIRLQILKGVLPIGAKLPS
FT                   EAELGDQFGISRIVVREALADLVRNNLIYKIKGRGAFVSARERDEDFVSTVLGFSDEME
FT                   RKGRSVRTQILTQELRAPTEQEAASLGLTEPDAQVVALKRLRSVDGELRLLVETVVPAD
FT                   LTPGLHRTRLDDRSLYDVLRRQYGLRLVRAERWIDAVLPDAETCKLLDLPHPEPLLRIE
FT                   SIAYGANGRPLEHYRALHRCKTSRLHVQTTT"
FT   gene            complement(422604..423497)
FT                   /locus_tag="Varpa_0396"
FT   CDS_pept        complement(422604..423497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0396"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: vap:Vapar_0377 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34618"
FT                   /db_xref="GOA:E6V3C8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C8"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU34618.1"
FT                   /translation="MPSFTPRQFVLLVLLTLAWGFNWPVMKLGVADYPPLAFRAISIWL
FT                   GLPVLGIALVWMKVPFRVPRSAWPELVWLGATNMFVWHACIILAVKALSGGRAAILGYT
FT                   MPVFSAVIGALLFSAVLTRRSWIGVGACAVGVGLLLWHELTDFAGRPGYVALALVAAAT
FT                   WALGTQLLRHTRIGLPTLTLSFWMTAMTAVVMTVLSLLFERGPWRWPGTVTWGSILYNA
FT                   VLIFGFAHAAWFYLARGLPPVASTLSVMFIPVLGVFSGAVWLGEVVHWQDWVAVALMMV
FT                   AIASVLWPSRGNAAKA"
FT   gene            complement(423513..426629)
FT                   /locus_tag="Varpa_0397"
FT   CDS_pept        complement(423513..426629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0397"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="KEGG: vap:Vapar_0378 excinuclease ABC, A subunit;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34619"
FT                   /db_xref="GOA:E6V3C9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C9"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADU34619.1"
FT                   /translation="MSGCPRTIAPLNSKATEELAAQEESARDAQRERDTYLGAVLAQQR
FT                   ISIRGARTHNLKNVDLDIPRNKLVVITGLSGSGKSSLAFDTLYAEGQRRYVESLSAYAR
FT                   QFLQLMDKPDVDVIEGLSPAISIEQKATSHNPRSTVGTVTEIHDYLRLLFARAGTPYCP
FT                   DHHLPLQAQTVSQMVDATLAIPDEPRLLILAPVAREKKGEFLELFAEMQAAGYVRFRVD
FT                   GQTYEYNDLPKLKKTEKHDIDVVIDRLRARPDMQQRLAESFEAALRLAEGRAIALELGA
FT                   EGVADKEHLFNAKFACPICHYSLSELEPRLFSFNSPVGACPSCDGLGHREVFDPARVVA
FT                   FPSLSIASGAIKGWDRRNGYYFSMIESVAKHYKFDVDAPFESLPASVQQVLLNGSAAEE
FT                   IKFNYTMESGNFAGKKLTKKHPFEGIIPNMTRRYRETDSVMVREDLARFRNLQPCPDCG
FT                   GSRLRREARNVFLVDESARPADGGEPPRMAIFELSHLTLRDSLAWFQTLKLRGAKADIA
FT                   DKVVREIGLRLKFLNDVGLNYLSLDRSAETLSGGEAQRIRLASQIGSGLTGVMYVLDEP
FT                   SIGLHQRDNDRLIGTLKHLRDIGNSVIVVEHDEDMIHAADHVIDMGPGAGVHGGRVMAQ
FT                   GTYAEVSANPDSLTGQYLSGTKKIEVPKHRTAWLPAVKKPAFNEGKKPSRFPQSPAAER
FT                   RAAREAAHIASQTDLQEIRVVGATGNNLKNVSVAFPVGLLTCVTGVSGSGKSTLVNDTL
FT                   YTAVARTLYRAHEEPAEHESVEGIEYFDKVINVDQSPIGRTPRSNPATYTGLFTPIREL
FT                   MAETNTARERGYGPGRFSFNVAGGRCEACQGDGVVKVEMHFLPDVYVPCEVCHGQRYNR
FT                   ETLEVQYKGKNIAQILEMTVETAHEFLKAVPTIERKLRTLLDVGLSYIKLGQSATTLSG
FT                   GEAQRVKLALELSKRDTGRTLYILDEPTTGLHFADIELLLKVLHQLRDAGNTIVVIEHN
FT                   LDVIKTADWLIDMGPEGGAGGGTVVGEGTPEDIAANEASHTGRYLKRLL"
FT   gene            426679..427371
FT                   /locus_tag="Varpa_0398"
FT   CDS_pept        426679..427371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0398"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: vap:Vapar_0379 single-strand binding protein;
FT                   TIGRFAM: single-strand binding protein; PFAM: single-strand
FT                   binding protein/Primosomal replication protein n"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34620"
FT                   /db_xref="GOA:E6V3D0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D0"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADU34620.1"
FT                   /translation="MAASLVGAFQEPGGGAPPAGIGHNPRFSFSSSFIYLSGAVHMASV
FT                   NKVIVVGNLGRDPEMRTFPSGDQVANVTVATTDRWKDKQSGEMREATEWHRIVFNGRLA
FT                   EIAGQYLRKGSQVYVEGSLRTRKWTDKDGIEKYTTEIRADQMQMLGSRQGQGGPSGGPE
FT                   DDGGYSQGGGGGGYSQGGNGGGGGGGGGGGYAPRAPAAAPRAPSAAPRQAPAKSSTGFD
FT                   DMDDDIPF"
FT   gene            427491..429479
FT                   /locus_tag="Varpa_0399"
FT   CDS_pept        427491..429479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0399"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="KEGG: vap:Vapar_0380 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34621"
FT                   /db_xref="GOA:E6V3D1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34621.1"
FT                   /translation="MNVPMVRELRAWFFEGLSKYRAAPLWANVVLVVSLALLALMIVFF
FT                   GGSSAAPGVPATRITHADWQVTEAPGFREPSIVMDSRALPDTWQSIELPLSLPIALLRQ
FT                   TDDRFIASATRTTWLRVAVHDLPVTTGPLALYGVRIKTDGTIAVYADGRLVHRDQENGP
FT                   LWNSTRTPLWVVIEKTPDAVPLKEILIRLEHTRNAQVAVSSLWLGPVDSLKDRYNKRLW
FT                   FQQDLPAMLGAAFMAVGLFALFVWFRRRHETGYLLFFNLATTSFLRSLHFYVSLPVAND
FT                   WFAWLTVNSLFWLVAVVHFALRQLHGRPLQWLTYAVVGWTALIGVLTLPGLGILTNTPQ
FT                   VTPLIYVGAAAMGAAVALVGGISAWRRSNEGRLVAVGIGVCVLLGLSDWLLQNNFANPE
FT                   GWYLGSYTNAVTFAVFGTLMYRRYVNAIAEVELVNASLAERLQAREAELEQSHRRLREV
FT                   EKRQTISDERQRLMQDMHDGLGSSLISAIRSVENGRLSDEKVSHILRSCLDDLKLTIDS
FT                   MEPLEEDLLLLLATLRYRLGPRLEGSGVALRWEVQEIPPLDWLDPTSALHILRIVQESI
FT                   ANILRHTRATEIRVGTAPEAEGVRVTIEDNGQGFDVDKAMAEAGGRGMQNQLRRAQAIG
FT                   GGVSWRSGPTGTLFTLWLPLQRKPRKA"
FT   gene            complement(429489..429917)
FT                   /locus_tag="Varpa_0400"
FT   CDS_pept        complement(429489..429917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0400"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: vap:Vapar_0381 glutathione-dependent
FT                   formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34622"
FT                   /db_xref="GOA:E6V3D2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D2"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ADU34622.1"
FT                   /translation="MTSPGTTTVRSLAGKCLCGAVHYTVADEFTYALNCHCADCRRATG
FT                   SAFKPFAGIERHKLAITQGADTLLIHGEEDAGDIHCGKCGSFLYSVVRDGMFVHVTLGT
FT                   LVDDPSIRPSAHIFVGSKAPWFAINDDLPQHQGHAGAD"
FT   gene            complement(429945..430658)
FT                   /locus_tag="Varpa_0401"
FT   CDS_pept        complement(429945..430658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0401"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   vap:Vapar_0382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34623"
FT                   /db_xref="GOA:E6V3D3"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D3"
FT                   /inference="protein motif:PFAM:PF01709"
FT                   /protein_id="ADU34623.1"
FT                   /translation="MGAQWKAKHKDLAANAKGRLFGKLAKEIMMAARNGADPASNSRLR
FT                   LVVEQARKVSMPKDTLDRAIKKGAGLTGEAVHFEHVIYEGFAPHRVPVMVECLTDNVNR
FT                   TAPEMRVLFRKGQLGTSGSVSWDFDHVGMIEAEPANATADAEVAAIEAGAQDFEPAGES
FT                   NATVFLTDPTDLDLVSRALPAQGFTVLSAKLGYKPKNPVDPASLSAADLEEVEVFLAAI
FT                   DANDDVQNVYVGLAG"
FT   gene            430787..431632
FT                   /locus_tag="Varpa_0402"
FT   CDS_pept        430787..431632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0402"
FT                   /product="PEP phosphonomutase and related enzymes-like
FT                   protein"
FT                   /note="KEGG: cwo:Cwoe_0706 PEP phosphonomutase and related
FT                   enzymes-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34624"
FT                   /db_xref="GOA:E6V3D4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D4"
FT                   /inference="similar to AA sequence:KEGG:Cwoe_0706"
FT                   /protein_id="ADU34624.1"
FT                   /translation="MPSIETRQQQTETFHRLHAGADPLVLVNAWDAVSARIVERAGAKA
FT                   IATTSAGIAWALGYPDGERVPVDELLAATARICRVSRVPVTVDIERGFGDSTETVCEVV
FT                   RAFIDMGVAGINIEDGTLPGTRELAPPEILCERVAALRKLDVRLFINARTDTYFVANDD
FT                   PAARYADTLRRARLYAAAGADGIFVPGMSKLEEIASLAAAVPLPVNVYAGHTQAPPVAV
FT                   LAGAGARRISLGCGPLQAALGLLGRIAAEAFDGSDAGFRAMSAGMLSAGEINALFSGTS
FT                   "
FT   gene            431653..432432
FT                   /locus_tag="Varpa_0403"
FT   CDS_pept        431653..432432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0403"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dac:Daci_4599 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34625"
FT                   /db_xref="GOA:E6V3D5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34625.1"
FT                   /translation="MGYSGDPLPQPTPTDPLVPYSIRLESVTLVRGEQRVFDELTLSLD
FT                   EARIGLVGDNGAGKSSLFRLISGLDQPQQGRVVVHGCDTQGTQADRRQLSQHVGLMFQN
FT                   PDDQIIFPTVAEELAFSLTARGETRQAARERAREFLAERGLAAWAGRAIGELSQGQRQQ
FT                   VCLLALQIGQPATLLLDEPFASLDLLSQARLAAQLEATGQQIVVSTHLLEHVYDFERVL
FT                   WLEQGRVRADGPGREVCEAYAENVRQRAEAERGPRHA"
FT   gene            432425..433018
FT                   /locus_tag="Varpa_0404"
FT   CDS_pept        432425..433018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0404"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG:
FT                   ctt:CtCNB1_2059 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34626"
FT                   /db_xref="GOA:E6V3D6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D6"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADU34626.1"
FT                   /translation="MRSLYSSHPTWTHALPAWVKLAVLSVCGTLLVLVERPVHLGIACV
FT                   VVLLLFASLGRTAWLRVRMLAGIAIGCALIVGFHWFLGTTVLGVASALRLASAAVLALM
FT                   LTLTTRFEDLLAVLETVMRPLQRFGVPTERIALGIGLMLRFAENFYVQWQRLDDAYRAR
FT                   AGHGGGLRLLAPLTIRTLQTAERVADALAARLGR"
FT   gene            433064..433642
FT                   /locus_tag="Varpa_0405"
FT   CDS_pept        433064..433642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0405"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: ajs:Ajs_2319 BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34627"
FT                   /db_xref="GOA:E6V3D7"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D7"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADU34627.1"
FT                   /translation="MTTTGSITSSRSLSYIALFAALMAVFGLIPKVDLPFGVPITLQSL
FT                   GVMLAGCLLGPRRGFFAIALFLLAVALGLPLLPGGRGGLAVFVAPAGGFLFGWMFGAFA
FT                   CGLLMRRMAGATGKGLLAAAFLSSVVGGIVVVYAFGIVGLSLIAHMSLTQAALAMLVFI
FT                   PGDLIKCGICAMLVQTVMRGMPSWRLDRD"
FT   gene            complement(433649..434116)
FT                   /locus_tag="Varpa_0406"
FT   CDS_pept        complement(433649..434116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aas:Aasi_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34628"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D8"
FT                   /inference="similar to AA sequence:KEGG:Aasi_0143"
FT                   /protein_id="ADU34628.1"
FT                   /translation="METTPLPPLAWGMPDTVFDLLEGVWDLDRVIEGKATMAGTARFVR
FT                   LDAGQLKYREEGRIQLPNGQAFDGHREYVFERSPKGFSVFFAEVPPRLFHDIAIVREGD
FT                   ELVGSAGHLCVADQYDSVYRFRADGSFVIEHLVKGPRKDYLSRTVFKRRGL"
FT   gene            434374..434754
FT                   /locus_tag="Varpa_0407"
FT   CDS_pept        434374..434754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0407"
FT                   /product="SNF2 superfamily protein"
FT                   /note="KEGG: vap:Vapar_0383 SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34629"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0383"
FT                   /protein_id="ADU34629.1"
FT                   /translation="MTASKILSAVAVALMAVAGAAHAESYDGVHQLTSAASRADVASQA
FT                   VVAAHSANPYATGANAGPAQVFVSSTSRAAVRSEAVAAAHSADPYAEGASAGVAPLVAS
FT                   TVDRNAVRAAARAAARGDALPL"
FT   sig_peptide     434374..434445
FT                   /locus_tag="Varpa_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(434841..435875)
FT                   /locus_tag="Varpa_0408"
FT   CDS_pept        complement(434841..435875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_1752 DNA polymerase III, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34630"
FT                   /db_xref="GOA:E6V3E0"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E0"
FT                   /inference="similar to AA sequence:KEGG:Gbro_1752"
FT                   /protein_id="ADU34630.1"
FT                   /translation="MLVASSMARLHPSVARIAHLSGHTPGYGYVSPDGRYQAVEAGGDT
FT                   LIVDLQARRMHRAPGVYPRGFEEAAPDGATGTTLRVEGEETATAYLPAWTDLQWIALEN
FT                   TAEDFWTPWPDPPDRRSADLPTVDETLPAEWTSDAPQATERVRRSVGDWVAWFVALAVL
FT                   AFFAVFGVRAMTWALAGGWQWLWMAVGLPVFAMFSVLTVVFVATTLRERRRVRVALSGM
FT                   SLERGEGFRVGEPLDVRLLATVPDAHAGERTVAPERIAVRLMRRSIRSETDGRWSVMDE
FT                   CRDEAVALRDDLTRAGRVLYACELCARPAPDDASAQWFVTLHEAAAPDSAPFVVAGLRL
FT                   LPAR"
FT   gene            436154..436759
FT                   /locus_tag="Varpa_0409"
FT   CDS_pept        436154..436759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34631"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E1"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0385"
FT                   /protein_id="ADU34631.1"
FT                   /translation="MALTLAPEDTRGRIHDLVWCGFYPDADVEWMITDEYLDPDELTSE
FT                   DRAWVKAEVASICAAKHAAEAQWPAETEYDRLEAVFAQLRSEKIIALHRAGNTLSDGHD
FT                   DVREHWRAAGRLGSGIRGCCFYHSQDLDTAVRTGRLHLAFSGGMIPEIEQREANTVVIG
FT                   HRIIELLRAAGFQANWSGNINERIEADLGQWRKRGPSV"
FT   gene            436732..438597
FT                   /locus_tag="Varpa_0410"
FT   CDS_pept        436732..438597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0410"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; glycosyl transferase
FT                   group 1; KEGG: mxa:MXAN_4997 VanW-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34632"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E2"
FT                   /inference="protein motif:PFAM:PF04294"
FT                   /protein_id="ADU34632.1"
FT                   /translation="MAQARPVGVSVRAWQPPRRIDAIDFWLRSRLLASAHALREALRPS
FT                   ARRWHGDAHALADAPVLAQYRTPLWSDGRADEFPLVAGKVQNLRVARRAFDAIEVPAGE
FT                   VLSFWRQLGRPSASRGFVQGRELRGGCVVPTLAGGLCQLSNALATVAARAGLELVERHG
FT                   HTARIEQAADAAGDAVDATVFWNYVDLKVRAKHAWRLEVELTSDELVLRIRARSPIAMP
FT                   AVPMALRRASEEGASAALPLARGCLSCDQTACFRHRLLPAVAQQGRTAVLLDAWTPEFA
FT                   RYLAAHHTGADRMQPVPLRLAFWRAGPATGRHREAVADGAASVQSPWWASLRSTVWQRL
FT                   WARHAGRRQGSLIGGQRWLALAFAARLKPEHTQLVIDQALLPHLQQLGALDGRRVTVLA
FT                   SALPMAEIERRLDAAAQRWPGDATLRDFRADAALVQAEAAALARVAAVVTPHAEAATHL
FT                   AAMAPRAALFRLDWVLPAARDIDAACDAPPLIVFAASALARKGARELAAALQGWPCRLR
FT                   VLGSPSDDAQLWRGIGSVEHMHWRGDGLNGARVVVLPAHIEHAPRALLRALAAGVPVVA
FT                   SSACGLAGLSGVREVAAGDVEGLRAALKNACNADDGNNKNDESAS"
FT   gene            438594..440270
FT                   /locus_tag="Varpa_0411"
FT   CDS_pept        438594..440270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_6116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34633"
FT                   /db_xref="GOA:E6V3E3"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_6116"
FT                   /protein_id="ADU34633.1"
FT                   /translation="MTIDLQTLKCGECGSSVLKRTGLNEYTCDHCGSVTLVEDKVSDRL
FT                   ERVLDQVKNEAGRRLAAEEALRQKLMLRKVGIGIAVVLAVVLVARIAELLIASRQPAGT
FT                   QQPVVAAFVDRTIPVDGLKLGEPRQVLLGSGSSAQPKLLVVARNETGKPLSRAGIRATY
FT                   YDGDSKVDERTETLPIFVLEPGESAPALIDMPNGKNVTRQELQVQKLAEPYTATDGPRM
FT                   TFSRVRLVQQGERVRLVGRIDNTRKDAAIVGGIDVLATLYDDAGQVIGFGHGYAQASEL
FT                   KPGGQTSVDVSVARFGRGAAIAAWDYRIGYNIVDASGSRTPVRSADRVIRTAAGPESFN
FT                   PDLRLGTEDLLAEDSERFDPKDLELLPLVDGRNNIQQRLFLGELVNRSTDAVVLAPGGV
FT                   ISRFSGSKAHGTTNITGLAYLYPGERFPIFLEPEDMERFTSTRIEWKPMRRAALPGPRK
FT                   PLEVKVTGTKAELGSVLLNFSQRFTYKSVEVSGSVKNPGNAIIGKVRLWVSLRDRNGQL
FT                   TGFKLVDNLPAIAPGESVPFQVDITQNGRDFASVSTLYQTE"
FT   gene            440304..441293
FT                   /locus_tag="Varpa_0412"
FT   CDS_pept        440304..441293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0412"
FT                   /product="luciferase family oxidoreductase, group 1"
FT                   /note="KEGG: vap:Vapar_0386 luciferase-like monooxygenase;
FT                   TIGRFAM: luciferase family oxidoreductase, group 1; PFAM:
FT                   Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34634"
FT                   /db_xref="GOA:E6V3E4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E4"
FT                   /inference="protein motif:TFAM:TIGR03558"
FT                   /protein_id="ADU34634.1"
FT                   /translation="MMAPMIPFSILDLSPITEGSDAAQSFRNSLSLAQHGEKLGYTRYW
FT                   LAEHHGMPGIASAATAVLLSYIGAGTTSIRIGAGGVMLPNHSPLVIAEQFGTLASLYPG
FT                   RIDLGLGRAPGSDQRTARALRRNLESDADQFPQDVVELMDFMSKTPQQPVRAVPGEGLE
FT                   VPVWILGSSTFGAQLAAHLGLPYAFASHFAPQQIMQAIQIYRETFKPSAQLKKPYVMLG
FT                   FNVFAADTDEEAEFRATSWQQAFVNLRSGRPGRLPPPVENYRQKVGPAENALLDSVLSC
FT                   SAVGSVETVRKGVEAFVARTGADELMITSQVFDHAARLRSYELLDGIR"
FT   gene            441352..442452
FT                   /locus_tag="Varpa_0413"
FT   CDS_pept        441352..442452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0413"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   KEGG: vap:Vapar_0387 tRNA-specific 2-thiouridylase MnmA"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34635"
FT                   /db_xref="GOA:E6V3E5"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E5"
FT                   /inference="protein motif:TFAM:TIGR00420"
FT                   /protein_id="ADU34635.1"
FT                   /translation="MAKQRIVVGLSGGVDSAVTAHLLKQQGHEVVGIFMKNWEDDDDSE
FT                   YCSSNIDFIDAASVADVLGIEIEHVNFAADYKDRVFAEFLREYKAGRTPNPDVLCNAEI
FT                   KFKAFLDHAMRLGAEKIATGHYARVRHNEVTGRHELLKGLDPSKDQSYFLHRLNQAQLS
FT                   KTLFPVGELHKTEVRRIAEEIGLPNAKKKDSTGICFIGERPFRDFLNRYISKEPGPIKD
FT                   DRGRKLGEHQGLSFYTLGQRQGLGIGGVKEKGAQRGSGDHSPWFVARKDIEKNTLWVVQ
FT                   GHDHPWLLSSALNADDASWVSGEAPAAGSYGSKARYRQADAGCELSDDANGAFSLRFGA
FT                   PQWAVTPGQSAVLYDGERCLGGGVIV"
FT   gene            complement(442442..442939)
FT                   /locus_tag="Varpa_0414"
FT   CDS_pept        complement(442442..442939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0414"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: vap:Vapar_0388 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34636"
FT                   /db_xref="GOA:E6V3E6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR033713"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E6"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADU34636.1"
FT                   /translation="MAARWKPNVTVAAVIEQDGRFLLVEEHTADGLMLNTPAGHLDPGE
FT                   SPAEGCIRETLEETAHRFTPTALVGIYMARSRPKAEQGEDVTYMRFAFTGVLGAKEDGR
FT                   ALDEGIVRTLWMTPDEIRASVARHRSPLLLQCVEDYLAGQRHPLELIHIDESVRTPPPV
FT                   KR"
FT   gene            complement(442947..443387)
FT                   /locus_tag="Varpa_0415"
FT   CDS_pept        complement(442947..443387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34637"
FT                   /db_xref="InterPro:IPR025091"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0389"
FT                   /protein_id="ADU34637.1"
FT                   /translation="MNRMTRLLVSAALLWSSFTGLAAAQDIVEPSDMVRGGMQAIQMID
FT                   QGKAGELWDGATPATRKRVTRADFTGQVAKSRASLGAPQQRTWVAVNRQVVADADADTA
FT                   GQYVSVEYETRFANKPDGTLRELVSFHLDRDRTWRFSGYVLR"
FT   sig_peptide     complement(443313..443387)
FT                   /locus_tag="Varpa_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.699 at
FT                   residue 25"
FT   gene            complement(443478..444182)
FT                   /locus_tag="Varpa_0416"
FT   CDS_pept        complement(443478..444182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0416"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: vap:Vapar_0390 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34638"
FT                   /db_xref="GOA:E6V3E8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU34638.1"
FT                   /translation="MRIAVLDNGAEQLKLINHTMAGLGHESHMYTEGKTLLQSLRRQTF
FT                   DLLILNWSLPDIKGLDVVKAIRHELKSRLPILFVTDSRDEADMVEALNSGADDFMDKPV
FT                   RAGELEARVTALLRRSYPAKHESELVFGPYHFYPPSRVLKVQGKLVELKNREYELALFL
FT                   FQNLGRLLSREHLHEAVWGLGVEALSRSLDTHVSRLRTKLDLRPANGFLLLAIYGLGYR
FT                   LETIEANTLSSR"
FT   gene            444619..445749
FT                   /locus_tag="Varpa_0417"
FT   CDS_pept        444619..445749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0417"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: vap:Vapar_6044 NAD(P)(+) transhydrogenase
FT                   (AB-specific); PFAM: alanine dehydrogenase/PNT domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34639"
FT                   /db_xref="GOA:E6V3E9"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E9"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADU34639.1"
FT                   /translation="MLIGVPAETAAGETRVAVTPETVKKLVASGHIVRVQSGAGVAASV
FT                   TDAAYQTAGAEITDQAGALSADMVLKVRTPSDAEAGLMKPGAVVIGMLNPFDAAGLQRL
FT                   ASAGVTGFALEAAPRTTRAQSMDVLSSQANIAGYKAVMIAADRYQRFFPMLMTAAGTVK
FT                   AARVVILGVGVAGLQAIATAKRLGAVIEASDVRPSVKEQIESLGGKFIEVSYDTDEEKE
FT                   AAVGVGGYAKPMPPSWLARQQVEVAKRVALADIVISTALIPGRAAPTLITEDMVKSMKP
FT                   GSVIVDIAAGKGADGVGGNCPLSEADKTVVKHGVTIVGETNLAALVAADASALYARNVL
FT                   DFLKLIVTKEGALKIDLEDDIVAACRMTQDGQVTKK"
FT   gene            445782..446114
FT                   /locus_tag="Varpa_0418"
FT   CDS_pept        445782..446114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0418"
FT                   /product="NAD(P) transhydrogenase, subunit alpha part 2"
FT                   /note="KEGG: vap:Vapar_6043 NAD(P) transhydrogenase,
FT                   subunit alpha part 2"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34640"
FT                   /db_xref="GOA:E6V3F0"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_6043"
FT                   /protein_id="ADU34640.1"
FT                   /translation="MDPVSHTVINLIIFVLAIYVGYHVVWTVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTTTPLGKTMGVLAVALAAVNVFGGFLVTRRMLEMFKKKDKKAAAPKA
FT                   EEGASK"
FT   gene            446117..447610
FT                   /locus_tag="Varpa_0419"
FT   CDS_pept        446117..447610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0419"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: vap:Vapar_6042 NAD(P)(+) transhydrogenase
FT                   (AB-specific); PFAM: NAD(P) transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34641"
FT                   /db_xref="GOA:E6V3F1"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F1"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADU34641.1"
FT                   /translation="MNLVTLLYLVASVCFIQALKGLSHPTTSIRGNIFGMTGMAIAVLT
FT                   TIALIHGQARSLNVDFGTGLAWVLAAVVVGGGLGAFMANKVEMTKMPELVAFMHSMIGL
FT                   AAVFIGVAAVAEPWAFGITAAPVAALIGAQTPDGAVILDGFVRYAIPAGNRLELFLGAA
FT                   IGAITFSGSVIAFGKLSGKYKFRLFQGAPVQFSGQHMLNLVLGLLTVALGLVFVFTESW
FT                   PAFFAMLALAFVMGVLIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNAMLIVAGSL
FT                   VGSSGAILSYIMCKAMNRSFFNVILGGFGGEAATTGGAAKEQRPVKTGSADDAAFVLGN
FT                   AETVVIVPGYGLAVARAQHAVKELAAKLTEKGITVKYAIHPVAGRMPGHMNVLLAEAEV
FT                   PYDQVFEMEDINGEFGQADVAIILGANDVVNPAAHTKGSPIYGMPILEAYKAKTVIVNK
FT                   RSMAAGYAGLDNELFYMDKTMMVFGDAKKVVEDMGKAIE"
FT   gene            447720..449399
FT                   /locus_tag="Varpa_0420"
FT   CDS_pept        447720..449399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0420"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   vap:Vapar_0394 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34642"
FT                   /db_xref="GOA:E6V3F2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F2"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADU34642.1"
FT                   /translation="MTDRPWLSSYPQGVPADIDASHYSSLVGLMEESFTKYADRTAYSF
FT                   MGKDISYAETDKQSKAFAAYLQGLGLAKGDRVAAMMPNCPQYPIAVAAILRAGLILVNV
FT                   NPLYTPRELEHQLKDSGAKAIVIMENFGTTLQQCIAATPIKHIVLTSMGDRLGFLKGAL
FT                   VNYVVRNVKKMVPHFSLPGAVRFNDALDKGASRTLQAPTIGPDDVAVLQYTGGTTGVSK
FT                   GAVLLHRNVIANVLQSEAWNEPVMAQVPAGEQPTSVCALPLYHIFAFTVGMMLNMRTGG
FT                   KLILIPNPRDLAGVLKELSKHTIHSFPAVNTLFNGLANHPDFNTVNWKNLKVSVGGGMA
FT                   VQAAVAKLWLEKTGCPICEGYGLSETSPSTTCNPTNSKAYTGTIGLPLPGTWLKLLDDD
FT                   GHEVPMGQPGEIAIKGPQVMAGYWQRPDETAKVMTPDGYFKSGDIGVVDERGYFKVVDR
FT                   KKDMILVSGFNVYPNEIEDVVAQIPGVLECAAVGVVDDKTGEAVKLVIVKKDESLTEAQ
FT                   VSEYCRANLTGYKQPRIVEFRTDLPKTPVGKILRRELRDAKK"
FT   gene            449451..450455
FT                   /locus_tag="Varpa_0421"
FT   CDS_pept        449451..450455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0421"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0395
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34643"
FT                   /db_xref="GOA:E6V3F3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34643.1"
FT                   /translation="MFKFICVRLSLLVPTFIGMTLLAFFLIRLVPGDPIETMAGERGID
FT                   PARHAELRTAYGFDKPILVQYGIYIGRVLHGDLGKSIITQDKVMSEFLALFPATVELGV
FT                   CAILFALLLGLPAGILAAVRRNSIFDHGVMATSLTGYSMPIFWWGLLLILFFSVQLGWT
FT                   PVSGRIAVQYFIEPETGFLLIDSLRAGDTDAFWSALHHLILPAIVLGTVPLAVIARMTR
FT                   SAMLEVLGEDYIRTARAKGLSRFRVVGLHALRNALIPVVTVIGLQVGVLFTGAILTETI
FT                   FSWPGVGKWLIEAIGRRDYPVLQGGMLLLGGIVMLVNLLVDVAYGVINPRIRR"
FT   gene            450455..451369
FT                   /locus_tag="Varpa_0422"
FT   CDS_pept        450455..451369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0422"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0396
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34644"
FT                   /db_xref="GOA:E6V3F4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34644.1"
FT                   /translation="MMNTTSTPTIPTTGASTAPPGPWREFWTAFSANRGAVIGLVTIVV
FT                   LLLVALFAPWIAPHAPNETNSAVFLQPPAWQQGGTWSYLLGTDAIGRDILSRLMYGARL
FT                   SLSIGVAVVALSVVAGVVLGLIAGFFRGVLEIAIMRLMDIVLTLPSLLLAIVIVAILGP
FT                   GLVNAMLAVAIVVLPHYVRITRAAVIAEVSRDYVTAARVSGAGTLRLMFREVLPNCAAP
FT                   LIVQASLGISTAILDAAALGFLGLGAQPPSPEWGTMLADAREFVLRAWWVVTFPGLAIL
FT                   AAVLAFNLLGDGLRDALDPKLKR"
FT   gene            451392..452420
FT                   /locus_tag="Varpa_0423"
FT   CDS_pept        451392..452420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0423"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: vap:Vapar_0397 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34645"
FT                   /db_xref="GOA:E6V3F5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F5"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU34645.1"
FT                   /translation="MPLLDIKDLHVEFPTQGGVLHAVDGVSLTLEEGEVLGIVGESGSG
FT                   KSVTMMALMGLVGFPGRVRAEHMRFAGKDLLGISDKARRSLVGKEVAMIFQEPTTSLNP
FT                   CFTIGFQLMETLRLHLNLDKRTAKKRATELLEQVGIPAASSRLASYPHQLSGGMNQRVM
FT                   IAMAIACNPRLLIADEPTTALDVTIQAQILDLLRDLQKERGMALVLITHNMGVVSEMAQ
FT                   RIAVMYAGQVMEHQRVDRLFASPQHPYTEALLAALPERAAPEGRLATISGVVPGVHDRP
FT                   LGCLFAPRCSYVTTRACNVRPALREWQGAEVRCHYPLGEPGRIVAIEQDRPQQVPAAEV
FT                   LQ"
FT   gene            452417..453460
FT                   /locus_tag="Varpa_0424"
FT   CDS_pept        452417..453460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0424"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: vap:Vapar_0398 dipeptide transporter ATP-binding
FT                   subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34646"
FT                   /db_xref="GOA:E6V3F6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F6"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU34646.1"
FT                   /translation="MNNDKGAPGDVVVEATSLQRTYDVRRGLFRAPAHLRAVGDISFRL
FT                   ERGRTLAVVGESGCGKSTLARMVALIEKPTAGQLTLVGADAVNPPAERKRELRQAVQLV
FT                   FQNPYGSLNPRKKISAVLEDPLAINTTMGKSERTAKAREMLARVGLRPEYANRYPHMFS
FT                   GGQRQRIAIARALMLSPRLLVADEPVSALDVSIQAQVLNLLADLQAELGLAYLFISHDL
FT                   GVVRHIAHDVLVMYLGHAVEQGPKGRIFARPLHPYTQALLASTPGLSSQRIVLKGELPS
FT                   PLNPPTGCVFNTRCQHVQQRCREERPLLRALDERLVACHYAEKFLDGAPPVRADVPVLA
FT                   VPMATNP"
FT   gene            453500..455131
FT                   /locus_tag="Varpa_0425"
FT   CDS_pept        453500..455131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0425"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: vap:Vapar_0399 extracellular solute-binding protein
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34647"
FT                   /db_xref="GOA:E6V3F7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F7"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADU34647.1"
FT                   /translation="MKTQSSVSRRSRMLALLAPTALAALTLAAGAVSAKTLVYCSEGSP
FT                   ENFYPGMNTTGTSFDVTTQVYNTIVEFERGGTKVMPGLAEKWDISPDGTVYTFHLRKGV
FT                   KWHTTSKSFKPTRDFNADDFIFMLERQWKESDPFFKVTSQNHSYFNDMGMPKLLKSVDR
FT                   IDDFTVKITLNQAEAPFLANLAMQYAGIQSKEYAIAMLKAGTPEKVDQDPIGTGPFYLV
FT                   QYQKDAIIRFKAFPQYWGGKAKIDDLVFAITPDASVRWAKLQKGECHVMPYPNPADLDA
FT                   IRKDPNVQVLEQPGLNVGYLSYNTTKKPFDDVRVRKAINMAINKKAIIDGVYLTTGVAA
FT                   KNPIPPTMWSYNDAIKDDPYDPEAAKKLLAQAGFPDGFSTDLWAMPVQRPYNPNAKRIA
FT                   ELMQADLAKINVKAEIKSFEWGEYRKRLQAGEHQMGMLGWTGDNGDPDNFMYTLLGCAS
FT                   AKSASGSNISKFCYQPYEDLVVKAKSTVKQADRDALYKKAQVIFKEQAPWFTIAHAVQL
FT                   KPVRKEVIDFKLSPFGRHTFYGVDIK"
FT   sig_peptide     453500..453604
FT                   /locus_tag="Varpa_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 35"
FT   gene            455135..455902
FT                   /locus_tag="Varpa_0426"
FT   CDS_pept        455135..455902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0426"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="PFAM: purine or other phosphorylase family 1;
FT                   manually curated; KEGG: vap:Vapar_0400
FT                   5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase;
FT                   TIGRFAM: MTA/SAH nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34648"
FT                   /db_xref="GOA:E6V3F8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F8"
FT                   /inference="protein motif:TFAM:TIGR01704"
FT                   /protein_id="ADU34648.1"
FT                   /translation="MAAPIAIVAAMHEELKALLAQMPDEQRVRVAGRDFWVGHLQGQPV
FT                   VAVLSRIGKVAAAITATVLLERFGVRAIVFSGVAGGLAPGVNVGDVVVATELLQHDMDA
FT                   SPLFPKYEVPLMGLSHFATDAAISEALAAVAEETLRDPVALVGQGAVDEFGLHSPKVHR
FT                   GLLISGDRFVSTAAESETLRRHLPKALAVEMEGAAVAQVCHDYGVPFAAMRTISDRADD
FT                   EAHGDFARFVAEVASRYSLALVGAWLATLPAVD"
FT   gene            456044..457498
FT                   /locus_tag="Varpa_0427"
FT   CDS_pept        456044..457498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0427"
FT                   /product="Kelch repeat type 1-containing protein"
FT                   /note="PFAM: Kelch repeat type 1-containing protein; Kelch
FT                   repeat type 2-containing protein; KEGG: geo:Geob_1618 NHL
FT                   repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34649"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR037293"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F9"
FT                   /inference="protein motif:PFAM:PF01344"
FT                   /protein_id="ADU34649.1"
FT                   /translation="MRGVLGALSAVLFCSLLLAGCGGGGGGGGFPFNLGGNTPEIKDFA
FT                   IGGGVTGISPGGQIVLKNNGGDPLTLSADGPFSFKQRIREGANYTVSVSSTLPTQACTV
FT                   VFASGVATADVASVKVVCGPAQEAVFQPAAAMLTPRVEHTLIALPDGTVLALGGQDLGL
FT                   KGVTSIERYDPASNLWKSAGTLPFQSLQAAVFLPSSGKVLVVGTGAGSQLYDPATQAFT
FT                   PSGGFVTLATVRQLILLLDGRVLASDGNLVELYRPDTGVWRASATASMDHQGGAFTLMA
FT                   NGKILVSGGLLGGTIADSEVFDPSTEKWTTVGRLATSRSGHRGVLLSTGKVLAVGGATG
FT                   TVAHACSCGLRTVAQAELFDPSTNMWSSAGSLLVGRNGFSSTLMPTGRVLVAGGSIQGE
FT                   IDQSTQGFRRTIPSPLSNVEVYDPLTNMWQSWGTLLAARSGHSASLMSSGKLLLSGGSA
FT                   ANPDNPTNPDPYAWHIEFVTSSEIGW"
FT   gene            complement(457539..458525)
FT                   /locus_tag="Varpa_0428"
FT   CDS_pept        complement(457539..458525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0428"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="KEGG: vap:Vapar_0401 magnesium and cobalt transport
FT                   protein CorA; TIGRFAM: magnesium and cobalt transport
FT                   protein CorA; PFAM: Mg2 transporter protein CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34650"
FT                   /db_xref="GOA:E6V3G0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G0"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ADU34650.1"
FT                   /translation="MLNIFTLANGRLVQEEIESLEELSKFQPIWVDLESPTLEEKRWIK
FT                   QYYGLSIPEDAMDEDIEESARFYEEDNGELHIRSDFLIDDDEDPRTVRVAFILNQHNTD
FT                   LRSRGVLFSIHDEDVPVFRLLRMRARRAPGLIEDAKEVMLKLFDADAEYSADTLENIYD
FT                   ELEVAGKKVLSGNVTDELAGEVLGLIARQEDLNGRIRRNVMDTRRAVSFMMRSKMLNAE
FT                   QFEEARQILRDIESLDNHTAFLFDKINFLMDATVGFININQNKTIKIFSVASVALLPPT
FT                   LIASIYGMNFKFMPELDWAMGYPYAIVLMAASALVPMWYFRRRGWLK"
FT   gene            458738..460855
FT                   /locus_tag="Varpa_0429"
FT   CDS_pept        458738..460855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0429"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: vap:Vapar_0402
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34651"
FT                   /db_xref="GOA:E6V3G1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G1"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADU34651.1"
FT                   /translation="MQTAAPPVISAAPKTQAERLAAALATLNDDQRAAVEHGVGAAVAD
FT                   DHRPLLVIAGAGSGKTSTLAHRVAHLIADGVDPQRLLLLTFSRRAAQEMERRAGQVLAK
FT                   VLGLKSERPPALPWAGTFHGIGARLLREYAQQIGLDENFTIHDRGDAEDLMGLVRHELG
FT                   LSSTVNRFPRKGTCLSIYSRCVNTRASVAEVLKEAFPWCGEWEAELKTLFGAYVEAKQQ
FT                   QNVLDYDDLLLYWAEMVAEPALAEAVGARFDHVLVDEYQDTNLLQASILLAMKPDGRGV
FT                   TVVGDDAQSIYSFRGATVRNILDFPSQFSREARVVTLERNYRSTQPILDVSNRVIAQAA
FT                   ERHAKTLWTDKPSAGKPQLVLVPDEAGQARWVADKVLAHREGGLALKSQAVLFRTSSHS
FT                   AALELELARRNIPFVKFGGLKFLEASHVKDLLAVLRFAENPRGRMAGFRVTQLIPGIGP
FT                   VTGTRLLDAMDQAADPAAAVRDFVPPSAAREQWAGFAEAYAALRAPSLAWPADVELAMG
FT                   WYLPHLERLYDDTSGVRRQDVEQLVRLAAGYGSRERFLTELTLDPPEATSDRPGPPLLD
FT                   EDYLILSTIHSAKGQEWNSVHVLNVVDGCLPADVAQSAHELEEERRLLYVAMTRARDHL
FT                   HLLVPQRFYITQQAVRGDRHLYANRTRFITESDLAGFEQQTWPPPPVQPPAVPPPAAVI
FT                   DLRNRMRAAWR"
FT   gene            461177..461506
FT                   /locus_tag="Varpa_0430"
FT   CDS_pept        461177..461506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0430"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: vap:Vapar_0403 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34652"
FT                   /db_xref="GOA:E6V3G2"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G2"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADU34652.1"
FT                   /translation="MNLTISGHHLDVTPALRTYVTSKLDRITRHFDQVVDVKVILTVEK
FT                   QKEKERRQRAECNIHVKGNDMFAESSHADLYAAVDELVDKLDRQVVRHKDRLQDHHHVA
FT                   PKRVM"
FT   gene            461728..462195
FT                   /locus_tag="Varpa_0431"
FT   CDS_pept        461728..462195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0431"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: vap:Vapar_0404
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34653"
FT                   /db_xref="GOA:E6V3G3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G3"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADU34653.1"
FT                   /translation="MNRLASILPPAQVLVSVDATSKKRAFEEAGLLFESLHGLGRALIT
FT                   DSLFARERLGSTGLGHGVAIPHGRIKGLKAPMAAVFQLANPIGFDAPDEQPVALLIFLL
FT                   VPEAATQKHLEILSEIAELLSDAGLREQIKSSTDATALHGLIAGWQSTQVA"
FT   gene            462294..463247
FT                   /locus_tag="Varpa_0432"
FT   CDS_pept        462294..463247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0432"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain-containing protein;
FT                   KEGG: vap:Vapar_0405 HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34654"
FT                   /db_xref="GOA:E6V3G4"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G4"
FT                   /inference="protein motif:PFAM:PF02603"
FT                   /protein_id="ADU34654.1"
FT                   /translation="MKPTVISADAMFEEFRGSLRWEWLAGLGASERQFDPEVISRAQSA
FT                   ADLVGYLNYIHPYRVQILGAREVAYLTRGSPDDCARRIARIVTLEPPMLVLADGQAPPD
FT                   ELLSICERAQLPLFATRESSAFVIDLLRAYLSKHFAERTSMHGVFMDILGMGVMITGES
FT                   GLGKSELGLELISRGNGLVADDAVDLYRINQNTIEGRCPDLLLNLLEVRGIGLLDIRAI
FT                   FGETAVRRKMRLKLIVHLVRRDSFERDYERMPSAPLTQDVLGIPVRKVIIQVVAGRNIA
FT                   VLVEAAVRNSILQLRGIDTYADFVARHHKAMETGQD"
FT   gene            complement(463363..463782)
FT                   /locus_tag="Varpa_0433"
FT   CDS_pept        complement(463363..463782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0433"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: vap:Vapar_0406
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34655"
FT                   /db_xref="GOA:E6V3G5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G5"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADU34655.1"
FT                   /translation="MANIDELKNTGLKATLPRLKILEIFQTGSQRHMTAEDVFRVLLNE
FT                   HSDIGLATVYRVLTQFEQAGILERSHFESGKAVYELNEGTHHDHLICTSCGKVEEFYDA
FT                   EIERRQQMISKDKGWILQDHAMSLYGLCGDCVKKR"
FT   gene            463871..464428
FT                   /locus_tag="Varpa_0434"
FT   CDS_pept        463871..464428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0434"
FT                   /product="SmpA/OmlA domain-containing protein"
FT                   /note="PFAM: SmpA/OmlA domain-containing protein; KEGG:
FT                   vap:Vapar_0407 SmpA/OmlA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34656"
FT                   /db_xref="GOA:E6V3G6"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G6"
FT                   /inference="protein motif:PFAM:PF04355"
FT                   /protein_id="ADU34656.1"
FT                   /translation="MLAIFQRRSWLLAAAVAATLCLGACSGFSDRTRGALAAVTPYKVE
FT                   VVQGNFVSKEQVAALKPGMSRQQVREILGTSLLNDVFHANRWDYVFTIRRQGVEPQERH
FT                   LTVFFNGELMDRFVGDEMPSEEEFVATLDTRKKTGKVPPLEATEDELKKFAPAKDGKAD
FT                   ASASATTVPPLPAAYPPLEAAR"
FT   sig_peptide     463871..463984
FT                   /locus_tag="Varpa_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.497 at
FT                   residue 38"
FT   gene            464528..465370
FT                   /locus_tag="Varpa_0435"
FT   CDS_pept        464528..465370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0435"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; manually
FT                   curated; KEGG: vap:Vapar_0408 dihydrodipicolinate
FT                   reductase; TIGRFAM: dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34657"
FT                   /db_xref="GOA:E6V3G7"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G7"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ADU34657.1"
FT                   /translation="MTQPTSSSPSATSVPRRIAIAGASGRMGHMLIEAVRNAPDCRLAG
FT                   ALDIAGSEAIGNDAAAFLGFTSGVPIVADLRTGLKDAQVLIDFTRPEGTLAHLAVCREL
FT                   GVQAVIGTTGFSDAQKAEIAEIAKDVAIMLAPNMSVGVNVTFKLLEMAAKAMSTGYDIE
FT                   IIEAHHRHKVDAPSGTALKMGEVIADALGRDLKDCAVYAREGITGERDPSTIGFSAIRG
FT                   GDIVGDHTVLFAGIGERIEITHKSSSRVTYAQGALRAVRFLAEQKSGLFDMYDVLGLR"
FT   gene            465382..466077
FT                   /locus_tag="Varpa_0436"
FT   CDS_pept        465382..466077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0436"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   vap:Vapar_0409 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34658"
FT                   /db_xref="GOA:E6V3G8"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G8"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADU34658.1"
FT                   /translation="MSVLELLTHGDGVSRSVAALLLAMSIASWVVILWKTWLLRGGTRD
FT                   VLRSIAAFWQSATLADAEQKLQAFDRAALVLPAVVAIKNAAAVNVNGTLGATADRNQRL
FT                   TRVLRDALHGALRRLQAGQILLATVGATAPFVGLLGTVWGIYGALTGIAGQTGGFTIDK
FT                   VAGPVGEALVMTAFGLAVAIPAVLAYNVFGRVIGRIEAELEGFAHDLLGSFGAAPAPVA
FT                   PPPARPMPV"
FT   gene            466092..466562
FT                   /locus_tag="Varpa_0437"
FT   CDS_pept        466092..466562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0437"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   vap:Vapar_0410 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34659"
FT                   /db_xref="GOA:E6V4B3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B3"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ADU34659.1"
FT                   /translation="MAFGRTSLGSSAAGGGRATGAGGQRPLSDINVTPLVDVMLVLLVI
FT                   FIITAPLMASSIKLDLPQTDAGQPNDTPKFVSLAVDASGKVFLNDKPVTHEELAAQLEK
FT                   SAADSKDTEVQLRADQTVPYGKVVALMGIANKAGLSRIGFVTEAEAPPEKPR"
FT   gene            complement(466687..469170)
FT                   /locus_tag="Varpa_0438"
FT   CDS_pept        complement(466687..469170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0438"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /note="KEGG: vap:Vapar_0411 glycogen/starch/alpha-glucan
FT                   phosphorylase; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34660"
FT                   /db_xref="GOA:E6V4B4"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B4"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ADU34660.1"
FT                   /translation="MTIKDFAYDHPDRDVAAFKRAVANKLIYAVGKDPVAASQDDWLNA
FT                   TSQAVRDQLVERWMMTTRANYAQDLKRVYYLSMEFLIGRTFTNALLAVDLYDTVREALA
FT                   DFGVDMSALAEREPDAALGNGGLGRLAACFLDSMATLGVPGMGYGIRYEYGMFRQRIVD
FT                   GQQVETPDYWLTRGNPWEFQRPEVNYRVRFGGHVQKREGTNAPYGAADWVDTHDVLAVA
FT                   YDTIIPGYGTQATNTLRLWSARATEEIDLSAFNRGNYMGAVESKNQSENVSRVLYPDDS
FT                   TPSGRELRLHQEYFFCSASVQDLLRRYLRSHKTFDQLSEKVSIHLNDTHPVLAVPELMR
FT                   LLLDEHGLAWDEAWAHTQKVFSYTNHTLMHEALETWPVEMLGRILPRHLQIIYDMNAKF
FT                   LATVTQKVGNDVELMRRLSLVDEAGERRVRMAYVAVLASHSINGVSGLHSELMKQSIFA
FT                   DFDKIFPERFNNKTNGVTPRRWLAQANPPLAGLLDQRIGKGWRRDLSQLEALKPMAAQP
FT                   AFVRAFRHAKRENKLRLANWVGEHLKIDLDTDAMFDVQVKRIHEYKRQLLNVLHVVTRY
FT                   HRILDAQAAGTPLDIVPRVVVFAGKAASAYAMAKLVIRLINDVASTINADARVGKLLKV
FT                   VFLPNYSVSLAEIIMPAADLSEQISTAGTEASGTGNMKFALNGALTIGTLDGANVEMRE
FT                   NVGPENIFIFGNTTPEVAEIRARGYQPREIYEENADLKRVLDAIRDGAFSPGEPSRYQG
FT                   IYDALVNWGDHYLLLADYASYVAKQAEVDALYRDSDAWTRMAILNVAGMGAFSSDRTIA
FT                   QYAHEIWNTKPVVLG"
FT   gene            complement(469221..470699)
FT                   /locus_tag="Varpa_0439"
FT   CDS_pept        complement(469221..470699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0439"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   KEGG: vap:Vapar_0412 glycogen/starch synthase, ADP-glucose
FT                   type; PFAM: Starch synthase catalytic domain-containing
FT                   protein; glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34661"
FT                   /db_xref="GOA:E6V4B5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B5"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ADU34661.1"
FT                   /translation="MRILQVSAELFPLLKTGGLADVAGALPLALMAAGQDARVLLPGFP
FT                   AIVAGVRDLAPVAELTAPWGSERFALRAGHIAIDGAPPIPAYVIDAPALYDRPGNPYED
FT                   ATRQPYGDNHRRFALLGWAAAQLAQGLDPAWRPEVVHAHDWHAGLAPAYLHFAREAGST
FT                   RAGSVFTVHNLAYQGISAPWNFADLGLPAPAFHMNGLEYHGQVSFMKAGLYFADRITTV
FT                   SPTYAREIQTPEQGCGLDGLLRQRSGALTGILNAVDDKVWNPAADAALVQGYHSPEGRH
FT                   MAGKARCKAVLQHQLGLAERPDAPLFILVSRLTEQKGLHLVLGGIDALLAQGGQLALLG
FT                   SGEAWLEEAFRQRAAAAPQSVSVTIGYNETLAHQLFGGGDVTLVPSLFEPCGLTQMYGL
FT                   KYGSLPLVRRVGGLADTVVDSTLEDMASGEATGFVFDRFDAADYERALRRAFALYERAP
FT                   DWRRVRGNAMRRPADWATAAAQYIDVYRQAQAPT"
FT   gene            complement(470726..472033)
FT                   /locus_tag="Varpa_0440"
FT   CDS_pept        complement(470726..472033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0440"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   KEGG: vap:Vapar_0413 glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34662"
FT                   /db_xref="GOA:E6V4B6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B6"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ADU34662.1"
FT                   /translation="MDNKLGTPPSQEPLQAHQLVRRTIALVLAGGRGSRLKQLTDRRAK
FT                   PAVYFGGKFRIIDFALSNCLNSGIRRMAVVTQYKSHSLMRHLQRGWSFLRAELNEMVDV
FT                   LPAQQRVGDEHWYRGTADAVFQNLDIIQTRSTKHDYVVVLAGDHIYKMDYSIMVKDHAE
FT                   RGLGCTVGCIEVPRMEATAFGVMAIDDGRQITAFLEKPADPPAMPGHPDVALASMGIYV
FT                   FDSNYLYQLLEEDAANPDSSHDFGKDIIPRAVAQGRALAHPFGMSCVTRASRGPDAKAY
FT                   WRDVGTIDAFWAANLDLASITPELDIYDTDWPIWTYQRQLPPAKFVLDRDGKHGMTVNT
FT                   IVSGGCIVSGSKVSSSVLFSGVRIHSFCEINEAVLLPDVEVGRGARLSKVVIDRGCVIP
FT                   DDMVIGEDAAADAARFERTETGVVLVTREMLKRLTA"
FT   gene            complement(472122..474212)
FT                   /locus_tag="Varpa_0441"
FT   CDS_pept        complement(472122..474212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0441"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; KEGG: vap:Vapar_0414 glycogen debranching
FT                   enzyme GlgX; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34663"
FT                   /db_xref="GOA:E6V4B7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B7"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ADU34663.1"
FT                   /translation="MLSPGTPFPLGATPSKEGVNFALAAPTAESVELCLFDSTGQNEQQ
FT                   RLQLPACTDGIWHGLLPSGHEGLVYGYRVHGPWAPHEGQRFNPAKLLLDPYAREIVGRY
FT                   NGSDLFLGHDPANPDQRDTRDNGTVALKGRVTTASRSNATPPGHARIAATDRVLYELHV
FT                   RGQTRLHPGVPAPLRGTYAGLAEPAVLDHLQRLGVTTLSLMPVQHRADEQRLLAMGLSN
FT                   YWGYNTIGWFAPEARYWSGRPGTTPASEFRAMADAVHARGMELVIDVVYNHSAESDEVG
FT                   PTLSMRGIDNALYYHLREDDRALYENWTGTGNCLNLREPRVLQLVMDSLRFWACEMGVD
FT                   GFRFDLAPVLGRDAKTGFDARAPFFAAIAQDPVLSRTLLIAEPWDIGPGGYRLGEFPSG
FT                   WLEWNDRYRDTQRGFWLRQGRDDASGLGDFAHRFTASSTQFAHHGRAPTASVNFITAHD
FT                   GFTLRDLVSYEERHNLANGENNRDGHGHNLSNNCGVEGPSDDAGVLAKRSRLQRALLAV
FT                   LLLSQGTPMLLAGDELGHSQQGNNNAYCQDNETTWLAWIGASDPASDMARTSDFVARLS
FT                   ALRREAPVLRSTRWWPADPPEGAPAIRWLRPDGQPMTPHDWHAGTALAILFDNNESAES
FT                   KDAGAWLVLVNAGAETVNFTLLPGNWRHRLSTDPGHDHDASPQALGDAVEVSCSSIRIA
FT                   RT"
FT   gene            complement(474206..475027)
FT                   /locus_tag="Varpa_0442"
FT   CDS_pept        complement(474206..475027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34664"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B8"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0518"
FT                   /protein_id="ADU34664.1"
FT                   /translation="MGLESSFFPRPGLAPAGDLLSFASPKERKQRKGDPAVCVPPLRCG
FT                   QPAVLAFRGVRRTRFAQTAAALIRETLRSSAHTEGLWGPHTPSLRSAAPSGLRFARLGL
FT                   APSPSGGRLGWGHATLDETRLCSKGRRAPIPAFPRKGKEQCTKPGVPCLVFLPPLPGEG
FT                   RGGGTAAERSNGPTASRAKQWPGLSPPPSGCAEERSGSRTRARRCLSEASSARPREPRA
FT                   PQVARSEAEGRRQWGRLSFAYLSLAKQRKVGRLPGRDPASEKKQTQGQQEC"
FT   gene            complement(475027..477210)
FT                   /locus_tag="Varpa_0443"
FT   CDS_pept        complement(475027..477210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0443"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   alpha amylase all-beta; glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; KEGG:
FT                   vap:Vapar_0415 1,4-alpha-glucan branching enzyme; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34665"
FT                   /db_xref="GOA:E6V4B9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B9"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ADU34665.1"
FT                   /translation="MPPKSLPASEIRALMRAEHGDPFAVLGPHETREGLEVRALMPGAH
FT                   SVAVMHSRTGWPLAMLTRHEGSDLFSGLVPAAEARLGYSFQVDWDSHTSRLEDPYRFPF
FT                   VLGETDVWLLAEGTHLRPWERLGAHLREIDGVKGVAFAVWAPNARRVSVVGDFNNWDGR
FT                   RHMMRLRRECGVWEIFAPHVATGDSYEFEILSAKGEVLRKADPFAFSSRLRPETACIVA
FT                   PLPAAVKMPEGRAEANERHAPVSIYEVHLGSWRRKNNGHNGQEWLDYRELADTLVPYAR
FT                   DMGFTHIELLPISEHPFDGSWGYQPIGLYAPTSRFGTPGDFRHFVEAAHAAGLGVILDW
FT                   VPAHFPTDAHGLGNFDGTALYEYADPREGFHNDWQTLIFNFARTEVRNYLVGNALYWLE
FT                   RYGVDGLRVDAVASMLYRDYSRKAGEWVPNAQGGRENLEAIDFLRRMNRVVGIERPGAV
FT                   TLAEESTSFPGVTRPPENGGLGFHYKWNMGWMNDTLAYAGTDSVYRKHHHQQITFGLMY
FT                   AHTENFVLPLSHDEVVHGKGSMIGRMPGDEWQKFAGLRNLYGYLWGYPGKKLLFMGGEF
FT                   AQVAEWNADRSLDWHLLEHAAHQGVRRLVRDLNNVYRHFPALHELDNDSAGFEWIAHDD
FT                   ADQSVFAFVRRARDGAFVVVVCNFTPLPRHGYRLGVPVAGAYREIINTDGAVYGGSGVG
FT                   NGIVESSPVPWHGKADSVSVSVPPLATVMWVLV"
FT   gene            complement(477216..478895)
FT                   /locus_tag="Varpa_0444"
FT   CDS_pept        complement(477216..478895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0444"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: vap:Vapar_0416 alpha amylase catalytic region;
FT                   PFAM: alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34666"
FT                   /db_xref="GOA:E6V4C0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C0"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADU34666.1"
FT                   /translation="MGSSINSSNSEWWRGAVIYQIYPRSFMDSNGDGIGDLPGITARLD
FT                   HVASLGVDAIWVSPFFRSPMKDFGYDVSDYRAVDPLFGTLADFDAMLARMHALGLKLII
FT                   DQVLSHTSDQHAWFAESRSSRDNPKADWYVWADPKPDGTPPTNWLSVFGGSAWQWDSRR
FT                   RQYYLHSFLTEQPDLNFHCTAVQDALLGEVRFWCERGVDGFRFDACNHQFHDALLRDNP
FT                   PASLASIDEVSTVRADNPYAMQQHLYDKSQQENLVFLERLRQLLDGYGAVALGEVGDEN
FT                   APPVMAQYTEFGKRLHLAYSFSLLTADHRAKHLRHQVETLDLALAPTGGWGCWAVSNHD
FT                   VPRVATRWSDGKAPDTRRDRLWLALLLILRGSASIYQGEELGLPEAEVPFELLQDPYGR
FT                   TFWPEFKGRDGCRTPMPWQADAPHGGFTTGTPWLPVYGPHLPLAIDNQADDPGSMLAFS
FT                   RALLHWRRAQPLLRTGGIVFFDAPEPLLWFERRDGNRSLQAIFNMGSEPVTIALREALV
FT                   PPQGHPLAATASVQGTSEKRMLALAPYGVFFGTPANEEEGQS"
FT   gene            479027..480481
FT                   /locus_tag="Varpa_0445"
FT   CDS_pept        479027..480481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0445"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   vap:Vapar_0417 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34667"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C1"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADU34667.1"
FT                   /translation="MTTSDPVSSLAALEARLAQDLDYLGFPGRQWMPVRQKDGEAMLDV
FT                   AVIGGGQAGLAASVALAQQSIRAVIFDRSPAGKEGPWATTARMETLRSPKELTGPALGL
FT                   PSLTFRAWFEAQFGREAWAAMDKIPRLQWMDYLAWYRRVMHVDVRNDTAVTGIHPLPDG
FT                   TAVRLDLRTRAGVGRVFARRVVLATGRDGLGGPAVPAFVNALPRSQWAHSSDAMDYGQL
FT                   AGLRVGVVGAGSSAMDSAATALEAGARSVELLIRRPDLPRVNKGKGAGVPGLTQGHFDL
FT                   SDERKWRIRHYINVANVPPPHGSTLRVSAFSNAFFNFGCPILSVAPQGDSMRVSTPRGD
FT                   FEFDFLIVSTGFKVDWPNRPEFDAIASHIRTWKDRFVPAPGDEDQELADSPDLGPVFEF
FT                   KERVPGECPGLERIHCFCYPAALSHGTVSGDIPAISDGAKRLASGIASLFYREDFDHHF
FT                   ANLEAYSEPELFGDEWTPAPPPGERG"
FT   gene            480608..483238
FT                   /locus_tag="Varpa_0446"
FT   CDS_pept        480608..483238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0446"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="KEGG: vap:Vapar_0422 leucyl-tRNA synthetase;
FT                   TIGRFAM: leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34668"
FT                   /db_xref="GOA:E6V4C2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C2"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADU34668.1"
FT                   /translation="MNPSYKPSDVESAAQAQWSAADAYRVTEDASRKKYYACSMLPYPS
FT                   GKLHMGHVRNYTINDMLTRYLRMSGYNVLMPMGWDAFGLPAENAALKNGVPPAKWTYEN
FT                   IDYMRGQLQAMGLAIDWSREIATCDPSYYKWNQWLFLKMLEKGVAYRKTQVVNWDPVDQ
FT                   TVLANEQVIDGKGWRTGATVERREIPGYYLKISDYAEELLEHTQHKLPGWPERVKLMQE
FT                   NWIGKSEGVRFAFTHDIQDASGQLIQDGRMYVFTTRADTIMGVTFCAVAPEHPLAAHAA
FT                   TLDPKVAAFIEECKNGGTTEAELATQEKKGVPTGLTVKHPITEEQVPVWVGNYVLIGYG
FT                   DGAVMGVPAHDERDFAFANKYGIEIIQVVLVDDEPHFDYHKWQDWYGDKQRGVTINSDN
FT                   FSGMTYKEAVAAVAHALGQKGLGELQTTWRLRDWGVSRQRYWGTPIPIIHCEEHGAVPV
FT                   PEKDLPVVLPTDCVPDGSGNPLNKHEGFHAGVVCPVCGKAARRETDTMDTFVDSSWYFM
FT                   RYCDPKNDQAMVAEGADYWMPMDQYIGGIEHAILHLLYARFWTKVMRDLGLVKADEPFA
FT                   KLLTQGMVLNHIFYKRNEKGGKDYFPPLEVTPVLDAQGRITGGTTADGTKVEYGGVGKM
FT                   GKSERNGVDPQDLIEKYGADTARLYTMFTAPPEATLEWNDAAVEGSYRFLRRVWNFGVT
FT                   QADVAPAKAGTQAFGKAAQALRREVHTVLRQVDYDYQRMQYNTVVSGAMKLLNALEGFK
FT                   PDGSAGDAAAVREGFGILLRCLYPATPHIAQQLWTELGYDKDLGGLLDAAWPTVDVEAL
FT                   VQDEIELMLQVNGKLRGKLLVPAGASKDEIEKLALACDDFVAFAEGAPPKRVIVVPGRL
FT                   VNVVL"
FT   gene            483250..483771
FT                   /locus_tag="Varpa_0447"
FT   CDS_pept        483250..483771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0447"
FT                   /product="Rare lipoprotein B"
FT                   /note="PFAM: Rare lipoprotein B; KEGG: vap:Vapar_0423 rare
FT                   lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34669"
FT                   /db_xref="GOA:E6V4C3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C3"
FT                   /inference="protein motif:PFAM:PF04390"
FT                   /protein_id="ADU34669.1"
FT                   /translation="MNKRNASLPRRGFLLGLTAVGASVGLAGCGFELRKAPVFAFKTLS
FT                   VEGNSALINQIRRDLRAAGTVTLVPKEDAKTADAVLVVLGEDRDRFVISTNSAGALREL
FT                   QLRLRVRFSLKTPGGKELLAASEVSQTRDLSFNETNALAKEGEAELLFRDMQSDIAQQL
FT                   MRRLAAVKEL"
FT   sig_peptide     483250..483336
FT                   /locus_tag="Varpa_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.407 at
FT                   residue 29"
FT   gene            483793..484866
FT                   /locus_tag="Varpa_0448"
FT   CDS_pept        483793..484866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0448"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta subunit; KEGG:
FT                   vap:Vapar_0424 DNA polymerase III subunit delta; PFAM: DNA
FT                   polymerase III delta"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34670"
FT                   /db_xref="GOA:E6V4C4"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C4"
FT                   /inference="protein motif:TFAM:TIGR01128"
FT                   /protein_id="ADU34670.1"
FT                   /translation="MQLASAQLGGHLQKGLKPLYTIHGDEPLLAQEAADAIRAAAREQG
FT                   YTERSSYTVAGAHFDWSAVLAAGGSLSLFADKQIVEIRIPSGKPGKDGSTALQQLAEAA
FT                   PGNDSTLTLVMLPRLDKATRTGAWFSALENNGVSIQVDPVERNVLPQWIAQRLGQQGQR
FT                   VMPGDEGQRTLQFFADRVEGNLLAAHQEIQKLALLHPAGELSWEQVEGAVNNVARYDVF
FT                   KLSEAVLAGNPQRVARMLDGLQAEGEAEVLVHYTIAEDIRALKRVKDAMAAGRPLPMAL
FT                   RENRIWGPRERAFERVLPRLDDRMLARLLRAAHLVDGICKGLKQPDWPASGWQALQRLA
FT                   LMLCRACSSAPAAARRA"
FT   gene            484948..486243
FT                   /locus_tag="Varpa_0449"
FT   CDS_pept        484948..486243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0449"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   vap:Vapar_0425 gamma-glutamyl phosphate reductase; PFAM:
FT                   Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34671"
FT                   /db_xref="GOA:E6V4C5"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C5"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ADU34671.1"
FT                   /translation="MNAFNVSEHMQALGLQAKTAAFLMARADAATKNIALKALARRLRE
FT                   AGPALSVANQKDLERATAAGLSAPMVDRLKLTPKVIETVALGCEQLAGMADVIGEMIGM
FT                   KQQPSGIRVGQMRVPIGVFGMIYESRPNVTIEAASLAIKSGNAAILRGGSEAIESNKAL
FT                   ALLVSEALAEAGLPVEAVQLVQTTDREAVGQLIAMPEFVDVIIPRGGKGLIERISRDAK
FT                   VPVIKHLDGNCHVYVDDTAEFGMALRIVDNAKTQKYSPCNAAEGLLVSEVVAEDFLPQI
FT                   AAIFAAKGVEMRCDPAAARILRSDEAALDPAAKVIDAVETDWSEEYLAAVISIKVVAGV
FT                   DEAIAHINRYSSHHTDAIVTRDHVHAQRFLREVDSASVMVNASTRFADGFEFGLGAEIG
FT                   ISTDKFHARGPVGIEGLTSLKYVVLGQGEVRT"
FT   gene            486336..487652
FT                   /locus_tag="Varpa_0450"
FT   CDS_pept        486336..487652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0450"
FT                   /product="glutamate/cysteine ligase"
FT                   /note="KEGG: vap:Vapar_0426 glutamate/cysteine ligase;
FT                   TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34672"
FT                   /db_xref="GOA:E6V4C6"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C6"
FT                   /inference="protein motif:TFAM:TIGR02049"
FT                   /protein_id="ADU34672.1"
FT                   /translation="MVPHLVTALTGPINELEQRVLDSMPAIERWFRLEWMEHTPPFYSS
FT                   VDIRNAGFKLAPVDTNLFPGGWNNLTKEMLPLAVQAAQAAIEKICPEARNLLVIPENHS
FT                   KNTFYLANIAQLVRIFHMAGLNVRIGSVDPAIKSPKKIELPNGETVTLEPVVRGKRRLG
FT                   LKNFDPCTILLNNELSAGTPGILEDLHEQYLLPPLHAGWSVRRKSNHLHSYEELSKRLG
FT                   KLLGIDPWLINPIYARAEGVDIAEGRGIDVLTSHVDAVLTKVRRKYKEYGINEKPFVVV
FT                   KGGHSGSGSPGVVTVRDAKEVEALIGKSRTSTSSAAKTSAGRDLREPTELIVQEGVLTN
FT                   ERVHNGVAEPVVYMMDRYVVGGFYRVHAEQAADENLKLPGASYVPLAFSESTHMPQPGA
FT                   KPGASAPNRFYMYGVVGRLAMVAASYEMEATDPDAEIYE"
FT   gene            487836..489704
FT                   /locus_tag="Varpa_0451"
FT   CDS_pept        487836..489704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0451"
FT                   /product="potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG: vap:Vapar_0427
FT                   K potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34673"
FT                   /db_xref="GOA:E6V4C7"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C7"
FT                   /inference="protein motif:PFAM:PF02705"
FT                   /protein_id="ADU34673.1"
FT                   /translation="MSAPKTISAGLIVGAIGVVYGDIGTSVLYAVKEVFGHGHVPFTVQ
FT                   NVYGILSMFFWTLTVIVSIKYVVLVLRADNEGEGGLVAMLALASRAVADKPRLRHVLLV
FT                   IGIFGTSLFYGDGVITPAISVLSAVEGLEVVSPHFKHYVIPITLVVLFCLFAVQKRGTA
FT                   GIGKFFGPVTLAWFAAIAVLGVWQILHHPEIVKALNPWYALKFIWDNPGTSFILLGAMV
FT                   LCVTGAEALYADLGHFGKKPIRIAWFSVVMPALTLNYLGQGALLLENPEAVKNPFFMMA
FT                   PEWALIPLVLLATLSTVIASQALITGAFSVTRQVIQLGYLPRLNIEHTSVRTAGQIYIP
FT                   LVNWGLFVAIVLAVVMFRTSSSLAAAYGIAVTTDMLITTILTFFVIRYAWKLPLALCIA
FT                   STAVFFVVDFLFFASNLLKMFEGGWFPLLIGGFVFTLMITWKEGRRLMGEAQHADAIDL
FT                   KSFLDSVFVSPPARVDGTAVFLTAEPGVVPNALLHNLKHNKVLHEQNMFVTVRNHEVPW
FT                   IPMDKRIEIEALGHHCWQVIVHYGFKNDIDLPRALEHARLRGCQLEPMATSYFLSRDVV
FT                   IPTLGSGMAPWREKLFAQMHHNASGAAAFLGLPNNAVVELGSKIEI"
FT   gene            complement(489730..490653)
FT                   /locus_tag="Varpa_0452"
FT   CDS_pept        complement(489730..490653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0452"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   vap:Vapar_0429 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34674"
FT                   /db_xref="GOA:E6V4C8"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C8"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADU34674.1"
FT                   /translation="MTTRWPDLLPSHDRFDYRPITRRPDYVWPNGARLAVYLGFNIEHF
FT                   AFGDGLGACIGPASPQPDVLNHGWREYGNRVGAWRCLELFDALALPTGALINTALYDHC
FT                   PELVAACVARGDELIGHGHSNAERQGALDEEHERALLLRCRERMLRESGQAPAGWLSPW
FT                   ISESAVTPDLLGETGYGYTLNWCHDDQPVRMRTRGGGSIWSVPYPQELNDIPMIVGRLM
FT                   DAKDFSAMVVDNFDEMLEQSRAQPLVMGLALHPYIVGQPYRLRHLRTALAHLARARDRG
FT                   EIWFTTPGAIAGHMTQLAAERPEEFG"
FT   gene            complement(490664..491077)
FT                   /locus_tag="Varpa_0453"
FT   CDS_pept        complement(490664..491077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34675"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0430"
FT                   /protein_id="ADU34675.1"
FT                   /translation="MNTPAPLDPAAIVDEFLRLVMIPDPQSASRFTAPDIRIRFTGNRE
FT                   MHAPGDTSAFNAKRYAWVKKKIERTETVAGGTPEATVVYSLGTLYGAWPDGTAFEGNRY
FT                   VDRYVVSHGLIVQMDVWNDSAEWLLVRAGLAVL"
FT   gene            491372..492325
FT                   /locus_tag="Varpa_0454"
FT   CDS_pept        491372..492325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0454"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutathione synthetase; KEGG:
FT                   vap:Vapar_0432 glutathione synthetase; PFAM: glutathione
FT                   synthetase ATP-binding; glutathione synthetase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34676"
FT                   /db_xref="GOA:E6V4D0"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D0"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ADU34676.1"
FT                   /translation="MKNILFVADPLDHFKIYKDTTFSMMREAQRRGHRIAACLPQDIQW
FT                   KSGGLVTATVQQITLTGDAKDWYTVDITESKALKDFDAVLMRKDPPFDAEYIYSTHLLQ
FT                   QAEREGAQVVNSPRALRDHPEKLAIMEFPQFVTPTLVTRSAQAVRDFHAEHGDIILKPL
FT                   DGMGGMGIFRVKQDALNLGSIVETLNKDGAETIMVQRFVPEVSQGDKRILIIAGEPAPF
FT                   VLARIPQGTEVRGNLAAGGKGVAQPLTPRNREIAEAIGKVLAPRGLLLIGLDVIGDSVT
FT                   EINVTSPTCFQEITEQTGFDVPKMFIDALEKTLRPA"
FT   gene            complement(492288..493592)
FT                   /locus_tag="Varpa_0455"
FT   CDS_pept        complement(492288..493592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0455"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="KEGG: vap:Vapar_0433 PepSY-associated TM helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34677"
FT                   /db_xref="GOA:E6V4D1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D1"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0433"
FT                   /protein_id="ADU34677.1"
FT                   /translation="MRAFATGIHRWAGLAVALFLVVSGLTGAVISWDHEIDGWLNRKLY
FT                   DTQSRGPFKDPFELAAAVEAHDPRARVAYMPLGFEEGHAAGYFVQPRVDPATGKPFRLG
FT                   YNQVFVDPVTAEVRGRRDSTAISLKPETLMPFLRKLHYMLHVPAMWGTDRIGWWIMGTV
FT                   ALVWLLDSFVALYLTMPRRLRKAVHPTHRPAAAWWQRWKPSWTVRWAAGGYKLNFDLHR
FT                   AGGLWIWGLIIVVAFTSFSLNLYKEVFHPMLSLVSKTTPGPSALVPLAPLGTRIEPTIG
FT                   FREIVAQAEAEARRRGWTTPLGGAFYNARGGFYNISFFDHATHDDSDGMGLSNLYLDGR
FT                   DGHVISSNRPWHGTAADVFAQLQLPLHGGRILGMPGRIMMSALGLVVAMLSITGIVIWA
FT                   RKLRSRRLQARREREQARTAAPGFRQDAGFSPARR"
FT   gene            complement(493592..495784)
FT                   /locus_tag="Varpa_0456"
FT   CDS_pept        complement(493592..495784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0456"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="manually curated; TIGRFAM: TonB-dependent
FT                   siderophore receptor; KEGG: ctt:CtCNB1_3496 TonB-dependent
FT                   siderophore receptor; PFAM: TonB-dependent receptor;
FT                   TonB-dependent receptor plug"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34678"
FT                   /db_xref="GOA:E6V4D2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D2"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ADU34678.1"
FT                   /translation="MAASLLALHALGAMAQTPAAEPAASSGTLATVNVEASADASAEGL
FT                   TKPYAGGQVARGGRVGILGNQDMMSTPFSSTNYTNELIQDQQAKSVADVLLNDPSVRQA
FT                   RGFGNFQELYVVRGFPVYSDDVAYNGLYGMLPRQYIASEFFERVEVFRGANSFLNGAAP
FT                   GGSGIGGAINLLPKRAPNEPLTRVGFGVQSGGQGFVNLDLARRFGRDDSLGVRVNAVRR
FT                   EGGTGVFKESQQLSAFGVGLDWHSRNVRLSADFGYQDYDLKDGRPSLTPSSTLPIPRVP
FT                   DAKSNFAQPWTYSKEKDKFATFRGEVDITDNITAWAAGGVRRSDEDNVLSNPALVNSFG
FT                   NTSNTRFSNTRKDRIGTAEIGVRGNFTTGPVKHTVVASATTYSNDRDNAYAISSGSVRN
FT                   NIYAPFFSPYPVANGTGGFVGNRLEDPRLTDKIDTSSVAVADTMSFMEDRLLVTLGARR
FT                   QTIKQTSFAYNTIKETSAYDKSKTTPVAGVVFKITPTVSAYANYIEALVQGKVAPATAN
FT                   NRPVANGGEVFAPYQAKQKEIGVKYDGGSLGASAAFFTIDQPVYQYADEAAGQVYGLYG
FT                   KQRNQGLEFSVFGEPTKGLRLLGGLTLLDAKQKNTQGGATDGLTAIGVAKQQANLSAEW
FT                   DVPGVRNLSLNARLLYTSKQYANAANTQQIPGWTRFDIGARYLVDLGNGRALTLRARID
FT                   NLFNKSYWASVGGTQGSNYLTLGAPRTFAVSGTIDF"
FT   gene            complement(495915..496703)
FT                   /locus_tag="Varpa_0457"
FT   CDS_pept        complement(495915..496703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0457"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="KEGG: vap:Vapar_0435 glutamine amidotransferase
FT                   class-II; manually curated; PFAM: glutamine
FT                   amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34679"
FT                   /db_xref="GOA:E6V4D3"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D3"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADU34679.1"
FT                   /translation="MCQLLGMNCNTPTDVTFSFTGFAQRGGRTDHHADGWGIAFFEDRG
FT                   LRHFVDHQPACESPVAELIRRYPIQSRNVIAHIRKATQGEVNLQNCHPFVRELWGRYWV
FT                   FAHNGDLKDFRPRLHGNFHPVGNTDSEHAFCWLMQELAKSHAGVPSIDELTLTLRELAP
FT                   QLASHGTFNFMLSNGQALWAHASTNLWYVERRHPFVTAQLSDEDLEIDFAQHTTPTDRV
FT                   AVVVTTPLTTNETWTQFAPGELHVFVDGQRSVGRDPNEAF"
FT   gene            complement(496780..497922)
FT                   /locus_tag="Varpa_0458"
FT   CDS_pept        complement(496780..497922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0458"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0436 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34680"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D4"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34680.1"
FT                   /translation="MHRRNFIAASAAAAAGLGPLSFPALGAENGVSDSEIVLGHTGILS
FT                   GPLGVPVKVVMAGAGLAFDAVNAQGGLSGRKIRVVSLDDELKPEKALANYEKLLAEHRV
FT                   FAFFGCVGSGTTAAGAKVVNQSGAPTVGGYAVSDSAREKMGGAGYFVRATFAREAQALV
FT                   QHLTTIGVSRIAVAYLDNPGGAEVAKLVEAALDTLKLKPEAAVAVKGDGTTNEASGKAL
FT                   AESKAQAVIMYLGGGIGGEVMKAAWAAGGRQMYYGMSIVPGDVTAKLVGDKTSGLAISQ
FT                   IVPYLWSEVDATAREFRQLAERAKVDLGYLSYEGYVNALVMIEGLRRTGRDLTRAKLHA
FT                   ALKAMKLRIGGMEIDFTGASNTGSRFIEMVRVTKEGKFIR"
FT   sig_peptide     complement(497842..497922)
FT                   /locus_tag="Varpa_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(497991..499484)
FT                   /locus_tag="Varpa_0459"
FT   CDS_pept        complement(497991..499484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0459"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: vap:Vapar_0437 drug resistance transporter,
FT                   EmrB/QacA subfamily; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34681"
FT                   /db_xref="GOA:E6V4D5"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D5"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADU34681.1"
FT                   /translation="MTSPPTPEAAATPAPPAMSILRERYGERYRWYLLLSVMVGTMASI
FT                   MSSTIVNVAIPGMSHHFSLGQERAQWVSSGFMVAMTVSMLTTPWLLSRYGYRRTYIGTM
FT                   LLLLVGGIVGGLANNFSLVLFARVAEGLAAGVVQPIPAIIILRAFEPHEQGRASGIFGM
FT                   GVVLAPAIGPSIGGVLVDLFGWRSIFFMVVPFCLASIWLAYKFVPKTAPGGVAAVRGGG
FT                   LDARGLALGTVGTLCLLNGLVELRGDSPLQAVLLLAGALVSFIAFVWWQRRLAASGGTP
FT                   LMNLALFQYRQFAMGSVVAFIYGTALFGSTYLLPVYMQVGLSLSASHVGTILLPAGIVL
FT                   AVTIAGVGRLADRQPTWVLVTIGLALLAASFALMMVLRLDSALWLLVAFAIIGRIGLGF
FT                   ILPSLNLGSMRPLAKPLIPQGASAINFVRMLGGAAGVSLCAIVLEWRLAAHGDSLANPL
FT                   SSPARLAAFDEVFAMLAGLCALAICAAWQLREGPARNTG"
FT   gene            499616..500929
FT                   /locus_tag="Varpa_0460"
FT   CDS_pept        499616..500929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0460"
FT                   /product="protein of unknown function UCP012641"
FT                   /note="PFAM: protein of unknown function UCP012641; KEGG:
FT                   vap:Vapar_0438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34682"
FT                   /db_xref="InterPro:IPR011201"
FT                   /db_xref="InterPro:IPR031321"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D6"
FT                   /inference="protein motif:PFAM:PF10005"
FT                   /protein_id="ADU34682.1"
FT                   /translation="MDSPINDPVNEQSAATLATELAAPTVSRAYRCQCGRPVFLRNSEC
FT                   LACHTPLGYVIDRLGVMPLAPAEGGGALPDTFTVFGDPHGKTYRRCANLMTPAACSWMV
FT                   PAAREGEEAPADVHGLAPGYCLACSVTRTIPDLSVEAHGVFWGKLEQAKRRLISQLLAL
FT                   GLPVVSRHADPVHGLAFDFLSNMPGGPHVMTGHEDGVITLNAEEAEDAVRERIRAEMRE
FT                   PYRTLLGHFRHEIGHYYWDLLVQPTHWLDDYRALFGDERADYAASLQTHYEQGPPPDWA
FT                   DRFVSSYASTHPWEDWAETWAHYLHMADTADTAMSFGVDATNVELTSDLFTADDLSQPD
FT                   HPDAAKFLDFINGWVLLTNVLNELSRSMGQPDYYPFVLPRAAVGKLQFIHRVITEQRAG
FT                   SAPTMVVASDVAATEPEPAEPAPEQTQTQTQSQGGAQS"
FT   gene            complement(500920..501144)
FT                   /locus_tag="Varpa_0461"
FT   CDS_pept        complement(500920..501144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34683"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0439"
FT                   /protein_id="ADU34683.1"
FT                   /translation="MTASAAVIDVSRCLLCGESNRCAMEIERETGQAQPPCWCMQADFS
FT                   NAPLAKLPESMRGLACICARCAAETPPQD"
FT   gene            complement(501141..502421)
FT                   /locus_tag="Varpa_0462"
FT   CDS_pept        complement(501141..502421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0462"
FT                   /product="phosphofructokinase"
FT                   /note="PFAM: phosphofructokinase; KEGG: vap:Vapar_0440
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34684"
FT                   /db_xref="GOA:E6V4D8"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D8"
FT                   /inference="protein motif:PFAM:PF00365"
FT                   /protein_id="ADU34684.1"
FT                   /translation="MGLRENARMPILNAFYAQSGGVTSVINASACGVIETARKHPDRIG
FT                   KLYAGRNGIIGALTEELIDTGAESAEAIAALRTTPSGAFGSCRYKLKSLEKNRREYERL
FT                   IEVFKAHGIGYFFYNGGGDSADTCFKVSQLSQSLGYPLQAIHVPKTIDNDLPLTDCCPG
FT                   FGSVAKYVAVSTIEASFDVRSMAATSTKVFVLEVMGRHAGWIAAAGGLAADQGIPVVVL
FT                   FPEIEFDKPRFLARVDELVKQHGYCSVVVSEGCHYPDGTFLAEQGTRDAFGHAQLGGAA
FT                   PVVAQMIKDAYGHKFHWAVADYLQRAARHIASATDVKQAYELGQRAVELALEGRNAVMP
FT                   TIERTSDVPYAYTLGSAPLESVANVEKPMPRDFISDDGYGITEKCRRYLLPLIEGEDYP
FT                   AYRNGLPVYVTLQNVAVAKKLPAFELA"
FT   gene            complement(502452..503255)
FT                   /locus_tag="Varpa_0463"
FT   CDS_pept        complement(502452..503255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0463"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   vap:Vapar_0444 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34685"
FT                   /db_xref="GOA:E6V4D9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D9"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU34685.1"
FT                   /translation="MDSQAPILYELADGIATLTLNLPAKLNPIAHGLQVELRDALERIR
FT                   DDRAVRAVILTGAGKAFCVGADLSAMTPGEEGKSLGTQTAEWMQSLSNPLIETLRTLPV
FT                   PVVAAVNGAAAGAGVGLALAADVTIAARSAYFYLPFLPKLGIVPDLGCTWAIPRRAGKA
FT                   RAMGMALLDERLSAGRAVQWGLIWACADDEQLMDEARAIAQRLARLPAHAVIEAREAFE
FT                   ASERHTLKEQLHYESERQRELIDRPTFREGVSAFLQKRPPAFESR"
FT   gene            complement(503288..503611)
FT                   /locus_tag="Varpa_0464"
FT   CDS_pept        complement(503288..503611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34686"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0446"
FT                   /protein_id="ADU34686.1"
FT                   /translation="MSTRPTTSSRFHITLPTRTVFAVPDGAGVGIECRSGTVWITLDRD
FT                   PRDIVLEAGDRFDGTEHRRILVSALTSSCITVSDAQPAAMPLAPRARAWSPWRLRPHGL
FT                   SPA"
FT   gene            503694..504629
FT                   /locus_tag="Varpa_0465"
FT   CDS_pept        503694..504629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0465"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0447 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34687"
FT                   /db_xref="GOA:E6V4E1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34687.1"
FT                   /translation="MPPANAKPSKLPSSELPPLDLLRSFEAAARQLSFTLAAGELHLTQ
FT                   SAVSRQIQQLEASLGVLLFERRHRALALTEAGGVLQRAVTDSLERLRDATARVRASAAP
FT                   RQVAITCTPGFASLWLIPKLARFTGTHPQVDVRLSATLDVLDLDVSRLDLAVRFAPIAR
FT                   GVGPALFEESVIPLCAPQVAASLRALSDFSGLTLLTIEYPDHSEAPTADWEPWLKVMGL
FT                   EDLRVKSTLRFTQYADAVAAAVAGQGVVIGRLPLLRELVRDGRLVAPLGEGAASHRGYF
FT                   IEMSRRAASNRDAQDFAQWLRDEAEAAQRT"
FT   gene            complement(504664..505230)
FT                   /locus_tag="Varpa_0466"
FT   CDS_pept        complement(504664..505230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0466"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="KEGG: aav:Aave_3256 beta-Ig-H3/fasciclin; PFAM:
FT                   beta-Ig-H3/fasciclin; SMART: beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34688"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E2"
FT                   /inference="protein motif:PFAM:PF02469"
FT                   /protein_id="ADU34688.1"
FT                   /translation="MKKLVIALGVSVLLGACAGGMGMSGSGASNPMVGGAAMYPTKDIV
FT                   DNAVNSKDHTTLVAAVKAADLVGTLKSPGPFTVFAPTNAAFAALPAGTVDTLLKPENKP
FT                   TLTKVLTYHVVPGKMDGPALMSAINAGGGKAVLKTASGGTLTATMSGGNVMVTDAKGGT
FT                   ATVTIANVYQSNGVIHVVNKVLLPG"
FT   sig_peptide     complement(505144..505230)
FT                   /locus_tag="Varpa_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.666 at
FT                   residue 29"
FT   gene            505653..505871
FT                   /locus_tag="Varpa_0467"
FT   CDS_pept        505653..505871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34689"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0448"
FT                   /protein_id="ADU34689.1"
FT                   /translation="MSAQRKARDDEKRLGRFYFSVPSTAPRNPVVAAMARGESSQGAGR
FT                   HLRTHRAERRAQKVALQKAARSLGRED"
FT   gene            505874..506665
FT                   /locus_tag="Varpa_0468"
FT   CDS_pept        505874..506665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34690"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0449"
FT                   /protein_id="ADU34690.1"
FT                   /translation="MREDMDKVIVERPRRGGSWQGDGRAWRNSKEAGSHLGMKRGYDHP
FT                   KGFNENLAPLKRWLHKQVHRPWDKVYAELCSGIDRRSTVQAHIFLHIDDFVERRAELRD
FT                   GEVCVPPHRWGTHRSVPLREAPDVELFVHPVTGILLPNRRLAEAKAARRAARKTWTEQR
FT                   GGKPCAVYHVIDETTQWHRVDGCWFEVTLARFPEKACATQGEEKRYDVLRRCLVTRSGA
FT                   ARRPAPDLPTHRAMYGRSDVYAIAKRQLGRREVRARLGDEA"
FT   gene            506669..507949
FT                   /locus_tag="Varpa_0469"
FT   CDS_pept        506669..507949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0469"
FT                   /product="protein of unknown function DUF1016"
FT                   /note="PFAM: protein of unknown function DUF1016; KEGG:
FT                   vap:Vapar_0451 protein of unknown function DUF1016"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34691"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E5"
FT                   /inference="protein motif:PFAM:PF06250"
FT                   /protein_id="ADU34691.1"
FT                   /translation="MWANVARALPRIIQDELPQSVALPTSDKTPPRAAKTTRAKAASSS
FT                   NALLARVREILEAARAGVARTVNTTQVAANWLIGREIVEEEQRGQRRAGYGAKLLAELS
FT                   ARLNAEFGRGYSVDNLEAFRQFYLDYPQLISETASRKSTVIRELPAQPISATPSRKSIS
FT                   ESDWLPGVLHPSLSWSHYRQLLRVARMEARAFYEIEAIRNAWSVRELQRQAASLLYDRL
FT                   AKSKDKKGLMRLATHGQEVAQPLDALKDPMVIEFLGLPESPRLVESALEQALIDNLQTF
FT                   LLELGKGFAFVSRQERITIDGDHFYIDLVFYHAVLKCYVLIDLKVGKLTHADLGQIQFY
FT                   VNYYDRERRTEGDNPTLGVILCPDKNDAVVKYTLGEQQERNIFASRYQLHLPTEQELES
FT                   ELRREIRYLSVSEAVRVPAKKQAKRGA"
FT   gene            complement(507976..509256)
FT                   /locus_tag="Varpa_0470"
FT   CDS_pept        complement(507976..509256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0470"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_0450 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34692"
FT                   /db_xref="GOA:E6V4E6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU34692.1"
FT                   /translation="MNTNAASPPPPRWSTSAAAMLVALASAFALSQAFRTVGAMMATPL
FT                   GSHFGLSPQQLGTWAGTFHFMFGIMQLAMGVSIDMFGVRRTVLTAFPLAIAGAVLCTVA
FT                   DSFHMLLLGQALIGVGCAPAFLACTVFIARHFDAARFTAMSGLVMSMAGLGIVFTGTPL
FT                   ALLIEAASWRAGYAVLAAAAVLSWLIIFWRVREPARAAMEPVGTMAPTERQSLRKAVRE
FT                   LLPLFAMPHTLGLLCFACVSYAAFITLRGLWLGPVLHERHGLSLVASGNVALVMTITGM
FT                   ISPALFGRLDPGAARRARWMIGCATAGALMFAAMAFTHSRAIDIGLPIVYGLLSGYSVL
FT                   QYAYTKNAYPAAMTGRALALMNMAMFLGVSLMQWTTGVAASWGVANGVEPFRAVFLTVA
FT                   GMLAMGTVAFLVLPRMRESQGTKSIVP"
FT   sig_peptide     complement(509161..509256)
FT                   /locus_tag="Varpa_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.696 at
FT                   residue 32"
FT   gene            complement(509385..511559)
FT                   /locus_tag="Varpa_0471"
FT   CDS_pept        complement(509385..511559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0471"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="TIGRFAM: malate synthase G; KEGG: vap:Vapar_0452
FT                   malate synthase G; PFAM: Malate synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34693"
FT                   /db_xref="GOA:E6V4E7"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E7"
FT                   /inference="protein motif:TFAM:TIGR01345"
FT                   /protein_id="ADU34693.1"
FT                   /translation="MTARTTAHGLQVATELHRFIEEKVLPATGVASDVFWKGFDAIVSD
FT                   LAPKNIALLAERDRLQSELDAWHKKNPGPIADMPAYRAFLEKIGYLLPQPKGAKATTAN
FT                   VDSELALQAGPQLVVPILNARYALNAANARWGSLYDALYGTDAIPETGGAEKGKGYNPV
FT                   RGAKVIEFARNVLDQAAPLANGSHKMATGYSVKDGKLVVALQSSSTGLADPAQFIGYQG
FT                   DAAAPSSVLLKHNGIHLDIRIDRSTAIGKTDAAGVSDLVLEAALSTILDLEDSVAVVDA
FT                   ADKVVAYANWLGIVEGTLTEEVAKGGKTFTRGLNADREYTGADGQPVKLHGRSLMFLRN
FT                   VGHLMTNPAILYAGGKEIPEGILDAVVTTTIATIDLKRKGNSRTGSIYIVKPKMHGPAE
FT                   VAFASELFGRVEQLLGLPANTVKLGIMDEERRTSVNLKACIAEAAARVAFINTGFLDRT
FT                   GDEMHTAMQGGPMIRKGDMKSSAWIGAYEKNNVLVGLSCGLRGKAQIGKGMWAMPDLMA
FT                   AMLEQKIGHPKAGANTAWVPSPTAATLHALHYHQVSVTAVQQELEKIDADAERDNILNA
FT                   LLQVPIAPEAKWTAEERQQEIDNNVQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRAT
FT                   LRISSQHIANWLLHGVVTKAQVDETFQRMAKVVDEQNAGDALYQPMAGNFATSAAYKAA
FT                   QDLVFKGIEQPSGYTEPLLHAWRLKVKGEA"
FT   gene            511816..512793
FT                   /locus_tag="Varpa_0472"
FT   CDS_pept        511816..512793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0472"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="KEGG: cti:RALTA_A0774 histidinol-phosphate
FT                   aminotransferase; TIGRFAM: histidinol-phosphate
FT                   aminotransferase; PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34694"
FT                   /db_xref="GOA:E6V4E8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E8"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ADU34694.1"
FT                   /translation="MILLASNENPLGMPESARRAAAAALEGAGNYPDSNGTALKNALAA
FT                   RLDVSPEWLTLGSGSSEILELAAQVSLKPGENVVYSQYGFIVYAQATAHAHARASVVPS
FT                   QDFGHDLGAMRAAIADDTKLVFVANPNNPTGTFIDAGPLRDFLQSVPAHVTVLLDEAYT
FT                   EYLSPAQRYDSIEWVRRLPNLIVARTFSKAFGLAGMRIGYGVSQPPLTSRMNAQRPRFN
FT                   VTTPAQAAAVAALGDTEFLARTYELNTAGREQLAAGFTELGLVHIPSSGNFLMVQVGDA
FT                   QAVHARLLAAGIEVSLLGPYGLPQWLRVSVGLPEQNEALLAALR"
FT   gene            complement(512922..513662)
FT                   /locus_tag="Varpa_0473"
FT   CDS_pept        complement(512922..513662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0473"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: vap:Vapar_0454 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34695"
FT                   /db_xref="GOA:E6V4E9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E9"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADU34695.1"
FT                   /translation="MPRKAQTESVSDLNAAPGGAAAVDRALSLLSAFRPGDEALSLAQF
FT                   AERTQLYKSTALRLLASLEHARLIRRQDDGRYALGMEIARLHGLYAASQSLDRIVLPVL
FT                   RALAAATGESAAYHVRQDQGDGWVRLCQFRVDSSHVVRDHVRAGDLLPNDRGAGARVLI
FT                   AFGPDTERPRGARERKLYEAIRAQGCCALVGDRTAELAGISAPVFHADGSLAAAVTLTM
FT                   PTHRYDEGYIEPVRAAAKELSGQV"
FT   gene            513781..514716
FT                   /locus_tag="Varpa_0474"
FT   CDS_pept        513781..514716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0474"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   vap:Vapar_0455 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34696"
FT                   /db_xref="GOA:E6V4F0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F0"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADU34696.1"
FT                   /translation="MTPPDVLISEVGPRDGLQSVKATMPTADKLRWIDALYAAGVREIE
FT                   VASFVPAKLLPQMADAADVVRHAVTLPGLTVMALVPNRKGAQAALEAGVHKLTMPVSAS
FT                   VAHSLANVRKTPSEMVEEVRAISDLRRAIAPQVKLEAGISTAFGCTLQGLVPEDDVIRL
FT                   AAQCIEAGAEEAGLSDTVGYANPAQVRRLFKRLRAELGTHAGAAHMHNTRGLGIANCLA
FT                   AWDEGVRTFDASLGGLGGCPYAPGASGNAVTEDLVFMFEAMGVRTGIDIQKLIAARAPL
FT                   MAGLPGEPVYGMTPEAGLPKGFAQEHNTHV"
FT   gene            514709..515908
FT                   /locus_tag="Varpa_0475"
FT   CDS_pept        514709..515908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0475"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: vap:Vapar_0456 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34697"
FT                   /db_xref="GOA:E6V4F1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F1"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ADU34697.1"
FT                   /translation="MSEANPPPSLPYAGIRVVEFTHMVMGPTCGLLLADLGAEVIKVEP
FT                   IEGDNTRRLLGSGSGFFPTFNRNKKSIALDLKKPEGVEAALRLIATADIVSENFKPGTM
FT                   KKLGLDYDTLAKLNPRLIYVSHKGFLPGPYDHRTALDEVVQMMGGLAYMTGRSGDPLRA
FT                   GTSVNDIMGGMFGAIGAMAALRQRDATGKGCEVQAALFENNVFLVAQHMMQFAATGKAA
FT                   DPMPSRISAWAVYDVFTVKDGEQIFLAAVSDKQWAIFCKAFGLEDMLADPRLKTNNDRV
FT                   RARDWMMPILRSHLADRSAAELAAVFEQNELPFAPITKPEELFDDPHLNATGGLAPVRM
FT                   NDGHMAKVPLAPFTLGGQRPGIRLQPPRIGEHGDELLREVGYSEPEIAALRAVGATSGG
FT                   "
FT   gene            515947..516873
FT                   /locus_tag="Varpa_0476"
FT   CDS_pept        515947..516873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0476"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0457 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34698"
FT                   /db_xref="GOA:E6V4F2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34698.1"
FT                   /translation="MDRLKQLESFVSVATRGSLTAAAKAEGVAPAIMGRRLDALEERLG
FT                   VKLLVRTTRRITLTHEGSAFLEDCQRLLTEFQNAEASVSAGGVKASGHLRVTAPAGFGR
FT                   RHVAPLVPRFHALHPEVTISLNLSDRVVDVTGESFDCAVRVGDLPDSSLVSVRLADNRR
FT                   RCVATPDFLRRHGTPKHPGELSRFACLTLSSDASQTRGWAFRVTTEAGVEELIHLRPSG
FT                   PLDCSDGQVLHDWCLAGHGIAWRSTWEVEAEIDAGLLVPVLDEFAAPPNGIYAVFAGAK
FT                   HLPLRVRLWLDFLKDQYGQPEFWGRTA"
FT   gene            516936..517388
FT                   /locus_tag="Varpa_0477"
FT   CDS_pept        516936..517388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0477"
FT                   /product="Protein of unknown function DUF2214, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2214, membrane;
FT                   KEGG: vap:Vapar_0458 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34699"
FT                   /db_xref="GOA:E6V4F3"
FT                   /db_xref="InterPro:IPR018706"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F3"
FT                   /inference="protein motif:PFAM:PF09980"
FT                   /protein_id="ADU34699.1"
FT                   /translation="MTLEAILAYVHLLAILTMVVFISSEAALCRVQWLNAAVVERLAKV
FT                   DMVYGIAAIAVLATGIARTWWGVKGTAWYWTNPLLHVKLGLFIIVGVLSIFPTLTYFRW
FT                   RKTLRSTGKLPVEADIKKTRKLVMVQAHLIALIPLVAVFLARGFGK"
FT   gene            complement(517473..517817)
FT                   /locus_tag="Varpa_0478"
FT   CDS_pept        complement(517473..517817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34700"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0460"
FT                   /protein_id="ADU34700.1"
FT                   /translation="MKKFLSLVALGACLSFGAAQAQDKAPAPAVAPAAAAPAAAAPAAG
FT                   ATCDAKAIDKNGKPLAGAAKASSIKKCEKETKAAAAPACAAKAIDKNGKPLAGAAKNSF
FT                   IKKCEKDAKA"
FT   sig_peptide     complement(517752..517817)
FT                   /locus_tag="Varpa_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            517949..519634
FT                   /locus_tag="Varpa_0479"
FT   CDS_pept        517949..519634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0479"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase; KEGG:
FT                   vap:Vapar_0461 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34701"
FT                   /db_xref="GOA:E6V4F5"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F5"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ADU34701.1"
FT                   /translation="MLLVKQELLAALANTLESLSPGAGAKAAFESPKVAAHGDFASTAA
FT                   MQLAKPLAKKPRELAEQLSAALLATPAFGQWVEAIEIAGPGFLNIRLKTAAKQQIVREV
FT                   LAAGNTFGQQPATGEKVLVEFVSANPTGPLHVGHGRQAALGDAICNLRASQGDSVWREF
FT                   YYNDAGVQIQTLANSTQLRARGFKPGDPEWPSGEKAPAYNGDYIADIAEDFKAKKTVKS
FT                   DDREYTASGDIDDIDSIREFAVAYLRREQDLDLQAFRVRFDNYYLESSLYTSGRVEAAV
FT                   GKLVAAGKTYEEDGALWLKSTDYGDDKDRVMKKKDGTYTYFVPDVAYHIAKWERGFHKV
FT                   VNIQGTDHHGTIARVRAGLQAAGEGIPEGYPDYVLHTMVRVMKGGEEVKISKRAGSYVT
FT                   LRDLIEWTSTDAVRFFLLSRKPDTEYTFDVDLAVTKNNDNPVYYVQYAHARICSVLAGW
FT                   GGDAATLKDVDLSPLKSPAAQALMLLLAKYPAMLTAASKDFAPHDVTFYLRELAASYHS
FT                   YYDAERILVDDEKVKLARLALVAATAQVLHNGLAILGVSAPNKM"
FT   gene            519646..520413
FT                   /locus_tag="Varpa_0480"
FT   CDS_pept        519646..520413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0480"
FT                   /product="Sporulation domain-containing protein"
FT                   /note="PFAM: Sporulation domain-containing protein; KEGG:
FT                   vap:Vapar_0462 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34702"
FT                   /db_xref="GOA:E6V4F6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F6"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADU34702.1"
FT                   /translation="MKKTTRQRGNIVIGLIIGLVIGLGVALGIAVYVTKVPIPFVNKTQ
FT                   KGGAEQDEAEARKNRDWDPNAPLAGKAGAAKPTPPAATGPVNPVTGEPATSTTAVAPGT
FT                   PPPATAPVPVVVAPKPTRAVPVPAEANALPASNDPLGDLARARAGTGSGSTTVASAVPS
FT                   SNANNSAAASSGADPFMYFVQAGAFRTTDDAEAQRAKLSLMGVEARVTEREQAGRTVYR
FT                   VRAGPFNKKDDADRLKERLDGGGLESALVRVQR"
FT   gene            520574..521221
FT                   /locus_tag="Varpa_0481"
FT   CDS_pept        520574..521221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0481"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: vap:Vapar_0463 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34703"
FT                   /db_xref="GOA:E6V4F7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F7"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADU34703.1"
FT                   /translation="MKRRDFSLAATSLGLLSLAANPAHAQARMPKAGSEYLVLDKRVPV
FT                   DAPAGKVEVVEFFSYNCPHCNDFEPALEAWAKTAPKEVAFRRIPVPFVGNDVEAKQRLY
FT                   YALEAMGKVDEFQPKVFNAIHKQRQNVNGDANIIAWVAANGIDGTKFKEVFTSFGVASK
FT                   AKRASQMTDAYKVAGVPAMAVAGRWYVDGETAGNMTNVLQVVNFLVGEAKKG"
FT   sig_peptide     520574..520651
FT                   /locus_tag="Varpa_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            521416..522132
FT                   /locus_tag="Varpa_0482"
FT   CDS_pept        521416..522132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0482"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="KEGG: vap:Vapar_0464 lipopolysaccharide transport
FT                   periplasmic protein LptA; TIGRFAM: lipopolysaccharide
FT                   transport periplasmic protein LptA; PFAM: OstA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34704"
FT                   /db_xref="GOA:E6V4F8"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F8"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ADU34704.1"
FT                   /translation="MTLPSYPNNTPLVRRIGRLAIGALLLAGLASGVLAETADRSKPMN
FT                   IESDAMRYDDLKQTSVFTGNVLVTKGTIIIRGARLDVRQDAEGYQYGVVTAAPGKRAYY
FT                   KQKRNAPDEWIEGESEVIEYDSRADNVKFIRNATMRRLLGATPNDESQGALIVYDQSND
FT                   TYTVNGSTVPPNTAVNASTPTGRVKTILTPKAATAPKPGASAPAGAKPAAPASTPAPGT
FT                   GLRSTTTLSGEGEGRK"
FT   sig_peptide     521416..521523
FT                   /locus_tag="Varpa_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 36"
FT   gene            522129..522923
FT                   /locus_tag="Varpa_0483"
FT   CDS_pept        522129..522923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0483"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0465 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34705"
FT                   /db_xref="GOA:E6V4F9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34705.1"
FT                   /translation="MIETAGIQEANTVPGSRLVARGLQKSYGSRTVVKDVSLDVQKGEV
FT                   VGLLGPNGAGKTTSFYMIVGLVRADAGEITIDGEPIAHMPIHRRARMGLSYLPQEASIF
FT                   RKLTVEENVRAVLELQREPDENGKVVALSKKHIEERLSELLTDLRVDHLRDSPALALSG
FT                   GERRRVEIARALATQPRFILLDEPFAGIDPIAVIEIQRIISFLKERGIGVLITDHNVRE
FT                   TLGICDHAFIISDGHVLAQGTPSEIVDNAEVRRVYLGEHFRM"
FT   gene            522942..524531
FT                   /locus_tag="Varpa_0484"
FT   CDS_pept        522942..524531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0484"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: vap:Vapar_0466 RNA polymerase, sigma 54
FT                   subunit, RpoN; TIGRFAM: RNA polymerase sigma-54 factor,
FT                   RpoN; PFAM: sigma-54 DNA-binding domain protein; sigma-54
FT                   factor; sigma-54 factor core-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34706"
FT                   /db_xref="GOA:E6V4G0"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G0"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADU34706.1"
FT                   /translation="MKQGLSLRVSQHLALTPQLQQSIRLLQLSTLELSQEVEQMLDENP
FT                   FLERTAEEAAREEFGLDAVDTPVPRDDGGETGEGDFAPVSTSSATTTTETSSTPDSDGP
FT                   AAEITEREPDWEGDGTVDMAPDDSEWGSDAPARQNNLGDDERADATELARSQESLQSFL
FT                   HRQALSLRLNENDSAALRFLIESLNDDGYLEDSLPALASGLAGDDNDQFDDLVHHFQVA
FT                   LGLLQSLEPAGVGARDLGECLGIQLRALASEDETEDEELIRKTAIAICKQPMELLARRD
FT                   FKRLATLTRTNEELVRSALQIIARLEPKPGRRFVDVERNIVIPDVIVTKTGRGTNIKFR
FT                   VMLNPEVMPRLRVHDIYAGALKSHKGEGSQALSQRLQEARWFIKNIQQRFDTILRVSNA
FT                   IVERQKSYFVHGELAMRPLVLREIADELGLHESTISRVTTAKYMSTPFGTVELKYFFGS
FT                   ALGTETGGNASSTAVRALIKQFVSSESIKKPLSDSQISEMLKEQGIECARRTVAKYREA
FT                   LRIAPANLRKAL"
FT   gene            524542..526143
FT                   /locus_tag="Varpa_0485"
FT   CDS_pept        524542..526143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0485"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: vap:Vapar_0467 phospholipase
FT                   D/transphosphatidylase; PFAM: phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34707"
FT                   /db_xref="GOA:E6V4G1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G1"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADU34707.1"
FT                   /translation="MTRRLLSRCGHWVFAMATVLLFAGCATLPDEAPRAPAKAMGVSAD
FT                   TALGKIALASQPDPDLSGFRLMPGGDFAFDTRIQLARRAQRTLDVQYYQIENDETGRYL
FT                   LRTLRDAAQRGVRVRLLMDDLYTSGEDELLLGLAATPNVELRLFNPFPAGRGSLLKRFT
FT                   ASLFDFSRVNRRMHNKLFIADGAMAVAGGRNIGNQYFTRTSGENFIDLDTFVTGALIPR
FT                   LGVLFDQYWNSVYVRPVQSIIASDLSREELQRRFEAATGPDTTPPPPKPAPNDLLGYSP
FT                   MADDLNAGKLGLIWTLAEAYADSPERVIGKTASYGGVPLLDVDSVRYNVVEQMRRARSE
FT                   VTIVSPYLIPGAAGLEVMKEIRGRNVKISVVTNSLAATDEPLVHTAYRRYRPEMLKLGA
FT                   DLYELSTTRTRRSVRLGLFGTSVGRLHAKSAVIDQRILFVGSMNFDPRSETHNTEIGLF
FT                   IRSAEMAQQALKLIDVLKQQGAYRLRFVEGSGESHIEWTSEDAGKTTVLNEEPDSGFWD
FT                   RTMLELLAPLTPESLL"
FT   gene            complement(526263..526910)
FT                   /locus_tag="Varpa_0486"
FT   CDS_pept        complement(526263..526910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0486"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   vap:Vapar_0468 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34708"
FT                   /db_xref="GOA:E6V4G2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G2"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADU34708.1"
FT                   /translation="MMDTTLSLLGIAGAMTVGAMSPGPSFVMVARTAVASRSDGLAAAL
FT                   GMGAGGLVFAIAALAGLQAAFLAVPGLYLAIKGFGGAYLIYLGFLIWRGARQPLAMTQD
FT                   ADASSTPQQGRGRRTFLLGLATQVSNPKTAVVYASIFAAFLPREVPLVLALAVPVVIFC
FT                   IETGWYAIVALALSSAAPRSAYLRYKVWIDRAAGGVMGLLGLRLVWSAVSES"
FT   sig_peptide     complement(526827..526910)
FT                   /locus_tag="Varpa_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.320 at
FT                   residue 28"
FT   gene            complement(526924..527577)
FT                   /locus_tag="Varpa_0487"
FT   CDS_pept        complement(526924..527577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0487"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: vap:Vapar_0469 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34709"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G3"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADU34709.1"
FT                   /translation="MSLIPYAMKKLLLASALSAAALPFAAIAQEYTAPAVAAKPAGGPV
FT                   KNGNYVIDPTHTFVMYEMGHYGTTTNRGRFSTKDGSVQIDGSGTSGKVDITMDIGTINT
FT                   GVDLLNRHVQSKDFFNVAEFPTGRFVADRIEFSGDKVVDVPGTLTLMGQTKPVTLKAVR
FT                   FNCYLNPLINRQVCGGDFETTVQRSDWGINWGLNFGFENKVKLLVQVEAVNVQQ"
FT   sig_peptide     complement(527491..527577)
FT                   /locus_tag="Varpa_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 29"
FT   gene            complement(527606..528184)
FT                   /locus_tag="Varpa_0488"
FT   CDS_pept        complement(527606..528184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0488"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: vap:Vapar_0470 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34710"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G4"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADU34710.1"
FT                   /translation="MTRLFLPLLTALLLAAATMPAAADPAAKLIADKSQIAFVTKQMGV
FT                   PMEGAFKKFDAQIAFDPKKPEGGTVALQIDAASAGFGVPMSDAELPKAPWFDAAKFPQA
FT                   SFQSSAIKALGDGKFEMAGKLTIKGTSKYLTVPVTIAPAGGNYAVATGYFTIQRLDYKV
FT                   GDGEWTDTSVVGNDVQVRFKLTLAGLGPL"
FT   sig_peptide     complement(528113..528184)
FT                   /locus_tag="Varpa_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 24"
FT   gene            complement(528210..528791)
FT                   /locus_tag="Varpa_0489"
FT   CDS_pept        complement(528210..528791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0489"
FT                   /product="cytochrome b561"
FT                   /note="KEGG: vap:Vapar_0471 cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34711"
FT                   /db_xref="GOA:E6V4G5"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0471"
FT                   /protein_id="ADU34711.1"
FT                   /translation="MSADTPLPPLSAVARGQRYGTVAIVLHWLLAAMIVGSLGVGLYMT
FT                   GLPFSPLRIKLYNWHKWAGVTILLLSAVRLLWRLAHRPPAVPAQVLAAMPRWQIAGYRA
FT                   SHAAMYLLFFAVPLFGWAYTSALGIPVVWFGVLPLPDFVPVDKDLAEAILKPLHKGSAY
FT                   TLAAVALLHVAAALKHHWIDRDDLLKRMWP"
FT   gene            complement(528874..530664)
FT                   /locus_tag="Varpa_0490"
FT   CDS_pept        complement(528874..530664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0490"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="KEGG: vap:Vapar_0472 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34712"
FT                   /db_xref="GOA:E6V4G6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34712.1"
FT                   /translation="MTPTPAPSVAPAADASSDRFAIQCEVLRLSIRPIGPVLLVQYLLN
FT                   CGVAALFAWQYSLVRALVWIALITGVTVMRGFFPQRLPDPFTPESLRHAQRAHTLRTAV
FT                   WELAHGLAGVLLFNPERPDQQLLLGLMLMGMTLSSAFSVSFYTPATQLAITLLLAPVIV
FT                   TGLTLGAPTMMAVSVIGIGLTAMMWKLVAERSRQLEENIGLRLNERTLREQALAGLRAS
FT                   EQAQAERLRFFSAANHDLRQPVMAIGLQAEVLRQQLDTGADASAVQHTVVSLARAQQAL
FT                   EGLTNQLLEIGRIEAAVDPLRPVAVALAPLLQDLARQAGNGRVTVRCPAGAVAWTDAVS
FT                   LRRVLANLVDNAVKFTPRGRVLLAVRARHRGTERAWRVEVRDSGIGIAADSQERVFNDF
FT                   EQIGNAERNLQHGHGLGLAIVRRLAAQLGIEVSLRSAPGRGSVFGFELPAAQGYGAAAL
FT                   QPAPPPQASPEAAPALRPGLAVLVVEDNAVVADSLYALLRQWEVSPRVYASAAEALALA
FT                   DLRALDAALCDIRLPGALDGIALAERLQAQNPALTIALISADINEATQRLATERGWHAL
FT                   RKPVQPEELRGVLLRAPQRP"
FT   gene            530707..531969
FT                   /locus_tag="Varpa_0491"
FT   CDS_pept        530707..531969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0491"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="KEGG: vap:Vapar_0473 putative RNA methylase; PFAM:
FT                   RNA methylase; THUMP domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34713"
FT                   /db_xref="GOA:E6V4G7"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G7"
FT                   /inference="protein motif:PRIAM:2.1.1.52"
FT                   /protein_id="ADU34713.1"
FT                   /translation="MESPLVGLPDGQFPVNDLSFFLPCAAGVEEFLAQEVHALTGRVGQ
FT                   DLLTLRGGVRVRADWRDALKLNLHSRLAQRVLVELAHAPYRNENDLYAIASGVAWEIWF
FT                   TPKQTFKIETTAQHSPLQSLNFATLRIKDAIADRFRAKANGVRPSIETQWPDTRVFAHL
FT                   TTEHCTLYIDTSGEPLFKRGWRQDKGDAPLKETLAAAMLAASGWWNPETGTVSEQPLYD
FT                   PCCGSGTIPIEAAQIARGIAAGSLRRFGFEKLLPFQAHVWDAIKKESLLAVKPGSVAIF
FT                   GSDVSHRMVDFAERNAERAGVADAIEFRGGDALQRMPPAEGGVVMLNPPYGERIEVGGV
FT                   ARAGAREAAQTEEGDGSEFFPQLATHWKKNYAGWTAWVLTPDLKLPKQMRLKESRRVPM
FT                   WNGPIECRLFRFDMVAGSARK"
FT   gene            complement(532105..532527)
FT                   /locus_tag="Varpa_0492"
FT   CDS_pept        complement(532105..532527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34714"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G8"
FT                   /inference="similar to AA sequence:KEGG:Bpro_1344"
FT                   /protein_id="ADU34714.1"
FT                   /translation="MKRLPLFFLALLASALTRAEWLTLSGTPGDATGSYVQVDPARIEV
FT                   DGARRGVTLRMSLAQDFTGKDGFKLRSFEARVTVDCEARTARYVSATYYGLPNFVGQPV
FT                   AIKQFEDDDIRPMTLPGAPPELAARTVNAACNVGAK"
FT   sig_peptide     complement(532468..532527)
FT                   /locus_tag="Varpa_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            532654..533088
FT                   /locus_tag="Varpa_0493"
FT   CDS_pept        532654..533088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0493"
FT                   /product="protein of unknown function DUF132"
FT                   /note="KEGG: vap:Vapar_0474 protein of unknown function
FT                   DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34715"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0474"
FT                   /protein_id="ADU34715.1"
FT                   /translation="MTLPQETGLVVIDTNIALDLLVFDNPDCLPLAAALASGALRWIAT
FT                   APMRTELARVLGYPLIARRLAQREMEATRVLEAFDARVSLLTDTPPRAPCVCKDPDDQV
FT                   FIDLAVAQRARLFSKDQAVLTMRKRLAAQGVVVATVLAAA"
FT   gene            533447..534385
FT                   /locus_tag="Varpa_0494"
FT   CDS_pept        533447..534385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0494"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: lch:Lcho_0133 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34716"
FT                   /db_xref="GOA:E6V4H0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H0"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADU34716.1"
FT                   /translation="MTSSSQRSPRQLLPEVEVERSRSTELGYEPSTEVGLVRCLEHGFP
FT                   TPLARWHCHEEYELHLIVATSGQAFVGDWIGAFEPGHLVLCGPKLPHNWISLDMPAEGV
FT                   PQRDLVIQFLHDPIFEAAQRIPELQEAVRMLERARYGIEFFGMSASAEAHWHRVKDARG
FT                   LKRFSLFCDFLADMAMCTDYRLLSGMQTDGDHGIEAINDVVTRITNEPAKDISAADIAA
FT                   ELGMNPGRFGRLFRRATGHSFLGYVNEVRINKACLLLMQSDRYVTSICYEVGFNNVSNF
FT                   NRRFLEIKGVTPTEFRRQSQLRFEGAGSLEN"
FT   gene            534520..534825
FT                   /locus_tag="Varpa_0495"
FT   CDS_pept        534520..534825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swd:Swoo_0756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34717"
FT                   /db_xref="GOA:E6V4H1"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H1"
FT                   /inference="similar to AA sequence:KEGG:Swoo_0756"
FT                   /protein_id="ADU34717.1"
FT                   /translation="MQIHRLTQLSRQLASKIKIRGQGMTEYLVILGLIAIAAIAVFSFF
FT                   GQTMRNQVAGMAKEVGGQSGATEVTNAQTAAGKASTNAQVNMNMSTYTKGGAEATK"
FT   gene            534867..536780
FT                   /locus_tag="Varpa_0496"
FT   CDS_pept        534867..536780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hna:Hneap_2318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34718"
FT                   /db_xref="GOA:E6V4H2"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H2"
FT                   /inference="similar to AA sequence:KEGG:Hneap_2318"
FT                   /protein_id="ADU34718.1"
FT                   /translation="MPPAAASLPLATAGASARRRRQSGQAIVYLVAMLPIIFLSVLVVY
FT                   NTATAAREKMKLQNTADAATYSANVLTARTLNYLAYTNRAMAANEASVATLASVQTSMA
FT                   MLITSAANIQEGLVVAEAMKGIRNLERARLPVVGPIFALAWLLGNVPRANRLQRTADRI
FT                   AGFVEPSAKPLQIGADILRAFNQGISASQAVMLLGTTAQLPQLVKDVVNSNDPDASVPP
FT                   TETAIFVIKFVADVGTYLKTYHQSGSLGFDDEEFNEVLRFAHAAQATRDDWTKNRRFLP
FT                   NVLGWVASGMSGALQGMVSSSPNSPPGFSDITGDMMGGLLEWKGGTELVATEGIVGDET
FT                   GRIRWQSADSIEIKLPIGVLYTDLIGGWDDILRGRFGLGAGAAAAGGPNYMKSWEGQRL
FT                   TLRSYAREGRTYGGLNGEVGDTAYMERESFERAARDRNGELLLAPMAVLVFNAKLHYSP
FT                   RTDIGIVTKSWAMPRFTEIKDHPPMVANESDNWLKENGFSGANPLKWGKNTDKGPAFTL
FT                   VVQKGGDKVRTGEVAGFGNSAADGKAGLRDNFQGREIKALSTSQVYFRRPQDRWARRDN
FT                   AVADPSTVGKYNVGFAGGYIEHRSLFSPYWHVHNVEPSLWARAIAMGGAAVGGSADEDN
FT                   GN"
FT   gene            536797..537786
FT                   /locus_tag="Varpa_0497"
FT   CDS_pept        536797..537786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_4341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34719"
FT                   /db_xref="GOA:E6V4H3"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H3"
FT                   /inference="similar to AA sequence:KEGG:Bphy_4341"
FT                   /protein_id="ADU34719.1"
FT                   /translation="MTRPHRRPFAHQARASATVAGHAMVETLLIVSFAAVVLGAIPAIA
FT                   EYGTKRMQTVSAAKLVAWQRTVWMPEAQGITAEEAKGASGAIKKTDAEVTRDLRRHIFR
FT                   DRSAPGISIHAADIAEFEPMLPAIDQRTTAVAASSTAAPLPSLLNASDVVFDGIRVAQA
FT                   ALGGNAITGPLGKFQFVSSGYLRHEVKVSQTYTKFKDVPALDMTEQVTMLTEAWNAGGT
FT                   NREETKIQGLVPMKLLDAPFYQQLRGGMHQTAYQIKQIFPAFDMNNLTMGFTPGDALEK
FT                   TPLDRFERIPPGATGETGGDGEANGGSVKDHFRYYRAFPPTPVVNTLP"
FT   gene            537786..538508
FT                   /locus_tag="Varpa_0498"
FT   CDS_pept        537786..538508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34720"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H4"
FT                   /inference="similar to AA sequence:KEGG:Veis_0243"
FT                   /protein_id="ADU34720.1"
FT                   /translation="MSLAAPFLRWMLAAAWLCLCGAAVAAPPQRDWPAIPSPAAAKTFW
FT                   IAEYIEQNTIPMQIRGIESSDPLEVVSRFYEKWLSDKTGYGVTTLGPMRVLGARFGLYQ
FT                   VTVQLRAVPSGTAGRLVAAVVYDEVKNEQALRERAERIGKGFPRPAGSQVVSDTLSFDE
FT                   GQRNRTIVVTNNVSVETNALYLREQMIRLGWTLIQDRTLEGGTRSSLVFRRNSEEMTVA
FT                   ISRRDDGYFIVASQTSPE"
FT   sig_peptide     537786..537863
FT                   /locus_tag="Varpa_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            538520..538732
FT                   /locus_tag="Varpa_0499"
FT   CDS_pept        538520..538732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_4343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34721"
FT                   /db_xref="GOA:E6V4H5"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H5"
FT                   /inference="similar to AA sequence:KEGG:Bphy_4343"
FT                   /protein_id="ADU34721.1"
FT                   /translation="MRSRRPPRPRSSSRRTQRGQVITEYVIVAGILAVMLFATFPGADR
FT                   SVVALLIKAFRDAWSTYSYTLSYPL"
FT   sig_peptide     538520..538651
FT                   /locus_tag="Varpa_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.482 at
FT                   residue 44"
FT   gene            538739..539698
FT                   /locus_tag="Varpa_0500"
FT   CDS_pept        538739..539698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0500"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="KEGG: vei:Veis_0245 SAF domain-containing protein;
FT                   TIGRFAM: Flp pilus assembly protein CpaB; PFAM: SAF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34722"
FT                   /db_xref="GOA:E6V4H6"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H6"
FT                   /inference="protein motif:TFAM:TIGR03177"
FT                   /protein_id="ADU34722.1"
FT                   /translation="MKSSPGLLKFKQSVKRLSPLIGALMLGLLAAGLGWYYLRASEREI
FT                   AASLEKDADSQRRDVVVANRALGDGTTVLPTMVAKRSVPNEYVHNDAITPETFSQFAGR
FT                   QLSVPVAAGKPLLASFFSAPRKVFAQEIEQGVRAITIPVDEISSISGMLRAGDRIDFMY
FT                   MVEKSAANDPSVVVPLLQDVEVRATGQITSEQFAAMRKRSDVSADTDPYAQQRYSTVTV
FT                   AIQPQDAQKLILAQRLGKIIATLRNPEDRATMTSGVDAVDLDAIVAGFRPQRSHAMAVS
FT                   SGPSGPSVEYIVGGSGNRGAPPAPGLGAALPTGGALPR"
FT   sig_peptide     538739..538831
FT                   /locus_tag="Varpa_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.675 at
FT                   residue 31"
FT   gene            539770..541368
FT                   /locus_tag="Varpa_0501"
FT   CDS_pept        539770..541368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0501"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   KEGG: hna:Hneap_2310 type II and III secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34723"
FT                   /db_xref="GOA:E6V4H7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H7"
FT                   /inference="protein motif:PFAM:PF00263"
FT                   /protein_id="ADU34723.1"
FT                   /translation="MNLKRCTLAATALCLVFQAEAQGPYPGAPAASPVPLGTVAPAPAF
FT                   SAPGAPAGARAETSPGIRPPAPPPSQASITEAELQRIAARATVLQRLPDLLTLYVGQMA
FT                   LVKMPGVSRVAIGNGKVMEARVLDGANMLITAQDAGDSTLHVWDKNGTVRKLKVRVNVA
FT                   DLERIADELREITRGISGVNIRRIGERIIMDGNSLDPAAVERLNTVAQLYAPAVVSLAT
FT                   ADRIRVDRMVDIQVRIVEFSKTALDDLGVRWQSSGDGFNFGLFSDIASSGSYRILPDGS
FT                   AFNTSTPQGTALLGQNRRMPEAYFGIGLSLTSRINLLVQRGNAFLLASPNLSTRSGGEA
FT                   KFLAGGEIPLPALSTQGAGSVEFKPYGVRLNIKPIADGEGNVSGSILTEVSSIDRSVAV
FT                   QGIPGLLIRRTDTEFNVKAGETIVLSGLLSRESTRSSDGVPGLRKTPIIGRAFRADNDT
FT                   DKEQEVVVFITPRVVGPADSRPRIERARELERDVGSNFGTLTEDKSDPNGSRPPAAAAD
FT                   IGGIPAGTPGQPVAP"
FT   sig_peptide     539770..539835
FT                   /locus_tag="Varpa_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            541388..543031
FT                   /locus_tag="Varpa_0502"
FT   CDS_pept        541388..543031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0502"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: hna:Hneap_2309 FHA domain containing protein;
FT                   PFAM: type II secretion system protein E;
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34724"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H8"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADU34724.1"
FT                   /translation="MHKVFVNSPQQVVREVPIDVAELQVGKDAGNHIVLSGWNVAKLHA
FT                   QFVLHDEEVFVQDLGSLFGTWVDGNRVTRFGPMKGGEEIIIGGHTLVVSLDVALKPAGA
FT                   DPQEAAEAAQYAEAALAIEDPLLQWRRSLHRTLLQQLDNRRIDTAQMKDEELRSNIRAL
FT                   IAEVIRDTRDMPPELDRALLSQQLLDEAIGLGPLEVLLKDESVTEVMVNRFDEIWIERA
FT                   GRLERTNVAFTSNIAVLGAIERIVTPLGRRIDESSPMVDARLKDGSRVNAIIPPLALRG
FT                   PSVTIRKFPKNRMGHEGMIRTGSITAQMVDFMRIAVEEKLNIIVSGGTGTGKTTLLNMV
FT                   SNFIPPNERIVTIEDAAELSLGQPNLVSLESRPANIEGKGAIAIRDLVRNSLRMRPDRI
FT                   VVGECRGGEALDMLQAMNTGHDGSLTTLHSNSPRDAMSRLEVLVTMAGMNIPVAAIREQ
FT                   IASAVDLIVQLTRFPCGSRKVTQITEITGFADGMIQMQDVYAFRKTGVDDSFKTIGHFT
FT                   AAGTVPEFFTRLQEHGLKLDLEYLFGETTA"
FT   gene            543028..543885
FT                   /locus_tag="Varpa_0503"
FT   CDS_pept        543028..543885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0503"
FT                   /product="Type II secretion system F domain"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   bph:Bphy_4347 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34725"
FT                   /db_xref="GOA:E6V4H9"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H9"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADU34725.1"
FT                   /translation="MKGMILLASVLCGMGFITLCGYLLLQRSPELVGKMMSKLQASGRR
FT                   TLNLSEFQAQHAVAFASGHAFLVALCGAVGWLISGNLIGGVVAAVVLYLLPARWFAWQR
FT                   KKRRQQIESELPDALLFIASALRAGSALSVAIQVLVRDQVGPLGQEFGLVLKEQRLGVS
FT                   FDDAIQKMSQRLGIPDFVLVVVALRVSKEVGGNLSEPLQVLAETLRRKAILEGRIKALT
FT                   AQGRIQGLVMTLFPLLLMGVLYLMQPTMSLLFTTTIGWVVLTVIAIMLMLGYAMIRKIV
FT                   AIDI"
FT   gene            543894..544784
FT                   /locus_tag="Varpa_0504"
FT   CDS_pept        543894..544784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0504"
FT                   /product="Type II secretion system F domain"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   slo:Shew_0642 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34726"
FT                   /db_xref="GOA:E6V4I0"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4I0"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADU34726.1"
FT                   /translation="MRSLILLAIIFLCATTGVILLLYMISLIRKARPSERTHMDPLPRM
FT                   LRLVWPVVNILQFHVSEIAPTSMLVKRKRQLQLAGLEFVLKAEEFIAVQCVSMLIVAAL
FT                   GLWTAGLLDATAGTKIWVTLASCVTGWLYPVMWMRDRRKRREKDILRTLPGYLDMITLC
FT                   CQAGLSLTGAIAQAVQKGPGGALGQEFDRMMREMRTGASRMDALNALADRLDNKHIKSL
FT                   VSNLTQAESLGASLADTLSAISDQRRTERFQMAEKLAMEAPVKMIGPLVIFIFPVTFII
FT                   IFFPLVMQFLETQNH"
FT   gene            544802..545143
FT                   /locus_tag="Varpa_0505"
FT   CDS_pept        544802..545143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0505"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   slo:Shew_0641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34727"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4I1"
FT                   /inference="protein motif:PFAM:PF02643"
FT                   /protein_id="ADU34727.1"
FT                   /translation="MRIVSLRSPQAQPFGPVRVAERGWDRTRGLLGRPRLAASEGLLIM
FT                   RCSSVHTVGMRYPIDVVFLDRHGGIARVVESLRPMRVAMCLRAAHVLELAAGQARRLAL
FT                   RPGSKLSGW"
FT   gene            545172..546353
FT                   /locus_tag="Varpa_0506"
FT   CDS_pept        545172..546353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0506"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: bpy:Bphyt_6880 TadE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34728"
FT                   /db_xref="GOA:E6V4I2"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4I2"
FT                   /inference="protein motif:PFAM:PF07811"
FT                   /protein_id="ADU34728.1"
FT                   /translation="MHSTLQPKRRQRGVSMTETMIALPVLILFVMCVVQFGLIYRARLT
FT                   LEYAAHEAARAGSLNNGMPLPFIFRMGNSTVPGLSTLNSAALELTTNALTRGSVWQGLV
FT                   KGMMPLNVREASVGGMFKGWIDTNTDLIQSACIEYLNPTQTTFIDWAFIENFGQNRWIM
FT                   QIPNDTMRYRKPLPYDFKAKAMSTTVGIGDPLPPDAELRGNVSNKTLGEASVLHLRVHY
FT                   GYRLGIPVANKIILTALKGYQFVGEAWFKLMSTDGATAPGTDFRLNQLDAYYIANGKIP
FT                   LSAEGVAGMESPMFWHPFYSFGPRGDRSIELQWDPAWSNNLGINVLEKPQDAMTNIFAF
FT                   VRNNSTEWASQLLASGVDALADKVGDGNSFCPAIWDASVKGQLDQVPNPGKAP"
FT   gene            546365..548651
FT                   /pseudo
FT                   /locus_tag="Varpa_0507"
FT   gene            complement(548661..549563)
FT                   /locus_tag="Varpa_0508"
FT   CDS_pept        complement(548661..549563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34729"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4I3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0477"
FT                   /protein_id="ADU34729.1"
FT                   /translation="MNPLRRGASTRLHSAKGAASAPAPLDALPNTPAPGDYAEFLRVTL
FT                   PKQEKNVASHRLGSERVWLKKAGPRHGKWGYRVMAAVARMVRLDIIKPVPNPGGEAAIA
FT                   TEARRLKQLAAAGLRVPTVLAQQPDGLLISDLGESGRATVVLQERLDQAAAAGPAALLA
FT                   VWREGLAAIAAVHVRGQHLSQAFDRNLVQCPDGVIGYIDFEDDPAEVMTLAECQARDWL
FT                   SYLHSTAMMLEAAAPQAAGQHWHAALATVNEEVRERIANAARRMKWARKLPASRRWGRD
FT                   TQRVRAVARLLGRWHDAAA"
FT   gene            complement(549628..551325)
FT                   /locus_tag="Varpa_0509"
FT   CDS_pept        complement(549628..551325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0509"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   vap:Vapar_0478 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34730"
FT                   /db_xref="GOA:E6V4I4"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4I4"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADU34730.1"
FT                   /translation="MPTIIPFPARYSAFALCVVGLVACLAFVLVSPHLWLAWIGVAVFA
FT                   VLSGTGIHDLRQPRHAILRNYPVIGHLRFLLEFIRPEMRQYFIESDSEAAPFSRAQRSL
FT                   VYQRAKGEPDNRPFGTQLNVTIAGYEWINHSMQPTKLANHDFRIVIGGTPQPTDGNSAQ
FT                   VCTQPYSASVFNISAMSFGALSANAILALNQGAKMGGFAHDTGEGSISQHHRVHGGDLI
FT                   WEIGSGYFGCRNDDGSFNAERFTANARDPQVKMIEIKLSQGAKPGHGGVLPAPKVTPEI
FT                   AAARGVPVGVDCISPSSHSAFSTPTEMMHFVAKLRELSGGKPTGFKFCLGHPWEWFGIV
FT                   KAMQATGITPDFIVVDGAEGGTGAAPVEFSDHVGAPLQEGLLLVHNTLIGVNLRHRIKI
FT                   GCAAKVITAFDVARMMALGADWCNAARGFMMALGCIQAQSCHTGHCPTGVTTQDPLRQQ
FT                   ALVVPTKADRVRNFHRSTLHALQELVQAAGLDHPQQITAHHIVRRISDTEVRLLSNLVM
FT                   QVQPGALLGPLDAQHNVFRTYWPLASAESFQPVTQSPQGLVPGFAMAA"
FT   gene            551382..552179
FT                   /locus_tag="Varpa_0510"
FT   CDS_pept        551382..552179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0510"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   vap:Vapar_0479 sec-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34731"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5C5"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ADU34731.1"
FT                   /translation="MTTSPPTPETPQIPAAPAQEPLGPDDFDALDTALDAMREHDEEIP
FT                   QWEFCEGFMAALICTRRSIEPTEYWPVLLGDSFVPAQHMEFVWNWKRRWREIEEGLDAP
FT                   VETLDDERSWQPEVLDTRGAIASLPEEERAEVAGEAIPSFAQVWALGFMYAVENWPEDW
FT                   ATPRDKDAAQMLDDALDNIVALTEDDKAKPTVSMYSEDGPPSVSQQRLDDFGAAIWAVY
FT                   DLRQLWKSLGPKVETIRKEATPGRNDPCPCGSGKKYKKCHGAA"
FT   gene            552169..553416
FT                   /locus_tag="Varpa_0511"
FT   CDS_pept        552169..553416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0511"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_0480 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34732"
FT                   /db_xref="GOA:E6V5C6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5C6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU34732.1"
FT                   /translation="MPPSTGPESAAPLTPRAAWVMVLALCAGVALSQAFRTVGAIMASP
FT                   LQTDFKLSAQALGIFSGAFHFAFGAMQLFMGIGIDLHGVRRTVLVAFPIAIAGALLSAV
FT                   SSSYLVLVAGQALIGVGCAPAFLVCTVFIARHFPAARFATVSGMVLAIGGIGMLVTGTP
FT                   LAWLVEAYSWRAGFLVLAVAAALAWLAIWHWVHEPASAVPQVKESIPEAIRQFGALFAM
FT                   PHTLGIMVLGAVTYAAFISLRGLWLGPLMMERHGYSLVQSGNVALAVSVISLIGAPLFG
FT                   RLDRDGASRRRWIVICALVYAALFALIAVLHSAWLDIFGMVLIGVLSGFIVWQYADVRV
FT                   AYPVTLTGRAMAVFTMAMFLGVALMQWGTGVAASIAAAHGGDPLTAVLATIATLLVIGI
FT                   AAFAWLPAPKAVTVRS"
FT   gene            complement(553406..553720)
FT                   /locus_tag="Varpa_0512"
FT   CDS_pept        complement(553406..553720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0512"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vap:Vapar_0481 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34733"
FT                   /db_xref="GOA:E6V5C7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5C7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU34733.1"
FT                   /translation="MSNNDIVFTSNEAAHRYEAAIDGKLAGYAEYNLLTDAIMFTHTEV
FT                   LPEFEGKGVGSGIAKHVLGEARTKGLHVIPVCQFIAGYIRKHREYADLVRPDIQRAFKI
FT                   "
FT   gene            complement(553717..554214)
FT                   /locus_tag="Varpa_0513"
FT   CDS_pept        complement(553717..554214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34734"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5C8"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0482"
FT                   /protein_id="ADU34734.1"
FT                   /translation="MTAATNAQTIERFYSAFAKLDAATMEACYAPDAVFDDEAFSLRGR
FT                   REVGGMWRMLAGATKAKGADVWRLTFRDVQADDTTGSAHWDAHYRFSATGRLVDNSVDA
FT                   RFTFTPEGLIATHRDTFPFWTWSRQALGTPGLLLGWTPMLRNKVRATAAGNLSKFLSSQ
FT                   PS"
FT   gene            complement(554249..555145)
FT                   /locus_tag="Varpa_0514"
FT   CDS_pept        complement(554249..555145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0514"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rfr:Rfer_3491 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34735"
FT                   /db_xref="GOA:E6V5C9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5C9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34735.1"
FT                   /translation="MGLDSNLDFDWRLVRAFLAALDHGSLLAASRALGSSQPTLGRHIA
FT                   ELETQLGVVLFERTGRGLRPTAMAARLAESARAMESGAVSLSRSVSGANAATAGTVRIS
FT                   ASQATARQMLPALLVRMRQELPEIQVELVSTNEVSNLLRREADIAIRMTEPTTATVVAR
FT                   RIGRFALGAFAQADYLRRRGTPRQTADLLRHDVLGYDRIDTIVRMSAQLGTPLQREDFC
FT                   FRTDDMGAYWEALRQGMGIGFVSESLARTDSQVQRVLPQLKIPSLPVWLAVHREIRTDR
FT                   RIRAVYDFLARNIPASI"
FT   gene            555212..556405
FT                   /locus_tag="Varpa_0515"
FT   CDS_pept        555212..556405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0515"
FT                   /product="twin-arginine translocation pathway signal
FT                   sequence domain-containing protein"
FT                   /note="KEGG: sil:SPO1385 twin-arginine translocation
FT                   pathway signal sequence domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34736"
FT                   /db_xref="GOA:E6V5D0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D0"
FT                   /inference="similar to AA sequence:KEGG:SPO1385"
FT                   /protein_id="ADU34736.1"
FT                   /translation="MRAMDERRNFVRLLGGGVVVAAGAVALATWWLHSDIPAAALEIWN
FT                   GPGNEPDARRRAVAYAVTAPTAYNCQPWLVDLREPEAIVLYCDRERLLPQTDPYGRQAL
FT                   IGHGAFIELLVMALAQQGILASVQLWPQGELPLEPRHWPHVPVARLRLASGGAPDPLFA
FT                   QVLRRRTPKQRFDTARPVSSDMLQGLTAIAPAGGTVQADGTVDMARVRVLRKLCAAAAR
FT                   VEIATPGTALENLRMLRVGPQEILEHRDGFSRNDPALRLAIALGQFDRNVPASEDSESF
FT                   KQTFQMFEDQANTAMGFVWLSTRGNSRTDQIAAGRAYVRQQLRATDLGVGLHPMSQPLE
FT                   EFAEMAPHHTAAHDLLLGTEPPRNARSPTLQMMCRLGYPISPVQAAPRRAIGDFMMA"
FT   gene            complement(556545..557072)
FT                   /locus_tag="Varpa_0516"
FT   CDS_pept        complement(556545..557072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0516"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: vap:Vapar_0483 CinA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34737"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D1"
FT                   /inference="protein motif:PFAM:PF02464"
FT                   /protein_id="ADU34737.1"
FT                   /translation="MDSSFSSTLSSPLPDQDTPALVAAVAERLLQKGWMLSTAESCTGG
FT                   LIAAACTELAGSSAWFERGFITYSNAAKTELLGVDAASIDAHGAVSEPVARAMALGAIA
FT                   RSAPSRAAIAVTGIAGPTGGTPEKPVGTVWFGWCVDGQIRTERRRFDGDRATVRAATVH
FT                   YALQTLVTLLTE"
FT   gene            complement(557078..557665)
FT                   /locus_tag="Varpa_0517"
FT   CDS_pept        complement(557078..557665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0517"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="KEGG: vap:Vapar_0484 phosphatidylglycerophosphatase
FT                   A; manually curated; PFAM: phosphatidylglycerophosphatase
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34738"
FT                   /db_xref="GOA:E6V5D2"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D2"
FT                   /inference="protein motif:PFAM:PF04608"
FT                   /protein_id="ADU34738.1"
FT                   /translation="MQAASPSSSSHATASGAMPQPSIRRPTLRFLFGHPAHAIALGFGS
FT                   GLPRFAPGTVGTLWAWVAFAVMQLWFTPATIGWIILASLPIGWWACTVTARDMNIADPG
FT                   AIVWDEVVAFWIVLWLVTPAGLFAQAIAFGLFRFFDAAKPGPVAWADGLFKQRDAVQTS
FT                   QVRWWHAGFGIILDDLVAAFCTLLVIALWRAW"
FT   gene            557796..559259
FT                   /locus_tag="Varpa_0518"
FT   CDS_pept        557796..559259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0518"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_0485 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34739"
FT                   /db_xref="GOA:E6V5D3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU34739.1"
FT                   /translation="MPPAASSSVADPSSISPPATAAWGELFTGRNGWRALALTGGVALH
FT                   AVNVHIVTTVLPSVVREIGGLDWYAWSTTLFVVGSILGATLSVRLLAVLGPRGACLAAL
FT                   AVFTAGSVGCALAPAMHWLLAGRTVQGLGGGMLAALSYGLIQLVFAQRLWPRAVALVSG
FT                   MWGVATLCGPAVGGLFAQSGHWRWAFWFLLPVAAAQALLVTVQLRPGAGVHHARPAKMP
FT                   RIPALQIALLAISVLVIAASGLLADLALQAAGVVLGLGVGVVATRVDREATVRLLPTGA
FT                   YMLSAPLGAIYASVALLLIGTTTEIFVPYFLQLLHGHSPLAAGYLTAAMAGGWSAGSLL
FT                   SSGRSGAGADRMLRAGPVACTLGLVALALLLPFPGHLGAGFETALVAMALAVVGAGVGI
FT                   GWPHLVTRVLSLAPKGEEGLASASITTIQLYGMAVGAAVAGLVANAAGLTLPGGVEGAQ
FT                   SAAVWLFASFALAPALAAWLAYRVVAERS"
FT   gene            complement(559268..560977)
FT                   /locus_tag="Varpa_0519"
FT   CDS_pept        complement(559268..560977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0519"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: bbr:BB0732
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34740"
FT                   /db_xref="GOA:E6V5D4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D4"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADU34740.1"
FT                   /translation="MNDTTLKADVLIIGAGPVGLTLAMDLASRGVSVIVCETRRFAEPP
FT                   NVKCNHVASRTMEQFRRLGVAQKLRDAGLPADYPNDVVFRTTVTGTELTRIPIPCRRDR
FT                   YTETEGPDAWWPTPEPPHRINQIYLEPILLKHTAALPGVQLLNRTQFAGFTQDREGVTA
FT                   IAIEMDSGVTRSIRCRYMVGCDGGSSVVRKQIGAKLEGTAVIQRVQSTFIRAPQLRDMI
FT                   PGKLAWSTYAMNPRRCGTMFAIDGHETWLVHNHLNAEEPEFDSVDRDQALRDILGVGPD
FT                   FQYEVISKEDWIGRRLVANRFREGRVFLAGDAAHLWVPYAGYGMNAGIADALNLSWLLG
FT                   ACVQGWGDEAMLDAYEAERQPITEQVSNFAMDHAQKMIRARRAVPQNIEAPGPEGDALR
FT                   ADIGSEAYALNVQQFCCAGLNFGYFYTGSPIIIADGEHTAPPYSMGDFTPSTVPGCRAP
FT                   HFWLADGRSLYDAFGPGYTLLRFDRSVDVRPLERAAQSYSMPLTVLDIETAEVPKVYAH
FT                   RLVLCRADQHVAWRGAHLPFDVYDFVAILRGDAKRVRERKRALAWEGVVAAA"
FT   gene            complement(561022..562029)
FT                   /locus_tag="Varpa_0520"
FT   CDS_pept        complement(561022..562029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34741"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D5"
FT                   /inference="similar to AA sequence:KEGG:bll0408"
FT                   /protein_id="ADU34741.1"
FT                   /translation="MTASIARTAPSLRRQLLLATAFTLLAGTALAQAPAADFPSHPIRM
FT                   VVTFPPGGSADAVVRMLVPRLNEKLGQQVVVDNRPGAGGNVGLTLVAKAPADGYTLGLG
FT                   AAGALTANVNLYPQMPFDPVKDFKPVGMVAATPFVIVGHPSIGARTLRELIALAKAKPG
FT                   TLSMGHGGNGTAMHLSTALFAQMADVKLIEVPYRGSGPAALDAIAGQVQLALVDLPASL
FT                   QQIRAGKLIAFGVTSAQRVPMLPDVPTVAEAGLPGYDSTGWFGVVAPAGTPAPIVARLN
FT                   AELNAALGDEQIKASMRNLGAEPAPTSTEAFEAYIRSETKKWAKVIQVANIKLD"
FT   sig_peptide     complement(561934..562029)
FT                   /locus_tag="Varpa_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            562132..563040
FT                   /locus_tag="Varpa_0521"
FT   CDS_pept        562132..563040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0521"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bbr:BB0712 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34742"
FT                   /db_xref="GOA:E6V5D6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34742.1"
FT                   /translation="MNENFSPTFSPTIRQLRAFLAVHQLRKLSAAAQRLFVTQSAVSML
FT                   IRQLEEGLGTRLFDRTTRSLKPTAAANEMLPVAERILRDVDSLSTGFRELTTLERGRVS
FT                   VAITPTLATFLLPDAIRSFSQEHPKVRVLVNDCAPDQFISRILGEHVDFGIGTPERPGA
FT                   EVEVERLMRDHLALVCRDDHPLAKARVVRWTDLAGHPLITVRAGYGVRPLIDGTAADAG
FT                   VALDVVNEVSFLSSAIWMTAIGMGASIMPSAFARAANDPSLVVKVLSAPRVSRDISLVI
FT                   KRGHSLSVAARAFIAALKKSL"
FT   gene            563142..563849
FT                   /locus_tag="Varpa_0522"
FT   CDS_pept        563142..563849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0522"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: vap:Vapar_0486 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34743"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0486"
FT                   /protein_id="ADU34743.1"
FT                   /translation="MKNIVRLGVLGLCLAFSFMLAACGNKEAEQRTAFIEFLQTRVLDK
FT                   PGLRVPSPSEEQKKSFGDYAQHYAVITDFTEGMNKSVSQPMGEVMAKGALRSIGDLATR
FT                   RDDLKAAKEGLAGLRTALDQQLAKADAARAQLKQPEDLKQVYDKAYEKTVSTPAATFKE
FT                   VFPALDTTFDGALAVGEFLQQNKSKIQISGASVTVTDPAVQAELNKMLQNLNGQSAAIN
FT                   AAQRKMQAVVRGS"
FT   sig_peptide     563142..563210
FT                   /locus_tag="Varpa_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.913 at
FT                   residue 23"
FT   gene            complement(563850..564809)
FT                   /locus_tag="Varpa_0523"
FT   CDS_pept        complement(563850..564809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0523"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; KEGG:
FT                   vap:Vapar_0487 thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34744"
FT                   /db_xref="GOA:E6V5D8"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D8"
FT                   /inference="protein motif:TFAM:TIGR01379"
FT                   /protein_id="ADU34744.1"
FT                   /translation="MGEFDLITRYFKRPAKRSPLGVGDDCALLAPAPGMQLAVSSDMLV
FT                   EGRHFLSTVEPSRLGHKALAVNLSDLAACGAKPLAFTLALALPGVDEHWLEGFSRGLFA
FT                   LADEHGCELVGGDTTRGPLNICITVFGEVPAGSALLRSGARAGDDIWVSGTLGDARLAL
FT                   EVFRGTIALPADVFAQARMRMEQPTPRVTLGQALRGIASSAVDVSDGLVGDLGHILGSS
FT                   NVGATLDVDAAVGTVAAAGTSALSVEMLRTCALSGGDDYELVFTAPSSARAAVEQAGKD
FT                   SATRVTRIGRIDAEAGLRIADASGAPVAQRFGSFDHFV"
FT   gene            complement(564956..566164)
FT                   /locus_tag="Varpa_0524"
FT   CDS_pept        complement(564956..566164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0524"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   vap:Vapar_0490 carboxylate-amine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34745"
FT                   /db_xref="GOA:E6V5D9"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D9"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ADU34745.1"
FT                   /translation="MSTALQTPIDPDSDDVRSAPLAADPDSRAVKLEPFNKSEALSLGV
FT                   ELELQLVNTHDYDLAPYAEDMLRLMAQTPLPGSVVPEMTSSMIEISTDICHSAADVIKQ
FT                   LSPIREALIKNADKLNIAVVGGGTHAFQQWHERRIYDKPRFRELSELYGYLSKQFTIFG
FT                   QHVHIGCPDADAALLMLHRMSRYIPHFIALSASSPFVQGQDTQFDSARLNSVFAFPLSG
FT                   RAPFTTSWKEFEAYFERMTRTGVVRSMKDFYWDIRPKPEFGTIEIRVFDTPLTVERAAA
FT                   LAGYVQSLAAWFLQEQPFEPSEDDYLVYTYNRFQACRFGLDAVYVDPASGQHMPLRDHI
FT                   LMTMTQLEWHSEALNATQALGELRTSVEANRNDARWLREKQGKERLLAEVVRQAALRFR
FT                   GAA"
FT   gene            complement(566161..567432)
FT                   /locus_tag="Varpa_0525"
FT   CDS_pept        complement(566161..567432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0525"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   vap:Vapar_0491 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34746"
FT                   /db_xref="GOA:E6V5E0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E0"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADU34746.1"
FT                   /translation="MNLTSFINDLLGFWSEWVRPSAGLPTVLWSLLLAAAAASGHLVQR
FT                   YLGLPKVIGYSLVGAVVGFAGFEGAIWPLRGISLFLLELGVAVVLFEAGGRLPLRWFRH
FT                   NPMVLVQSLLEATLTYFGVYWVLTLLGLPEPVANPIALMAIVASPAVLSRVIIDTRAAG
FT                   PVTERAMTLATLNTFYALALGYAQAGLIERAPQTMLQKLYPVAVVLGLSFVVGALMALA
FT                   LRSALRVMSPTSENTSILLLAIIAAGAALTAHVGGSAPLAALIGGVLLKTLNPKPWAWQ
FT                   RQLGTAASLLTMLMFVLVSIVAAQADWTLPVASVVLAVIGVRMIAKISGVAIANPGSGA
FT                   SWKQAFWVGCAMSPLSSIALLIASNFATASPLLGTMITQVALPSILLMEVVGAVLATVA
FT                   IHAVGESSVPWAPQAFSTTEDTQR"
FT   gene            complement(567429..569411)
FT                   /locus_tag="Varpa_0526"
FT   CDS_pept        complement(567429..569411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0526"
FT                   /product="site-specific recombinase Gcr"
FT                   /note="PFAM: site-specific recombinase Gcr; KEGG:
FT                   vap:Vapar_0492 putative site-specific recombinase
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34747"
FT                   /db_xref="GOA:E6V5E1"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E1"
FT                   /inference="protein motif:PFAM:PF10136"
FT                   /protein_id="ADU34747.1"
FT                   /translation="MAAASRDLQGLLAGLDPTADVAQRHIWLINLFDWLRGDRASPQAA
FT                   MGRVSLLLDAVEARPELRERLRAWWRVFTQSVDLTTLLADYGFAPRTAFVSELSERLRR
FT                   KILPGTPETTDASDLFRMVLPGVFDAGWIALLDDTQLARIGALLADATVDTDGSPRWRH
FT                   TVMDAVTYCGSQVVAAGFSPELRLRISAEHHENRPFHALMADLDELREQMFEQPEGEES
FT                   DEALQAAFVAFRDRLDACRASASSVYTHLEDNGISVGLVFRLRQLRERVLRIRELLDCL
FT                   MSPSPAPSVARLIGKLVLAGGERNSIRALVATNSSMLAAKVTERSAETGEHYITRDRAS
FT                   YLQMVKKAAGGGALTAMTVLLKFGIYALALSAFWAGLASGLMYAASFVAIQLLHLTLAT
FT                   KQPAMTAPALAARLRDIKADGAVDHFVDEVANLVRSQVAAVLGNVLVVVPAMIALALLV
FT                   QYALGRPLLDAAHAAATLHSLSLAGPTALFAAITGILLFSASIVAGWTENAFVLHRLDS
FT                   AMRYNPRIGAFLGAARARRWATFMRTHISGFASNISLGLMLGLLPAFAGFFGLGLDVRH
FT                   VTLSAGQIAAATASTGLSVLQQPALWWAVAAIPVIGALNVSVSFYFAFRLALRAHSVSL
FT                   GDRARIRSAIWARWRSRPVSFFLPA"
FT   gene            complement(569544..569939)
FT                   /locus_tag="Varpa_0527"
FT   CDS_pept        complement(569544..569939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0527"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: vap:Vapar_0493
FT                   ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34748"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E2"
FT                   /inference="protein motif:PFAM:PF04379"
FT                   /protein_id="ADU34748.1"
FT                   /translation="MSHSPFSVQVEPRYLADQSSPKDDVYTFSYTITITNVGTVGAQLI
FT                   ARHWLINDASGHPQEVKGLGVIGQQPLLAPGESFRYTSGCRLQAASGTMHGSFFVVTEE
FT                   GERFDVPVPMFVLEADIGGAPVSRVLH"
FT   gene            570000..570692
FT                   /locus_tag="Varpa_0528"
FT   CDS_pept        570000..570692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0528"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="TIGRFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   vap:Vapar_0494 ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34749"
FT                   /db_xref="GOA:E6V5E3"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E3"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ADU34749.1"
FT                   /translation="MSTPFRIAPSILSADFAHLGQELTDVIAAGADWIHFDVMDNHYVP
FT                   NLTFGPMICQALKPYAKTADGTPVPIDVHLMIQPVDALAASFAQAGADYISFHPDASPH
FT                   VHRSIQAIKAAGCKAGLVFNPGLGLEALDWAIDDIDLILIMSVNPGFGGQSFIDSALRK
FT                   IELARKRIEQSGRDIRLEVDGGIKADNIARVASAGADTFVAGSAIFNAKDYGAVIGEMR
FT                   KNLAGVSA"
FT   gene            complement(570682..570954)
FT                   /locus_tag="Varpa_0529"
FT   CDS_pept        complement(570682..570954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34750"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0495"
FT                   /protein_id="ADU34750.1"
FT                   /translation="MTQAKPSKTPPTDPKDPSKDAGGGKTKVEQGGESAPRLPHERDQS
FT                   SDSQQTQDGKPTKVGRQAHDDVERGVVDTDRGPEADRVYNDKIKR"
FT   gene            571073..572110
FT                   /locus_tag="Varpa_0530"
FT   CDS_pept        571073..572110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0530"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: vap:Vapar_0496
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34751"
FT                   /db_xref="GOA:E6V5E5"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E5"
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /protein_id="ADU34751.1"
FT                   /translation="MRRWKGLRNNPRMSSDPFAGVATDSLRIHTFASLHPGPRLLVIGG
FT                   VHGNETCGTAGIERILAEFDAGTLQLQRGELTLVPVANPLARRRLQREGERNLNRLFRP
FT                   TDEPADYEACITNRLAPVIARHEVLLDLHSFQSEGEAFAMIGPRDNTGTLEPFARSYEE
FT                   GQLALHIGTPIVVEGWLDIYAAGLAQRAGGAPADEAALDFGRGTNEYIRSCGGYGVTLE
FT                   CGQHDDPQAPEVAWRAIRRTLALLGMAALPPGLSGAPAQPPKLLRLASVTDRLHEEDSF
FT                   VRDWATFDEVRRGEPIGMRHDGTMLNAPDDGFIVFPNALALPGTEWFYFAHPSERVLGP
FT                   VTGTA"
FT   gene            572176..573171
FT                   /locus_tag="Varpa_0531"
FT   CDS_pept        572176..573171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0531"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   vap:Vapar_0497 Ku protein; SMART: Ku domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34752"
FT                   /db_xref="GOA:E6V5E6"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E6"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ADU34752.1"
FT                   /translation="MPVSKKAPAPRVLWKGAISFGLVHIPVALYSATTDHGIDFDWLDK
FT                   RSMDPVGYKRINKKTGKEITRENIVKGVEYEDGEYVVLSDKEIAAAYPKTTQTIEIETF
FT                   VPANGIPFVYLERPYYVAPINKGAKVYALLRETLQRSERVGVARVVIQTKQHLAVLVPV
FT                   GPGLVLNLLRWGADIRPWNDLPLPSEDAKKAGLTDRELKMAQQLVEDMSGEWDPMEYKD
FT                   EFKDEILRLVDRKVKAGQTETVTQPDPEEGQSTEGKGAKIIDLTELLQRSLRSKGGKTK
FT                   AVANDEDEDDDKEGDAPAPRAKPAARKRKPAAKAASKAASKTATRHRRAA"
FT   gene            573184..575793
FT                   /locus_tag="Varpa_0532"
FT   CDS_pept        573184..575793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0532"
FT                   /product="DNA ligase D"
FT                   /note="KEGG: pol:Bpro_3003 ATP-dependent DNA ligase;
FT                   TIGRFAM: DNA ligase D; DNA polymerase LigD, ligase domain
FT                   protein; DNA ligase D, 3'-phosphoesterase domain protein;
FT                   DNA polymerase LigD, polymerase domain protein; PFAM: ATP
FT                   dependent DNA ligase; ATP dependent DNA ligase domain
FT                   protein; DNA primase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34753"
FT                   /db_xref="GOA:E6V5E7"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E7"
FT                   /inference="protein motif:TFAM:TIGR02776"
FT                   /protein_id="ADU34753.1"
FT                   /translation="MGTTRTASTARKALSRYHGKRDFSRTPEPKEGGRAGQGVLSFVIQ
FT                   KHHASRLHYDFRLELDGTLKSWAVPKGPCLDPTVKRMAVHVEDHPISYADFEGTIPPKQ
FT                   YGAGTVIVWDRGDWLPEGGSEADARKALAAGKLKFELRGEKLKGHWTLVRMRGKGDEKQ
FT                   EPWLLIKERDDAARDLADYDVLEEQPASVLTGRGLDEVDSPPKKAAPAKKAAAKKPEKK
FT                   AAKKEVKKEVKKKAALPATLQPQLAVLAASPPSSPDDWLYELKFDGYRLLARIDKGKVR
FT                   CFTRNGHDWTDKLPVIAKALAKLPTDSAWLDGEITVEGGNGAPDFQALQNAFDRGATSS
FT                   IVYWLFDAPFLDGQDLRDEPVEERRAHLARLLGKRPPATLRLSEAFDASPRDLLASSAR
FT                   IGFEGIVGKRKGSPYVSRRSADWIKLKNQQRQEFVIGGYTAPKGSRSGFGALLLGVHDD
FT                   KGRLRYCGNVGTGFNADRLADIKARLDRLATDDCPFKPMPDGANAKAQWVKPTLVAEVS
FT                   FGEWTREDRVRQAVFQGLRTDKPARGIVRERAAPSETSPETSTEASTDTPAKKQGARKS
FT                   MALKITHADRVIDAKSGITKGELAAYYDAVGTLMLPHLRGRPVSLVRAPDGVGGELFFQ
FT                   KHIQNREIPGVNLLDPALDPGHEPLLQIDSKTGLIGAAQMNVIELHTWNATSRAIDRPD
FT                   RMTFDLDPGEGVGWPQIQEATLLVRTLLDELGLPSFLKTSGGKGMHVVVPIRRQYGWDE
FT                   VKGFSQAVVVHLAKTIPDRFVAKSGPRNRVGKVFVDYLRNGFGATTVSAWSARSRPGLG
FT                   VSVPVAWEELPALTGAAQWTVANVAERLATGNKPWAAMERSRKGIAAAMKMLDYKPA"
FT   gene            complement(575939..576757)
FT                   /locus_tag="Varpa_0533"
FT   CDS_pept        complement(575939..576757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0533"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: vap:Vapar_0499 transglutaminase domain
FT                   protein; PFAM: transglutaminase domain-containing protein;
FT                   SMART: transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34754"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E8"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADU34754.1"
FT                   /translation="MQIRIGYDIQLGVTAPTALIYMLQVHPSRAADIQGSEHITISPPL
FT                   VTDHYRDSFDNHCARVQVPLGVSSVRLRNTATVFDTGAPDPVDLGAIEHAPADLPVGTL
FT                   PFVLPSRYCEVDSELLQFAWANFANVAPGWNRVQAICNFVHGHLRFDYQNARATRTALE
FT                   GFREGTGVCRDFAHLAITLCRCMNIPARYVTGYLGDIGIPPVRYPMDFSAWFEVYLGDR
FT                   WHTFDARHNTPRIGRIVMARGRDAADVPITMVFGANTLERFDVTTEEVLQ"
FT   gene            577053..577202
FT                   /locus_tag="Varpa_0534"
FT   CDS_pept        577053..577202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34755"
FT                   /db_xref="GOA:E6V5E9"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0500"
FT                   /protein_id="ADU34755.1"
FT                   /translation="MEFATLFDSLTGAWGDEILVWAVAAVAGCICLVALVNVLDMFLDS
FT                   NEMG"
FT   gene            577267..579462
FT                   /locus_tag="Varpa_0535"
FT   CDS_pept        577267..579462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0535"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: vap:Vapar_0501 catalase; PFAM: Catalase
FT                   related subgroup; Catalase domain protein; ThiJ/PfpI
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34756"
FT                   /db_xref="GOA:E6V5F0"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F0"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADU34756.1"
FT                   /translation="MTPQNKAAAGRRANATKTAKSGDGRNTKQLQLDGFTTEHPAHLTT
FT                   NQGLQIPDNHNSLKAGVRGPTLLEDFILREKITHFDHERIPERAVHARGSAAHGYFQVY
FT                   KSMSQFTSADFLQDPDVKTPVFVRFSTVAGERGSADTVRDVRGFAVKFYTREGNYDLVG
FT                   NNIPVFFIQDAMKFPDLIHAVKPEPHHAMPQAASAHDTFWDFASLMPESTHMLMWAMSD
FT                   RAIPRSYRMMEGFGVHTFRFVNSHGESHFVKFHWKPKLGIHGLVWDEAQKIAGKDADFH
FT                   RRDLWEAIENGDFPEWELGVQIIPADKEHSLGFDLLDPTKLIPEEMVPVQRIGKLVLDR
FT                   NPDNFFAETEQVAFHPGHVVPGIDFSNDPLLQGRLFSYTDTQISRLGGANFHELPINKG
FT                   VCPFHNFQRDGMHRQTIARGQVAYEPNTLGSGTEFRVDGGSNGFQSFPEAIDAPKVRRR
FT                   SASFDDHFTQARLFFNSQSVAEKEHIIAAFRFELSKLEVPAIRQRMVDNLAHVDEKLAR
FT                   RVAEPLGIGEPDAKAAAGRAGFRDHRIALPIDESPALSMADTGDGSIRTRKIAILVADG
FT                   IDSASLKPIREALEQAGAQCKIVGPRLGTVASASKRQIDVEMTFSNTPSVMFDAVLVPA
FT                   GADSAATMSATGDAVHFVLEAYKHCKAICTVGEGVKLLASLGVGADGDAPAGVVVAATP
FT                   VTNLGDTTAAQQIAQDFVAAIGKHRHWDRANIDAVPA"
FT   gene            complement(579483..581045)
FT                   /locus_tag="Varpa_0536"
FT   CDS_pept        complement(579483..581045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0536"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: bch:Bcen2424_6420 Sel1 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34757"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F1"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADU34757.1"
FT                   /translation="MNDLPRNMNLKTFNPHRADFACVHEAAKLPPIAVEVEMLFQQGMA
FT                   VTNNELWPNQRDYKKAAQLWEKAAAMGHWKAAMNLAGLHERGLGVQRDTERAVLIVEGL
FT                   MKQGVPGAFDKMGTYHQSGIGVKSDIDRAYGFWQLAADMGNPAAQTYIGDKLDAAYDDA
FT                   QMGIWGNRKVGLKMLECAFAQGDGEAAYRLGQTLDIDKNYTRALVVLHEGAKFGSADAA
FT                   NYLSSSFTQVDPLSGNQIDRARSERYSLLGDALELNPDLRFPNLDKVLPLPPASLPFWD
FT                   GKRETLIDAAKAVIVKQPTPATPGANRTGRTHIPQGYVLTGNIAPPPDENAYDNHGRPW
FT                   SLKARQHAHFTGYWLPQIDVIRGDWQANWNAAQVPWKFNRGEPLPNLAEQVPPGYGAVS
FT                   WHYKGLPVQQAASSHPYVAQGIARYVPGPEAPRSCSGTVPCPQTGIWSAGLKKEHAHHA
FT                   VFHEPWRQAYIEEGQPFPVPTTLHEAGGITVAARDIRWHWIGDANRADTSGHVHVTLTT
FT                   IDS"
FT   gene            complement(581138..583189)
FT                   /locus_tag="Varpa_0537"
FT   CDS_pept        complement(581138..583189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0537"
FT                   /product="phospholipase D/transphosphatidylase"
FT                   /note="KEGG: bac:BamMC406_6428 phospholipase
FT                   D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34758"
FT                   /db_xref="GOA:E6V5F2"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F2"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_6428"
FT                   /protein_id="ADU34758.1"
FT                   /translation="MSDLRPTNDTQHRSTVPLCAATGAATGSAQWFLEKRGEDEKTPVF
FT                   HHNNLRLYICGEETFKQIATDIRRAQHSIDLVCWGFDPAMELTRETADQWPRGDTWGDL
FT                   LLGAAQGKFNNGKPVNVRLLVWYDFIGSAAVNNMPGYKTESLYERSKPGLLFPPSPSER
FT                   DRREIFNSHWYRDVVAGKQNALSLRTRGGVHDDVMTSLRSEASMNGLGRIERLGFEYLA
FT                   THHQKTIVIDYEGDKPCGYVLGLNSVTDYWDTTAHKFDDPRRGKSWEGANDAEPGLKPY
FT                   QDYGCRVEGQVLAAVCKNFTEAWNKAEGNGKGAGSNVSREFNLKATPANLTRNLVAPHQ
FT                   SAQILRTLPATDGSEKSIHRLYNHAISFARHYLYVENQYFQHAAWVKELKRLRGEYLAG
FT                   FQKGKLGMADVPKLHVMVLTPTPERKQMVPRTHDTVTELGHGSSMPNQTKLVEEEIARY
FT                   DAVQEARRRSRDPLMIPPPQPLSSIAQAYKDAGGGKDDEMARKALEGQFAMRSLVASLW
FT                   TFDTNWQTTQRDRLAKLDGWKKSANYDPNSPGYAGGINYIKDLENQLLKARYREIYIHS
FT                   KLMVIDDSMFTLGSANLNLRSFAVDSEINIASDDPVTAKNLRERVWGQHTDGKFAGGVA
FT                   TDQTVMAETFKNWRREAYKNFKKKALGEAPSCFLVAFHDDRASSIRLG"
FT   gene            complement(583186..586020)
FT                   /locus_tag="Varpa_0538"
FT   CDS_pept        complement(583186..586020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0538"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="KEGG: mei:Msip34_1364 type VI secretion system Vgr
FT                   family protein; TIGRFAM: type VI secretion system Vgr
FT                   family protein; Rhs element Vgr protein; PFAM: Protein of
FT                   unknown function DUF2345"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34759"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F3"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ADU34759.1"
FT                   /translation="MQRTLSIQSPAIPVLLGQPTLEAVRLSGNEGINSLFAYELLLKTP
FT                   DALNLGASGAMDFDLDLFIGREITCLIQLDGAGQFVPSVAGQALDHIGAGVRQINALIT
FT                   DVEVWGEEGRHVQYKLTLRPWLHLATLTTDCRIYQNKTVVQILDELLASYDFPVDKRLI
FT                   ETYPTRDYQVQFNESDFEFFERLTQSWGISYFFQHSEGKHRLVLIDNMGAYRKNDSAAY
FT                   QKVEYHAPGWKVDAEYVSSFVPHHHLTSGRYASREYDYMRPRADLSQGRKEPRATGQAD
FT                   GEVYQWHEGSAAGSHYAQPRAGSAEANDPHGEGHRLALLRMEALRTHGARARASGNLRG
FT                   MVPGCSFQLTKHPRQKANAEYLLLDTRFLIEDVAQDSQIGDAAPGRKQQWKVEVDFTAH
FT                   PMAEPLRPVPTRPKPLTHGPQTARVVGPPGQNIWTDKWGRIKVQFPWDRIGNEDQHSSC
FT                   WIRVNLHGAGNQQGSIHVPRIGQEVIVDFVGGDPDLPICTGRVYNQANEPPWALPHHSA
FT                   LSGYRSRELTDNGGNSSAGRSNHIAMDDTKGKIQVQIKSDHQHSQLSLGHITRIEDNAG
FT                   RKDHRGQGLELRTDGHGAIRAAQGLLITTEGRANARAHITDMDETAARLTAAHEQHEGL
FT                   SGAALQTEAHSTGDQDEVIQSIKAQNDAIKSTAAAGKDRFPELADPHLVLASPAGIETT
FT                   TSQSTHIASAEHNALTSGGHTSVSAAKSFLVSAKQAVRLFAYQAGLRLFAFGGNIDIKA
FT                   LKESINILAKLDIVQVANRITITAKEELVLNGGGSTIRLNAAGIEDATSGKHVEHAAVH
FT                   SMVGPKNAPPRSVSGMSSLDLKKKGALSFVLLSHAQDGRPLGFEPYTLYRDGANVADGV
FT                   TDADGQVLIEDHQSDTTSYKVRLANGNEYELPVKAQLKSNDDRLAASGYRAAHSDTKNR
FT                   MQHYLRHRDDEGNS"
FT   gene            586337..588475
FT                   /locus_tag="Varpa_0539"
FT   CDS_pept        586337..588475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0539"
FT                   /product="tetratricopeptide domain protein"
FT                   /note="KEGG: vap:Vapar_0502 tetratricopeptide domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34760"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0502"
FT                   /protein_id="ADU34760.1"
FT                   /translation="MAWFSRWGWERPARCRAGIAGALGLAGILLLGFGPPVSAQPNAEA
FT                   AASKAEQARLADTDTLLALTSEGAVLYGQDAVKLSGYQYCSQAVALAEAGEFRQSIRAA
FT                   SKALHLANATRDPNLMAMANRDLAIVYSYSGQLEKAEEFAREALKHPARDPKLVVGPVQ
FT                   KVIGDVRTRRGDFSGAVLSYDEALANSSPRYAPLVQASLVNALIESGDAVRAREVLGTM
FT                   PPPKDAPLTAQLDRTRARLLLAENKPAEARDMYRALTARQVGADTEYYRLWAWDGVARS
FT                   EIALGQKQAAAEAVGQALGGVDKVRAKFRSEEFKMGLFSDLQSVFERGVSVYSDAGDAR
FT                   AAFEVSEHSRSRALLDAVRGRAKVSEQASNTVDLATLQRTLAADERVVQFHSLPDRLVV
FT                   WVVSPSAIQEKTVAVKREELNELVETFRNSIVRGRRTAITNADKLGAALLGPLGLAPGQ
FT                   RLVIVPHGPLHYLPFQALRLDGRYIIETHPVSVAPSMSIAVQLAQRTPRVNASLTAFGN
FT                   PRIEDKYDLPGAETEVKQLAQLFPRNTVFMGAAATKTQFRDVAARSPLMHVAAHAEADA
FT                   VDPLYSRILLANEGGKQNFLEAHEILGMPMDGTALVTLSACESGLGRIAQGDEVLGFTR
FT                   SFLSAGSSSLIASLWPVSDDATAVLMGTLYGELSKGRDLQKAMQAGQLAVLKDPKMSHP
FT                   FFWAPFNLIGNWRLTVGS"
FT   gene            588479..590269
FT                   /locus_tag="Varpa_0540"
FT   CDS_pept        588479..590269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0540"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; KEGG: vap:Vapar_0503
FT                   polypeptide-transport-associated domain protein ShlB-type"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34761"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F5"
FT                   /inference="protein motif:PFAM:PF08479"
FT                   /protein_id="ADU34761.1"
FT                   /translation="MRNAMNSSNRSTALAPRSALRPIAWATGALVSAVLFMAADRAHAE
FT                   EHAQAEQQAAPANDAGDSTELLPTKDPCGTCDRPLAQATGTVAPQSLPAPPRPAGTTFK
FT                   LNDLRLNGVKALTNAELQSITAPYIGRDVTLGDLEGLAQAITARYKERGYFLAQAIVPV
FT                   QTVRDGIVEISVIEGRLGKVDVVVAPDAPLSEARVRGFLAPLQPGEAVSAQGYERAMLL
FT                   LSDQPGVKVSSGLQEGTSPGTTDLSVEVAAAPRWAFTAEADNHGTKESGRYRVGGTARW
FT                   LSPFGIGDNLDMRLMVSDSNDLQFGRIAYEAPIGTSGLRAGVGLARVNYELGGQFADYE
FT                   ARGRANVLDFSLNYPLIRQRQQNLFLRLGADIKDLTDEVGIANTTSRKRVHGLSMGWTW
FT                   ERRDEVLGGGYWASTGTLYHGNLSIRDPESRLADQSLGGHNTEGGFTKMTFQLSRLQAI
FT                   VPRHSLYLSVGGQWASKNLDGSEKLALGGARAVRAYPSGELLVDQGVIGTAEWRWSFNE
FT                   ELTPFLFYDAARGKIVRNPTVFDGANSHSLRGYGVGVSWSRPGNFSINATLAWRAGTPP
FT                   AQTDGGGRNPRLYVQLIKAF"
FT   gene            590272..595749
FT                   /locus_tag="Varpa_0541"
FT   CDS_pept        590272..595749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0541"
FT                   /product="filamentous hemagglutinin family outer membrane
FT                   protein"
FT                   /note="KEGG: vap:Vapar_0504 filamentous hemagglutinin
FT                   family outer membrane protein; TIGRFAM: filamentous
FT                   haemagglutinin family outer membrane protein; PFAM:
FT                   filamentous haemagglutinin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34762"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR041286"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F6"
FT                   /inference="protein motif:TFAM:TIGR01901"
FT                   /protein_id="ADU34762.1"
FT                   /translation="MKQRSNPSRQRPRHHRGLQLRPLAISLLCAGLSPAIAQVLPTGFL
FT                   PIAGGVTMSQTGAVMSINQPLARGIASWQTFSIGAGGTVNIVQQSASSVLLNRVTGNEL
FT                   STIAGTLNANGRVILVNPNGVMFSQGATVNVGGLIASTLALTTSDKSFMDGATKLTFER
FT                   ADLNSAEVRNLGSITATGGGPVVLMGAAVGNGSTGTITADNGTVALASGRRITLDLVGD
FT                   GLTNLVIAPDAMATHAAVSNGGTIQADGGRVALVGSSVTAGELVVNQTGTVRARSIGTR
FT                   NGEIILGGGRDNQVAMTGGTLDATGDTANERGGSIRIAAGQVQLQANDKGQQAVVDASG
FT                   LAGGGTVAVRGYDVALSSGSVLRANATGQGAGGTIDVGTATGQVLVDGLTAPERESHAQ
FT                   VFGELSARGAGTGAGGAITTSGDFLRINPAKVDAGGGTQGGANGKWTVTAASDLNVVSA
FT                   ADIPAYDSIYPPLSITNVSAEGIGGTLGRGTDVTLSSSSIGDNAGVRFAADAKVIKSEG
FT                   GTATLRVDSAGSIVMATGSAIDARTGALHVDFNADSTGRVAENAAVINSGSGPVTELDY
FT                   AGSIRLSGATINANGGSVRFFGQSDAANGRAIGGSASHTDEPADSWRDGVYLNASSVTT
FT                   SGSGQVSMRGQGRSWVSDPSGTGGFYVGSGGVVVTNDSAVQAGTGGVSLDGVAGFGASG
FT                   VAAQDGAKVVATGDIAITGRGAAWNDTMPAAGAGSSTAVLIDAASVASDRNVRIDGTGA
FT                   DLDGFRTSKAFAAQNDFAGSSQGVSIYGSVTAGEGQRIDVNGRAGNQSFTSTLDDSGNI
FT                   VVTPFGQVYGVVVRANEALPNPLRTSGGTIAIDGQGTDVSLRMETFGSGSFALAAAPEP
FT                   GALAAPPQPALLSVMSETGKGGNISVRGRNIVIDGAEQFGDVPLVGRLDASGATGGGSI
FT                   DIAATGVIAVGANASLEANATGSGNGGSVKVVAGDSLRAYGNLSARGGAEGGNGGFIET
FT                   SAAQFDLAGIRADASAPVGNAGSWLIDPFDVDIVSGVATGSLTGNPFDPIAASTIQDGD
FT                   INAALNAGTSVTIGTGSTGSPLLGDIHMSNAKGAVNINYSTNKGPVTFQLDANRSVRGD
FT                   AGTVIQSTGGGALNVVFNADVNNGGTATGGGQISYSGDIYTNGGNVVMNGSWANPSNQS
FT                   VSVNLDGNEIDTRVGRSDAGAGGSVTIVGKSIGLGGIGDAAVAVDGVHISTSTGNVNIT
FT                   GTAEGASGVRLGSRFVATGIPNRQTEITSTTGNITVLGVGNSVTSAGTTPGHGVIIDQS
FT                   ALRSVDGDITVRGLRQAGGPTVGDGVRLTTGAQVVTSGTGDIELSGQSVGNGAGVRVGP
FT                   QAALGGAVPPVLADVIVSAGGNTVLRAGNDGSTDALVIDGKVSAANVINLRPGGVDAAG
FT                   NGVDQTGTPITLGGTAATGFAVSAAEFGRLTAPTIVAGSNAHAANIDVVGPLTLPSALT
FT                   LQNGGGGNIQLGGAIAATRLGLLSAGNITQAAGAPITAGTLMARSTGGSVLLDMAPNNV
FT                   SAATVGGGAAGAFRYVDVDTVQLGSVSVTGFDAASNAPQVQSATSMAADTVFVRTLSGD
FT                   LLLGTNVSSTRGTDLVAASRFQNLGAYTITGAPWRVWADTWGGETRGGLFGSGPLPNLY
FT                   HCAYLGLCTVTVSPGDNHFIYAQQPVATVVIGNATRPAGQANPPFTYTVAGLILGDTAS
FT                   SFSGAPGTSATPDSPPGLYAINGSFASAAGYAVNVRPGDLTVTEAPPPSVVLRLPDFPK
FT                   PDVLREVPSTWLYDRNVGPPPICFATGALEGDRASQGGDVLAREWSRVRSRPNLSSCVD
FT                   TEKRNGCADF"
FT   gene            complement(596572..597450)
FT                   /locus_tag="Varpa_0542"
FT   CDS_pept        complement(596572..597450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0542"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   mgi:Mflv_5092 FkbM family methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34763"
FT                   /db_xref="GOA:E6V5F7"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F7"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ADU34763.1"
FT                   /translation="MNTMTQTTRAAVDLRDILAPRRLTEVVDVGANPIDGDPPYLAMLQ
FT                   AGLCRVTGFEPQLSALHELTQAQGPLERYLPWALGDGGMHTLHVCAAPGMTSLLAPDAQ
FT                   SLALFEALQPLAEVRERIAVQTRRLDDIAEIAHLDFLKIDVQGSELAVFRAGRAKLAQA
FT                   VMVQTEVSFVTLYKDQPTQGEIDQELRGQGFVPHCFAAVKQWPIAPCVVDGDPRRPLRQ
FT                   LLEADLVYMRDIRRPEAMDDEQLRHLALVAHHCHGSFDLALRCLLLLEERRAVEAGAQQ
FT                   RYLQLLAARGA"
FT   gene            complement(597447..598232)
FT                   /locus_tag="Varpa_0543"
FT   CDS_pept        complement(597447..598232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34764"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F8"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0507"
FT                   /protein_id="ADU34764.1"
FT                   /translation="MPDLSALKDIRPFVATPSYGGTMTSLYVRSLLGLVNLAWEHRFPM
FT                   QTRFLDGDSLITRARNRLVAEFMADTRWTHLFWIDADIGFEPEAALRLLCAGRDVVAGI
FT                   YPHKTDGWPAGGLREPLPAGATREDFEALHASFPANAFDTRLSVDAEGFTEVLDAPTGF
FT                   MLIARSVFERLAAAYPQLRYTPERAADPATRDLPHYRFFDVLAEPDNGAYLAEDFAFCR
FT                   RWQSIGGQVFIDARSNLSHQGTRTYTGHFGRALAVREGR"
FT   gene            complement(598343..598975)
FT                   /locus_tag="Varpa_0544"
FT   CDS_pept        complement(598343..598975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0544"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   vap:Vapar_0488 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34765"
FT                   /db_xref="GOA:E6V5F9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F9"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADU34765.1"
FT                   /translation="MSNTAAPRRVLVVIDVQNEYFEGGGLPIEYPPILDTLPNVTKAMD
FT                   AAHAAGVPVVVVRHHAPKGAPVFQADTHNGQLHPEVANRPRDHLITKTFPSVFTGTDFA
FT                   DWLALHEIDTLSVAGYMTQNCDASTVFEAMHRGLNVEFLADASGALPYANDAGKVTAEE
FT                   IHRVFSVVFHSNFAAVTSTAAWITAMQEGQAIAKDNVVMSNRRARGV"
FT   gene            599087..600073
FT                   /locus_tag="Varpa_0545"
FT   CDS_pept        599087..600073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0545"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: vap:Vapar_0489 transcriptional regulator, AraC
FT                   family; PFAM: ThiJ/PfpI domain-containing protein;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34766"
FT                   /db_xref="GOA:E6V5G0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G0"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADU34766.1"
FT                   /translation="MARTTTTTTETIAVVAFDGISPFHLSVPCMVFGEDRTEAGAPRFR
FT                   MRVCAPEPGPLRTNAGFDLVVPHGLEAIRRAQIVVVPSWRDDGRPAPPALIRALQAAHR
FT                   RGATVVGLCLGAFVLAEAGLLDGRPATTHWNLAAAFAKQYPKVSLQPEVLYVDDGDVLT
FT                   SAGTAAGIDCCLHLLRVRYGAETANRAARRMVVAPHRQGGQAQYIQQPMPATAERDRLA
FT                   PLLEWLGKHLDVPHELDELARRALMSRRTFTRRFRESTGTTVGQWIQNQRLALAQRLLE
FT                   TTDHPVERVATGAGFGSAVSLRKHFTSAFKVSPTVYRRQFSRTEEAA"
FT   gene            complement(600235..602190)
FT                   /locus_tag="Varpa_0546"
FT   CDS_pept        complement(600235..602190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0546"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="KEGG: vap:Vapar_0508 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; response regulator receiver; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34767"
FT                   /db_xref="GOA:E6V5G1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34767.1"
FT                   /translation="MNAPPPPQGPVPAGDDAVQPRAASALVVRGNLQGDLFRLGVVPCA
FT                   AVALALTGWFTHNRLQTLEAQFDAEGEAVARQVAAMSDLSLYAGDVPALQNVANAALRG
FT                   GQVMRVEISNSAGVYVTAGPKNESLAQLRMFTSPVTLREASRASAFAPAGSTAAGDTPI
FT                   GLVQTFRDTTAYARERSRSLMAGIGIALVALLAAWASVRHMARTVARPLRRVSRTVAAL
FT                   EAGHFDMRCEVVEGGTRGSHELAVLAHDIDRLAERLQHNRQVSEERVREATAVALQRMA
FT                   EAEQAALSRARFLAAASHDLRQPLHAMGLFIDGLLPTASAAQRPAVLRLQESTEFMGVL
FT                   LDDLLEISRLDAQVLTPTITRISLAALFDQLDAQHAAAAIEARVRLRWSDRGLAVRTDA
FT                   AMLQRIVNNLVANALRHAPEGGTVLVAARRIASGVRIEVRDNGVGIAPIHQGRIFEEFY
FT                   QVANTERDRRRGFGLGLAICARIATLLGTRITVRSALQAGSTFAFTLPAARAADVVLPE
FT                   PAPVAPAPLAGLRCLVVDDDPAILDGSRALLEQWGCEVECVATGAEAIARMGTGDIHFD
FT                   AVLCDLQLAGDGDGVDVIEAAKRLQPDALAVLVSGATGPEVLQRLRHGGVMLLTKPVPP
FT                   AKLRALLTTRRHAHAA"
FT   gene            complement(602187..603266)
FT                   /locus_tag="Varpa_0547"
FT   CDS_pept        complement(602187..603266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0547"
FT                   /product="ABC-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: vap:Vapar_0509 ABC-type uncharacterized
FT                   transport system periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34768"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G2"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0509"
FT                   /protein_id="ADU34768.1"
FT                   /translation="MSVVAKHLFHPFPGRLRGAVRAALAFGLTAGVAVGLLGLSMASRA
FT                   AAAPSLTVLMSDDNPAHSEFVQQLRAGQEPGGRFELVRLSPTGEMPQGVETASAETEPR
FT                   ANAGVRTRSMRPSAADANLTMAVGAAAARAAVERPGQEPLVLAMLSRLDYEALKAASPA
FT                   LKRGDRRVGVLLRDPAMADQLALIHAVLPQKHRIGVVATPESEPLVRELQRAAQGANPA
FT                   WEVRVEYAPDARSLAAALRTVVPMSDALMVLPDLIGDNQAATLSVLRAGASAGLAVFGA
FT                   SEGLVRSGGLAAAVSTPSQLAQQARLLGQKVAVAGSSNSPLVEAATPATVRVNATVARG
FT                   LGLRLPEERELTDRLAAPR"
FT   sig_peptide     complement(603123..603266)
FT                   /locus_tag="Varpa_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.714 at
FT                   residue 48"
FT   gene            complement(603418..605310)
FT                   /locus_tag="Varpa_0548"
FT   CDS_pept        complement(603418..605310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0548"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="KEGG: vap:Vapar_0510 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; response regulator receiver; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34769"
FT                   /db_xref="GOA:E6V5G3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34769.1"
FT                   /translation="MNWNFRVLRGLARLTFAQQLILLALVPATAATLTAIAVLTRQHLG
FT                   NLTELMRANAQTVALQVATVAQAPLARMDKRALQRTAQSGTYQPHVQQVQIWTEDGEIV
FT                   ANSETVDRARGEGLQVVVPIVADDGRHNGKVMVEISLSAVQNARRSVWLNVAVVLAISL
FT                   LGVGLAGWWAARRISEPIRALGKAVDRLGAGEDASVAIEGTSEVKHLQLGFNHAARALA
FT                   ESRRLLQSRINEATAELARKNALLEVASQAKTRLLAAASHDLRQPLHALTLFSDGLANG
FT                   ETDPVKLQRIGHIRECVESLDRLFSELLNLSQLDAGVLQPQWADFPLDRLFDEISRNFR
FT                   PVAEQQGLRLVARKTELWVRCDYVMLSRILNNLVSNSLRHTLEGGVLIGARRRGKGVRI
FT                   DVVDTGVGIAAQHQTRVFEEFYQVEPAGRPSARGARGMGLGLATVQRLTELLNTRVELS
FT                   SRLHKGTCVRVLVRSAPAALPSPTPSPVAAGMEDGEPSLANLRILVIDDERTILEGLSV
FT                   VLANWGAEVLVAQTRAEALALADTWAEPPDVVVSDLLLQGGDNGLDVIAALERHPRGIG
FT                   PGTARLLVTGETKPDRLREVASAGIAVLYKPVSPRVLRQSIHAQRAAALLNLDA"
FT   gene            605457..606515
FT                   /locus_tag="Varpa_0549"
FT   CDS_pept        605457..606515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0549"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: vap:Vapar_0512
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34770"
FT                   /db_xref="GOA:E6V5G4"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G4"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ADU34770.1"
FT                   /translation="MLAFLRHFAAVPAVFSAAFRAAALAFFVGLPVVAAAQTAQAAPPD
FT                   KTAVRFGILPLGGAFESRSDWDPLLAELSRAIHRPVSVLSVNSYEALEQAIQRDEVDMA
FT                   FLSGKMALDAVTQRRMKVVAQVVRHDGLPGYRALLLARKTPPLNTLKDLMDQPERWRLA
FT                   RGEKQSVSGFIVPQLQLFLPNHIVMETRFLSEVVGTHQTNALAVANSEADVATNNSADF
FT                   ERFKLRFPAEAQRLQVLWESELIPHAQIVVRREYPAELRSRVQAFLTAYGRGKGPRGDA
FT                   ERLVLKSLHDLAGFVVADNSSLQPAAKLAYQLAKQNAVTAQFVNDAAKQARLQRIENGY
FT                   AEQVSVLRDIAP"
FT   sig_peptide     605457..605561
FT                   /locus_tag="Varpa_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.425 at
FT                   residue 35"
FT   gene            606583..607608
FT                   /locus_tag="Varpa_0550"
FT   CDS_pept        606583..607608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0550"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: vap:Vapar_0513
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34771"
FT                   /db_xref="GOA:E6V5G5"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G5"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ADU34771.1"
FT                   /translation="MPPALKHLLAAAFIAASGLLPPSLALAQAVNEKPVQTIRFGVLPL
FT                   GGTVESRALWTPFMADMSRSLGIPVNAYSVPSYEELDRAIGKDEIDMAFLSAKMALDAV
FT                   MQRRMKVVAQIARRPGMPEHRAVLLARKAGPLNTLEGMLAQPERWRLARGDSRSVTGFV
FT                   VPQSQLFLPNNIEMETRFLSEFVGTHQATALAVANGDADVATNNTTDLERFRQQFPIEA
FT                   ERLQVIWESTPPPGAPMVVRRNYPPEFQAKLQNFLITYGQGKGPHADGEREVLKNLRAA
FT                   YGYVAADDSALLPEARLEYELGKQRAMAAAWVNEAARAQRLQRIEKAYAEQVQTLRAGG
FT                   R"
FT   sig_peptide     606583..606666
FT                   /locus_tag="Varpa_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 28"
FT   gene            607752..609083
FT                   /locus_tag="Varpa_0551"
FT   CDS_pept        607752..609083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0551"
FT                   /product="type VI secretion protein, VC_A0114 family"
FT                   /note="KEGG: vap:Vapar_0514 type VI secretion protein,
FT                   VC_A0114 family; TIGRFAM: type VI secretion protein,
FT                   VC_A0114 family; PFAM: protein of unknown function DUF876"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34772"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G6"
FT                   /inference="protein motif:TFAM:TIGR03353"
FT                   /protein_id="ADU34772.1"
FT                   /translation="MSWRTKVVWSEGMLLQPQHLQQSERHADHARHVLLRSTTPYAWGF
FT                   AELEIDQAALTLGKLALVRAVGIFGDGTVFDMPAVDPLPEPIDIPSSMRDEAVVLALPL
FT                   RRAGAREADAEEYEELVRHRVLESDVPDSNTAGERTAMLQLGQLHTRLMRASEATDAWT
FT                   TMGVARVVERRTDNQVQLDRGMLPPLLDVAGHAVIRAWLDELLGLLRQRGEALAGRMTQ
FT                   GGTGGVAEIADFMLLQAVNRNEAIFAHLAKSAMLHPQHFFEHALGLAGDLSSFRDTRRV
FT                   ARFGPYIHDDLALSFRPVMDDLRRSLSMVFEQSAIRIELHDRKHGVRVAMVTDVELQRK
FT                   ATFVLAVNANMPSEALRARFPTQVKIGPVERIRDLVNLALPGVTLTPMPVAPRQIPFHT
FT                   GANYFELETRNSDLWRQLEQSGGIAMHIAGDFPGLDLAFWAIRS"
FT   gene            609312..610676
FT                   /locus_tag="Varpa_0552"
FT   CDS_pept        609312..610676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0552"
FT                   /product="type IV / VI secretion system protein, DotU
FT                   family"
FT                   /note="KEGG: vap:Vapar_0515 type IV / VI secretion system
FT                   protein, DotU family; TIGRFAM: type IV / VI secretion
FT                   system protein, DotU family; type VI secretion system
FT                   OmpA/MotB family protein; PFAM: Type IV / VI secretion
FT                   system, DotU; OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34773"
FT                   /db_xref="GOA:E6V5G7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G7"
FT                   /inference="protein motif:TFAM:TIGR03349"
FT                   /protein_id="ADU34773.1"
FT                   /translation="MSTPPDPFAAFESERTVIKPKPRTPAGTPPAATPAPFFGGADPTP
FT                   AVEVGEIGLLNPLVSAAGKLLVLIGKLRNLAQPPNVPALRASTADAVNQFDASARRSGV
FT                   SNESVLAARYVLCTALDEAVANTPWGVQAGWNKQSLLVQFHNETWGGEKVFQLLAKLAQ
FT                   DVPTHRQLLELIYSVLALGFEGRYRVVDNGRAQLDSVRQRLADLIAKDRPAVEPELSPH
FT                   WRGQGAGTVRLRESLPLWVFAAGFAFLLALAWVGMQIMLNQRSDTTYAAVSGLRVPNIQ
FT                   IAPPAPPAKTPRLARFLEPEVKQGLVTVTDEADRSVVRLRGDSFFGSGSAEPMAASLPV
FT                   LRRIGQALAEVKGDVLITGHSDNQPIRSLRYPSNWHLSAARADAVKGALTTLVDPARMR
FT                   SDGKADAEPVAANDTPANRARNRRVDIVLLTEPERIASAAPVAPAPAAPVPGATK"
FT   gene            610673..614272
FT                   /locus_tag="Varpa_0553"
FT   CDS_pept        610673..614272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0553"
FT                   /product="type VI secretion protein IcmF"
FT                   /note="KEGG: vap:Vapar_0516 type VI secretion protein IcmF;
FT                   TIGRFAM: type VI secretion protein IcmF; PFAM: ImcF domain
FT                   protein; protein of unknown function DUF1215"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34774"
FT                   /db_xref="GOA:E6V5G8"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G8"
FT                   /inference="protein motif:TFAM:TIGR03348"
FT                   /protein_id="ADU34774.1"
FT                   /translation="MIKKIFGFLFSPLLLTLLALIVVGLLIWWIGPLVKIGSLAPLESE
FT                   LARWLLIGAIVLIVVLRMAWRRWRARRASQHLTDGLMKAPTVKTDAPANGEQKILDTRF
FT                   SEAVATLKQMRLHAAGKKPGWRDWMSISGGSYLYDLPWYVFIGAPGAGKTTALVNSGLS
FT                   FPLAEKFGPGAIRGVGGTRNCDWWFTDEAVLIDTAGRYTTQDSHQTEDKNAWEGFLGLL
FT                   KKARPRRPLNGVFLTVSVADLLSQGPEQRTQLAASIRARLLELDSKLTTRLPVYVLVTK
FT                   SDLLYGFTDYFDDLGKEQRAQVFGFTLPADENVQTEEKGLSTAFHREFALLHNRVNDGL
FT                   IPRMQRETDGGRRAAIFGFPAQFGSIGSLLSDLLDQVFTGSRFAQPPWVRGVYFTSGTQ
FT                   EGSPIDRVMGSLSRSFGIERAMLAPQKSSGRSYFLTSLLRDVVFPEQRLAGADVKLERR
FT                   RHLLRMTGVAAMTLVTVGLIAGWGYSTWQNTNYLKSVEARAVPAQKSLANLPVQLQNLV
FT                   EVAPVMQGIRDIWKTPENRQGDEPLSMTLGLYQGNKLDAAARLAHQRALNDVFLPQIAK
FT                   RIEDQLRTAQKDNLEYTYEALKSYLMLYQPEHFDPEALKAWITLDWARSLDRGIPEEQR
FT                   MALEEQLDVLIAQGPPRSPLKMDENLVRSVRAVLASYPLEQRVFSRLKRQRATKDIPGF
FT                   SVATAAGPSAPLVFERISGKPLTEGVPGMFTYDGYHKRFQNEVTVLTGLLAAEDPWVLG
FT                   QDKGAADRLRDVAALGALTDRVRRLYLAEYVKQWEALLGDVRLIRATGLDKNIEAARIL
FT                   SGVSSPLANFLRAVVKETTLIPADQPKDVVSKATATVASTRKGLEDLFGGDPNKPVATG
FT                   KRIESIVDDRFEPLRRLVTAAAPGQPAPIDDALKLFNEVYVYLNAVDTAVKGRTSPPPG
FT                   DVAGKLKADAGRLPEPVRSMVENLSQSGAAQAQVAERGNLSQDLRPVTEFCARAIAGRY
FT                   PFSPTSKRDVLPEDFGQMFGAGGLMDDFFQKRLAALVDTSTRPWRYKPVAERGAITTQA
FT                   LAQFERAARIKDIFFRAGGRGPSMRLDFKPVEMDAGITQFILDVDGQLVKYAHGPVVPM
FT                   AVQWPGPKGSNQVRIQVSPPSTTGSSGSAVDGPWALFRALDDGQLEAGDAPEKFFITFQ
FT                   IGARKTRFEVTTNSVQHPIRLRELREFSCPEGL"
FT   gene            614269..614913
FT                   /locus_tag="Varpa_0554"
FT   CDS_pept        614269..614913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0554"
FT                   /product="type VI secretion-associated protein, BMA_A0400
FT                   family"
FT                   /note="KEGG: vap:Vapar_0517 type VI secretion-associated
FT                   protein, BMA_A0400 family; TIGRFAM: type VI
FT                   secretion-associated protein, BMA_A0400 family; PFAM: Type
FT                   VI secretion system-associated, BMAA0400"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34775"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G9"
FT                   /inference="protein motif:TFAM:TIGR03373"
FT                   /protein_id="ADU34775.1"
FT                   /translation="MSLATSSSSSSSLFTSTELPGWFGKLPGMGDFAHRRLPESFRTVW
FT                   DQWLQRGLARLRDRHADWTAHYLEAPIWCFALGPQVAGERGWIGVLMPSVDGVGRYFPF
FT                   TLAVELAGDVSDALQGEALVAALQWWALATQAALEGLDGDLDALRFDAVLGRLFVAAAA
FT                   GSVDGVELLEMPAAGASLWLGDPAVEGGVRMLATGLPRDAQFEALFLGGGE"
FT   gene            614910..615749
FT                   /locus_tag="Varpa_0555"
FT   CDS_pept        614910..615749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34776"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0184"
FT                   /protein_id="ADU34776.1"
FT                   /translation="MNSLLPFTFRGRVSPRQATYFSLLRQRKVGKRKATLLSATLRFAA
FT                   GNLRCSRFAGSRRTRFAQTAASPDPRTAALLGAARRALGTDRPSLRSASSRAFAALGRG
FT                   APAPALPREGREKDKTCDTGPDALLLPLPGEGWDGGTTALAAQLRLIERRVPPPQPSPG
FT                   RGGSQSKPSEAMARDVFKAERSDGASESPSVCAEERSVSRIRARPCLSEASLGETPRNV
FT                   STAGCPKRSAGTQTAGSPFLCLRSFGEAKESKSPAGARPGLRPSQGKQSIQPAGASR"
FT   gene            615746..617689
FT                   /locus_tag="Varpa_0556"
FT   CDS_pept        615746..617689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0556"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: vap:Vapar_0519 serine/threonine protein
FT                   kinase; PFAM: Serine/threonine-protein kinase-like domain;
FT                   SMART: serine/threonine protein kinase; Tyrosine-protein
FT                   kinase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34777"
FT                   /db_xref="GOA:E6V5H1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADU34777.1"
FT                   /translation="MTDSPSNSSPPEDDRTRVVSRPAPQQQTTGTGDTAATVISAGVTS
FT                   LSNVPVTSPASATHEAGLLPVGSRLAEFEITRVIGQGGFGVVYEAWDHDLERVVAIKEY
FT                   LPTSLSTRQNDGTVVPLSERHRETFDLGMRSFINEARLLAQFDHPSLLKVYRFWQERGT
FT                   TYMVMPFYRGDTLREALVAIPAGVDESWLIRIMDGVTQALGVMHNANCYHRDIAPDNII
FT                   LLEGSGRPVVLDFGAARRVITDKTQAITVILKPGYAPIEQYAEMPDMSQGAWTDVYALA
FT                   AVMHVAVCGRAPPPSVARLLSDSYVPLAGNDILRQRYSLKLLQAIDAGLGVRPEQRPQS
FT                   MADLRAALDLEVGHSIAPTPRTQPPSGARTGGGNNNTGSNANAATVIAGKKAPPPPAPA
FT                   PGSGNSGAGKGKAVAAIASIAVVAAVAGGGWWWYQGRAGGTDKQDVAIATPPPPLENVT
FT                   KLDPPPPPPPPPPPPPPAAPRTPLESLQSLAAGAAPGFEVTATAKKPEVAIGKDKLAFE
FT                   VRSKRDGFVYVFLLSSGGEMFLLFPNLLDKYNKINANSALALPRASWPMDAGGPAGTNQ
FT                   FAVLVSEHERDFSASGVQNDGVFPQFPLPVLSALEATRGTGPSPLLGKPTCAPGAPCND
FT                   VYGVANFKIVEK"
FT   gene            617750..619342
FT                   /locus_tag="Varpa_0557"
FT   CDS_pept        617750..619342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0557"
FT                   /product="3D domain-containing protein"
FT                   /note="PFAM: 3D domain-containing protein; MltA domain
FT                   protein; KEGG: vap:Vapar_0520 3D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34778"
FT                   /db_xref="GOA:E6V5H2"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H2"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADU34778.1"
FT                   /translation="MHTSSQSPRFTGSTLIRWAAFAAVASLAGCVNPPPAATTADTTAA
FT                   TDTSSTTSSRPASTGASVAGQARTFSTQLATYTAVSFDAMPGWSRDDFSETWPAFLGSC
FT                   KVLTGRGAEWKEVCDRAGKVDGKNRNAIRGFFESEFSAYQIRDDDRKPDGVVTGYFEPE
FT                   IAGSRTYGAPFIYPVYGQPEDMLFADARKLPAGSGTVAAKVEGRNVVVQTGLSTRDMGA
FT                   PGLYALDLSAITRDTLDRKVRMRIEGKQLLPYYTREEIETKGAPNAKVLAFVSSATALY
FT                   EMQIQGSGRIKLANGDTIRVAYAEQNGQPFRPTIAQAANGKPRSAVKVRGSSIELQLDD
FT                   GDDDDVGSVDSSVIRTRGFTLARPTASGAVVVPGRRTAGAVAGSGIKDPSYVFFKEATS
FT                   PAGGPVGAFGVPLSAGRSIAVDPRSTPLGYPVFVSTRTPGSGAPMQRLTIAQDTGGAIR
FT                   GAVRADYFFGNGQAAATNARRMKERGQLWILLPRGLAVAQAAVSSAIRTRGAAVGAGLP
FT                   QCLVPTEGQCVDD"
FT   gene            619372..620121
FT                   /locus_tag="Varpa_0558"
FT   CDS_pept        619372..620121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34779"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0521"
FT                   /protein_id="ADU34779.1"
FT                   /translation="MQETLSSAESTELVRLWRRRQTLSSNDMGTMYRIVGDALVACNPP
FT                   ELQILGEGRQELVAQFIYVKVLRLDADPDEADERASHSAPSTAFALCAYFRRYLIDCTR
FT                   ASSFRRKLSIGDQITEAQLEDEIGAGDDLEGCLAEHGLSAQAVQLAARAFIAELPEPER
FT                   ILLCEGFGKEAEGGLSGIASRHAIASYHYRAGRLGLVHKREGLTADYAKTRLGGWIQQT
FT                   LGIAIEAENMAAILQVFKILGAEASYA"
FT   gene            620150..621304
FT                   /locus_tag="Varpa_0559"
FT   CDS_pept        620150..621304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0559"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34780"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0522"
FT                   /protein_id="ADU34780.1"
FT                   /translation="MNTELWPPLSVIRNAFETGHAAVPDAAAAGVATVAMPGTTSQATP
FT                   QAAPAAAPVLQDLLLPLTELARRREAVAQRGFTARWAPGRLLSVLHEGRLLGVLLDRCI
FT                   HGDLWQGWMAAGEADWASAFDVLLEPDDEPFEPAFGLIQAWNVLTLEPSPQLCARVLGE
FT                   VSATRLAAIRAVHDEWAAQKVLPIAPEPGHIALRTVGGVFSVLSGTPLGARDPRADYQA
FT                   LYRTVGLQLGSALTPSAKAAPAAPVPPRARPQERPEGGWWGSIRRWFGADGWMRPAFAV
FT                   LALCVVVQNVGLLGGRGSEEDEVRFRNVPTAPAAASANLVVRWKDGVRVDEADRLLRTM
FT                   SAEVVGGPGTNGVWRLRVDDPVGGLSMLAASPLVESAGPASERP"
FT   gene            621430..623403
FT                   /locus_tag="Varpa_0560"
FT   CDS_pept        621430..623403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0560"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: vap:Vapar_0523 peptidase C14 caspase catalytic
FT                   subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34781"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H5"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ADU34781.1"
FT                   /translation="MRALCLRLLLSLALLVSGSTAFATQRALLVGVSELVNQPQALWLQ
FT                   APRNDVMLMRDALLKQGFAPADITVLADGVSGSVLPESQAIHEALGRLLAQSKSGDFVL
FT                   LYFSGHGTRLRDSNKRYQEPDGLSENFLARDVRGTLGADSALTGDLRDADFDAWIQAFL
FT                   ARNVFVASVFDTCSANSMTRSTTDAPAIADGPPGDEVRWRGLRTAQLVGAPGPAARVAM
FT                   TRPTVTDPVPRARYVALFASESHQITPELRLPRKNRNARPQGLLTWAVVEALSRKPATW
FT                   RDLFDGVLAVYPPVIDELAQRFPTRELPSPVAEGNLDAPIFANRAQAVTTRPVWRAQRS
FT                   GDTLTLQAGQLDGLVVQQPLRVLATMDDGTVRSAEGTLAQAFNDKARMAVPAALRELSG
FT                   AALWNITPLGEPATVALRVRAEQGLPPGLSLEYPASVIAVNETDGADARWSAGRLEVLS
FT                   PMLGAGAKSAPADAAVARRRLEVLARLKWLNQLYTIARDAQFDGFDAVFEIWNGDRLVR
FT                   SGSAQQVDAKLLPLRSGERAVLNVRNTSARSVDLVIVGIDPQGAARQVYPEDPGETNRF
FT                   KRGTREAPAVKRFELPWFNAEGGRLLVLATPAAPYSAPRLFGTGAGDAVAEVRVRGALQ
FT                   PESERQTFAAMVHWAGEVSAAK"
FT   sig_peptide     621430..621501
FT                   /locus_tag="Varpa_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.974 at
FT                   residue 24"
FT   gene            623463..624020
FT                   /locus_tag="Varpa_0561"
FT   CDS_pept        623463..624020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34782"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H6"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0524"
FT                   /protein_id="ADU34782.1"
FT                   /translation="MSWTYDGKLDPDEALRLLDYLSGESGNDFSMMIESKGTPIEGESV
FT                   RTYEDGKQRMDIGGYSYKSDVVIPPGSSKGKLRNYSFIVIRDCDAATASIASLMKSQDA
FT                   DLKVTVSVFKAGGDSSKDLQSHLEFVLEGARVNCHAIVTGGTPKRPCDIIFFDYTKLEI
FT                   RSAPQQKTGARGAVRTCTFTGN"
FT   gene            624022..624876
FT                   /locus_tag="Varpa_0562"
FT   CDS_pept        624022..624876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0562"
FT                   /product="virulence protein SciE type"
FT                   /note="PFAM: virulence protein SciE type; KEGG:
FT                   vap:Vapar_0525 virulence protein SciE type"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34783"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H7"
FT                   /inference="protein motif:PFAM:PF07024"
FT                   /protein_id="ADU34783.1"
FT                   /translation="MATSSAELIKSADPVAALKALSDEVRAKPSDSKHRVFMAQLLCVL
FT                   GQWERALNQLTVAAELDALAVPMKQVYGDAVRCEGLRAEVFAGTRTPMIFGQPDEWLAL
FT                   LIESLLRQGRGESELAEDLRQRAFDGAPAIAGTIDGTPFEWLADADMRLGPVLEAFVNG
FT                   KYYWIPYARLAHIKIEPPEDLRDCVWMPAHLQFENGGETLALIPTRYEGSEKSEDGELQ
FT                   LARKTEWRELRPEVWAGTGQRVLGSDAGEYALMDVREILFNPVASAEAEAAPSQEGTES
FT                   AGG"
FT   gene            624878..625393
FT                   /locus_tag="Varpa_0563"
FT   CDS_pept        624878..625393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0563"
FT                   /product="type VI secretion system lysozyme-related
FT                   protein"
FT                   /note="KEGG: vap:Vapar_0526 type VI secretion system
FT                   lysozyme-related protein; TIGRFAM: type VI secretion system
FT                   lysozyme-related protein; PFAM: GPW/gp25 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34784"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H8"
FT                   /inference="protein motif:TFAM:TIGR03357"
FT                   /protein_id="ADU34784.1"
FT                   /translation="MGELTAQERLQPSLLDRLVDNAPTEKREGDEKRTLTKQALRAAVL
FT                   RDLSWLFNATGFGLAMDDKQYPNAARSVINYGLPMLSGQFTSSVQRVSMEQALKNAILQ
FT                   FEPRILSRTLEVELVMEGSAMDSHNSIGLQIRGMLWAQPVPLEFLMRSRVDLEEGRIEI
FT                   VDMAQNPR"
FT   gene            625402..627294
FT                   /locus_tag="Varpa_0564"
FT   CDS_pept        625402..627294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0564"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="KEGG: vap:Vapar_0527 type VI secretion protein,
FT                   VC_A0110 family; TIGRFAM: type VI secretion protein,
FT                   VC_A0110 family; PFAM: protein of unknown function DUF879"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34785"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H9"
FT                   /inference="protein motif:TFAM:TIGR03359"
FT                   /protein_id="ADU34785.1"
FT                   /translation="MDPRLLNLYEQELRYFRESSSEFARAFPKIAHRLGIEGQEVADPY
FT                   VERLIEATAFLSARVNLKLDAEYPRFTGHLLDIVYPNFLAPTPAMAVVSFSPDLDDANL
FT                   ATGPKLPRGAGLRARQAVGQNTHCEFRTSSALRIWPMEVQRAQYFTYAPDLPLATHPQS
FT                   RAIRGGLRIALRATAGLKFNQIALDDLVLHLGGAEDVAWQLQECALGQPIGVMVRPLSP
FT                   TGALQGAAQSLPASAIQPVGFEDDEALLPVTATGFSGFRLLQEYFAFPQRFQFLRIAGL
FT                   QALLATMPVTEIELVLLFSRGDAALEKLVTAENVQLHCVPVVNLFNKRLDRVPLTEGVS
FT                   QFHLVPDRTRPQDFEVHTVTEVIGHGAPGADATAAEQPFRPFYSAFHGTRHNHPAYFTT
FT                   TREPRMLSVRQRTEGHRSSHIGSEVYMQIVDPQQAPYAATLRQLAVSAMCTNRDLPLLM
FT                   PLGRDNDFDCVDSFPVQRVRMVRGPSRPVSPVVSQGLGWRVVDHLALNYLSISDSTPEQ
FT                   GAAALRETLMLYATHADEMRQGQVRGLLSVKSKPVARRLPLKGPIAFGRGLEVTLEVDK
FT                   DAFHGHSVFLFGAVMSRFLARHVEVNHFVETVLRVAGKGETMRWRPLCGTRQIL"
FT   gene            627258..628340
FT                   /locus_tag="Varpa_0565"
FT   CDS_pept        627258..628340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0565"
FT                   /product="type VI secretion protein, VC_A0111 family"
FT                   /note="KEGG: vap:Vapar_0528 type VI secretion protein,
FT                   VC_A0111 family; TIGRFAM: type VI secretion protein,
FT                   VC_A0111 family; PFAM: protein of unknown function DUF1305"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34786"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5I0"
FT                   /inference="protein motif:TFAM:TIGR03347"
FT                   /protein_id="ADU34786.1"
FT                   /translation="MEAAVRDPADSVATRVDNALRGWSAEPWSFDYFAVMRRLESVAAT
FT                   TPRWGRALLPSAEPVRVGQEPSLSFAPASFSRFEPATAYSPPRLRQHFFSYVGPNGPLP
FT                   VHLSDFIRERSLNHGDPTWLAFLDSFLHRFSLHFYRAWAQARPAVALDRPGEDRFRLQV
FT                   GAFVGMGTPGRIGRDEVHDDARLHFSGWLARRVHNAESVESVLRSYFGVPVTLERWVGH
FT                   WMRVPSDEVTRLGRGESSRSMGMGAMLGTRAWDRQHRVRLHMGPLTLDQYRMFLPIGTA
FT                   RPVLQRWMQQLLGDELEWDAELVLEKAEVPVTRLGQKNGNAPRLGWASWLGQRTRAKDA
FT                   ADVRIGSSSMTVRTAAGAAA"
FT   gene            628337..629671
FT                   /locus_tag="Varpa_0566"
FT   CDS_pept        628337..629671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0566"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Tetratricopeptide
FT                   TPR_1 repeat-containing protein; KEGG: vap:Vapar_0529
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34787"
FT                   /db_xref="GOA:E6V5I1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5I1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADU34787.1"
FT                   /translation="MTTTTLGCADTAAHAAALVQAADLTKAGNLDAADELLARILEAAP
FT                   DDPDALHYQGLLRHAQGRDAESIALIGRSLTLQPAQGGAWNNLGNLLVEAGRVDDAMRA
FT                   YENSVSFASGDEAADALSNIAMLERGKGHWQAAERASRRAIELRPTSSEAWYNLSIALM
FT                   EQGRIEESVIANSRAVLLQPRNMSARSKVIRALELLRESEQAIRMYREWLAEDPGNPVV
FT                   AHLLAACEGHAPARASDGYVETLFDSYAGSFDASLEKLHYRAPELVARAVRDMFGPPAA
FT                   RIAVVDAGCGTGLCAPLLRPWASHMAGCDLSVGMLQRAEQRGGYDVLHKAELTHYLHTQ
FT                   PGRFDLVASADTLCYFGDLHEVLAAAARALRPEGGVAFTVEAMDGGPNDFRLEGSGRYR
FT                   HAAAHVEACLAAAGFDAIRIEPIVPRREAGRNVQGWLASA