(data stored in ACNUC7421 zone)

EMBL: CP002418

ID   CP002418; SV 1; circular; genomic DNA; STD; PRO; 5404117 BP.
XX
AC   CP002418; ADFI01000000-ADFI01000058;
XX
PR   Project:PRJNA38503;
XX
DT   30-DEC-2010 (Rel. 107, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 3)
XX
DE   Rhodopseudomonas palustris DX-1 chromosome, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Rhodopseudomonas palustris DX-1
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Bradyrhizobiaceae; Rhodopseudomonas.
XX
RN   [1]
RP   1-5404117
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Goodwin L., Pitluck S.,
RA   Misra M., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Ovchinnikova G., Logan B., Oda Y., Harwood C.,
RA   Woyke T.;
RT   "Complete sequence of Rhodopseudomonas palustris DX-1";
RL   Unpublished.
XX
RN   [2]
RP   1-5404117
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Goodwin L., Pitluck S.,
RA   Misra M., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Ovchinnikova G., Logan B., Oda Y., Harwood C.,
RA   Woyke T.;
RT   ;
RL   Submitted (22-DEC-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 72e79e81962f74f27a1fce52830dfac6.
DR   BioSample; SAMN00713571.
DR   EnsemblGenomes-Gn; EBG00001021112.
DR   EnsemblGenomes-Gn; EBG00001021113.
DR   EnsemblGenomes-Gn; EBG00001021114.
DR   EnsemblGenomes-Gn; EBG00001021115.
DR   EnsemblGenomes-Gn; EBG00001021116.
DR   EnsemblGenomes-Gn; EBG00001021117.
DR   EnsemblGenomes-Gn; EBG00001021118.
DR   EnsemblGenomes-Gn; EBG00001021119.
DR   EnsemblGenomes-Gn; EBG00001021120.
DR   EnsemblGenomes-Gn; EBG00001021121.
DR   EnsemblGenomes-Gn; EBG00001021122.
DR   EnsemblGenomes-Gn; EBG00001021123.
DR   EnsemblGenomes-Gn; EBG00001021124.
DR   EnsemblGenomes-Gn; EBG00001021125.
DR   EnsemblGenomes-Gn; EBG00001021126.
DR   EnsemblGenomes-Gn; EBG00001021127.
DR   EnsemblGenomes-Gn; EBG00001021128.
DR   EnsemblGenomes-Gn; EBG00001021129.
DR   EnsemblGenomes-Gn; EBG00001021130.
DR   EnsemblGenomes-Gn; EBG00001021131.
DR   EnsemblGenomes-Gn; EBG00001021132.
DR   EnsemblGenomes-Gn; EBG00001021133.
DR   EnsemblGenomes-Gn; EBG00001021134.
DR   EnsemblGenomes-Gn; EBG00001021135.
DR   EnsemblGenomes-Gn; EBG00001021136.
DR   EnsemblGenomes-Gn; EBG00001021137.
DR   EnsemblGenomes-Gn; EBG00001021138.
DR   EnsemblGenomes-Gn; EBG00001021139.
DR   EnsemblGenomes-Gn; EBG00001021140.
DR   EnsemblGenomes-Gn; EBG00001021141.
DR   EnsemblGenomes-Gn; EBG00001021142.
DR   EnsemblGenomes-Gn; EBG00001021143.
DR   EnsemblGenomes-Gn; EBG00001021144.
DR   EnsemblGenomes-Gn; EBG00001021145.
DR   EnsemblGenomes-Gn; EBG00001021146.
DR   EnsemblGenomes-Gn; EBG00001021147.
DR   EnsemblGenomes-Gn; EBG00001021148.
DR   EnsemblGenomes-Gn; EBG00001021149.
DR   EnsemblGenomes-Gn; EBG00001021150.
DR   EnsemblGenomes-Gn; EBG00001021151.
DR   EnsemblGenomes-Gn; EBG00001021152.
DR   EnsemblGenomes-Gn; EBG00001021153.
DR   EnsemblGenomes-Gn; EBG00001021154.
DR   EnsemblGenomes-Gn; EBG00001021155.
DR   EnsemblGenomes-Gn; EBG00001021156.
DR   EnsemblGenomes-Gn; EBG00001021157.
DR   EnsemblGenomes-Gn; EBG00001021158.
DR   EnsemblGenomes-Gn; EBG00001021159.
DR   EnsemblGenomes-Gn; EBG00001021160.
DR   EnsemblGenomes-Gn; EBG00001021161.
DR   EnsemblGenomes-Gn; EBG00001021162.
DR   EnsemblGenomes-Gn; EBG00001021163.
DR   EnsemblGenomes-Gn; EBG00001021164.
DR   EnsemblGenomes-Gn; EBG00001021165.
DR   EnsemblGenomes-Gn; EBG00001021166.
DR   EnsemblGenomes-Gn; EBG00001021167.
DR   EnsemblGenomes-Gn; EBG00001021168.
DR   EnsemblGenomes-Gn; EBG00001021169.
DR   EnsemblGenomes-Gn; EBG00001021170.
DR   EnsemblGenomes-Gn; EBG00001021171.
DR   EnsemblGenomes-Gn; EBG00001021172.
DR   EnsemblGenomes-Gn; EBG00001021173.
DR   EnsemblGenomes-Gn; EBG00001021174.
DR   EnsemblGenomes-Gn; EBG00001021175.
DR   EnsemblGenomes-Gn; EBG00001021176.
DR   EnsemblGenomes-Gn; EBG00001021177.
DR   EnsemblGenomes-Gn; EBG00001021178.
DR   EnsemblGenomes-Gn; EBG00001021179.
DR   EnsemblGenomes-Gn; EBG00001021180.
DR   EnsemblGenomes-Gn; EBG00001021181.
DR   EnsemblGenomes-Gn; EBG00001021182.
DR   EnsemblGenomes-Gn; EBG00001021183.
DR   EnsemblGenomes-Gn; Rpdx1_R0001.
DR   EnsemblGenomes-Gn; Rpdx1_R0002.
DR   EnsemblGenomes-Gn; Rpdx1_R0003.
DR   EnsemblGenomes-Gn; Rpdx1_R0004.
DR   EnsemblGenomes-Gn; Rpdx1_R0005.
DR   EnsemblGenomes-Gn; Rpdx1_R0006.
DR   EnsemblGenomes-Gn; Rpdx1_R0007.
DR   EnsemblGenomes-Gn; Rpdx1_R0008.
DR   EnsemblGenomes-Gn; Rpdx1_R0009.
DR   EnsemblGenomes-Gn; Rpdx1_R0010.
DR   EnsemblGenomes-Gn; Rpdx1_R0011.
DR   EnsemblGenomes-Gn; Rpdx1_R0012.
DR   EnsemblGenomes-Gn; Rpdx1_R0013.
DR   EnsemblGenomes-Gn; Rpdx1_R0014.
DR   EnsemblGenomes-Gn; Rpdx1_R0015.
DR   EnsemblGenomes-Gn; Rpdx1_R0016.
DR   EnsemblGenomes-Gn; Rpdx1_R0017.
DR   EnsemblGenomes-Gn; Rpdx1_R0018.
DR   EnsemblGenomes-Gn; Rpdx1_R0019.
DR   EnsemblGenomes-Gn; Rpdx1_R0020.
DR   EnsemblGenomes-Gn; Rpdx1_R0021.
DR   EnsemblGenomes-Gn; Rpdx1_R0022.
DR   EnsemblGenomes-Gn; Rpdx1_R0023.
DR   EnsemblGenomes-Gn; Rpdx1_R0024.
DR   EnsemblGenomes-Gn; Rpdx1_R0025.
DR   EnsemblGenomes-Gn; Rpdx1_R0026.
DR   EnsemblGenomes-Gn; Rpdx1_R0027.
DR   EnsemblGenomes-Gn; Rpdx1_R0028.
DR   EnsemblGenomes-Gn; Rpdx1_R0029.
DR   EnsemblGenomes-Gn; Rpdx1_R0030.
DR   EnsemblGenomes-Gn; Rpdx1_R0031.
DR   EnsemblGenomes-Gn; Rpdx1_R0032.
DR   EnsemblGenomes-Gn; Rpdx1_R0033.
DR   EnsemblGenomes-Gn; Rpdx1_R0034.
DR   EnsemblGenomes-Gn; Rpdx1_R0035.
DR   EnsemblGenomes-Gn; Rpdx1_R0036.
DR   EnsemblGenomes-Gn; Rpdx1_R0037.
DR   EnsemblGenomes-Gn; Rpdx1_R0038.
DR   EnsemblGenomes-Gn; Rpdx1_R0039.
DR   EnsemblGenomes-Gn; Rpdx1_R0040.
DR   EnsemblGenomes-Gn; Rpdx1_R0041.
DR   EnsemblGenomes-Gn; Rpdx1_R0042.
DR   EnsemblGenomes-Gn; Rpdx1_R0043.
DR   EnsemblGenomes-Gn; Rpdx1_R0044.
DR   EnsemblGenomes-Gn; Rpdx1_R0045.
DR   EnsemblGenomes-Gn; Rpdx1_R0046.
DR   EnsemblGenomes-Gn; Rpdx1_R0047.
DR   EnsemblGenomes-Gn; Rpdx1_R0048.
DR   EnsemblGenomes-Gn; Rpdx1_R0049.
DR   EnsemblGenomes-Gn; Rpdx1_R0050.
DR   EnsemblGenomes-Gn; Rpdx1_R0051.
DR   EnsemblGenomes-Gn; Rpdx1_R0052.
DR   EnsemblGenomes-Gn; Rpdx1_R0053.
DR   EnsemblGenomes-Gn; Rpdx1_R0054.
DR   EnsemblGenomes-Gn; Rpdx1_R0055.
DR   EnsemblGenomes-Gn; Rpdx1_R0056.
DR   EnsemblGenomes-Gn; Rpdx1_R0057.
DR   EnsemblGenomes-Gn; Rpdx1_R0058.
DR   EnsemblGenomes-Gn; Rpdx1_R0059.
DR   EnsemblGenomes-Gn; Rpdx1_R0060.
DR   EnsemblGenomes-Tr; EBT00001624025.
DR   EnsemblGenomes-Tr; EBT00001624026.
DR   EnsemblGenomes-Tr; EBT00001624027.
DR   EnsemblGenomes-Tr; EBT00001624028.
DR   EnsemblGenomes-Tr; EBT00001624029.
DR   EnsemblGenomes-Tr; EBT00001624030.
DR   EnsemblGenomes-Tr; EBT00001624031.
DR   EnsemblGenomes-Tr; EBT00001624032.
DR   EnsemblGenomes-Tr; EBT00001624033.
DR   EnsemblGenomes-Tr; EBT00001624034.
DR   EnsemblGenomes-Tr; EBT00001624035.
DR   EnsemblGenomes-Tr; EBT00001624036.
DR   EnsemblGenomes-Tr; EBT00001624037.
DR   EnsemblGenomes-Tr; EBT00001624038.
DR   EnsemblGenomes-Tr; EBT00001624039.
DR   EnsemblGenomes-Tr; EBT00001624040.
DR   EnsemblGenomes-Tr; EBT00001624041.
DR   EnsemblGenomes-Tr; EBT00001624042.
DR   EnsemblGenomes-Tr; EBT00001624043.
DR   EnsemblGenomes-Tr; EBT00001624044.
DR   EnsemblGenomes-Tr; EBT00001624045.
DR   EnsemblGenomes-Tr; EBT00001624046.
DR   EnsemblGenomes-Tr; EBT00001624047.
DR   EnsemblGenomes-Tr; EBT00001624048.
DR   EnsemblGenomes-Tr; EBT00001624049.
DR   EnsemblGenomes-Tr; EBT00001624050.
DR   EnsemblGenomes-Tr; EBT00001624051.
DR   EnsemblGenomes-Tr; EBT00001624052.
DR   EnsemblGenomes-Tr; EBT00001624053.
DR   EnsemblGenomes-Tr; EBT00001624054.
DR   EnsemblGenomes-Tr; EBT00001624055.
DR   EnsemblGenomes-Tr; EBT00001624056.
DR   EnsemblGenomes-Tr; EBT00001624057.
DR   EnsemblGenomes-Tr; EBT00001624058.
DR   EnsemblGenomes-Tr; EBT00001624059.
DR   EnsemblGenomes-Tr; EBT00001624060.
DR   EnsemblGenomes-Tr; EBT00001624061.
DR   EnsemblGenomes-Tr; EBT00001624062.
DR   EnsemblGenomes-Tr; EBT00001624063.
DR   EnsemblGenomes-Tr; EBT00001624064.
DR   EnsemblGenomes-Tr; EBT00001624065.
DR   EnsemblGenomes-Tr; EBT00001624066.
DR   EnsemblGenomes-Tr; EBT00001624067.
DR   EnsemblGenomes-Tr; EBT00001624068.
DR   EnsemblGenomes-Tr; EBT00001624069.
DR   EnsemblGenomes-Tr; EBT00001624070.
DR   EnsemblGenomes-Tr; EBT00001624071.
DR   EnsemblGenomes-Tr; EBT00001624072.
DR   EnsemblGenomes-Tr; EBT00001624073.
DR   EnsemblGenomes-Tr; EBT00001624074.
DR   EnsemblGenomes-Tr; EBT00001624075.
DR   EnsemblGenomes-Tr; EBT00001624076.
DR   EnsemblGenomes-Tr; EBT00001624077.
DR   EnsemblGenomes-Tr; EBT00001624078.
DR   EnsemblGenomes-Tr; EBT00001624079.
DR   EnsemblGenomes-Tr; EBT00001624080.
DR   EnsemblGenomes-Tr; EBT00001624081.
DR   EnsemblGenomes-Tr; EBT00001624082.
DR   EnsemblGenomes-Tr; EBT00001624083.
DR   EnsemblGenomes-Tr; EBT00001624084.
DR   EnsemblGenomes-Tr; EBT00001624085.
DR   EnsemblGenomes-Tr; EBT00001624086.
DR   EnsemblGenomes-Tr; EBT00001624087.
DR   EnsemblGenomes-Tr; EBT00001624088.
DR   EnsemblGenomes-Tr; EBT00001624089.
DR   EnsemblGenomes-Tr; EBT00001624090.
DR   EnsemblGenomes-Tr; EBT00001624091.
DR   EnsemblGenomes-Tr; EBT00001624092.
DR   EnsemblGenomes-Tr; EBT00001624093.
DR   EnsemblGenomes-Tr; EBT00001624094.
DR   EnsemblGenomes-Tr; EBT00001624095.
DR   EnsemblGenomes-Tr; EBT00001624096.
DR   EnsemblGenomes-Tr; Rpdx1_R0001-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0002-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0003-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0004-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0005-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0006-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0007-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0008-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0009-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0010-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0011-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0012-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0013-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0014-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0015-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0016-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0017-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0018-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0019-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0020-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0021-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0022-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0023-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0024-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0025-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0026-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0027-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0028-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0029-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0030-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0031-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0032-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0033-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0034-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0035-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0036-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0037-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0038-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0039-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0040-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0041-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0042-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0043-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0044-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0045-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0046-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0047-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0048-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0049-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0050-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0051-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0052-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0053-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0054-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0055-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0056-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0057-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0058-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0059-1.
DR   EnsemblGenomes-Tr; Rpdx1_R0060-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01723; Rhizobiales-2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01736; flg-Rhizobiales.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002418.
DR   SILVA-SSU; CP002418.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086172
CC   Source DNA and organism available from Caroline S. Harwood
CC   (csh5@u.washington.edu)
CC   Contacts: Caroline S. Harwood (csh5@u.washington.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Rhodopseudomonas palustris DX-1
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Fresh water, Soil
CC   num_replicons       :: 1
CC   ref_biomaterial     :: Missing
CC   biotic_relationship :: Free living
CC   trophic_level       :: Phototroph
CC   rel_to_oxygen       :: Facultative
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi03248
CC   Greengenes ID       :: 246026
CC   Funding Program     :: DOE-CSP 2009
CC   Gene Calling Method :: JGI -ORNL annotation pipeline
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5404117
FT                   /organism="Rhodopseudomonas palustris DX-1"
FT                   /strain="DX-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:652103"
FT   gene            167..1576
FT                   /locus_tag="Rpdx1_0001"
FT   CDS_pept        167..1576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   bbt:BBta_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41646"
FT                   /db_xref="GOA:E6VE33"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE33"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADU41646.1"
FT                   /translation="MEQDRWSRVKGRLRSSVGEDVYSSWFARMDLESVQDESVHLSVPT
FT                   RFLKSWIQTHYSDKVLSCWQAELPDVNRIDVTVRSPARCSAPAKEAPAQVESRRDEQKS
FT                   AAERSNGATPVSANHDALGGSPLDPRLTFASFVVGRSNTLAHAAAKQVAEGRRGDPVMF
FT                   NPLYIHSGVGLGKTHLLQAVTWAGNAGSERKVLYLTAEKFMYGFVAALKTQTSLAFKEA
FT                   LRGIDVLVIDDLQFLQGKTTQAEFCHTLNALIDAGRQVVVAADRPPSDLESLDERVRSR
FT                   LAGGLVVEMAPLGEDLRLGILRSRVVAARAHHVSFDVPQPVLEYLARTITHNGRDLEGA
FT                   INRLLAHSKLNNQPVTLEMAEHEVRDLIRPSEPKRIKIEDIQRIVARQYNVSRSDLLSS
FT                   RRTANVVRPRQVAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKIEGLVSKDNTLSD
FT                   EVESLKRQLQE"
FT   gene            1821..2939
FT                   /locus_tag="Rpdx1_0002"
FT   CDS_pept        1821..2939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: nha:Nham_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41647"
FT                   /db_xref="GOA:E6VE34"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE34"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADU41647.1"
FT                   /translation="MKVTVERAQLLKSLSHVHRVVERRNTIPILGNVLVRAENAQLALK
FT                   ATDLDLEVTETLPAETATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSVLAIRAGR
FT                   SRFTLQTLPESDFPDLAAGEMSHAFRLPASDVKRLIDRTQFAISTEETRYYLNGIYLHT
FT                   AGSSGAASLRAVATDGHRLAQLDLTLPSGADGMPGVIVPRKTVGEVQRLIEDTEAEIGI
FT                   ELSTGKIRFTLGNVVLTSKLIDGTFPDYGRVIPQNNDKELLVDKKDFEAAVDRVSTISS
FT                   ERGRAVKLALSAGKLVLSVTNPDSGSATEELEVEYASDPLDIGFNSRYLLDIAAQIEGE
FT                   VAVLRLADPGSPTLIQDRDSKSALYVLMPMRV"
FT   gene            3081..4265
FT                   /locus_tag="Rpdx1_0003"
FT   CDS_pept        3081..4265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: bra:BRADO0003 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41648"
FT                   /db_xref="GOA:E6VE35"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE35"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADU41648.1"
FT                   /translation="MPVAVPCNSPKASYCMIAARITRLTLTHFRNYRSASLTTTADQVV
FT                   LVGPNGAGKTNCLEAVSLLSPGRGLRRARLEDIAGHEGDGSWAVSAEVEGALGLATLGT
FT                   GIEPPRGDVATTRRCRIDREPVGSAAAFGDHLRMVWLTPSMDGLFMGAASERRRFFDRL
FT                   VLAIDSGHSARVSALDRSLRSRNRLLEDIRNADSHWLDAIERETAELAIAVAAQRGQTA
FT                   TKLAAMIDARGATSAFPSARIMLDGWMESALASEPATVVEDRYRAVLRDNRSRDAAAGR
FT                   TLDGPHLTDLEVIYAPKAMPAREASTGEQKALLIGLVLAHAQLVAETTSITPLLLLDEV
FT                   VAHLDPGRRAALFGELSRLGAQVWMTGADPLAFAEIGPAAAIFDVDNGRISARG"
FT   gene            4482..6923
FT                   /locus_tag="Rpdx1_0004"
FT   CDS_pept        4482..6923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: nha:Nham_0004 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM domain
FT                   protein; DNA gyrase subunit B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41649"
FT                   /db_xref="GOA:E6VE36"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE36"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADU41649.1"
FT                   /translation="MTEPARQPSAESVHPAPAEYGAESIRVLKGLDAVRKRPGMYIGDT
FT                   DDGSGLHHMVYEVVDNAIDEALAGHASAVEVILNADGSVTVRDDGRGIPVDIHKGEGIS
FT                   AAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSSKLILRVWRDGKEHYIEFAHG
FT                   DAVAPLSVVGDAGGRRGTEVTFYASSETFTNVEYDFATLEHRLRELAFLNSGVNILLSD
FT                   LRHAVEKREEMRYEGGVTEFVKYLDRNKKPIVPTPIVVAADLNGIAVEAALWWNDTYHE
FT                   NVLCFTNNIPQRDGGTHLAGFRAALTRQLTGYADNNAKKEKVALTGDDCREGLTAVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPVVENVLNEALAAWFEEHPSEAKTIVGKVIEAAAAREA
FT                   ARKARELTRRKGALDIASLPGKLADCQERDPSKSELFIVEGDSAGGSAKQGRNREFQAV
FT                   LPLRGKILNVERARFDKMLSSEQIGTLITALGTGIGRDDFDIGKLRYHKIILMTDADVD
FT                   GAHIRTLLLTFFFRQMPALIEGGYLYIAQPPLYKVTRGKSEQYLKDERALEDYLIATGL
FT                   DDCVFKLATGEERGRRDLLKLVEDARAIRSTLNNLHSRYNRSVVEQAAIAGVLSPRVTA
FT                   DIATANEAAAYIARRLDALADEVERGWIGRFTEGEGFAFERTVRGVKEVAAIDDALLGS
FT                   ADARKLDEYAAVLQEVYPRPGVLRRKDAETAIHGPISLFEAVTDAGRKGVALQRYKGLG
FT                   EMNPGQLWETTLDTNARSLLQVKVREVDEADDIFTKLMGDVVEPRREFIQENSLHATVD
FT                   V"
FT   gene            7604..9301
FT                   /locus_tag="Rpdx1_0005"
FT   CDS_pept        7604..9301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0005"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: mag:amb3054 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41650"
FT                   /db_xref="GOA:E6VE37"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE37"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADU41650.1"
FT                   /translation="MKSTHGTHSWSLGLVPRIILLSVFGVLLLGVTVTAVAWKVLADAA
FT                   TDAARERVETNIRVAWDTVKANGSAFSRADNKLTVGNRVLNDDFATVDKIKSLVGGTAT
FT                   IFMNDQRVATNVMKPDGTRAVGTRLAPGPAYTTVLENRQPFRGEVAILGEPYMTAYDPI
FT                   VDAGGNVIGILYVGIKKADFEAAAYQTLWTIAAATLAVALLAVLASFAVVRGTIARPLR
FT                   AAIATMQRLAAGDLATETPQPHRQDEIGEILKALAVFKEHGLEVERLRCEQEKAKARAE
FT                   MERRTEMMRLATEFEGAVGEIVGTVSSSANELEASAGSLTGTATRSRQLAMAVSSAAEE
FT                   ASTNVQSVASATEEMASSVNEISRQVQESARIAQEAVEQAHLTNDRVADLSKAAARIGD
FT                   VVELINTIAGQTNLLALNATIEAARAGDAGRGFAVVASEVKALAEQTARATGEIGQQIS
FT                   GIQTATDESVAAIRDISGTIGRMAEIASTIASAVEEQGAATQEIARNVQMAAHGTTQVS
FT                   SNIGHVRDGAEETGEASNEVLSAAKSLSQDSDRLKTEVTRFLETVRAA"
FT   gene            complement(9356..10804)
FT                   /locus_tag="Rpdx1_0006"
FT   CDS_pept        complement(9356..10804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0006"
FT                   /product="signal transduction histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: HWE histidine
FT                   kinase; PAS fold-4 domain protein; KEGG: rru:Rru_A2544
FT                   signal transduction histidine kinase; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41651"
FT                   /db_xref="GOA:E6VE38"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE38"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADU41651.1"
FT                   /translation="MTSAISALSRAELEARLEEAEETLRAIRDGEIDAVVVRGADAEQV
FT                   FTLEGGGQSYRTFMEAMDVGAAAFDQDGQLLYANQALCAQLDCAHGSLTATALIELLDP
FT                   VKQAAFRRLLAQAQHQRQSAEIHLRVGDAERSMLLTGTPLEFGVVRGAAITFTDISERE
FT                   QAAAARESERLARAILASANEAVIVCDRAGCVTHLNGAAMRICAEAPVGKTFAEAIALS
FT                   FPEASELMSSDDIVAMATAGLPVQGLEAAVRTPSAAITDVMISAAPLLVSGERTQGCVV
FT                   TLVDLSQRKAAERHQALLMGELDHRVKNTLTMVMAICARTAVHERTIEDFQKSFTGRIQ
FT                   ALAATHTLLSNASWQSLQIRDVLAAELAPFASLSSGRIVTDGLDIAVEAKTAVSLGLVF
FT                   HELTTNAVKYGALSVPSGRISVRQVAAGDDALTIEWQEHDGPPVTPPQTSGFGQTLISR
FT                   SLGSGGAALEFRSDGVVCRIAVPK"
FT   gene            complement(10801..11085)
FT                   /locus_tag="Rpdx1_0007"
FT   CDS_pept        complement(10801..11085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0007"
FT                   /product="KaiB domain protein"
FT                   /note="PFAM: KaiB domain protein; KEGG: rru:Rru_A2543 KaiB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41652"
FT                   /db_xref="GOA:E6VE39"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE39"
FT                   /inference="protein motif:PFAM:PF07689"
FT                   /protein_id="ADU41652.1"
FT                   /translation="MADPIKLVLYVAGETPKSLAAIRNLEKICAEHLAGKYKVEVIDLK
FT                   KSPQLAREHGIVAIPTLVKELPVPIRKIIGDLSDTPKVLVHLAVEESSS"
FT   gene            complement(11095..12786)
FT                   /locus_tag="Rpdx1_0008"
FT   CDS_pept        complement(11095..12786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0008"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /EC_number="2.7.11.1"
FT                   /note="PFAM: Circadian clock protein KaiC central region;
FT                   KEGG: rsk:RSKD131_4430 circadian clock protein KaiC; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41653"
FT                   /db_xref="GOA:E6VE40"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE40"
FT                   /inference="protein motif:PRIAM:2.7.11.1"
FT                   /protein_id="ADU41653.1"
FT                   /translation="MVDGISKALTGIEGFDDLTLGGLPTGRPSLVCGSAGCGKTLFAST
FT                   FLINGARLYGEPGVFVTFEERAVDIVDNVASLGFDLQGLIEQERILIEHIALDPTEVAE
FT                   VGDYDLEALFLRLEFAVDQIGAKRIVLDTIESLFSAFQNPAVLRAEIRRLFDWLKQKGL
FT                   TAVITGERGDGSLTRQGLEEYVSDCVILLDHRVDSQISTRRLRIVKYRGTAHGTNEYPF
FT                   LIDEEGFSVLPVSSLALSHTVHEDRISTGVADLDAMLSGGGFYRGTSVLVSGVAGSGKS
FT                   SLACMMADAACRRGDRALYLSFEESEAQTVRNMKSVGTDLGRWLSSGQLRYIAARPTFY
FT                   SLEMHLAVMLREVARFKPDLVVLDPISAFTESGQVGEVQSMLLRMVDYLKSNGITGVFT
FT                   HLAHGAQTETDAGLSSLMDAWILLLNREAHGEFNRELYLLKARGIAHSNQVREFVMSAD
FT                   GIHLLPPYLGEGGALTGSARRAEEAKARRAESERRTEVARLQAQIEQRRRRARAQIEAI
FT                   QADLAADEAELNRLTQAEVSFRAQSERDVAEMERSRGVIGSPGGTE"
FT   gene            complement(13021..14100)
FT                   /locus_tag="Rpdx1_0009"
FT   CDS_pept        complement(13021..14100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0009"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   bja:bll4376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41654"
FT                   /db_xref="GOA:E6VE41"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE41"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADU41654.1"
FT                   /translation="MHAAAVRRDDPAGEPKADDRADVSALVARLTSEVNEIACGKTRTI
FT                   QKITSQMKILALNALIESARAGKHGAGFAIVAQEVRNVGAQIEQIARDLETQLTRRTGE
FT                   LIDSIDNMTERSRGDRLVDLALNAVELIDRNLYERTCDVRWWATDSAVVDCAADPSRKA
FT                   GAHASERMGVILSAYTVYLDLWLCGLDGTVLANGRPDRFAVAGNNVAGQAWFKEAQRLR
FT                   SGDDYVAGNIERSPLLGGAQVATYCASVRADGRSSGAPLGILAIHFDWEAQARAIVQGV
FT                   RVDDPERTRVLLLDADRRVIASSDGRGILDERFPLQSAHRTCGTYRDGGGALVGFHVTP
FT                   GYETYQGLGWYGVIVSRHD"
FT   gene            complement(14363..14872)
FT                   /locus_tag="Rpdx1_0010"
FT   CDS_pept        complement(14363..14872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0010"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: bja:blr8125 transcriptional regulatory
FT                   protein; PFAM: Transcription regulator AsnC-type-like;
FT                   SMART: Transcription regulator AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41655"
FT                   /db_xref="GOA:E6VE42"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE42"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADU41655.1"
FT                   /translation="MADTDVGVVEPGRRLDAIDRKILTVLQQDASLSVAEIGDRVGLSS
FT                   TPCWKRIQRLEADGVIIKRVALVDQDKIGLGLSVFVSIESGDHSDAWLKTFADAVSAMP
FT                   EVIEFYRMAGDVDYMLRVVVADMRAYDQFYKRLIGTVPLKNVTSRFAMEKIKSVTALPV
FT                   PPMPVS"
FT   gene            complement(15182..15391)
FT                   /locus_tag="Rpdx1_0011"
FT   CDS_pept        complement(15182..15391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_2219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41656"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE43"
FT                   /inference="similar to AA sequence:KEGG:BBta_2219"
FT                   /protein_id="ADU41656.1"
FT                   /translation="MSHAFIIEVDSRAAGIVVRDGRSFRFHAACDDFSGLEGQGFRSPG
FT                   DAQKAAVRHLGAYPAGRSPKLKVA"
FT   gene            complement(15532..15783)
FT                   /locus_tag="Rpdx1_0012"
FT   CDS_pept        complement(15532..15783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_3641 glutathione S-transferase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41657"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE44"
FT                   /inference="similar to AA sequence:KEGG:Vapar_3641"
FT                   /protein_id="ADU41657.1"
FT                   /translation="MAMLAYDDRPRITALSEAGARSAAGPAPDPAAAVSAAVDAPVEPD
FT                   DEVQERWLQAQPWPRRWFARFYRALRKLQPAFPPMSCC"
FT   gene            complement(15785..15970)
FT                   /locus_tag="Rpdx1_0013"
FT   CDS_pept        complement(15785..15970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0013"
FT                   /product="cytochrome oxidase maturation protein, cbb3-type"
FT                   /note="KEGG: bra:BRADO2445 nitrogen fixation protein FixS;
FT                   TIGRFAM: cytochrome oxidase maturation protein, cbb3-type;
FT                   PFAM: cytochrome oxidase maturation protein cbb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41658"
FT                   /db_xref="GOA:E6VE45"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE45"
FT                   /inference="protein motif:TFAM:TIGR00847"
FT                   /protein_id="ADU41658.1"
FT                   /translation="MEVMVILVPLALALGLLGLIAFLWSLKSGQYDDLDGAAWRAIADD
FT                   ESPLPPPAETPAEKRG"
FT   gene            complement(15961..18159)
FT                   /locus_tag="Rpdx1_0014"
FT   CDS_pept        complement(15961..18159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0014"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="KEGG: bbt:BBta_2797 nitrogen fixation protein FixI;
FT                   TIGRFAM: copper-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41659"
FT                   /db_xref="GOA:E6VE46"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE46"
FT                   /inference="protein motif:TFAM:TIGR01511"
FT                   /protein_id="ADU41659.1"
FT                   /translation="MLQTRDFSHYVKDVDGRIVHLDLAVEGVHCASCMAKIERGLQSIP
FT                   DVTLARVNLTDRRLAVEWNKGSALEPGQFIDRLAELGYKAYPYEPVRAEVEEAERTRFL
FT                   LRCLGVAAFATMNVMMLSVPVWYGGDLSPEARDFFHWLSALVALPCAAYAGQPFFQSAY
FT                   RALKAKSVNMDVPITIGITLALGMSLVETINHAEHAYFDAAVMLIAFLLAGRVLDQKMR
FT                   QKTRAVAGNLAALKAETATKFVGPDEISEVPIAAVRAGDIVLLRPGERCSVDGTVIEGR
FT                   SEIDQSLITGETLYVPASQGTQVYAGTLNISGTLRVRVAAAAEGTLLAEITRLLDHALQ
FT                   ARSRYVQLADRASRLYAPVVHIAALLTVFGWVLAGASWHDSIVIGIAVLIITCPCALGL
FT                   AIPAVQTVASGAMFRAGVLLNSGDAIERASAVDTIVFDKTGTLTLPELDVVNAASVPPE
FT                   AFELAGRLALASHHPVAAAVARAAQAKAPLPGVVEEPGRGVRAIFDGEELRLGSPAFCG
FT                   ADSEANAVLSEDPEVSVVAFSRGDQRLVFAVRQLLRPDAAKTIDALRNRGISVELLSGD
FT                   REPAVRHAAEALGVGAWRAAVTPAEKIAHIEELKAKGRNVMMVGDGMNDAPSLAAAHVS
FT                   MSPISATHLSQATADLVFLGKELAPVLAAVDYSRKAMAVMRENLGLAIGYNILAVPIAI
FT                   AGYATPLIAALAMSGSSVLVMLNAMRARRVRRGGASWK"
FT   gene            complement(18194..18694)
FT                   /locus_tag="Rpdx1_0015"
FT   CDS_pept        complement(18194..18694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0015"
FT                   /product="FixH family protein"
FT                   /note="PFAM: FixH family protein; KEGG: bra:BRADO2443
FT                   nitrogen fixation protein FixH"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41660"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="InterPro:IPR018037"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE47"
FT                   /inference="protein motif:PFAM:PF05751"
FT                   /protein_id="ADU41660.1"
FT                   /translation="MSRSQSSPRPLTGKVVLAVLVAFFGVVFGVNGLMMTLAIKTLPGT
FT                   EVDSAYAASLAYEREILAARDQDQRGWKVDAKLERKPNGAAVLQVEARDKVGLPLAGLS
FT                   FYGRLERPSDKRFDREVTLAEVGAGVYRGDADSVLPGRWDLVLEGDKNGIRLFLSKNRL
FT                   MLD"
FT   sig_peptide     complement(18605..18694)
FT                   /locus_tag="Rpdx1_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.787 at
FT                   residue 30"
FT   gene            complement(18714..20171)
FT                   /locus_tag="Rpdx1_0016"
FT   CDS_pept        complement(18714..20171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0016"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="TIGRFAM: cytochrome c oxidase accessory protein
FT                   CcoG; KEGG: bbt:BBta_2795 nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41661"
FT                   /db_xref="GOA:E6VE48"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE48"
FT                   /inference="protein motif:TFAM:TIGR02745"
FT                   /protein_id="ADU41661.1"
FT                   /translation="MNKPLRATDLQPDDDGPLYTAQKKIYPQSVTGPFRRIKWILMAVC
FT                   LGIYYFLPFVRWNRGLGAPDQAVLIDLANNRFYFFAIELWPQEIYYFTGLLIVAAIVLF
FT                   LMNSLGGRVWCGYLCPQTVWTDLFYAVERFVEGDRRERMRKAGEGFKLQRAAELALKHS
FT                   IWLMIAWWTGGAWVLYFADAPTLIKELVTFDAPMVAYIWIGILTFTTYTLAGFMREQVC
FT                   VYMCPWPRIQAALTDEWALNVTYKYDRGEKRSSLKKAAQLRALGEPVGDCVDCNQCVAV
FT                   CPTGIDIRNGPQLDCIQCGLCIDACDNVMKKIGRPTRLIGYDNDINIHRRMEGKPEIFK
FT                   PIRARTVIYTVIIVAIGGAMLYKLANRTLLDVNVLHDRNPVAVRLSDGSVRNGYTVRFL
FT                   NKRGFDRVVAIDVEGPPNAVIHVVGSDSITPDRPMIILGRDTTTELRVLVDSNSADDTP
FT                   QSVPVTFHVTDIGLGEVASTKDVFVTP"
FT   gene            complement(20284..21165)
FT                   /locus_tag="Rpdx1_0017"
FT   CDS_pept        complement(20284..21165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0017"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit III"
FT                   /note="KEGG: bra:BRADO2441 cytochrome-c oxidase FixP chain;
FT                   TIGRFAM: cytochrome c oxidase, cbb3-type, subunit III;
FT                   PFAM: cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41662"
FT                   /db_xref="GOA:E6VE49"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE49"
FT                   /inference="protein motif:TFAM:TIGR00782"
FT                   /protein_id="ADU41662.1"
FT                   /translation="MADHSHHVEIDKVTGTATTGHEWDGIKELNTPLPRWWIWTFYATI
FT                   IWSIGYFIVYPAWPMVNGYTRGLFGYSSRAELDVDLAKLDQVRGEKMQALATASLEEIE
FT                   KNPALLALARAKGKVVFGDNCAPCHGSGAAGGKGYPNLNDDDWLWGGTLEQIEKTIKFG
FT                   ARSGHDDGHMGNMLAFGKDGVLTKEQIVEVANYVRSLSGLSTRPGVDLAAGKQVFADNC
FT                   VACHGDDAKGNQELGAPNLTDRIWLYGSDEATIIDTVTNGRAGVMPAWIGRLDPTTIKA
FT                   MAVYVHSLGGGK"
FT   gene            complement(21173..21337)
FT                   /locus_tag="Rpdx1_0018"
FT   CDS_pept        complement(21173..21337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO2440 cytochrome oxidase subunit,
FT                   FixQ"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41663"
FT                   /db_xref="GOA:E6VE50"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE50"
FT                   /inference="similar to AA sequence:KEGG:BRADO2440"
FT                   /protein_id="ADU41663.1"
FT                   /translation="MKAIIYFDNIASSLVTTWWTPLFVAIFVAIVAYALWPKNKKAFDE
FT                   AAQMPLRED"
FT   gene            complement(21347..22081)
FT                   /locus_tag="Rpdx1_0019"
FT   CDS_pept        complement(21347..22081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0019"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /note="KEGG: bbt:BBta_2793 cytochrome-c oxidase FixO chain;
FT                   TIGRFAM: cytochrome c oxidase, cbb3-type, subunit II; PFAM:
FT                   cytochrome C oxidase mono-heme subunit/FixO"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41664"
FT                   /db_xref="GOA:E6VE51"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE51"
FT                   /inference="protein motif:TFAM:TIGR00781"
FT                   /protein_id="ADU41664.1"
FT                   /translation="MSIWARHKIFETNSVVLIVGILIVVAIGGLVEITPLFYLKSTIEK
FT                   VDGVRPYTPLELAGRNVYIREGCYLCHSQMIRPLRDEIERYGHYSLAAESMYDHPFQWG
FT                   SKRTGPDLARVGGKYSDDWHVAHLKNPRSIVPQSVMPAYAFLGQNKVDLTSLSDHLKTN
FT                   RTLGVPYSDEDIAKAASDAKAQVDPDGAEAADLVKRYPKAVVRNFDGQTGDPTELDALV
FT                   AYLQMLGTLVDFKLYDGKANLR"
FT   gene            complement(22094..23740)
FT                   /locus_tag="Rpdx1_0020"
FT   CDS_pept        complement(22094..23740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0020"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit I;
FT                   KEGG: bja:blr2763 cytochrome-c oxidase; PFAM: cytochrome c
FT                   oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41665"
FT                   /db_xref="GOA:E6VE52"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE52"
FT                   /inference="protein motif:TFAM:TIGR00780"
FT                   /protein_id="ADU41665.1"
FT                   /translation="MNQALNSKRITLGEGGLTVVFALTTILSIYAAMFAKDAPFAFHAS
FT                   LAAACSAWAVFAIIVRYRSRSGLPPQEINGVPNYNFGPIKFMAFMAMFWGIAGFTAGLY
FT                   IALELAYPGLNVAQWVNFGRLRPLHTSAVIFAFGGNVLLATSFYVVQKTTRARLAGDLA
FT                   PWFVALGYNFFIVIAGTGYLLGVTQSKEYAEPEWYADLWLTIVWVTYLLVFLATLMKRK
FT                   EPHIYVANWFYLAFIITIAVLHLGNNPTLPVSFLGSKSYIAWSGVQDAMFQWWYGHNAV
FT                   GFFLTAGFLGIMYYFIPKRAERPVYSYRLSIIHFWALIFLYIWAGPHHLHYTALPDWTQ
FT                   TLGMTFSIMLWMPSWGGMINGLMTLSGAWDKLRTDPVLRMMVVSVAFYGMSTFEGPMMA
FT                   IKAVNSLSHYTDWTIGHVHSGALGWVGFVSFGALYCLVPWVWGRKQLYSIRLVNWHFWI
FT                   ATLGIVLYISAMWVSGILQGLMWRAYTSLGFLEYSFIESVEAMHPFYAIRAAGGGLFLI
FT                   GALIMAYNLWMTVRVGERSEAQPRVALQPAE"
FT   gene            complement(24039..24776)
FT                   /locus_tag="Rpdx1_0021"
FT   CDS_pept        complement(24039..24776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0021"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bra:BRADO0329 putative acetoin(diacetyl) reductase (acetoin
FT                   dehydrogenase) (AR) (meso-2,3-butanediol dehydrogenase);
FT                   oxidoreductase, short chain dehydrogenase; putative short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41666"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE53"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU41666.1"
FT                   /translation="MQPRNATVAVIGAGDYIGAEIAKKFAAEGFTVFAGRRNGDKLAPL
FT                   VAEIEAAGGKIVARSLDARKEDEVTAFLNDADAHAPLEVTIFNVGANVNFPILDTTDRV
FT                   FRKVWEMACWAGFVSGRESARLMLARGQGKIFFTGATASLRGGSGFAAFASAKFGLRAV
FT                   AQSMARELMPKNIHIAHLIIDSGVDTAWVRERREQVFGTDALANPDLLMPPAAVAGAYW
FT                   QLYQQPKSAWTFEMEIRPYGEKW"
FT   gene            complement(24896..25498)
FT                   /locus_tag="Rpdx1_0022"
FT   CDS_pept        complement(24896..25498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0022"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bja:blr0588
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41667"
FT                   /db_xref="GOA:E6VE54"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE54"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADU41667.1"
FT                   /translation="MTQPAPQFLFDFGSPNAFLAHEAIPAIERRIGVKFDYVPVLLGGI
FT                   FKATNNKSPAETLAGIKNKREFHALETERFLKRYAVKPYVWNPHFPVNTLNLMRAAVAA
FT                   QLDGVFDKYVEAAFHHMWVEPKKMDDLEVAAAALSSSGLDGKALLTRAQEPDVKAKLIA
FT                   NTEDAVQRGAFGSPTFFVGKEMFFGKEQLRDVEEMYG"
FT   gene            25714..26382
FT                   /locus_tag="Rpdx1_0023"
FT   CDS_pept        25714..26382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0023"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bja:bll0585 glutathione S-transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41668"
FT                   /db_xref="GOA:E6VE55"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE55"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADU41668.1"
FT                   /translation="MLTVHHLNNSRSQRVLWLLEELGTPYEIKRYQRQPDMMAPKELRA
FT                   VHPLGKSPVITDNGNTVAESGAIIEYIVGTYGDGRLIPPPNTPERLRYTYWLHYAEGSA
FT                   MPPLLLKLLFSMMPKRAPALVRPLVKMVASGALTGFVDPQLKLHMDYWESELGKAAYFA
FT                   GDEFTAADIQMSFPLEAAASRGGLDQRYPKALAWLERIHARPAYNRALEKGGPYEIGKA
FT                   "
FT   gene            complement(26505..27380)
FT                   /locus_tag="Rpdx1_0024"
FT   CDS_pept        complement(26505..27380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0024"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   oca:OCAR_4340 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41669"
FT                   /db_xref="GOA:E6VE56"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE56"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU41669.1"
FT                   /translation="MASLQGKTLFITGASRGIGLAIALRAARDGANVAIAAKTTEPHPK
FT                   LKGTIYTAAEEIVAAGGKALPLVCDIRDEAQVIDAIGKTVAEFGGIDICVNNASAISLT
FT                   NSQATEMKRYDLMMGINTRGTFMVSKYCIPHLKKAANPHILMLSPPLDMKAKWFAASTA
FT                   YTMAKFGMSMVALGLSGELKHAGVAVNALWPRTTIATAAVGNLLGGDAMIRASRTPEIM
FT                   GDAAHAILTKPSREFTGQFCIDDSVLYESGVRDFEPYRVDPSVPLMSDFFVPDDSVPPP
FT                   GVTVTPLPMG"
FT   gene            complement(27630..29363)
FT                   /locus_tag="Rpdx1_0025"
FT   CDS_pept        complement(27630..29363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0025"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="TIGRFAM: gamma-glutamyltransferase; KEGG:
FT                   nha:Nham_0191 gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41670"
FT                   /db_xref="GOA:E6VE57"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE57"
FT                   /inference="protein motif:TFAM:TIGR00066"
FT                   /protein_id="ADU41670.1"
FT                   /translation="MITLRVPQRILMTLAVLVLVVSPLAAPAQDMRSGMARGPAQAVIA
FT                   KHGMVVAQERLAAEIGASFLARGGNAIDAAVATGFAMAVTYPRAGNLGGGGFMVIHSAA
FT                   KNEDLAIDYRETAPQAATQDMFLTDGKPDPDKSRKSALGIGVPGTVAGLALALDKYGSG
FT                   KFKLADVIAPAIALARDGIEVADDTADTLPDWHRWLSRWPSTQKVFARPDGSPLQAGDR
FT                   LVQLDLAATLEAIAQQGPDGFYRGPVAEKLSRGIRDAGGLITPEDLAGYQPMLRTPLRG
FT                   SYRGYDIVAMPQPSSGGVVLIESLNILEGYAMRDRGQGTAPSLHLLIEAMKRAYADRAR
FT                   YLGDPAFTEAPVAKLLSKDYATSLRAGIDPQRATSVDQPLPQPREGDNTTHFSVADADG
FT                   NAVSNTYTLNFSYGVGLVADGTGVLLNNQLDDFTAAPGASNAYGLVGFAANLPAPGKRP
FT                   LSSMSPTILLKDGKPVLVTGSPGGSRIISAVLQVIVDVIDYRMNVADAVAAPRLHHQWL
FT                   PDEVRVEHRFPDATLEVLRAMGHRVVTPLGQTSANSIWIDADGFHGAADPRTRGATAAG
FT                   N"
FT   sig_peptide     complement(29286..29363)
FT                   /locus_tag="Rpdx1_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.799 at
FT                   residue 26"
FT   gene            29469..30866
FT                   /locus_tag="Rpdx1_0026"
FT   CDS_pept        29469..30866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0026"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   nha:Nham_0192 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41671"
FT                   /db_xref="GOA:E6VE58"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE58"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU41671.1"
FT                   /translation="MSSSRAEGIAQTREPIRYPSQGAVIGWILFDWAAQPYFTLITTFI
FT                   FAPYFATYVAPDPATGQSLWGFATAASGFVIALASPVLGAIADASGRRKPWIALFGGML
FT                   VIGSMLMWFGKPGEPHTILPLLIAYAIATIGVEFATVFNNAMMPNLVPPEKIGRLSGTG
FT                   WATGYVGGILSLVLVLGFLAASPETGKTLLGLAPWFGLDPTLHEGDRISGPLTGVWFVL
FT                   FVLPMFLLTPDFPAKLAPRAAIREGLHELAETLRDLPRRRSLAIFLLANMIYTDGLVSL
FT                   FAFGGIYATGTFGWSTIQIGTFGVILAIAATIGAFIGGRLDDAFGSKRVITGSLVLLLI
FT                   AIAGILLVDPSHVLLIEVKPPQPGAALFASPAERAYLLLGCLIGIAGGPLQAASRTLLI
FT                   RIAPRDRIAQYFGLFALTGKVTSFIGPLLIATVTALASSQKAGMAVLVLFFIAGLALLT
FT                   QVRRSAE"
FT   gene            31081..32169
FT                   /locus_tag="Rpdx1_0027"
FT   CDS_pept        31081..32169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0027"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; KEGG: mlo:mll4988
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41672"
FT                   /db_xref="GOA:E6VE59"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE59"
FT                   /inference="protein motif:TFAM:TIGR00034"
FT                   /protein_id="ADU41672.1"
FT                   /translation="MLTTTDDLRLQKITELSTPAEVMGEIPRTLTATRTVAASRSAIHA
FT                   ILTGADDRLLVVVGPCSIHDPAAAMDYASRLAALRETLADRIEIVMRVYFEKPRTTVGW
FT                   KGLINDPDLDGSFRIDKGLRLAREVLSAVNNLGLPAATEFLDLITPQYIADLVAWGAIG
FT                   ARTTESQIHRELASGLSCPIGFKNGTDGNVRIAAEAVKSAAQPHHFMAVTKGGRNAIAA
FT                   TTGNSDCHVILRGGVTPNYDAANVEAAAAVLGKIGLAPQLMIDASHANSSKQPDNQPKV
FT                   TADIGRQLASGENRIIGVMIESNLVAGRQDVVPGRPLHYGQSITDGCIDWATTETVLHD
FT                   LAAAVESRRTTLRAAQREGAAA"
FT   gene            complement(32236..32379)
FT                   /pseudo
FT                   /locus_tag="Rpdx1_0028"
FT   gene            complement(32381..33973)
FT                   /locus_tag="Rpdx1_0029"
FT   CDS_pept        complement(32381..33973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0029"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="SMART: AICARFT/IMPCHase bienzyme formylation region;
FT                   TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; KEGG: bja:blr0581
FT                   bifunctional phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41673"
FT                   /db_xref="GOA:E6VE60"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE60"
FT                   /inference="protein motif:TFAM:TIGR00355"
FT                   /protein_id="ADU41673.1"
FT                   /translation="MTQNPRRVTRALLSVSDKTGLIDFARALASHGVELVSTGGTAKAI
FT                   AAAGLPVKDVSDLTGFPEMMDGRVKTLHPKVHGGLLAIRDNAEHKNAMAEHGIAQIDLL
FT                   VVNLYPFEATVDKGASYEDCIENIDIGGPAMIRAAAKNHDDVAVVVEASDYQPVLDELA
FT                   ANNGATTLTLRRRLAAKAYARTAAYDAAISNWFALQLKTDAPDFRAIGGRLIQSLRYGE
FT                   NPHQTAAFYATPEKRPGVATARQVQGKELSYNNINDTDAAYECVGEFDAKRTAACVIVK
FT                   HANPCGVAEGASLLDAYRKALACDSVSAFGGIVALNRTLDAEAARAITEIFTEVIIAPD
FT                   ATDEAIAIVAAKKNLRLLLAGALPDPRANGLTYKTVAGGLLVQSRDNAVVDDMALKVVT
FT                   KRQPTEAELRDLKFAFRVGKHVKSNTIIYAKDLATVGIGAGQMSRVDSARIAARKAQDA
FT                   AAELKLAAPMTKGSVVASDAFFPFADGMLACIEAGATAVIQPGGSVRDDEVIKAADEAG
FT                   IAMVFTGTRHFRH"
FT   gene            complement(34194..35909)
FT                   /locus_tag="Rpdx1_0030"
FT   CDS_pept        complement(34194..35909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0030"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   bja:blr0580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41674"
FT                   /db_xref="GOA:E6VE61"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE61"
FT                   /inference="protein motif:PFAM:PF07940"
FT                   /protein_id="ADU41674.1"
FT                   /translation="MGRFARTVMARASSGSVALTRLWPGRTDRLIIAPHDLRTADATRA
FT                   AEIYAGRFVFAGKIVTCHGRSIFDLEPPSDDWEAALLGFGWLRHLRAADTAITRANARS
FT                   LVDDWLSNMSRTGPVGRRPDVLARRVISLLSQAPLVLSDTDGKFYRRYLRGLTREIRAL
FT                   RYALLDVQDGVPRLQVLIALCYASLCLANQARQIRGATKKLSDELQRQVLPDGGHISRN
FT                   PGALIELLIDLLPLRQTFAARNIAPPPALLNAIDRMMPMLRFFRHGDGNFALFNGMSAT
FT                   PSDLLATLLAYDDSQGTPLASMPHSGYQRIDAGTTLVIADAGTPPPANVSQEAHAGCLS
FT                   FELSSGNCRIVINSGMPTTNRESWRGFARSTVAHSTVTCHDTSSCSFVERSAMKRFLHG
FT                   APVVGGPRQVENRREEVAGGVLLTTSHDGYRDKFGVLHRRVLMVKHDGSRVDGEDSLTP
FT                   VQGGRHRAAQADYAVRFHLHPLVKASRLHDARGVMLVLPNREVWTFEAADDKVDLEESV
FT                   FLAGNDGPRRSTQIVIRQNSIEAPNVRWSLIRSNASPQTTSARRAARREPELPL"
FT   gene            complement(36247..37599)
FT                   /locus_tag="Rpdx1_0031"
FT   CDS_pept        complement(36247..37599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0031"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; NusB/RsmB/TIM44;
FT                   KEGG: bja:blr0579 SUN protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41675"
FT                   /db_xref="GOA:E6VE62"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE62"
FT                   /inference="protein motif:PFAM:PF01189"
FT                   /protein_id="ADU41675.1"
FT                   /translation="MPVPRFAQASEVPGLAARRIAADILDGVLQKRRMLDDQLEGPAAH
FT                   PGLKTLSDRDRALMRRLVATILRRLGTLEGLLARLLDRGVPTDAPRAKSALLIGAAQIL
FT                   WMDVPDHAAVDLSVRLVQSDRRAAKYAGLVNAVLRRCAREGQPLVEELAAGTPDVPQWL
FT                   LARWSAHYGADTARAIAQAISHEPSLDLTVKSDPAHWATRLHGEVLPTGTVRTLLQGSV
FT                   RMLPGFDEGQWWVQDAAAALPARLFGDIAGKSVADLCAAPGGKTAQLAAAGARVTAIDR
FT                   SPARVARLRENLARLSLEVETGVADAAEWRGDATAEFDAVLIDAPCASTGTIRRHPDVA
FT                   WLKQESDIGALAAVQNRLLKKAASLLRPGGTLVYCTCSLEPEEGEQAIAVLLAAEPSMR
FT                   RQPIDPAEVAGLTEIVTADGALRTLPCHLPHSDPRLAGLDGFYAARLMKSL"
FT   gene            37755..37973
FT                   /locus_tag="Rpdx1_0032"
FT   CDS_pept        37755..37973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0032"
FT                   /product="protein of unknown function DUF1674"
FT                   /note="PFAM: protein of unknown function DUF1674; KEGG:
FT                   nha:Nham_0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41676"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE63"
FT                   /inference="protein motif:PFAM:PF07896"
FT                   /protein_id="ADU41676.1"
FT                   /translation="MTQPDPKSAPTDAAPPRKDLPEAAKRALAEAEARRVEAARHAEAR
FT                   AKEVQGPKGPEPTRYGDWEVKGIASDF"
FT   gene            38057..38629
FT                   /locus_tag="Rpdx1_0033"
FT   CDS_pept        38057..38629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0033"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="manually curated; PFAM: nuclease (SNase domain
FT                   protein); KEGG: nwi:Nwi_0154 nuclease; SMART: nuclease
FT                   (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41677"
FT                   /db_xref="GOA:E6VE64"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE64"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ADU41677.1"
FT                   /translation="MSRYPRTNPVRISRLPWRSRLWPWIFVLGVAAGTMLPARHWLHLP
FT                   WSKPPESEAVDNDSETVWRRAGNPTVRHPVEVLYTIDGDTFDARVFLWPGQALRTRVRL
FT                   RGIDAPELKAQCAQEARMATAAAEALRRLLAEGEVTIYNIGPDKYQGRVVANVATKRTA
FT                   NVSSALLDGGYARTYGGGHRNGWCDGR"
FT   gene            complement(38645..39529)
FT                   /locus_tag="Rpdx1_0034"
FT   CDS_pept        complement(38645..39529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41678"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE65"
FT                   /inference="similar to AA sequence:KEGG:BRADO0145"
FT                   /protein_id="ADU41678.1"
FT                   /translation="MGVVLETIGKLIASYLQKEEPGYEPFTPSDPDHLRSIMQPGDVLL
FT                   VEGNSRIAGIIKYLTQSTWSHAAVYVGPIDGVAEPDGEPHVLVEANIGEGVSSSPLSRH
FT                   LAYHTRVCRPVGLSYEDRHTVCRYAINRIGFGYDTKNILDLMRYLVPLPLPQRWRRRMI
FT                   ALGSGDPTKIICSALIAQAFEAVRYPILPKITRAGSRAARREILHIRHSSLYMPRDFDI
FT                   SPYFEVVKPTIVNGFDYTALHWADKPKPAADNDGHFAPPLDDTEAAPSLTPQIAEAEAD
FT                   FDLAGSPKLAAGG"
FT   gene            39877..41334
FT                   /locus_tag="Rpdx1_0035"
FT   CDS_pept        39877..41334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0035"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: bbt:BBta_0209 amine
FT                   oxidoreductase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41679"
FT                   /db_xref="GOA:E6VE66"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6VE66"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADU41679.1"
FT                   /translation="MTISRRSLLEGLLGATAGLALLPVLGGRANAALPREAEVVVVGAG
FT                   AAGIAAARRLVAAGRKVIVVEAASEIGGRCVTDTTSFAAPFDRGARWLHNPDSNPLVWL
FT                   ARSSGFAVTPIAPGQKVRIGRRNARSRETEDFLAAFVRASRAISEASRGKTDISCAAAL
FT                   PKDLGDWAATIEYVLGPATTSKDLRALSAMDTARTLDRTALLGCPQGVGSLLTQLASSL
FT                   PIALSTPVKRIVWSGRDLAVETAAGRIGARAIIVTASTNVLTSGNLAFSPELPKRQLDA
FT                   AARLSLGSTDRIALQLKGNPLGLSRDETIIERADDIRTATLVGNIGGSSLCTVDVAGSF
FT                   GRQLAAQGEAAMQDFAIEWLGKLFGSDVAGAVERKAVTRWNEMPYVLGAMSAAEPGGQP
FT                   SRKVLGEPLGNLFFAGEATHETLFGTVQGAWESGERAADAALKKIGAVKEPAPEKPARK
FT                   QKPRREPQRQREQRPPATASGTPSWWR"
FT   sig_peptide     39877..39972
FT                   /locus_tag="Rpdx1_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.889 at
FT                   residue 32"
FT   gene            complement(41341..43752)
FT                   /locus_tag="Rpdx1_0036"
FT   CDS_pept        complement(41341..43752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0036"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /note="KEGG: bra:BRADO0141 phenylalanyl-tRNA synthetase
FT                   subunit beta; TIGRFAM: phenylalanyl-tRNA synthetase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41680"
FT                   /db_xref="GOA:E6VF10"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF10"
FT                   /inference="protein motif:TFAM:TIGR00472"
FT                   /protein_id="ADU41680.1"
FT                   /translation="MKLTLSWLKDHLDTDEPLEKLADKLTMIGLEVEGIEDKAKALAPF
FT                   TIAKVLTAEKHPNADKLQVCTVDVGDGAAPVQVVCGAPNARAGLVTVFSPPGTYIPGKN
FT                   ITLGVGTIRGVESRGMLCSAAELEISEDHDGIIELPADAPVGTAYAEWAGLGDPVLDIN
FT                   LTPNRQDCAGVHGIARDLAAADMGKFKDPGIKQIPGEFPCPVNVTVEDSKLCPGFALRL
FT                   VKGVKNGPSPDWLQKRLAAIGLRPINALVDITNYLTFDRSRPLHVFDAAKVKGNLVVRR
FT                   AKDGETLLALDGRTYSLDSSVCVIADDHGVESLAGIMGGELSGCSADTTDVLIESALWN
FT                   EINIAQSGRKLGINTDARYRFERGVDPAFMLPGLELATKLVMEFCGGTPSEVVVVGNPF
FT                   ADDKIIDFPLAEVKRLAGIEVPLVEVRRILTRLGFVVAGQGPVVKVAVPSWRSDVHGKA
FT                   DLVEEVVRIVGVEKVPLTPFERGDAPRKPVLTQIQNRTRRAKRALAARGLTEAVTWSFI
FT                   SKPFAEAFGGGQPELALANPIASDLSDMRPSLLPGLIAAAQANADRGSPDLALFEVGQV
FT                   FKGDRPQDQFMAASGVRRGVASSAGIGRHWSGSAQATALDAKADAFAVLAAAGAPMAGL
FT                   QIATGKLPAWLHPGRSGAIQIGPQNVLGYFGELHPRVLEQLGADGPLVAFEVMLEKIPD
FT                   PKQRPTRAKPALELSAFHPVSRDFAFIVDRKVGVADIVRAAQGVDKKLITSVSVFDVYE
FT                   GKGIDPDKKSVAIAVTLQPRDKTMTDQEIEAVAAKIVAEVTKKTGGSLRG"
FT   gene            complement(43897..44376)
FT                   /locus_tag="Rpdx1_0037"
FT   CDS_pept        complement(43897..44376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0037"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41681"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF11"
FT                   /inference="similar to AA sequence:KEGG:BBta_0213"
FT                   /protein_id="ADU41681.1"
FT                   /translation="MDDPKQASWNVSPSQRRHARELRKKSTDAERFMWGELRDKRLNGF
FT                   SFKRQVPIGPYIADFACHAKKLVVELDGGQHVADEAERADAARTAAIEARGFRVIRFSN
FT                   HEVMTNRAGVLQSIADVLAARALTPALSRKRERGRAERAAKPRSDAGAANNQGDE"
FT   gene            complement(44612..45694)
FT                   /locus_tag="Rpdx1_0038"
FT   CDS_pept        complement(44612..45694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0038"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /note="KEGG: nwi:Nwi_0066 phenylalanyl-tRNA synthetase
FT                   subunit alpha; TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase class IIc;
FT                   aminoacyl tRNA synthetase class II domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41682"
FT                   /db_xref="GOA:E6VF12"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF12"
FT                   /inference="protein motif:TFAM:TIGR00468"
FT                   /protein_id="ADU41682.1"
FT                   /translation="MSNLQDLQSQILADIAAASDEAALEAVRVGALGKKGSISALLATL
FT                   GKMDPEQRKTEGAAINLAKDAVTQALAARRDVLKAAALDAKLAAETIDVTLPMREPSAE
FT                   AGRLHPLSQVWDELTAIFADMGFAIAEGPDIETDDYNFTKLNFPEGHPAREMHDTFYFN
FT                   PKEDGSRLLLRTHTSPVQVRTMLSQKPPIRVICPGRTYRSDSDQTHTPMFHQVEGLVID
FT                   KGSHLGHLKWILHEFCKAFFEVDNVNMRFRPSFFPFTEPSLEVDIQCRRGKDEIRFGEG
FT                   EDWLEILGCGMVHPNVLTACGLDPDEYQGFAWGMGIDRIAMLKYGMSDLRQLFEADVRW
FT                   LNHYGFKPLDIPTLAGGLSS"
FT   gene            complement(45810..46169)
FT                   /locus_tag="Rpdx1_0039"
FT   CDS_pept        complement(45810..46169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0039"
FT                   /product="ribosomal protein L20"
FT                   /note="KEGG: nha:Nham_0075 50S ribosomal protein L20;
FT                   TIGRFAM: ribosomal protein L20; PFAM: ribosomal protein
FT                   L20"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41683"
FT                   /db_xref="GOA:E6VF13"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF13"
FT                   /inference="protein motif:TFAM:TIGR01032"
FT                   /protein_id="ADU41683.1"
FT                   /translation="MARVKRGVTAHAKHKKVYKLAKGYRGRRKNTIRTAKAAVDKAGQY
FT                   AFRDRKRKKRTFRALWIQRLNAAVRPFGMTYSVFINGLSKSGIVVDRKVLSDLAINEPA
FT                   AFQAIAEKAKAALAA"
FT   gene            complement(46261..46461)
FT                   /locus_tag="Rpdx1_0040"
FT   CDS_pept        complement(46261..46461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0040"
FT                   /product="ribosomal protein L35"
FT                   /note="KEGG: bbt:BBta_0216 50S ribosomal protein L35;
FT                   TIGRFAM: ribosomal protein L35; PFAM: Ribosomal protein
FT                   L35"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41684"
FT                   /db_xref="GOA:E6VF14"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF14"
FT                   /inference="protein motif:TFAM:TIGR00001"
FT                   /protein_id="ADU41684.1"
FT                   /translation="MPKLKTKSGAKKRFKVTATGKVVSAQRGKRHGMIKRTKKQIRQLR
FT                   GTRVIFKTDGDNIKKYFLPNA"
FT   gene            complement(46792..47331)
FT                   /locus_tag="Rpdx1_0041"
FT   CDS_pept        complement(46792..47331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0041"
FT                   /product="translation initiation factor IF-3"
FT                   /note="manually curated; TIGRFAM: translation initiation
FT                   factor IF-3; KEGG: bbt:BBta_0218 translation initiation
FT                   factor IF-3; PFAM: Translation initiation factor 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41685"
FT                   /db_xref="GOA:E6VF15"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF15"
FT                   /inference="protein motif:TFAM:TIGR00168"
FT                   /protein_id="ADU41685.1"
FT                   /translation="MRRPNRAPPPVAKDGPRTNDEIRNFEIQLIDQTGVNQGKVETIVA
FT                   IKMAMDAGMDLVEISPTSSPPVCKIMDYGKYKYSAQKKAAEARKKQKIVEIKEIKLRPM
FT                   IDDHDYDVKMKAMLRFFEEGDKVKITLRYRGREMAHQEIGTKLLEKVKNDVAEIAKVEQ
FT                   DARFEGRQVVMVLAPR"
FT   gene            47654..48439
FT                   /locus_tag="Rpdx1_0042"
FT   CDS_pept        47654..48439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41686"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF16"
FT                   /inference="similar to AA sequence:KEGG:Nham_0078"
FT                   /protein_id="ADU41686.1"
FT                   /translation="MTNSSVPKPEFVTVGDGGAARQIAVRARPGASPGLFWLGGFNSDM
FT                   TGTKASALDQWAEARGRACVRFDYSGHGESSGVFAEGTIGRWLEESLAVFDAFCRGPQI
FT                   VVGSSMGGWMALLLARALRCRGGEAAANLAGLVLIAPAPDFTEALMWKGFSPEIRAEIE
FT                   TRGVWLRPSEYGEPYPITRALIEDGRNHLVLGGMIEVGCPVRILQGKQDEDVPWRHAFE
FT                   LAERLPTDDVVLTMIQDGDHRLSRPQDITRMLAAVEEIS"
FT   gene            complement(48432..49634)
FT                   /locus_tag="Rpdx1_0043"
FT   CDS_pept        complement(48432..49634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0043"
FT                   /product="domain of unknown function DUF1730"
FT                   /note="PFAM: domain of unknown function DUF1730; KEGG:
FT                   bja:bll0714 iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41687"
FT                   /db_xref="GOA:E6VF17"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF17"
FT                   /inference="protein motif:PFAM:PF08331"
FT                   /protein_id="ADU41687.1"
FT                   /translation="MAGGGAGFAHLRGSGFLSPAAGPSESQRGGAAWRAQLADQAYALG
FT                   FDAFGVCAPDSIPEAPARLRAFLDAGYHGEMAWLADRPERRSDPRVMWGEVQSVILLGF
FT                   NYGPDVDPRGVLTRKDRAAISVYAQGDDYHDVIKARLKQFARWLVATAGGDVKVFIDTA
FT                   AVMEKPLAQAAGLGWQGKHTNLVSTGRGSWMFLGAVFTTLDLPRDAAERDHCGSCRACL
FT                   DACPTAAFPAPYRLDARRCISYLTIEHKGPIPREFRARLGNRIYGCDDCLAACPWNKFA
FT                   QAGREAKLAARDGLRAPALAELVRLDDPLFRALFTKSPVKRIGRDRFIRNVLIAIGNSG
FT                   DSGVTADAERLLADPNPVIRGAAVWALAQLLPPDQFAALSAAHLTDEADEGVRTEWDAV
FT                   S"
FT   gene            complement(49583..50275)
FT                   /locus_tag="Rpdx1_0044"
FT   CDS_pept        complement(49583..50275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0044"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bbt:BBta_0222 putative glutathione S-transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41688"
FT                   /db_xref="GOA:E6VF18"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF18"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADU41688.1"
FT                   /translation="MYTLFHHPFCPLSRFIRLALGEHGLDLRLVEERSWERRTAFLALN
FT                   PAGTTPVLVAEGRPPVPGAGVITEFLDEVHGPELGDRRLLPQSTAERIEVRRLLSWFND
FT                   KFFEEASGPLMTERIYKRFMSEEDGGGPPAMDVIRAANANVRYHLAYIGWLARTRNFLA
FT                   GDRMTYADLAAAAHLSAIDYLGDVPWIEDEAAKAWYARIKSRPSFRPLLSEWLAGVPAS
FT                   RTYVDLDF"
FT   gene            50475..51281
FT                   /locus_tag="Rpdx1_0045"
FT   CDS_pept        50475..51281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0045"
FT                   /product="undecaprenol kinase"
FT                   /note="KEGG: bja:blr0716 undecaprenyl pyrophosphate
FT                   phosphatase; TIGRFAM: undecaprenol kinase; PFAM: Bacitracin
FT                   resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41689"
FT                   /db_xref="GOA:E6VF19"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF19"
FT                   /inference="protein motif:TFAM:TIGR00753"
FT                   /protein_id="ADU41689.1"
FT                   /translation="MLTDIIRAVILGIIEGVTEFLPVSSTGHLLLAGRFFNLGEGDFWK
FT                   SFAVLIQLGAILAILALYFVKLWRIALGMFSDPAARRFVIGVLLAFLPAAVIGAAAGGY
FT                   IKHFLFNPWVVCFSLIVGGAILLWVDQLELKPRYHDATAFPLRTYFYIGCAQCTAMIPG
FT                   VSRSGASIVAAMLLGTDKRSAAEFSFFLAIPTMLGAFVYDLYKSRGEMTFDNLTIVAIG
FT                   FVVSFITAIIVVKTFLTYVTRHGFELFAWWRVIVGTLGLIALALGM"
FT   gene            complement(51337..52302)
FT                   /locus_tag="Rpdx1_0046"
FT   CDS_pept        complement(51337..52302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0046"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bra:BRADO0128 putative NAD dependent epimerase/dehydratase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41690"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF20"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADU41690.1"
FT                   /translation="MTSNLDTLVTVFGGSGFLGRHIVSALARRDYRIRVAVRRPELAGH
FT                   LQPLGRVGQIHAVQANLRYPESVAAAMRGAHVAINLVGILAEGGAQKFDAVQGNGAASV
FT                   AQAAASVGARMVHVSAIGADPDSPARYARSKAAGERAVHEAVPQATIFRPSVVFGPEDQ
FT                   FTNRFAALARMSPVLPLVGADTKLQPVYVGDVATAIADAVDGLARPGAVYELGGPEVLT
FT                   MREIMRIILQITDRKPLLLPLPFGLASLQAMLLQFAPGAFKLTPDQVRMLEVDNVVSEA
FT                   ATKAGLTLQGLGIQPDSMQAVVPSYLWRFRKTGQFARKTA"
FT   gene            52463..52547
FT                   /locus_tag="Rpdx1_R0001"
FT                   /note="tRNA-Leu1"
FT   tRNA            52463..52547
FT                   /locus_tag="Rpdx1_R0001"
FT                   /product="tRNA-Leu"
FT   gene            52694..53329
FT                   /locus_tag="Rpdx1_0047"
FT   CDS_pept        52694..53329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0047"
FT                   /product="3'-5' exonuclease"
FT                   /note="KEGG: oca:OCAR_4455 3'-5' exonuclease; PFAM: 3'-5'
FT                   exonuclease; SMART: 3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41691"
FT                   /db_xref="GOA:E6VF21"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF21"
FT                   /inference="protein motif:PFAM:PF01612"
FT                   /protein_id="ADU41691.1"
FT                   /translation="MAKGLRHMTIRLHRGDLPDLSRYTHSVAIDTETMGLHPHRDRLCV
FT                   VQLSNGDGSADVVQIPLGATDAPNLKKLLGDPAVVKIFHFARFDLAALYKAFGVMPQPV
FT                   YCTKIASRLTRTYTDRHGLKDLVRELLGIDLSKQQQSSDWGAESLSDAQLAYAASDVLH
FT                   LHALRDKLDTMLAREGRTDLAAACFGFLPVRARLDLDGWSEEDIFAHS"
FT   gene            53585..54313
FT                   /locus_tag="Rpdx1_0048"
FT   CDS_pept        53585..54313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0048"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   bja:blr0720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41692"
FT                   /db_xref="GOA:E6VF22"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF22"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ADU41692.1"
FT                   /translation="MSSYQAGMEARFAAAARHSRLVRTLRVAVPLVVVLSMAVIVAISI
FT                   FNPFRYLTNLPLDIGDLVVSGTKITMESPHMAGFTNDGRPYEMWARSATQDLTSQDHVD
FT                   LHTLRAKVQSEDQSTVVIEAREGQFQTKAQLLKLNKDVYLHNSSGTEAWMTQADVDMGQ
FT                   GTVTSDAPVDVKWEGGTLRGQRMRITEKGDLIRFEGGVVMNLDNAALAEPAADPVAQPV
FT                   PPPAPAKRPAPVSGQRAPAR"
FT   gene            54322..54987
FT                   /locus_tag="Rpdx1_0049"
FT   CDS_pept        54322..54987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0049"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: nha:Nham_0177
FT                   OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41693"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF23"
FT                   /inference="protein motif:PFAM:PF03968"
FT                   /protein_id="ADU41693.1"
FT                   /translation="MRIAALPRSRRGTLAAVCAALIAVSTLGPRPAAAQSAVQGVPNAM
FT                   QGFSQNRDKPIQIESDTLEVRDKKKEATFSGNVKVVQGDTTMTSQTLVVFYDQDQAPAK
FT                   GAKGKPMAAAAPGPDGASSIRRLEAKGHVVVTQKDQVVTGDKAVFETKTNLVTMTGNVV
FT                   LTQARNVVRGDRLMVDMTTGVSRVESDSGRVQGLFQSSGTNGGGPLPLGPPTGSGKPK"
FT   sig_peptide     54322..54426
FT                   /locus_tag="Rpdx1_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 35"
FT   gene            55014..55163
FT                   /locus_tag="Rpdx1_0050"
FT   CDS_pept        55014..55163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41694"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU41694.1"
FT                   /translation="MLNRMPQACNSDWEALPLSQRHNTVVPARGTGCGATRMTVAWCVT
FT                   GQVR"
FT   gene            55186..56136
FT                   /locus_tag="Rpdx1_0051"
FT   CDS_pept        55186..56136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0051"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nwi:Nwi_0174 ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41695"
FT                   /db_xref="GOA:E6VF25"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF25"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU41695.1"
FT                   /translation="MFRRRGPKASGFAGARTDITGLGDEVGDLLTAPVRDAPPVARSDA
FT                   YAAQQRTPTAAAPRQTTAPTRQASAPRAATPSGYLAVHSVEKSFGTRKIVRGVSIYVRR
FT                   GEAVGLLGPNGAGKTTVFYMITGLIKADNGAIELDGHDVTKLPMYQRARLGIGYLPQEA
FT                   SIFRGLTVEQNIRAVLESVEPDKRKRECQLDNLLQEFNIERLRKSPSIALSGGERRRVE
FT                   IARALASRPNYMLLDEPFAGIDPIAVGDIQDLVRHLTNRGIGVLITDHNVRETLGLTDR
FT                   AYIVYAGEILTEGTPEDIVNDPDVRRLYLGEEFRL"
FT   gene            56339..57982
FT                   /locus_tag="Rpdx1_0052"
FT   CDS_pept        56339..57982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0052"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: bbt:BBta_0121 RNA polymerase factor sigma-54;
FT                   TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor core-binding region; sigma-54 factor;
FT                   sigma-54 DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41696"
FT                   /db_xref="GOA:E6VF26"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF26"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADU41696.1"
FT                   /translation="MALSQRLEFRQTQSLVMTPQLMQAIKLLQLSNLDLAAFVEDELEK
FT                   NPLLDRASDNGEPPVAGETAVDGSESGNDFSQSGGDDAGGESSDFVEAGSASAFEPGTE
FT                   EWMHRDLGSRSDIEQTLDTGMENVFPEEPAEAAARAAQDSAPASYTEWGGGASSDEGYN
FT                   LEAFVAAETSLADHLAEQLAVAVTTPSQRLIGQYLIDLVDDAGYLPPDLGDAAERLGAS
FT                   SAEVEAVVHVLQTFDPPGICARNLSECLAIQLRERDRYDPAMQALVEHLDLLAKRDVAS
FT                   LRKICGVDDEDLVDMIGEIRHLDPKPGLKFGSSRVQTIVPDVFVRPGPDGGWLVELNSD
FT                   TLPKVLVNQSYYSELSKTIRKDGDKSYFSDCLQNATWLVRALDQRARTILKVATEIVRQ
FT                   QDGFFTHGVKHLRPLNLKAVADAIQMHESTVSRVTANKYMATNRGTFELKYFFTASIAS
FT                   ADGGEAHSAEAVRHQIRQLIDSEDPSAILSDDTIVDRLREAGIDIARRTVAKYREAMRI
FT                   PSSVQRRRDKQNMLGTQSAAASRSRDTAPA"
FT   gene            58039..58647
FT                   /locus_tag="Rpdx1_0053"
FT   CDS_pept        58039..58647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0053"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="KEGG: bbt:BBta_0120 sigma 54 modulation protein /
FT                   SSU ribosomal protein S30P; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41697"
FT                   /db_xref="GOA:E6VF27"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF27"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADU41697.1"
FT                   /translation="MTIRISGKSISIGEALRGRVSERTEEVLRKYFDGNYSGHFTLSKD
FT                   GFGFRTDCALHLDSGITLEAEANAADAYASADQALVQIEKRLRRYKSRLKDRSARKAHA
FT                   EANALAELSTPVDVPSYVIEAPGDEEHQEDAYNPVIIAEATTAMKRLSVSEAVVELDLT
FT                   GAPVVVFLHGGSGRVNIIYRRADGNIGWIDPPVPNGAAS"
FT   gene            58920..59381
FT                   /locus_tag="Rpdx1_0054"
FT   CDS_pept        58920..59381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0054"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="KEGG: bra:BRADO0111 nitrogen regulatory protein;
FT                   TIGRFAM: PTS IIA-like nitrogen-regulatory protein PtsN;
FT                   PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41698"
FT                   /db_xref="GOA:E6VF28"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF28"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ADU41698.1"
FT                   /translation="MTITDLVAPEAVIPALKVISKKQALQELAARASELTGQNERTIFE
FT                   VLLQREKLGTTAVGYGVAIPHGKLPKLEKLFGLFARLERPIDFEAMDGQPVDLVFLLLA
FT                   PEGAGADHLKALARIARLLRDQDVAKKLRASRDSQAIYSVLALPPATAA"
FT   gene            complement(59652..59918)
FT                   /locus_tag="Rpdx1_0055"
FT   CDS_pept        complement(59652..59918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0055"
FT                   /product="protein of unknown function DUF1150"
FT                   /note="PFAM: protein of unknown function DUF1150; KEGG:
FT                   bbt:BBta_0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41699"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF29"
FT                   /inference="protein motif:PFAM:PF06620"
FT                   /protein_id="ADU41699.1"
FT                   /translation="MTESGTTHGNVGVTPEALAHLGEGHIAYVKQIRSEDVPGLFPQAP
FT                   EIAPGLKLFALHSADGTPIMLTDSREAAIANAWSQELQAVSVH"
FT   gene            complement(59968..60393)
FT                   /locus_tag="Rpdx1_0056"
FT   CDS_pept        complement(59968..60393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0056"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: oca:OCAR_4464
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41700"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF30"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADU41700.1"
FT                   /translation="MSRVPSLSSPFLLGFDEIERALDRVVKGADGYPPYNIERCERCDG
FT                   DPEKLRITLAVAGFTRDQLDVTVEENQLVIRGRQQDDKARQYIHRGIAARHFQRTFVLA
FT                   DGMQVLGADMKNGLLSIDLIRPEPERVVKTIAITEHE"
FT   gene            complement(60545..61633)
FT                   /locus_tag="Rpdx1_0057"
FT   CDS_pept        complement(60545..61633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0057"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bja:bll0730 glycerol-3-phosphate transporter
FT                   ATP-binding subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41701"
FT                   /db_xref="GOA:E6VF31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF31"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU41701.1"
FT                   /translation="MANVVLRSVRKTYPGGFEAIKGVDFEVGDGQFCVLVGPSGCGKST
FT                   LLRMVAGLETITSGEIEIGGRVVNQIEPADRDIAMVFQNYALYPHMSVYDNMAYGLRNR
FT                   GTARAEIEARVQEAARILELGSMLTRKPRQLSGGQRQRVAMGRAIVRQPKVFLFDEPLS
FT                   NLDAKLRVAMRVEIRKLQRRLATTAIYVTHDQLEAMTLADVLVVMNAGEVEQIGSPLDV
FT                   YARPATTFVASFIGAPPMNLMPLADDLRAQLGSAPPEAGILGVRPEDLTIVSGTAGSGA
FT                   LALDVTVEAIERVGPETFVYGARGDHLNEPVVVGSPEAAGADLIVRIPGQAAPGIGERI
FT                   TVTAPPPSLHLFSADGRRRIVR"
FT   gene            complement(61639..62487)
FT                   /locus_tag="Rpdx1_0058"
FT   CDS_pept        complement(61639..62487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0058"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:bll0731
FT                   glycerol-3-phosphate ABC transporter membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41702"
FT                   /db_xref="GOA:E6VF32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF32"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU41702.1"
FT                   /translation="MVEHRKFGNLLPHLVLWAGVLIVAFPVYLAFVASTQDNASIANGQ
FT                   MSLLPGGHFLETYTKTLFVGTSGTTREPVGTMLFNSMVMAMTIAVGKIGISVISAYAIV
FT                   YFRFPFRMTIFWLIFITLMLPVEVRIYPTYKIVADLNLLDSYAGLTLPLIASATATLLF
FT                   RQFFMTVPDELLEASRIDGAGPFRFFWDTLLPLSRTNMAALFVILFILGWNQYLWPLLI
FT                   TTRDDMQTIQIGIRKMIVTSDALTEWPVVMATAVLAMLPPVAVVVLMQKLFVRGLVETE
FT                   K"
FT   gene            complement(62487..63368)
FT                   /locus_tag="Rpdx1_0059"
FT   CDS_pept        complement(62487..63368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0059"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:bll0732
FT                   glycerol-3-phosphate ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41703"
FT                   /db_xref="GOA:E6VF33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF33"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU41703.1"
FT                   /translation="MLKQAVFQSKFLPYLLVLPQLAVVLVFFYWPAGQAVIQSFLMQDA
FT                   FGLSTVFVWFDNYRELLADPDYFAAILRTFAFSFAIALSSLSLALLLAVMADRPLRGST
FT                   FYRTLLIWPYAVAPPVVGVLWIFMLNPSLGVIAHGLRALGINWNPLLDGHQAALLIILA
FT                   AAWKQISYNFLFFLAGLQAIPASVIEAAAIDGARPMRRFWTIIFPLLSPTIFFLIVVNV
FT                   VYAFFETFGIIDTMTRGGPAKATETLVYKVYSDGLLGGNLGSSAAQSVILMGIVIALTA
FT                   FQFRFVERKVNY"
FT   gene            complement(63534..64862)
FT                   /locus_tag="Rpdx1_0060"
FT   CDS_pept        complement(63534..64862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0060"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bja:bll0733 ABC transporter
FT                   glycerol-3-phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41704"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF34"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADU41704.1"
FT                   /translation="MAFRSFGPTAAAATAIAVTLAMAAPAQAVTEIQWWHAMTGGNNEV
FT                   VVKLANDFNASQSDYKVVPAYKGSYPDTMNAGIAAFRAGNAPHIMQVFEVGTATMMSAT
FT                   GAVKPVYKLMQETGETFDPNAYLPAITGYYSTSKGEMLSFPFNSSSMVMWVNLDALKKA
FT                   GITEIPKTWPQVFDDAKKLKAAGYATCGFSTAWVTWANLEQLSAWHNVPLASKANGLDG
FT                   FDTKLEFNGPVQIKHLQKLIELQKDKTYDYSGRTNAGEGRFTSGECPLFLTSSGFFGNV
FT                   KSQAKFNWTNAPMPYYPDVQGAPQNSIIGGASLWVMGGKTPEEYKGVAKFLAFLSDTDR
FT                   QVAIHKASGYLPITKAAYEKAKADGFYNEQPYLETPIKELTNKPPTENSRGLRLGNMVQ
FT                   LRDLWAEEIEQALAGKKTAKEALDAAVTRGNTMLRQFEKTAVR"
FT   sig_peptide     complement(64776..64862)
FT                   /locus_tag="Rpdx1_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.925 at
FT                   residue 29"
FT   gene            complement(65081..66271)
FT                   /locus_tag="Rpdx1_0061"
FT   CDS_pept        complement(65081..66271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0061"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="KEGG: bja:bll0734 hypothetical protein; PFAM:
FT                   L-carnitine dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41705"
FT                   /db_xref="GOA:E6VF35"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF35"
FT                   /inference="protein motif:PRIAM:2.8.3.16"
FT                   /protein_id="ADU41705.1"
FT                   /translation="MPGAIAGLRVIDLTRVLGGPYCTQILADHGADVIKVEPPAGDEVR
FT                   DWGPPFHDEDAAYFLGINRNKRSIGLDLASPGGREVLLKMLEDADVLIENFKPGTLDKW
FT                   GLSNEVIREKFPRLVHCRISGFGADGPRGGNPGYDAIIQAMTGMIAATGSPESGPMRIG
FT                   VPLVDITTGLYATIGILMALAERERSGKGQFVEATLYETGLAIMHPHTANYFLHGKPPA
FT                   LTGNEHPNLVPYATFNARDGQIFTGVGNDGTFRKLCKEIGKPELGTDPRFARNKDRIAN
FT                   RAALRAELEAVFSQHDAVPLCDRLLNAGLPAGPVQSIDKALTSPHTAYRGDVIEKDWYK
FT                   GVASPIRFERTKASLRSLPPTFSQHAGEVLGEFGYSADDIAKLVADGIVSGPERKR"
FT   gene            complement(66463..66538)
FT                   /locus_tag="Rpdx1_R0002"
FT                   /note="tRNA-Ala4"
FT   tRNA            complement(66463..66538)
FT                   /locus_tag="Rpdx1_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(66608..67012)
FT                   /locus_tag="Rpdx1_0062"
FT   CDS_pept        complement(66608..67012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bja:bll0737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41706"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF36"
FT                   /inference="protein motif:PFAM:PF09538"
FT                   /protein_id="ADU41706.1"
FT                   /translation="MAKSDLGTKRICPTTGKKFYDLNKTPVISPYTGEVVPIAPVVAPR
FT                   TRADQRAAAPADTEAPEAMEAEELVSLEEADAEENTGKVKAVVPESEDDIEIDETIDDD
FT                   DDDSTFIADEEEEDEDVTDIIGDVSGDEET"
FT   gene            67156..68493
FT                   /locus_tag="Rpdx1_0063"
FT   CDS_pept        67156..68493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0063"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="KEGG: bra:BRADO0098 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41707"
FT                   /db_xref="GOA:E6VF37"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF37"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ADU41707.1"
FT                   /translation="MTDSNQPTPLQARKSDALRGTARVPGDKSISHRALILGALAVGET
FT                   RISGLLEGEDVLNTAKAMRALGAKVERTGDCEWRVHGVGVAGFATPEGPLDFGNSGTGC
FT                   RLAMGAVAGSPVLATFDGDASLRSRPMRRIVDPLELMGAKVVSSSDGGRLPLTLQGARD
FT                   PLPILYRTPVPSAQIKSAVLLAGLSAPGITTVIEAEASRDHTELMLQHFGATVVTEPEG
FT                   AHGRKISLTGQPELRGAPVVVPADPSSAAFPMVAALVVPGSDIELTDVMTNPLRTGLIA
FT                   TLREMGASIEDSDVRGDAGEPMARFRVRGSKLKGVEVPPERAPSMIDEYLVLAVAAAFA
FT                   EGTTVMRGLHELRVKESDRLEATAAMLRVNGVAVEIAGDDLIVEGKGHVPGGGVVATHM
FT                   DHRIAMSALAMGLASDKPVAVDDTAFIATSFPDFVPMMRRLGAEFG"
FT   gene            complement(68497..69171)
FT                   /locus_tag="Rpdx1_0064"
FT   CDS_pept        complement(68497..69171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0064"
FT                   /product="protein of unknown function DUF374"
FT                   /note="PFAM: protein of unknown function DUF374; KEGG:
FT                   mag:amb4091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41708"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF38"
FT                   /inference="protein motif:PFAM:PF04028"
FT                   /protein_id="ADU41708.1"
FT                   /translation="MATPAFVKRITRSDAVLSLGVNFSKIYFKFVMWTGRYDRQAAPIP
FT                   EPYILAMWHGRLIMAPMLQTKSKPLVALISGHRDGKIISRVGAAFGIQTAVGSSSRGGM
FT                   RAAREMMRLGKSGHSLFVTPDGPRGPRMRINSEGVLDMARLTGLPILPVSVSLSRHKLL
FT                   RSWDRLMLPGLFAKVAIRFGEPITVEAGSPTAEIAERLQAALTAAQNETDRIVGLQPVE
FT                   AA"
FT   gene            69337..69975
FT                   /locus_tag="Rpdx1_0065"
FT   CDS_pept        69337..69975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0065"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="TIGRFAM: cytidylate kinase; KEGG: bbt:BBta_0104
FT                   cytidylate kinase; PFAM: cytidylate kinase region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41709"
FT                   /db_xref="GOA:E6VF39"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF39"
FT                   /inference="protein motif:TFAM:TIGR00017"
FT                   /protein_id="ADU41709.1"
FT                   /translation="MIIAIDGPAASGKGTLAKRLAAHYGFGHLDTGVIYRAVAKAMLDA
FT                   GADLADEARAAEVARTLDPARFDDPALKSQTVGEAASVVSAHPRVRAALVEFQQRFAAT
FT                   PPGAVLDGRDIGTVICPDADVKIFVVASAEVRAHRRFLEAQSRGEPADEAVILADILKR
FT                   DERDQNRAAAPLKQAPDAVLLDNSYLDIEGGVRAAIDIVEAVRAGRRRV"
FT   gene            70275..71972
FT                   /locus_tag="Rpdx1_0066"
FT   CDS_pept        70275..71972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0066"
FT                   /product="ribosomal protein S1"
FT                   /note="KEGG: nha:Nham_0163 30S ribosomal protein S1;
FT                   TIGRFAM: ribosomal protein S1; PFAM: RNA binding S1 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41710"
FT                   /db_xref="GOA:E6VF40"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF40"
FT                   /inference="protein motif:TFAM:TIGR00717"
FT                   /protein_id="ADU41710.1"
FT                   /translation="MASTDTYNPTRDDFAAMLDESFAGGNLQESSVIKGKVVAIEKDMA
FT                   VIDVGLKTEGRVPLREFAGPGRDNEIKVGDTVEVFLDRIENALGEAVLSRDKARREESW
FT                   GKLEKAFNNNEKVFGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVAPLMNNSQPF
FT                   QILKMDRRRGNIVVSRRTVLEETRAEQRQELVQNLEEGQVIDGVVKNITDYGAFVDLGG
FT                   IDGLLHVTDIAWRRVNHPTEVLTIGQTVKVKIIKINHETHRISLGMKQLLDDPWQGIEA
FT                   KYPLNARFTGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNMHPGKIVSTSQEVEVQ
FT                   VLEVDSVKRRISLGLKQTMRNPWEVFVEKHPVGSTVEGEVKNKTEFGLFLGLDGDVDGM
FT                   VHLSDLDWKQPGEQVIDNFKKGDMVKAVVLDVDVEKERISLGVKQLEGDPFAEPGDVKK
FT                   GAVVTCEVLDVKESGIDVQIVGTDFNTFIKRSELARDRNDQRSDRFAVGEKVDARVIQF
FT                   DKKARKVQVSIKALEVAEEKEAIAQYGSSDSGATLGDILGTALKQRDK"
FT   gene            72197..73177
FT                   /locus_tag="Rpdx1_0067"
FT   CDS_pept        72197..73177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0067"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="KEGG: bra:BRADO0095 S49 family peptidase; TIGRFAM:
FT                   signal peptide peptidase SppA, 36K type; PFAM: peptidase
FT                   S49"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41711"
FT                   /db_xref="GOA:E6VF41"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF41"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ADU41711.1"
FT                   /translation="MSLDSDVIVDRRRMRRKLTFWRVAAVAVAIVAVVAIGVMASPAGR
FT                   GTLTTTGSIARIKIEGLIRSNNDRVEALDRLGKSSYAAVIVHINSPGGTTAGSEELHDA
FT                   LVRLKAKKPMVVVVEGLAASGGYIAALASEHIIAQQTSLVGSIGVLFQYPNLSELLKTV
FT                   GVKVEEVKSSPLKAAPNGFEPTSPEARAAIESLVRDSYAWFRGMVQQSRKMTDDQLNVV
FT                   ADGRVFTGRQAVGLKLIDQLGDEKTAIAWLETAKNVKSGLPVRDYKLAPQFGDLTFLRA
FT                   AASIAFDAAGLSAVARRVEQTGAMQSVERLGLDGMLALWAPSAGQ"
FT   sig_peptide     72197..72319
FT                   /locus_tag="Rpdx1_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.813 at
FT                   residue 41"
FT   gene            73343..73657
FT                   /locus_tag="Rpdx1_0068"
FT   CDS_pept        73343..73657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0068"
FT                   /product="integration host factor, beta subunit"
FT                   /note="TIGRFAM: integration host factor, beta subunit;
FT                   PFAM: histone family protein DNA-binding protein; KEGG:
FT                   bra:BRADO0094 integration host factor subunit beta; SMART:
FT                   histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41712"
FT                   /db_xref="GOA:E6VF42"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF42"
FT                   /inference="protein motif:TFAM:TIGR00988"
FT                   /protein_id="ADU41712.1"
FT                   /translation="MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVEL
FT                   RGFGAFSVKHRPARAGRNPRTGAHVPVEQKTVPFFKTGKEMRERLNRDSGDGAPTSDTA
FT                   "
FT   gene            73695..74081
FT                   /locus_tag="Rpdx1_0069"
FT   CDS_pept        73695..74081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr0743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41713"
FT                   /db_xref="GOA:E6VF43"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF43"
FT                   /inference="similar to AA sequence:KEGG:blr0743"
FT                   /protein_id="ADU41713.1"
FT                   /translation="MQKFLTALVLIPLGLILVVFAVANRHMVDVSFDPLDPTNPLGHIR
FT                   LPLFVVIIAVAIIGVIVGGIATWFGQRRWRRAARRHQAEAIEAQNQLASLRAGLATPAQ
FT                   SEPRRLLLESGSTGSGRDKSRATL"
FT   sig_peptide     73695..73760
FT                   /locus_tag="Rpdx1_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.953 at
FT                   residue 22"
FT   gene            74140..74781
FT                   /locus_tag="Rpdx1_0070"
FT   CDS_pept        74140..74781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0070"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="KEGG: nwi:Nwi_0056 N-(5'-phosphoribosyl)anthranilate
FT                   isomerase; PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41714"
FT                   /db_xref="GOA:E6VF44"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF44"
FT                   /inference="protein motif:PRIAM:5.3.1.24"
FT                   /protein_id="ADU41714.1"
FT                   /translation="MSTIVKICGLTTADTLEAAVEAGADMVGFVFFPASPRHLDIDFAD
FT                   ALGRQVRSRAAKVALTVDADDELLDAIVEQLRPNWLQFHGSESPERVRSIKRIYGLPVM
FT                   KAIAVAGPDDLAVLPDYAAVADRILFDARPPKDATRPGGLGTAFDWKLLDGVDVKLPFL
FT                   VSGGINAGNVAEALRVTRAHGIDVSSGVETSPGEKDPDLIRDFIRAARAA"
FT   gene            74795..76009
FT                   /locus_tag="Rpdx1_0071"
FT   CDS_pept        74795..76009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0071"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="KEGG: bra:BRADO0091 tryptophan synthase subunit
FT                   beta; TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41715"
FT                   /db_xref="GOA:E6VF45"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF45"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ADU41715.1"
FT                   /translation="MNQALPNSFRSGPDERGHFGIYGGRFVAETLMPLILDLEKAYAEA
FT                   KVDPAFRAEMDSHLKHYVGRPSALYFAERLTEHFGGAKIYFKREDLNHTGAHKVNNVLG
FT                   QIMLAKRMGKPRVIAETGAGMHGVATATMCAKFGLECVVFMGAVDVERQQPNVLRMKAL
FT                   GAEVRPVTSGANTLKDAMNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQAVIGQE
FT                   VREQIMQAEGRLPDSLIACIGGGSNAMGLFHPFLDDPGVAIYGVEAAGHGLDKLHAASI
FT                   AGGKPGVLHGNRTYLLMDADGQIEEAHSISAGLDYPGVGPEHSWLNDVGRVKFLSATDT
FT                   EALDAFKLCCRLEGIIPALEPSHALAKVADLAPKLPKDHLMVVNMSGRGDKDLASVAEH
FT                   LGGQF"
FT   gene            76009..76845
FT                   /locus_tag="Rpdx1_0072"
FT   CDS_pept        76009..76845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0072"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, alpha subunit; KEGG:
FT                   bbt:BBta_0096 tryptophan synthase subunit alpha; PFAM:
FT                   tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41716"
FT                   /db_xref="GOA:E6VF46"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF46"
FT                   /inference="protein motif:TFAM:TIGR00262"
FT                   /protein_id="ADU41716.1"
FT                   /translation="MTTRIDTRFTELKQQGRPALVTFVMAGDPDLDTSLQILKALPAAG
FT                   ADVIEIGMPFTDPMADGPAIQAAGLRALKAGTTLKKTLALVRDFRATDNATPLVLMGYY
FT                   NPIYIYGVDAFLADAKAAGVDGLIIVDLPPEEDEELCLPAMKAGLNFIRLATPTTDEKR
FT                   LPAVLANTSGFVYYVSITGITGSAAADASAVGAAVQRIKRHTNLPVCVGFGIRTPDAAQ
FT                   AIAAQANGAVVGSALIDALKASLDAEGRATKATVGAVADLVASLAAGVRGAKQAAE"
FT   gene            76954..77940
FT                   /locus_tag="Rpdx1_0073"
FT   CDS_pept        76954..77940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0073"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /note="KEGG: nha:Nham_0061 acetyl-CoA carboxylase subunit
FT                   beta; TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit; PFAM: carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41717"
FT                   /db_xref="GOA:E6VF47"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF47"
FT                   /inference="protein motif:TFAM:TIGR00515"
FT                   /protein_id="ADU41717.1"
FT                   /translation="MNWLTNVVRPKIRNILRRETPENLWIKCPDTGQLVFYKDVEQNQF
FT                   VIPGSNYHMRMGALARLKSIFDNETWYDVALPEVVADPLKFRDERKYADRIKDARTKTG
FT                   AHDAVRVGFGKLETSPVVVAVQDFDFMGGSLGMAAGEAIIRGMELAVEKHAPFIMFAAS
FT                   GGARMQEGILSLMQMPRTTVAVQMLREAKLPYIVVLTNPTTGGVTASYAMLGDIHIAEP
FT                   GALIGFAGARVIEQTIREKLPDGFQRAEYLKDHGMVDMVVHRHDLRPTLARLCRLLTKS
FT                   PALTVTTAVETPAEAVVQAEPEAEAPEQKTAAPAPTEPPAQPAPPQA"
FT   gene            77937..79265
FT                   /locus_tag="Rpdx1_0074"
FT   CDS_pept        77937..79265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0074"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /note="TIGRFAM: FolC bifunctional protein; KEGG:
FT                   nha:Nham_0060 FolC bifunctional protein; PFAM: Mur ligase
FT                   middle domain protein; cytoplasmic peptidoglycan synthetase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41718"
FT                   /db_xref="GOA:E6VF48"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF48"
FT                   /inference="protein motif:TFAM:TIGR01499"
FT                   /protein_id="ADU41718.1"
FT                   /translation="MSEGSAPPASLGELRARLARLHPVAIDLTLGRIERLLAALGHPER
FT                   DLPPVIHVAGTNGKGSTVAFLRAILEAAGLAVHAYTSPHLVRVNETVRIAGRLVRDDEL
FT                   LAALTDCERINAGEPITLFEIETAAALRLFAQHPADVTLLEVGLGGRLDATNVIEHPLA
FT                   CVLTPIGIDHTEFLGPTVADIAAEKAGILRRRAPVIVAEQRDEAMEVIEREAKRLRAPL
FT                   FACGQQWHVQLEHGRLAYQDERGLLDLTAPKLFGRHQIDNAGLAIATLRAQSHFTIPQS
FT                   AYQAGLLAAEWPARMQRITSGKLLDDAPAGCELWLDGGHNADGGRVAAAALGDLEERVS
FT                   RPLVLIAGMMANKDAAAFLANFTGLTRHLIVVPIPDRAGAMAPEALADAGRALDLRVDL
FT                   AADVPAALRRIAALAYELPPRILITGSLYLAGHVLSLNGTPPS"
FT   gene            complement(79405..79725)
FT                   /locus_tag="Rpdx1_0075"
FT   CDS_pept        complement(79405..79725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0075"
FT                   /product="thioredoxin"
FT                   /note="KEGG: oca:OCAR_4481 thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41719"
FT                   /db_xref="GOA:E6VF49"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF49"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADU41719.1"
FT                   /translation="MAVGKVSDADFENEVLNAQGPVVVDFWAEWCGPCRMIAPALDEIA
FT                   GAMGDKVKIVKLNVDESPVTASKYGVMSIPTLMIFKGGEMASRQVGAAPKAKLQQWISA
FT                   AV"
FT   gene            complement(79822..83307)
FT                   /locus_tag="Rpdx1_0076"
FT   CDS_pept        complement(79822..83307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0076"
FT                   /product="double-strand break repair helicase AddA"
FT                   /EC_number="3.1.11.5"
FT                   /note="TIGRFAM: double-strand break repair helicase AddA;
FT                   KEGG: bja:bll0752 putative helicase 2; PFAM: UvrD/REP
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41720"
FT                   /db_xref="GOA:E6VF50"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF50"
FT                   /inference="protein motif:TFAM:TIGR02784"
FT                   /protein_id="ADU41720.1"
FT                   /translation="MSRAIPNEARARQEIASDPSASVFVSANAGSGKTHVLVQRVIRLL
FT                   LDGVSPERILCITFTKAAAANMAERVFTTLGHWVKLDDEELSAAIRATGIKAVGPSLLA
FT                   QARKLFACALETPGGLKVQTIHALCTRLLQQFPFEANVPARFSVLDDRDQAELMQRASL
FT                   DVLLRAAAAPDSDAGRALAFAMTSAADVTFRDVVQEACMSRDRFMAWVAQAGSVERAMA
FT                   QLSATLGVAPDDSCEAADRDIVDGPNLPRSEWAAVAATFEGGSANDQAQARRLREALAL
FT                   TDAAQIDAYLQVFFTKDSGLRKSLITKKLGDGAPGLAERLQREGARLGALLERRRALAL
FT                   RERTRALLVIAAQVAGNIAREKRERGLLDYDDLIDKTLAMLDSGAAGWVHFKLDRGVDH
FT                   VLIDEAQDTSPKQWKIVARLIDEFTAGEGARDGIKRTIFAVGDEKQSIFSFQGAVPKEF
FT                   AEWRDLLQRRFTGAGLTFEKVSFNYSFRSGAAILQSVDHVFRDPAIYRSIHADIDYPVH
FT                   ASLADAGPSLIDLWPLEVPDDRQQIEGWQAPFDAVSETSPEVRLADKVRGEISELIGRG
FT                   TRTGPVGQRRPLSYGDVLILVRRRGSAFDAVIQALKRGGIPVAGADRLKLTEHIAIIDL
FT                   MNLADALLLPQDDLALAVALKSPLFGLDDDDLFKLAWQRKGPLRAALADHAAGDQRFAA
FT                   VQRRLESYAARAQVETPFGFYAWLLGGDGADSGRARILRRLGPEANDALDEFLELALSF
FT                   EQKRAPSLQGFMAWLREADTEIKRDMEISRDEVRVMTVHGAKGLEAPVVFLIDTTSSPA
FT                   DTQRLNLIRLPGGNAAPGSVPAMVWAGRKADDPSVVEQARSAMIEETEDEYRRLLYVAM
FT                   TRAADRLIVGGCMPGNRNEVRPHSWYDLISKGLESSGLAMQSVPPDGVIKRYCRPEDVI
FT                   EETGSAMPSQEATVTSLPDWLRRPAPGLPSAEQVLRPSDAEDDDRRRLRPGESDASRSR
FT                   ALQRGTLVHRLLQSLPDIAAGDRSAAAGRFLARNAPDWNSEDRDALAAQVLGLIADARF
FT                   AAVFGPGSRAEVPIVGRLQRRGGPVLVSGQIDRLVVTETEVLIVDYKTNHAPPRVEAEA
FT                   PRAYVRQLARYRAVLGAIYPQRTVRAALLWTEAAEIMEISASALDAEQADLTVP"
FT   gene            complement(83304..86453)
FT                   /locus_tag="Rpdx1_0077"
FT   CDS_pept        complement(83304..86453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0077"
FT                   /product="double-strand break repair protein AddB"
FT                   /note="TIGRFAM: double-strand break repair protein AddB;
FT                   KEGG: bbt:BBta_0089 DNA helicase/exodeoxyribonuclease V,
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41721"
FT                   /db_xref="GOA:E6VF51"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF51"
FT                   /inference="protein motif:TFAM:TIGR02786"
FT                   /protein_id="ADU41721.1"
FT                   /translation="MHVFSVPSSAPFLRTVIAALVDGRLVDGFEARSAPERLADATLYL
FT                   PTRRAGRMAREIFLDVLGADAVLLPRIVALGDIDEDELAFAQAASGLADLEIPPALDGL
FT                   PRRLLLAQLIASWAARLKPDDPTQAPLVVGGPASALALADDLARLIDDMSTRGVDWSAL
FT                   ETLVPDAFDRYWSLTLDFLKIAGHAWPEYLKETDRIEPAARRDRLIDAEAQRLATQRSG
FT                   PVIAAGSTGSMPATAKLLTAIARLPHGAVVLPGLDVDLDDAAWDLIGGSRDRQGKLVTP
FT                   PSPNHPQYAMHGLLDRMGVTRRDVQQLGTPARHGRELLASEALRPSSATAVWHDRLKDA
FT                   DVDRLIGEGIGGLTLIEAPNSEAEALAIAVVLREAREQGKTAALVTPDRALARRVVAAL
FT                   GRWHLPVDDSGGDSLMETQPGIFARLAAEAALEGCEPATLLALLKHPLLRLGRADHGWR
FT                   RAIETLELALLRGPRPPAGCHGLAKEFAIFRIELAKLKRGEASALHPSEPRTRLSEPSL
FT                   DDAQALIAQLEAALAPLETFGPSPLDLCEIGARHRDVLKALTTDHEGIAEAFEGPQGSA
FT                   LLRAFDDLAAVGPASGVLVAARDYGEVFETAFGDRVVRRPELAEAPIRIYGPLEARLTQ
FT                   QDRVVLGGLVEGVWPPAPRIDPWLSRPMRHELGLDLPERRIGLSAHDFAQALGADEVFI
FT                   AHAAKVGGAPAVASRFLHRLEAVAGEDRWKAMKARGQIYLDYTHELDRPESVTPIAQPA
FT                   PRPPRIARPLKLPVTAIEDWLRDPYTIYAKYILRLSPLDPVDMPLSGADRGSAIHAALG
FT                   EFTERYQDAMPDDPAAALRQIGQKHFAPLMDHAEARALWWPRFLRIATWFGAWEQQRRT
FT                   GVVQVQAERRGTLMIPLGGERNFELSARADRIERRDDGSYAILDYKTGHPPTGKQVRMG
FT                   LSPQLTLEAAILRDGGFEGIPAAASVSELTYVKLSGNTPPGDERVLELKIERKDEPQHP
FT                   DDAADEARAKLEGLVRRFEDEKQSYRSLVLSMWSQRYGTYDDLARIKEWSAAGGRGDAL
FT                   S"
FT   gene            complement(86516..87238)
FT                   /locus_tag="Rpdx1_0078"
FT   CDS_pept        complement(86516..87238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0078"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: bja:bll0754
FT                   nucleotidyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41722"
FT                   /db_xref="GOA:E6VF52"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF52"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADU41722.1"
FT                   /translation="MTVRPHKAMVLAAGLGLRMRPLTDHMPKPLVRVAGRPLLDHVLDR
FT                   LAEVGVAEAVVNVHYLPDQIIDHVAGRQSPRVMISDERDQVLGTGGAVVKALPLLGDAP
FT                   FYHLNADTVWIDGVRPNLARLAEAFDPVRMDILLLMAPTAGSIGYAGKGDFAMSPDGTL
FT                   HKRKETEVVPFVYAGAAIMSPAIFQDAPQGEFSLTRMFDRAAEQQRLFGLRLDGVWMHV
FT                   GTPEAVTAAERAYLASVA"
FT   gene            complement(87387..87698)
FT                   /locus_tag="Rpdx1_0079"
FT   CDS_pept        complement(87387..87698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41723"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF53"
FT                   /inference="similar to AA sequence:KEGG:BBta_0087"
FT                   /protein_id="ADU41723.1"
FT                   /translation="MVAERNKDGRVVFDRGLRAQMMAIDGTWRRPCLIEDVSELGAKLT
FT                   IEGSVEGLNLKEFFLLLSSTGLAYRRCELSWINGDQIGVTFLRLDKKKKRPAAQVENA"
FT   gene            complement(87802..89322)
FT                   /locus_tag="Rpdx1_0080"
FT   CDS_pept        complement(87802..89322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0080"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079;
FT                   aminoglycoside phosphotransferase; KEGG: nha:Nham_0054
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41724"
FT                   /db_xref="GOA:E6VF54"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF54"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADU41724.1"
FT                   /translation="MSAAATFSVALANEAATTRLMAEVALLIGPGDVVTLSGDLGAGKT
FT                   AAARAMIRYLAADDTLEVPSPTFTLVQTYDLPPYPLLHADLYRVEDPSELEEIGLSPLP
FT                   DGTVALIEWPERAGAALPEDRIDIALSHRPALGPSARAAEITGHGKAVKQVERLAALRS
FT                   FIETAGYAEAERLHMPGDASTRSYARLQRGTESVILMNAPRRPDGPALYAGKSYSAAVH
FT                   LAEDVRPFVAIGQGLRERGFSAPAIHHADLDAGFLITEDLGSVGVVEGDPPAPVVARYQ
FT                   AATDMLAALHAKPLPDHLPLSPRESYAVPTFDEDAMMIEVGLMPEWYLPDRGVIPTEAL
FT                   RAEFVALWRKLLADIAREARTWVLRDFHSPNLIWLGDRPGIERVGIIDFQDTVLGPAAY
FT                   DVVSLLQDARIDVPEAVELSLLGRYVKARLAADSEFDAAGFARLYAVMSAQRNTRLLGT
FT                   FARLNRRDGKPHYLKHQPRVWAYLARSLAHPALAEVRAWYRAQVPPPL"
FT   gene            complement(89319..91832)
FT                   /locus_tag="Rpdx1_0081"
FT   CDS_pept        complement(89319..91832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0081"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="manually curated; PFAM: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; PAS fold
FT                   domain protein; KEGG: nwi:Nwi_0045 histidine kinase; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41725"
FT                   /db_xref="GOA:E6VF55"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF55"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU41725.1"
FT                   /translation="MSGVLGSIRRTSLSCTSLVHGLAGTAVMVASSPARAADDHLAVIT
FT                   SSLLLDLNRHEMMTLIIALAALGFSVMSAIMLVRTRQRAAAREAGLRADLQGLQAESDR
FT                   FQALLFAEPQVLISWIAGDSRPRISGDTALFLPAEPQSRQPQRILAFGTWLPPEPALQM
FT                   DHAVDALLDKGEGFLLQLVTSNGRSIEAMGRAVGGQAVVRIRELSGVRRELADMTRRFK
FT                   ALQEETEMLRGFATAAPWPIWTRRADGTLSFANAAYARATDASDAADAIGRNLELLDTG
FT                   DRAALARSLGDSAEFTGRLPIVVGGERRYFDVRALKVPGGSAGIAVDATETAALGVALE
FT                   RMADAHRRTLDQLSSGVAVFDAQRRLKFYNDSYRKLWDLDRIFLDSHPDDSTVLDRLRA
FT                   ERKLPEERDFKAWKNKLHEAYRAVEADKDVWYLPDGRAVSIVTTPNPEGGVTYLFDDVT
FT                   ESLDLKRRYGGLIDVQRETLDNLSEAVAVFGSNGCAQLFNPPFVRMWNLSAEAMQSQPH
FT                   IEAIETWCRPLFDDDVFWQALRGAITGIDDRRHVLLKLERKDGSVLACKTMPLPDGATM
FT                   LTFQDLTDTENVERALRERNEALETADRIKIDFVHHVSYELRSPLTTIIGFAHFLSDSS
FT                   TGPLTDKQAEYVNYITTSTNALMAIINNILDLASIDAGAMTLNLGPIDIRKAIDAAAEG
FT                   IQDRLARDQIALQVDVDPEIDRFVGDERRVVQVLYNLLANAVDFSPPQGTVRLTVRRGE
FT                   TRVAFTVADAGPGIAPAFKDRMFDLFESDPQGSRHRGAGLGLSLVRSFVELHGGKVEVE
FT                   STVGRGTSVTCEFPLEQSAQRHAAE"
FT   gene            complement(92051..92509)
FT                   /locus_tag="Rpdx1_0082"
FT   CDS_pept        complement(92051..92509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0082"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /note="KEGG: bbt:BBta_0084 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase; TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41726"
FT                   /db_xref="GOA:E6VF56"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF56"
FT                   /inference="protein motif:TFAM:TIGR00576"
FT                   /protein_id="ADU41726.1"
FT                   /translation="MTQVITVSIRHLPHGEGLPLPEYQTAHAAGLDLIAAVPQDAPLTL
FT                   QPGCYVLVPTGLTIALPQNYEAQVRPRSGLAARHGVTVLNAPGTIDADYRGEIGVLLIN
FT                   HGSGPFTIRRGERIAQMVIAPVSRAEFVAVEALPDSDRGAGGFGSTGR"
FT   gene            complement(92506..93951)
FT                   /locus_tag="Rpdx1_0083"
FT   CDS_pept        complement(92506..93951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0083"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; KEGG:
FT                   bja:bll0759 bifunctional
FT                   SbtC-like/phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41727"
FT                   /db_xref="GOA:E6VF57"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF57"
FT                   /inference="protein motif:TFAM:TIGR00521"
FT                   /protein_id="ADU41727.1"
FT                   /translation="MANLTIRKLDDLLKAELRQRAAANGRSMEDEVRVILRDACHKRLG
FT                   FAEPASAELSVPPAPAPDDPPDGARLQSQPGGARVTLIVGGGIAAYKAMDLIRRLKERG
FT                   ADVRVVLTKAAQQFVTPLTASALSHQRCYTDLFDPASEFDAGHIRLARDCDLIVVAPAT
FT                   ADLMAKIAGGHADDLATAILLATNRQILLAPAMNPLMWNNAATRRNVAQLRQDGVAMVG
FT                   PNAGEMAERGEAGVGRMAEPIEIAAAAEALWRPRPPKPLLGKRVLITAGPTHEPIDPVR
FT                   YIANRSSGKQGYAIAAAAAAAGAEVALISGPVELRAPADVDLTRVESAREMLAAVQSAL
FT                   PADVAIFAAAVADWRVAAEGEQKLKKGAGGPPPLQLTENPDILATISKLTESRPPLVIG
FT                   FAAETENLIDNATAKLARKGCDWIVANDVSPATGVMGGDRNTVHLLMRHGAATDLESWP
FT                   LMTKDEVATALVARIAQTMAVPA"
FT   gene            complement(94005..95582)
FT                   /locus_tag="Rpdx1_0084"
FT   CDS_pept        complement(94005..95582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0084"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="KEGG: bbt:BBta_0082 2-octaprenylphenol hydroxylase;
FT                   TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM: ABC-1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41728"
FT                   /db_xref="GOA:E6VF58"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF58"
FT                   /inference="protein motif:TFAM:TIGR01982"
FT                   /protein_id="ADU41728.1"
FT                   /translation="MIAALTHVARLGRAAFVFAREGVFGVVDPGLIPPAGQVPVRLARL
FT                   IERGGAKSGPRLSRALTRLGPAYLKLGQFLATRPDVVGVAMARDLESLQDRLPPFSQEE
FT                   AEQAIAASLERPVRDVFVSLSAPVAAASIAQVHCGEIEIDGVRKQVAVKVLRPNVSARF
FT                   RRDLSDFFYVAEKAEIYSAEARRLRLVEVINTMSRSVAMEMDLRLEAAAASEMAENTKD
FT                   DPDFRVPAVDWNRTTHNVLTMEWIDGIPLNDHARLQAANVDTVELGRKVIQSFLRHALR
FT                   DGFFHADMHPGNLFLGSDGRLVAVDFGIMGRLLPNERRFLAEILLGFITRNYRRVAEVH
FT                   FEAGYVPPHHSVENFAQAIRAIGEPIHNRTAEEISMAKLLTLLLEVTGLFDMRTRPELI
FT                   LLQKTMVVVEGVARSFDPKLDIWKVADPVVREWIQRNLGPIGKVEGALAGAGELGHTLS
FT                   GLPTIVSRAVTVLNQLEVMTKDGLVLAPETIAAIGRTERGRTRGRTVALWVIAATFIGV
FT                   LIALSRMI"
FT   gene            complement(95579..96340)
FT                   /locus_tag="Rpdx1_0085"
FT   CDS_pept        complement(95579..96340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0085"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="KEGG: bja:bll0761 ubiquinone/menaquinone
FT                   biosynthesis methyltransferase; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferase;
FT                   PFAM: UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41729"
FT                   /db_xref="GOA:E6VF59"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF59"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ADU41729.1"
FT                   /translation="MTEPGETTHFGYRDVPLDEKQTLVNDVFHSVAGRYDLMNDLMSGG
FT                   MHRLWKDVMITTLNPPRDDTPFRLLDVAGGTGDISFRAAKASGAGFHATVCDINTDMLE
FT                   VGRQRAVERNLDDKVDFVEGNAENLQFDDRSFDAYTIAFGIRNVPRIDLALKEAYRVLK
FT                   PGSRFLCLEFSSVDVPGLSKLYDLFSFKVIPEIGRVVTGDAESYQYLVESIRKFPKPYD
FT                   FAEMMRDAGFARANWQVMSGGIVALHSGWRL"
FT   gene            96585..97460
FT                   /locus_tag="Rpdx1_0086"
FT   CDS_pept        96585..97460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0086"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; KEGG:
FT                   bbt:BBta_0080 formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41730"
FT                   /db_xref="GOA:E6VF60"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF60"
FT                   /inference="protein motif:TFAM:TIGR00577"
FT                   /protein_id="ADU41730.1"
FT                   /translation="MPELPEVETVRRGLQPAMEGFRIDRAVAHRENLRFPLQKDFVARL
FT                   TGQTVTGLGRRAKYLLADLSSGDVLLMHLGMSGSFRVIEADGETTPGEFHYQRSEDRTH
FT                   DHVVFEMTSGARIVFNDPRRFGFMKVFPRSEIETEPHLKGLGPEPLGNAFDANLLAKAC
FT                   AGKQTSLKAALLDQRVVAGLGNIYVCEALFRARLSPKRKAATLANRKEEPTDHAVRLTE
FT                   AIREVLGEAIKAGGSSLRDHRQTSGELGYFQHAFKVYDREGEPCPSCGGTVQRFVQNGR
FT                   STFWCPKCQK"
FT   gene            complement(97521..98861)
FT                   /locus_tag="Rpdx1_0087"
FT   CDS_pept        complement(97521..98861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0087"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   bja:bll0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41731"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF61"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADU41731.1"
FT                   /translation="MRSMLAATLIVAGAATLAAHGAHAAPKQTTAAPPAAQTPAETAKT
FT                   LAQAERQAIQSDLAWTGDYNGLINGEVSDRMIAAIKQFQTNQGHKPTGVLNPQERGQLA
FT                   AAARKLQASVGWKLVADPVTGARLGVPTKLVPQQASDAGGTRWSSSTGTIQVALSRRKE
FT                   ADLSITKLAEQEKKQPGRKVEYSAVRPDFFVLSGTQGQKKFYIRGSFKNAEVRLLTVLY
FT                   DQATEGTMQPVVVAMSSAYDPFPAGAQAGPPPRKKVEYSTGTIVGADGAILADREAVDG
FT                   CLSIVVAGYGPADLANRSKAHELALLRIYGASDLKPLPIGGSAKPGAVEITGVADPQSQ
FT                   GGGAAVTTVKAQLTPAGSAGGLAATPAPSLGFSGAPARDADGRFAGLTTLRLPLVAGPA
FT                   DSAAAPQAALISADTVRGYLASVGVKLADGSAKDAKASVVRVICVRK"
FT   sig_peptide     complement(98787..98861)
FT                   /locus_tag="Rpdx1_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            99068..99868
FT                   /locus_tag="Rpdx1_0088"
FT   CDS_pept        99068..99868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0088"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: bra:BRADO0069 putative
FT                   molybdopterin biosynthesis protein MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41732"
FT                   /db_xref="GOA:E6VF62"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF62"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADU41732.1"
FT                   /translation="MLSAEELERYARHIVLRDVGGPGQAALKSARVLVVGAGGLGAPVL
FT                   MYLAAAGIGTLDIVDDDIVTLSNLQRQIIHATPDIGARKADSAANRIMALNPHVRVVSH
FT                   RVRLDGSNALALIGGCDLVLDGSDNFATRYLVSDACYLAKKPLVTAALGQFDGSLTTIR
FT                   AHERNAAGEPNPTYRCLFPEPPPAGTVPSCEEAGVMGALAGMLGSMMALEAIREIVGFG
FT                   EGLVGRLVMIDARAMRFETLRYSRDPQNPLNGDAPTIADLSQHL"
FT   gene            99993..101678
FT                   /locus_tag="Rpdx1_0089"
FT   CDS_pept        99993..101678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0089"
FT                   /product="protein of unknown function DUF894 DitE"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; KEGG:
FT                   bja:blr0559 MFS permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41733"
FT                   /db_xref="GOA:E6VF63"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF63"
FT                   /inference="protein motif:PFAM:PF05977"
FT                   /protein_id="ADU41733.1"
FT                   /translation="MAGTAKRGLFSGDGIAAPLRHALFRRIWLASLLSNLGLMINGVGA
FT                   AWAMTQMTASADKVALVQTALMLPIMLVAMPAGAIADMYDRRLVALAALGIGLAGATTL
FT                   AVLAHLGLVTPNILLLFCFVIGTGMALFGPSWQASVSEQVPAETLPAAVALNGISYNIA
FT                   RSFGPAVGGIVVAAAGAVAAFAANAVLYLPLLIVLLLWRRESEPPRLPPERLNRAIVSG
FT                   VRYITNSPAIRIVLTRTLVTGIAGSSVLALMPLVARDLLHSGAETYGLLLGAFGIGAVI
FT                   GALNVGIARQRMSSEAAVRLCALIMGVAMAVIAISRSPLLTAAALVIAGAVWMLAIALF
FT                   NIGVQLSAPRWVAGRSLAAFQASISGGIAIGSWGWGHVADLSGVAPSMLLSGLAMLASP
FT                   VLAFLLPMPPVGPRAEDAELLADPEVKLALTPRSGPVVIEIEYRVDADQARAFHNLMQE
FT                   VQLSRQRNGAYGWSIARDIADPELWTERYHCPTWLDYLRQRSRSTQDDRILHRRAIALH
FT                   RGPEPIRVRRMLERPFGSVRWKEESPDRAATEVLPVAGVSGGST"
FT   gene            complement(101783..102004)
FT                   /locus_tag="Rpdx1_0090"
FT   CDS_pept        complement(101783..102004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO0286 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41734"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF64"
FT                   /inference="similar to AA sequence:KEGG:BRADO0286"
FT                   /protein_id="ADU41734.1"
FT                   /translation="MLKFIVPMAAAALIAGSAEAQPQRQPDPGCGRDVSRLCRAVMNES
FT                   DGVILNCLQQNRAKLSAKCAKVLADHGQ"
FT   sig_peptide     complement(101942..102004)
FT                   /locus_tag="Rpdx1_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(102082..102423)
FT                   /locus_tag="Rpdx1_0091"
FT   CDS_pept        complement(102082..102423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0091"
FT                   /product="Phasin"
FT                   /note="PFAM: Phasin; KEGG: bja:blr3464 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41735"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF65"
FT                   /inference="protein motif:PFAM:PF09361"
FT                   /protein_id="ADU41735.1"
FT                   /translation="MADKNSSDVILNMMTKNLEQTRGAMTNYLEFIGKSMSVVPLGQSS
FT                   QATALKGYVDRNVQATFDFSQQLLHAKDFQDVVRIQTEFLQTQFRVLTDQAKEVVEMTH
FT                   PKVIVPGDG"
FT   gene            complement(102664..103068)
FT                   /locus_tag="Rpdx1_0092"
FT   CDS_pept        complement(102664..103068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: krh:KRH_09010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41736"
FT                   /db_xref="GOA:E6VF66"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF66"
FT                   /inference="similar to AA sequence:KEGG:KRH_09010"
FT                   /protein_id="ADU41736.1"
FT                   /translation="MQNWFIALAVAVLLLIGFAAGPMSVVVAFLAFWVTLYLVWARDLG
FT                   FKDTWARYGLQRVKPPFWAAENKVWFFPIFDDRTKVMKAAAVPLLIVALSLMLPTSVVR
FT                   IGTLVVLAWYCLEIYRSQKGMDQLDRARFN"
FT   sig_peptide     complement(102982..103068)
FT                   /locus_tag="Rpdx1_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.596 at
FT                   residue 29"
FT   gene            complement(103144..103485)
FT                   /locus_tag="Rpdx1_0093"
FT   CDS_pept        complement(103144..103485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4370 triple helix repeat-containing
FT                   collagen"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41737"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF67"
FT                   /inference="similar to AA sequence:KEGG:M446_4370"
FT                   /protein_id="ADU41737.1"
FT                   /translation="MRSSSMILLGAIAFVAALSVVNQGGVPHPTLIEPAIGATPVAPPV
FT                   SAFRTVTSSTCASNGCPTSCEADEALISAICIGPSSAKFSDNLSLENGQMTASCGPRSS
FT                   TIVVSCARK"
FT   sig_peptide     complement(103417..103485)
FT                   /locus_tag="Rpdx1_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.430 at
FT                   residue 23"
FT   gene            103507..104139
FT                   /locus_tag="Rpdx1_0094"
FT   CDS_pept        103507..104139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bma:BMAA1451.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41738"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF68"
FT                   /inference="similar to AA sequence:KEGG:BMAA1451.2"
FT                   /protein_id="ADU41738.1"
FT                   /translation="MITRRFATAACYQRPGISTGASFSTLKDDATATKGEHRATSPARH
FT                   RHTGRAAKIACPVPNRGPVSFPRPSGLDVTVTHQAVRVGDLPDKRNTERAGGKPADAQR
FT                   RRRGNATHRRIHLVARLLRITDPSGVLATRSVAARDSGFPGQSDSAYAANGPSRSAESP
FT                   RSESDDRTRQRRVARWSHQGGERRSDVDEAHRRHADGPGLPRHLRDR"
FT   gene            104268..104942
FT                   /locus_tag="Rpdx1_0095"
FT   CDS_pept        104268..104942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0095"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bbt:BBta_2740
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41739"
FT                   /db_xref="GOA:E6VF69"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF69"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU41739.1"
FT                   /translation="MPHPLVMSSMPRPRRHQAIDPSGENRKLRQVLGAARKLFTTHGFD
FT                   VTSMDAIAREAGVSKATLYVHFASKDALLSALVDDECRSIGPQMLWQPDGRPIELEPAL
FT                   RAIARDYTAFFLDDRGLKLHRLVMSNAARFPKMAEVFMAAGPRRCEQEVATFLRAAVAQ
FT                   QLLRIPDIGLAATQFLSLVQGRLHLQWELQLGRPSADDVAALIDGGIRVFLAAYRNPEI
FT                   RP"
FT   gene            104939..105853
FT                   /locus_tag="Rpdx1_0096"
FT   CDS_pept        104939..105853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0096"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll3835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41740"
FT                   /db_xref="GOA:E6VF70"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF70"
FT                   /inference="similar to AA sequence:KEGG:bll3835"
FT                   /protein_id="ADU41740.1"
FT                   /translation="MNNVLLLKLHRWTSLVFALPLLAVIVTGLILSLEPMLQSRGLPAG
FT                   VIDAARLTELIQRHDPDGKARGLAINATGQQMRLLGVGTGPIDLATGEAAAASDPTGDL
FT                   LLWARRTHERLLGSEWLVIASTIALTMLMAIGVLMGLPRLRNSVAGWHKGAAWFTLPLL
FT                   VLSPLTGLCIAFGLTLSSGPPPARLAVKLTDAVERVAQSHDVSRLTMIANRGGRMMARI
FT                   YEDGELRAYTFTPDGVTPLPRNWPRLLHEGNWSTWLSGTLNVVTSVVLLGLLITGVWLW
FT                   TRRKLRRRPPSRHSGGPAVAAPL"
FT   gene            105983..107125
FT                   /locus_tag="Rpdx1_0097"
FT   CDS_pept        105983..107125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0097"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: nha:Nham_0992 secretion protein HlyD; TIGRFAM:
FT                   efflux transporter, RND family, MFP subunit; PFAM:
FT                   secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41741"
FT                   /db_xref="GOA:E6VF71"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF71"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADU41741.1"
FT                   /translation="MSPVVRRPVFALVALLAASPALAQMPGGGPPAVGTITAKPQAITE
FT                   TTEINGRIQAIGRVDLTARVTAYLQEQMFVEGAEVKKGDLLFRLEQPPFESDAEAKRAA
FT                   VDQAQAQLDYADLALGRAEQLLKSNSGSQSTADNARAAQRTAAAQLRSAQAQLRQAEIN
FT                   LGYTEIRSPIDGRIGRIQITPGNVVGPSSGALATVVSQDPAYVVFPISVNRLLQLREEF
FT                   AAQGGLEAMKIRLRLPDGRLYREVGKLQFVDVSIARDTDTIILRGTIANPPLAGGGREL
FT                   THDEMVRVILEGSKPREVLAIPRAAILTDQQGNYIYVVNDHNVAERRRIKLGQSSPQTA
FT                   SVIDGLKQGEQVIVEGVQRARPNAPVTPSPAAADALPTPR"
FT   sig_peptide     105983..106054
FT                   /locus_tag="Rpdx1_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            107129..110278
FT                   /locus_tag="Rpdx1_0098"
FT   CDS_pept        107129..110278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0098"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="KEGG: nha:Nham_0993 hydrophobe/amphiphile efflux-1
FT                   HAE1; TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41742"
FT                   /db_xref="GOA:E6VF72"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF72"
FT                   /inference="protein motif:TFAM:TIGR00915"
FT                   /protein_id="ADU41742.1"
FT                   /translation="MIADTFIDRPRLAAVIALVTTLVGALALLRIPVAQLPDIVPPQVR
FT                   VSTTYPGASADVLEATVAQPIEAKVVGVDKMIYMKSSSGNDGSYTLDVSFALGTNPDIN
FT                   TVNVNNRVQNALSQLPAEVRLQGVNVQKRSSSMLQVINMYSVGQKYDQLFLTNYGLINV
FT                   LDELSRVAGVGEATLFGRYAYSMRIWFDIEKLSSLGLVPSDVVAAISAQNVQAPVGRIG
FT                   ARPVPADQQFQFNLQTQGRLTKPEEFGAIVLRANQDGSVLRVADVARVELGAQNADTYA
FT                   RLNGDPTIGIGIFLAPGANAINTAAAIRAKLDQLQSRFPESVVARVVYDSTVFVNDTIR
FT                   AVLHTLLEAFVLVALVVYLFLGNFRASLIPIIAVPVSLVGTFAVLTALGASLNTVSMLA
FT                   LVLAIGIVVDDAIVVVENVERVMEEEQDLSPADATKKAMAQVTAPIIAITLVLLSVFVP
FT                   IGFLPGIMGELFRQFAVTISAAMLISAINALTLSPALCAVFLRHTGPRRGFMQKFSRGI
FT                   DTARDGYTSTVRIALRRPALSVLAVAACGAGIWGLSLTTPSGFLPEEDQGAFFINVQLP
FT                   DGASVARTEATVIEVEKLVKQMPEVRDVLSIVGLSLLDNYSASNNAFMIVQLKPFADRK
FT                   AASSSAQALIGKTFGATQAVRTATVLPFNLPPVVGLSTAGGFQYQLESLEGAEPAAIAG
FT                   VTNGLVAAANQNPLLTRVFSTYNANAPSLYLDIDREKAQSLGITVNDIFSALQISLGGL
FT                   YINNFNLFGRTWQVNLQGDASARRDLPNLWDIYVRNAKGAMVPLQSIASVRTVTGPAVI
FT                   TRYNNYRSVTINGSPAPGVSSGTAMAAMAEVSAKTLPPGYAFEWTGTAYQEHEAVGKTG
FT                   YILALAVIFAYLFLVALYESWVIPVPVLLSVSIAVLGAFAGILIGRVTLDLYAQIGLVV
FT                   LIALAAKNGILIVEFAKEQREAGLSIKAAAEMGAKLRFRAVMMTSIAFILGLVPLVWAD
FT                   GAAMLARRNLSTPVFAGMLTASLIGIILIPMLYVVFQSLREKVAEPGVLTPLSLKRLLK
FT                   R"
FT   gene            110415..110825
FT                   /locus_tag="Rpdx1_0099"
FT   CDS_pept        110415..110825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0099"
FT                   /product="protein of unknown function DUF1078 domain
FT                   protein"
FT                   /note="PFAM: protein of unknown function DUF1078 domain
FT                   protein; KEGG: bra:BRADO6624 putative flagellar basal-body
FT                   rod protein (FlgC)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41743"
FT                   /db_xref="GOA:E6VF73"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF73"
FT                   /inference="protein motif:PFAM:PF06429"
FT                   /protein_id="ADU41743.1"
FT                   /translation="MSAIASIAVSGLNAATRRLEVSASNIANQRSTGTLPGANGTVPAG
FT                   APQAYKPLQVNQTDTSTGGTQTSLATTSPATVPVSDPQAPFADADGMVAAPNVDLAQEF
FT                   IGQMVAKYSYAANLASLQADRDMTKALLDAKV"
FT   gene            complement(110860..111918)
FT                   /locus_tag="Rpdx1_0100"
FT   CDS_pept        complement(110860..111918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0100"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: mrd:Mrad2831_4760 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41744"
FT                   /db_xref="GOA:E6VF74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF74"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU41744.1"
FT                   /translation="MMIHEDLRPDDASPYLLDVNDLVVHFRTQRKRPWGKPSFVHAVDG
FT                   VSFRVKRGTTFGIVGESGSGKSTTAQAIMRLVAATSGQVVFRGEDIMPLTGEPLRKARK
FT                   HLQIVFQDPFSALDPRRRAGDQIREPLDLLEIGSRSERDARVRKLLAEVGLPPEAADLF
FT                   PHQFSGGQRQRLCIARALAPEPELIVCDEAVSALDVAIQAQILNLLKKLQRERGLTYIF
FT                   ISHDLGVIQQFCDEIAVMYLGKIAEQAPASALFTAPRHPYTWSLVSAAVPPGPLRDELK
FT                   AKYLVKGEPPSPVDPPPGCRFAQRCPFAVDRCREELPFLDAVGHEHYAACHRKDDIGVP
FT                   DFTPRAASGPGG"
FT   gene            complement(111915..112913)
FT                   /locus_tag="Rpdx1_0101"
FT   CDS_pept        complement(111915..112913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0101"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: mrd:Mrad2831_4761 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41745"
FT                   /db_xref="GOA:E6VF75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF75"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU41745.1"
FT                   /translation="MTPVLSVENLSVSMTNRDGDLVPVLENLSFTVQKGRTIALVGESG
FT                   CGKSMTALAIMRLLPEGFVITGGRILLDGEDLLTARPKRMRALRGDKISMVFQEPMTAL
FT                   NPLYTVGDQIAEVLYYHRRLSRKDAAEQAVQFLKAVQIPAAEQRAKAYPHQMSGGMRQR
FT                   VMIAMALACRPKLLIADEPTTALDVTVQAQIFDLLAQLQDETETAIVLITHDLGAVAEL
FT                   ADEIAVLYAGRCIETGPAHQIAAAPRHPYTRGLLGCVPHLAVGVAKPDEWTDLGEIPGM
FT                   VPGLGNRGPDCAFLARCANASELCRSKPQPPLGNIEAGHAVSCWRAGEIAA"
FT   gene            complement(112916..113824)
FT                   /locus_tag="Rpdx1_0102"
FT   CDS_pept        complement(112916..113824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0102"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mrd:Mrad2831_4762
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41746"
FT                   /db_xref="GOA:E6VF76"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF76"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU41746.1"
FT                   /translation="MSTMESRLAMAQKPAPSVAKVPKAVSPAQAALRQFIKSPSGVAGA
FT                   ILLLVLLVGTAIGPFLYPVDPLDIVGMPFAPPDADALFGTDYLGRDVLAGLIYGGRATL
FT                   TVGAVAALITILIGVTVGALSGFFGGWVDALLVKIAEFFQVLPPLLFAMVLVTLFGPKL
FT                   STITLAIGAVSWTSAARLTRAEFMRLRDLDFIKASRAAGAGNLHLILRVVLPNALPPII
FT                   VSATLAIGTAILFEGGLSFLGLGDPNTMSWGLMIGQNRNYVLDAWWAVTFPGAAIFLAV
FT                   LAVSLVGDGVNDAVNPRLRRR"
FT   gene            complement(113821..114801)
FT                   /locus_tag="Rpdx1_0103"
FT   CDS_pept        complement(113821..114801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0103"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mrd:Mrad2831_4763
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41747"
FT                   /db_xref="GOA:E6VF77"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF77"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU41747.1"
FT                   /translation="MALLTHLFGKLANAVALLLAVLVMNFCLIHLAPGDPVQVIAGEMG
FT                   GASPEVIAALRAKYGLDDTLLEQLFTYLGKVVHGDFGYSYYFNEPVLNLILQRLPATLY
FT                   LAAASLVFAVLIGTLLGVISARRPNGLLSHGVTVLSLAGHAAPIFWTGLLLLLLFGSVW
FT                   PILPVSGMTDVVDRKTGIAYGLDVAKHLVLPSMTLGLVFVAQYSRLARVNMIDVLSADY
FT                   VRTARAKGLPEMVVLVKHALRNTLIPIVTVVGLQFGNLFAGAVLVETVYSWPGMGRLVF
FT                   DSILRRDYPTLMGVLFFSALMVIAANILTDLVYRLIDPRIRAGAR"
FT   gene            complement(114830..116152)
FT                   /locus_tag="Rpdx1_0104"
FT   CDS_pept        complement(114830..116152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0104"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: mrd:Mrad2831_4764 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41748"
FT                   /db_xref="GOA:E6VF78"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF78"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADU41748.1"
FT                   /translation="MTLKLVKNATFHDGKPVTSEDVAFSIMTIKANHPFKTMLAAVDSV
FT                   DAPDPHTVVIKLAHPHPALLLAMSPALMPILPKHVYGDGQDVKSHPANLKPVGSGPYKL
FT                   AEYKQGDYYTLEKFDKFFIPGRPKLDKIVVRLISDPSALMVSAERGDVHVVPYFTGVRD
FT                   IERLEKAPNIVVTDKGFAGIGALNWLAFNTKKKPLDDVRVRQAIGYAANREFIVKKLMG
FT                   GKAMASTGPIAPGSPLEEKNVEQYKFDVAKANKLLDEAGLKPDGNGARTTLTIDYIPGN
FT                   DEQQRNVAEYLRSALKRVGINLEVRAAPDFPTWAQRVASFDFDLTMDTVFNWGDPVIGV
FT                   DRTYLSSNIRKGIIWSNTQQYANPKVDEILEQAAKETSPEKRKALYSEFQKIVVADAPI
FT                   FYINVTPYHSAFAKGLGSLPTSIWGVASPLDELHWATPPKN"
FT   gene            complement(116149..116259)
FT                   /locus_tag="Rpdx1_0105"
FT   CDS_pept        complement(116149..116259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41749"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF79"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU41749.1"
FT                   /translation="MMLTKRSFVVGALGGLAMMGLPIETRAEGASGGTLR"
FT   sig_peptide     complement(116176..116259)
FT                   /locus_tag="Rpdx1_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.747 at
FT                   residue 28"
FT   gene            complement(116348..117301)
FT                   /locus_tag="Rpdx1_0106"
FT   CDS_pept        complement(116348..117301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0106"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: mrd:Mrad2831_4765
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41750"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF80"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADU41750.1"
FT                   /translation="MTAASATIPVTVIGGFLGAGKTTFVNHLLRSGGPRTAVLVNDFGE
FT                   VNVDATLIESHDGTTMTLTNGCICCSIGTSFIDTICRVLDAAVPFERIVIEASGVGDPW
FT                   KIAEIALIEPSLRLGRVIVLADASRIAQLIDDARVGDTVRSQFERCDLVLLTKIDLVED
FT                   ETLAAARATVRRLRPDVRIVEAAQGAMATLETLETAAAASGFRADAVEAAIDHSTTFKS
FT                   WAYRRAGRFDRARLACAVDKLPPQLLRLKGSCRLADEDDVKVFQMVESVWSLSPADIAQ
FT                   AETGIVLVGVGTADMPPPAELDAILDRALAPAGAVS"
FT   gene            complement(117298..118941)
FT                   /locus_tag="Rpdx1_0107"
FT   CDS_pept        complement(117298..118941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0107"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mrd:Mrad2831_4766
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41751"
FT                   /db_xref="GOA:E6VF81"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF81"
FT                   /inference="protein motif:PFAM:PF07969"
FT                   /protein_id="ADU41751.1"
FT                   /translation="MTPETVVYSARKIITMNPSRPSATHVAVRDGRIVATGSADELMVS
FT                   GARLDTRFADNVLMPGFVEGHSHIMEGLMWKQPYVGAFDRRSPEGKVVAGVPDIEAIVA
FT                   RLHQAEAEMPDDGSPLYAWGFDPLHIGGKMLTRQDLDRVSTKRPVLVVHASFHINNVNT
FT                   LTLERAELLHATNISGVVAGADGLASGELQGIPARMRLFRALGHNPLAGNITEADVRRY
FT                   AASCCVQGVTTITDLHNDLADPTIEVYRSVTSQADFGVRLVPALAAVSHTPEQAIAKLE
FT                   TLRGHAGDKLHYGIVKLVVDGSIQGFTARLRWPGYHNGAANGLWYIAPEELPRLVEAYH
FT                   RAGVQLHIHTNGDEATEVALDAIEAAQTAAPRPDHRHTLQHCQMASAAQFRRMKSLGVC
FT                   ANLFANHLYYWGDAHYELTMGPERAARLDATGTAQRIGVPFAIHSDAPVTPLAPLFTAW
FT                   CAVNRVSSSGRVLGRDTEALTTEQALAAITIGAAYTLKMDHLVGSIETGKFADFVVLED
FT                   DPLSMAPERLKDVAVWGTVIGGLIKEAPRA"
FT   gene            119031..120719
FT                   /locus_tag="Rpdx1_0108"
FT   CDS_pept        119031..120719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0108"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="KEGG: mrd:Mrad2831_4755 transcriptional regulator;
FT                   PFAM: regulatory protein GntR HTH; aminotransferase class I
FT                   and II; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41752"
FT                   /db_xref="GOA:E6VF82"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6VF82"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADU41752.1"
FT                   /translation="MRQSRVLLARFLQLGGKGFMLGITAFSCGRVSQGIVLGKLAQLTY
FT                   RESTVARAPKAGAIASPDAAALGKDELFWGALFRGLNRGGSFLQLQIRQIIVTAIEDGR
FT                   LPLGMKMPSSRDLATVLKVSRNTVVIAYEQLVDQNFLVSRQRSGYFVAGLPKKFATDPP
FT                   GLPEFTSRGDDHWADRFAVRPSAHRNIVKPLDWQTHPYPFIFGQFDPSLFPTNDWRESA
FT                   RAALSVPEINNWARDLIDGDDPALIEQLQLQVLPRRGIHARADEIMMTIGAQHALYLIA
FT                   TLFINGETKVGIEEPGYPDARNIFRMLTPNVVPLGIDAEGLVPDETFQSCAVAYVTASH
FT                   QCPTAVTMPLPRRLELLKAAAAGDVVVVEDDYEGELMPETATLPPLKSLDRASNVLYVG
FT                   SLSKALAPGLRLGYVVAPAPVIRELRALRRLMLRHPPLNNQRVAALFIGLGHYRAHLAQ
FT                   VGRVLLERAKLLDHLLPKYLPDCKFSRGPGSTNFWVTCPASIDATALAQAALDQGVVIE
FT                   PGAVFSMDETASRHCFRLGFSSIRTDRIEVGIERLGKVLAQQLES"
FT   gene            complement(120838..121626)
FT                   /locus_tag="Rpdx1_0109"
FT   CDS_pept        complement(120838..121626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0109"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   mrd:Mrad2831_4756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41753"
FT                   /db_xref="GOA:E6VG29"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG29"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADU41753.1"
FT                   /translation="MHELIAEAFASFLSTLPSPLAIAGVLSAVLAAALLRGFTGFGFAL
FT                   AAVPLMGMFMPPAKAVPVAVLLQLLGGLNDLRRNHRDCHWASLRWLIVGAVIGSPIGAL
FT                   ALSVAPAPVARIVIATITAAAVVVLGRGFAIETIPSRPVTTGVGILCGLFNGLAAMPSP
FT                   PAIVYYMSGPFRAVAVRASLLVFFLATSIAGFTSVALVGLATVNVLWLAAMALPVMVLG
FT                   TWIGEQGFRRGSERLHRRVSIASLGGVALLSAAKGISELL"
FT   sig_peptide     complement(121486..121626)
FT                   /locus_tag="Rpdx1_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.699) with cleavage site probability 0.416 at
FT                   residue 47"
FT   gene            complement(121635..123146)
FT                   /locus_tag="Rpdx1_0110"
FT   CDS_pept        complement(121635..123146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0110"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   mrd:Mrad2831_4757 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41754"
FT                   /db_xref="GOA:E6VG30"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG30"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADU41754.1"
FT                   /translation="MINIATRIDPAIAPAVSEVISQLQARHLIGNALVPSVAGATLDVV
FT                   DPATGQVIGKAPAATGDDVARAVAAASAAFPGWAATPARQRGKLIAAAARAIAEQSDVI
FT                   ATVLALETGKAIRTECRGEVATAVDITTMYAGLASELKGETLPFDPQILTYTSREPLGV
FT                   VAAILPWNVPLVLMMLKIAPALVAGNTVVVKASEEAPYATIEMARLMAKLLPDGVLNVI
FT                   CGTGRDCGAALVEHPAVAKVTFTGSQAVGELIYQMAAKKIIPVSLELGGKSPMIVYPDA
FT                   DLPRTVAGAIAGMRFTRQGQSCTAASRIYVHTKLIDAFVAALREAVSKLKIGDPLDEAT
FT                   DIGTVISQRQKAKVESYIDLGARTAGAKVDRCGELPAASHLKDGLFLQPTIITGVPEDS
FT                   PLMREEIFGPVVCVQPWDDEDDVVARANDSDFGLAATVWTNDLRSALRTVQRLDAGYVQ
FT                   VNQNLTIQPNLSYGGFRKSGLGKEASLEAMLEHFTKKKTVVIDMR"
FT   gene            123358..123765
FT                   /locus_tag="Rpdx1_0111"
FT   CDS_pept        123358..123765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0111"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   mrd:Mrad2831_4758 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41755"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG31"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ADU41755.1"
FT                   /translation="MSDLDTQRLQTLHQLFDAFNRHDGAAVMAAMTDDIVFDAAAGPEA
FT                   CGRRIVGTADVRAAFETTFATFPDVSWECTRHAVFGDRGISEWIFRATTKDGGRIEAEG
FT                   LDLFGFRGDKIFSKSAFRKDRPVLPATGASA"
FT   gene            123762..125156
FT                   /locus_tag="Rpdx1_0112"
FT   CDS_pept        123762..125156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0112"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bph:Bphy_6224 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41756"
FT                   /db_xref="GOA:E6VG32"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG32"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADU41756.1"
FT                   /translation="MNKPVKTPPLAAYDPHYDPLVSEGPGRNRDYAPTYWTANCGPLPE
FT                   DDGPISRDTDVDVAIVGSGFTGLASAVFLAREHGIKAAVLEANRVAWGCSTRNGGQGQN
FT                   AAGRLTRSQWIARWGRDVALKLHAEISDGFETFEELIRQSPIDCEPQRGGHLYIAHRQR
FT                   NFEKISAEAKVLSEVFGEPTKVISADQLRSDYLNEAEAVGATLEPRGTGVHPAKLAFGY
FT                   QQMARNLGATVHPGSPVIEITERGGAFYLRTPGGTVKARAVGIATGAYTAPGLTPLLRG
FT                   RCMPILSNSIVTRPLTPAELEATGFKTKLVLTDTRTLRYYYRLLPDNRIQIGSRSSITG
FT                   ADADHPKHLQLLIDGLHRKFPVLQGIEIDYSWWGWVDVSHDMMPRIFQPDPSQKLVYAL
FT                   GYGGNGVSYSAQAGRRMAQMIAGQRFKGQDLPIFTSPLPTHTFSPFRRIGQRMLYRWYH
FT                   YRDEAA"
FT   gene            complement(125301..125609)
FT                   /locus_tag="Rpdx1_0113"
FT   CDS_pept        complement(125301..125609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_4360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41757"
FT                   /db_xref="GOA:E6VG33"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG33"
FT                   /inference="similar to AA sequence:KEGG:Xaut_4360"
FT                   /protein_id="ADU41757.1"
FT                   /translation="MNFLVKAFYQIPVIGWLVKDAKHGSPEAPYFFLFNAVVVGAALIY
FT                   VFGYPLVITVAVAGAFAGIAGLVVLTAGDAFDKRASQPATDVRRAKPATVRPLKKAA"
FT   gene            126044..126781
FT                   /locus_tag="Rpdx1_0114"
FT   CDS_pept        126044..126781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0114"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   smd:Smed_1809 FkbM family methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41758"
FT                   /db_xref="GOA:E6VG34"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG34"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ADU41758.1"
FT                   /translation="MTALLDRLRTRLRRLFRARTVPFDGLTLVGYRHGVPKGMIHALLS
FT                   GDYEAPERAAVKAVVRPGDRIVEIGACMGVVSLTAARIVGAANVVAFEPNPAAAAVASD
FT                   NFTLNRLPVRLERAAVGSQAGTARLAIGEGSWLGAAIGGSHRTTVEVPVRAIAEVIATC
FT                   DPTVLVLDAEGMEVDILPACPMQHLRAVIAEFHLAGVDPGVIHGLRLHLGAQGFARDAA
FT                   LSTCGEMVCTEVWTRAQAATASA"
FT   gene            126796..127686
FT                   /locus_tag="Rpdx1_0115"
FT   CDS_pept        126796..127686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_3956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41759"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG35"
FT                   /inference="similar to AA sequence:KEGG:AZC_3956"
FT                   /protein_id="ADU41759.1"
FT                   /translation="MPKKLSDYTLSDWKRLRPLSQGLKTARYNRIDRRYRRQPAKLGDP
FT                   AAVAKVITGRRALFTVAYQDPQAIDLQIPLIRLFVPDALYVVVDNSPDDDRAAEIERIA
FT                   GDHGVPYLRAPENPWQKSSRSHGIVLNWIWHNIIRPGAPEMFGLLDHDLFPTAPDDPFA
FT                   PLATQNVYGYVRTTEPPSERWFLWAGFTMMRFAAVRDLPLDFGQDWFLGLDTGGGNWGP
FT                   LYSKLDLGKLQQSPSRFVPYREGLATYDGPFQWCGTWLHEVGQMGEPEIMRDKRRVVME
FT                   LLAPHLEAARNLTAR"
FT   gene            127777..130056
FT                   /locus_tag="Rpdx1_0116"
FT   CDS_pept        127777..130056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0116"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ava:Ava_1003 multi-sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; GAF domain protein; PAS fold-2 domain protein;
FT                   Phytochrome central region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; GAF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41760"
FT                   /db_xref="GOA:E6VG36"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG36"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU41760.1"
FT                   /translation="MGEPDSGGIITARNVDLSSCDRELVQYPEAIQPHGAMLTVDEQSD
FT                   RVLHASANCAAFIGKPPETVIGAPIASVLGPGWRELIGSLHRMPLDSGPVNIARESFLS
FT                   SDQGWHLFAHRCGGLIILEFENAEPETAGTTSNLYSEVRADLAALQATESVQAFFDLAV
FT                   ERIRAFTGYDRVMAYRFAEDGSGQVIAEARRDDLEPYLGLHYPATDIPAPARRLFALSW
FT                   VRHLPDVGYTPVPLLAANSPLVTGPVDMSFASLRSVSVMYTGYLKNMGVQSTLVMPLVK
FT                   EGRLWGLISAMHHAAPRHISHQMRMAAEFLAHTLSLLMSAKEDAEQFERVSARKAAADE
FT                   LTRLLTKEADVGAALRASGSLDLLNAMIDAGGIVVASGGEPATRGDTPAPGPLLELTNW
FT                   LLDHAAPVFATDRLPGIVSAAQAVAKQASGVLAVRPLPDQPMLIAWLRPEQIEDVQWAG
FT                   DPRKPVEISEADGMQRLQPRNSFALWKESVQGRAVPWRDDEKDAATRLATAIAEIVATR
FT                   KGRIERINRALDASHSELSHYTDVASAELKEHLRGIHHLTTSLRHRQGEVLDEEGRQQV
FT                   ATILKLTQRMDALVDALLDRSRGGSEAASETVDLDAVLDDALAPFARRIAEDRIDVRRP
FT                   MRLGTALGNREWIGEVFTNLIGNAIRYNDKPERWIEIGVEDRSPPRYYVRDNGVGIADA
FT                   DQQLIFQMFHRVDQPEQRADGAGVGLAMTRRIVAHHGGRIWVQSRLGEGATFYFTLAPD
FT                   GERRDA"
FT   gene            130049..131689
FT                   /locus_tag="Rpdx1_0117"
FT   CDS_pept        130049..131689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0117"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport 2 domain
FT                   protein; KEGG: app:CAP2UW1_2571 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41761"
FT                   /db_xref="GOA:E6VG37"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG37"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADU41761.1"
FT                   /translation="MRSIVRLGLSRLRPPLMLLALVFAVSTLGLMLIPGVDVQGRPWRM
FT                   TLFDAFYFVTYTATTIGFGELPHPFTDQQRGFVTVIIYLSVIGWAWLLGSLLSLVQERA
FT                   FQQALVDRRFRRAVAGLDQPFYLVCGLGDTGMTVVHALRQLGCRLIAIDKDERAVQQLE
FT                   IEGLNGKAPALIADARSPETLTAAGLMKAECKGVLTLCNDDEVNLAVAIAASILRPGLT
FT                   VIGRADSQATAASMSSLGTHRVINPFREFADHLTLAMRAPDVYRLTAWLTSAPGANLFP
FT                   SAPARMPAAPGHWIVCGYGRFGREVVAAVQRGGFTAAVIDPVGSRADGHHAVHGRGADV
FT                   AVLREAGIAHASGIVAGTDDDAENLAIAIAARRLKPDIFLIARQNLRASHMLFAKLGAD
FT                   ITMVPSEIIANQCLAALRTPLLADFLEAARQQDEFWAFTLSERLRAALGNDTPQFWSAV
FT                   LDAEHAPKLIGADGALKQPLSVAELCVDPEHQDAAHPLRRRAIVLRLIRGGSTIETPAD
FT                   DVVLQPGDTLLCVGSAAACATQQRRLGGR"
FT   gene            complement(131696..132520)
FT                   /locus_tag="Rpdx1_0118"
FT   CDS_pept        complement(131696..132520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0118"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bja:bll4141
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41762"
FT                   /db_xref="GOA:E6VG38"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG38"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU41762.1"
FT                   /translation="MKFVVLTDTHFVARGRRIYGLDPAERLTAAVARINREHPDIAFVI
FT                   VTGDLAHWGEEPAYDNLASVLAGLRAPTILMMGNHDKREAFAKFFPGVPRDTNGFVHTV
FT                   QVFEAATIVTLDTLNEAAPNHEGLLCEARLAFLEHALAEAPADRPLLLFQHHPPFDTGL
FT                   RYMDTIRLANPDAEWEVIARTRKPDYLFMGHLHRPISGVWRGIPYHIQRGLAHQVAFDL
FT                   VAEGHIPGSHEPPDYAHVSVEADRIVIHQCSFMYDGPLFSLHDSVALHRVSF"
FT   gene            complement(132517..133341)
FT                   /locus_tag="Rpdx1_0119"
FT   CDS_pept        complement(132517..133341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0119"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mlo:mll3631
FT                   3',5'-cyclic-nucleotide phosphodiesterase, CpdA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41763"
FT                   /db_xref="GOA:E6VG39"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG39"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADU41763.1"
FT                   /translation="MKLIHLSDIHLTTAGATIGGRNPRLNFERALTHILRDHHDAELMV
FT                   ITGDLSDWGDADDYRWLKAQIDAFPIPVRLCIGNHDSRETFLSVFPDYADEHGLVQAVY
FT                   DTPAGRCLLLDTAEAGTHAGRYCDTRRAWLTRQLAEHPGPFLLFMHHNPMPTHLGPMDQ
FT                   IGLLDEGAFRQIVGRHRDRIRHIFFGHCHLPLAGSVAGVPVSSLRGTNHASYPLFSERR
FT                   LLSASDLPESYGVVFFGDDYVTVHMVEFGYTGEVRVEGSPDYSAWNRETMLR"
FT   gene            complement(133406..134686)
FT                   /locus_tag="Rpdx1_0120"
FT   CDS_pept        complement(133406..134686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0120"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bmr:BMI_II1186 sugar ABC transporter, periplasmic
FT                   sugar-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41764"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG40"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADU41764.1"
FT                   /translation="MLKRWFAAAAMTLVAGIAHAQQQTEVVLQFPYPELFTETHKRIAE
FT                   EFAKVHPEIKVSFRAPYESYEEATQKVLREAVTNQLPDVTFQGLNRIRVLVDKNIPAPL
FT                   DGYIAAEKDFDKQGFHQAMYDIGTASGKVYALPFAISLPIVYVNLDLVKKAGGDVNNLP
FT                   TTWDGLLDLAKKVKALGPDSNGITYAWDITGNWLWQAPVFARGGTMLNADETKVAFDGP
FT                   EGQFAMRTIARLVTEGGMPNLDQPSLRATFAAGKTGIHITSTSDLKKTTDMIGGKFALK
FT                   TIAFPDVVKPNGRLPAGGNVVLITAKDKAKRDAAWQVVKFWTGPKGAAIMAETTGYMPP
FT                   NKVANDVYLKDFYANNPNNYTAVSQLALLTKWYAFPGDNGLKITDVIKDHLNSIVSGAR
FT                   AKEPDAVLADMTRDVQNLLPKTVGAAK"
FT   sig_peptide     complement(134624..134686)
FT                   /locus_tag="Rpdx1_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(134709..135545)
FT                   /locus_tag="Rpdx1_0121"
FT   CDS_pept        complement(134709..135545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0121"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bmr:BMI_II1187 sugar ABC
FT                   transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41765"
FT                   /db_xref="GOA:E6VG41"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG41"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU41765.1"
FT                   /translation="MIATRRSLIRSSLRHAALMFGAVLMLAPFVWMLSTASKPPDEIYS
FT                   SDLHLIPHHFALWDNLRIAFGKADLGRFLLNGVIVTVSIFALQVLIALPAAYALAKLRF
FT                   VGRKTLFALVLFGILIPPQATAIPVFLLLHQLGALDSYAALVLPFTISVFGIFLMRQFF
FT                   MTVPDDLLDAARMDGMSEFAIVWRVMLPTAIPAVTAFGIFSVVAHWNDYFWPLIVLNSQ
FT                   QYYTPPLAVAHFRNAEAGTSYGPLMAAAIVIITPLVVAFLLAQRRFIEGITLTGLK"
FT   sig_peptide     complement(135432..135545)
FT                   /locus_tag="Rpdx1_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.589 at
FT                   residue 38"
FT   gene            complement(135542..136501)
FT                   /locus_tag="Rpdx1_0122"
FT   CDS_pept        complement(135542..136501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0122"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oan:Oant_1668
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41766"
FT                   /db_xref="GOA:E6VG42"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG42"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU41766.1"
FT                   /translation="MSEVTMSDAAVALRDLDAPVTVRALTKPRRRSRGTVAYGLVAPAF
FT                   TLMMLMLLGPLAGVIALSFTDYQLGAPSFAWIGLANYQQLFADRVFWISLTNTLTYAVI
FT                   VVPGSVALGLGVAMLIESGTRFRSFYRTIYFLPVMATLIAMAIVWEFMLHPQFGLVNGL
FT                   IKMVGFAPHPWLQDRGTALYALCVIGIWQAVGFNMVLFLAGLMSIPKHLYDAAEIDGAA
FT                   SAWSRFRLVTWPMLGPVTLFVVVITGIRSFQVFDTVHVLTKGGPSKSTEVLIHTMYMEG
FT                   FEFFRSGYAAAVTVVFLGLVLLLTLVKSRLAAKQVHYA"
FT   gene            complement(136494..137648)
FT                   /locus_tag="Rpdx1_0123"
FT   CDS_pept        complement(136494..137648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0123"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sil:SPO1823 sugar ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41767"
FT                   /db_xref="GOA:E6VG43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG43"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU41767.1"
FT                   /translation="MAKIELSAIRKSFGDTEVLKGVDLSIHDGEFVSLVGPSGCGKSTL
FT                   LRVIAGLEPQSSGEVKIGGVAVDHIRPSSRNLAMVFQSYALYPHLSVFDNIAVPLRMKR
FT                   LSALERAPLLGRLLPNRYHVERGIRADVERVASQLEISPLLARKPGQLSGGQRQRVAVG
FT                   RALVREPVGFLFDEPLSNLDAKLRVHMRAEIAQLHRRLKATFVYVTHDQAEAMTMSGRI
FT                   AVMIGGELVQVGTPADVYDNPRDIRVAEFIGSPKINVLPGAVQADGRIVMLDRVLAARA
FT                   AASGGPCRVAVRPERISLGGGDLSGVVVHVENMGAEAFVHLGCEGLTDPLVIRLDDPLR
FT                   LPPIGSTQRFGFAPEAIRLFDAAGKRITVRAEASVETIREVAHV"
FT   gene            137776..138654
FT                   /locus_tag="Rpdx1_0124"
FT   CDS_pept        137776..138654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0124"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: azl:AZL_a10500 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41768"
FT                   /db_xref="GOA:E6VG44"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG44"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU41768.1"
FT                   /translation="MALTSARVRAVNAVFDAGSFAAAARRIGVTQSAVAQSVRELEGEF
FT                   GVALFERHGANLIPTSLCRQLYGATSRMQAIETDALSILSQREELAGGELRVGLGNSMP
FT                   GMALIATFKQMYPKVQIAIEIGSWSAIVAAVVDQRVDIGVLPDVPADRRFRREICLEQR
FT                   VMALCHPSHPLKKKPQVTIAELMRYPLVFRTRDSSTQRAVDRAFRTAGLRPVPSIVVNT
FT                   REGMLEAVANHLGVGFMWEHGSSRVDRIAKVPIAELDAESPECIFALAGKKGRLVELFF
FT                   LASGAHSPPRE"
FT   gene            complement(138660..139355)
FT                   /locus_tag="Rpdx1_0125"
FT   CDS_pept        complement(138660..139355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0125"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tmz:Tmz1t_1807 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41769"
FT                   /db_xref="GOA:E6VG45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG45"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU41769.1"
FT                   /translation="MSGPLLQFRGVQFGYQAPVLRGIDFDVEAGSITAVMGPSGSGKST
FT                   LLALAAGLLMPDAGAVHRRSTRLGMVFQDPALLPWRNALDNVALPLIALGPPKRERRER
FT                   ARAMLANVGLSGDDVDKYPRQLSGGMRQRVALARALVIEPDLLLCDEPFSALDALVRAE
FT                   LWRIVRDIHAHSGLTMLIVTHDGPEAMQCDRLAILSAGRLEQIGAPAEILRHPASDVVR
FT                   TFVAAATGN"
FT   gene            complement(139352..140125)
FT                   /locus_tag="Rpdx1_0126"
FT   CDS_pept        complement(139352..140125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0126"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dia:Dtpsy_2682
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41770"
FT                   /db_xref="GOA:E6VG46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG46"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU41770.1"
FT                   /translation="MRGSARISWAWSLVGIVLLLALWEAGHRAYGPLILPSLGDTAATL
FT                   WRMIRAGQVGPALLETAGNAGLGWIIGVLIGSCAGMVAGLREEAQRALQPVAIILLGVP
FT                   AIAWVVMALLWFGGRWAVVVTVAAATGPMLFAAAMEGVRSLDGTLARMARVYQVPLSAR
FT                   LTEVYGPQLLSHLFPALVTTLAMSWKVAVMAELLAGAGGIGDGLATARAHVDTAETMAW
FT                   VVVVVGVLIVVDASVLQPLQRRLWLWRDEERSGRR"
FT   gene            complement(140115..141107)
FT                   /locus_tag="Rpdx1_0127"
FT   CDS_pept        complement(140115..141107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0127"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="KEGG: sth:STH760 ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41771"
FT                   /db_xref="InterPro:IPR027024"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG47"
FT                   /inference="similar to AA sequence:KEGG:STH760"
FT                   /protein_id="ADU41771.1"
FT                   /translation="MTSPQHPLVNRRDVVCGLAALPALDLTRAFAAEPLTLWGIPATPS
FT                   ALFVRAVTSERLQQIAPGTRFQLWKSTDQMRAGIASGQFRLFATSTYAAANFFNRGAGT
FT                   RMRNVVTWGVLYVMARDLAITSVADLAGRSILLSNKNEAPDLLFRMVLRWAGLDPDRDV
FT                   RCEYVGSPGEAVPLFLAGRSDVAVLHEPAATTALLRARQDGRPVYRVLDVAELYGRHTG
FT                   RGPRIPQVGLAVSPELLNTQPEVVAAVQAACVEASNWIAAHPREAAELAAPALGLSAEV
FT                   IAASLPHVRLDVVPARQARDDIEVYFKNLMELDPGIVGGRLPDAAFYAG"
FT   gene            complement(141120..142979)
FT                   /locus_tag="Rpdx1_0128"
FT   CDS_pept        complement(141120..142979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0128"
FT                   /product="hydrogenase, Fe-only"
FT                   /note="KEGG: dvu:DVU1771 [Fe] hydrogenase gamma; TIGRFAM:
FT                   hydrogenase, Fe-only; PFAM: hydrogenase large subunit
FT                   domain protein; NADH:ubiquinone oxidoreductase, subunit G,
FT                   iron-sulphur binding; ferredoxin; iron hydrogenase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41772"
FT                   /db_xref="GOA:E6VG48"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG48"
FT                   /inference="protein motif:TFAM:TIGR02512"
FT                   /protein_id="ADU41772.1"
FT                   /translation="MCTPDQASQSARDPAEATIALLINGVACAGFANETILSCARRYDV
FT                   YIPTLCELEDIDHTPGACRVCLVEILQAGKDTAQIVTACNTPVRDGMEVQTRSKKARDM
FT                   QRLQVELLMADHLQDCATCIRHGSCELQDLAQFVGLQQNRFFDRERTESRPVDQSSPSM
FT                   VRDMRRCVRCQRCVAICRYHQKIDALAIEGSGMERVVALRDADGYPNSVCVSCGQCVLV
FT                   CPTGALGERDETERALSYICDPNVVTVVQFAPAVRVAFGEEFGMPAGTNVEGQIIAACR
FT                   KLGVDVVLDTNFAADVVIMEEGAELLARLKQGRRPTFTSCCPAWINFAEIHYPDVLPLL
FT                   SSTKSPQQVLSTIAKSYLPEQLGVSAERIRVISIMPCIAKKDEAVRPQMVHDGRPETDL
FT                   VLTTREFARLLRREGIDLKDLPSSQFDRPFLSAYSGAGAIFGTTGGVMEAAVRTIYALV
FT                   NGRELDRIELMQLRGFEGLREAVVDLGGPVGEVKVAMVHGLGDTRRLVESVLSGQANYD
FT                   FIEVMACPGGCVDGGGSLRSKKAYLPLALKRRETIYNVDRAAKVRQSHNNPQVQALYRE
FT                   LLQAPNSEIAHRLLHTHYASRKRELQHTVKEIWDDLTMSTILY"
FT   gene            complement(142984..144984)
FT                   /locus_tag="Rpdx1_0129"
FT   CDS_pept        complement(142984..144984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0129"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; NADH ubiquinone oxidoreductase, F subunit,
FT                   iron sulphur binding; KEGG: dvl:Dvul_1383 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41773"
FT                   /db_xref="GOA:E6VG49"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG49"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADU41773.1"
FT                   /translation="MTQVVYGVWDGVAYDARADEGGEARATDYALANFDEFDDGNAIRA
FT                   FIADRGFFVFDPTVSLVDALYHYLKTAAEQSCGACTPCRVGTVLVRDALDQMRRGMDAA
FT                   LTLDDIVMLGEQIRQTSLCGLGQTCAVALLAALREFRPRVERELGSHRPIPAQHGMAYV
FT                   TAPCIEACPSKINVPRYIDYIRDGKPESSLGVLLQKYPMAATCGRVCVRYCEQACRRKF
FT                   VDEAVGIKTLKRYVADQQSGPHALKFTRDMIRKPLADGMRVAVVGAGPAGISCAYHLLL
FT                   RGYHVDVFDKASQAGGMAQIGIPSYRLPKDTLALETDIIVDLGGRFLFDQRLGRDFSID
FT                   DLFARGYRAVFLGLGCQQGARLGVAGEDLAHGGYFSGIDFLLKVHDHVDGIAPLALQGE
FT                   VVVVGGGNVAMDCVRSAIRLGADKVHVVYRRTLADMPADPAEIEAARAEGVEFHVLSAP
FT                   AEIVIEHGKVTGMVLTKMQASEPDAGGRRSVKPIPGSETAIRCDVLIAAIGQQVEDGPL
FT                   IESDGIAFDRWRCVATDRLLATSRPGVFAGGDCVTGPSTLVYAMAAGLKAARNIDDWIQ
FT                   RGSVRFFKRSRMRKLIADNHMMANEIVAAPVRNAYRVHNPEIDPELRKHMFGEVEQTID
FT                   ARAAYAETQRCMRCYRVYSVVTKHPIPEGAA"
FT   gene            complement(145300..148515)
FT                   /locus_tag="Rpdx1_0130"
FT   CDS_pept        complement(145300..148515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0130"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; PAS fold domain protein; histidine kinase A
FT                   domain protein; response regulator receiver; KEGG:
FT                   bbt:BBta_0531 PAS/PAC sensor hybrid histidine kinase;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; histidine kinase HAMP region
FT                   domain protein; PAS domain containing protein; response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41774"
FT                   /db_xref="GOA:E6VG50"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG50"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADU41774.1"
FT                   /translation="MKLSTRLTLAMVALVLVTTAVLGFLNYQNVVDLVVPRALMRLHTH
FT                   AQLNALLIETSLRSTHADAVGAQSSASLRDLLTARRDSLRTTGQEPPDWRKRIEDRFVG
FT                   EMIAKPNCAILRVISPDDGGRELVRVDRLGPGGGIRAVPPDELTRRGDRAYFKEGMALP
FT                   PNRASMSRVELNKTATGLETPHVPTVRTMAPIDAADGTRLGLLVVNTDLRALLNRIRES
FT                   ADGSNIIYVVNSDGDYLLHPDRSREFGLDLGRRSRIQDDFPGLAERLVAGAEPALVTDR
FT                   NGERFGAGWDWAQLPQGPRIAVVELRPYSSLTSVKTAVRNSTIVGGTVAVLVAMLMAIP
FT                   LARSLTRPLVRITNSIEAFASNGVPVEVKSGGGHEIDVLAAAFTRMASESQRKAAALAR
FT                   EVEERSRIADVLQNTIDNMVDPVLVADARGMVILTNPAAREIFGQLSGVGVLNTTRSFD
FT                   RFDADGNPMPQDQSPLLRAYRGETIVNFEFSVRPNGSGLSSHLIANGRPLRSETGEIQG
FT                   AVMVYHDITKTKKAEDALRRSQQMARAIIDTALDAFVQLDVQGRITDWSPHAEALLGWS
FT                   RAEALGKDLGELVLAPDRSSEIKTGYRRFIDAIEHDMGVIHGHRIEVEALRRDGSMISL
FT                   EVSMAALPVEGRFVVNAFMRDLTEKIAFEEQLRQSQKMESIGQLTGGIAHDFNNMLTVI
FT                   TGTIDIISDGVADQPHLAAIAKLISEAADRGSELTRLLLAFARKQPLRPDETDVNALLA
FT                   GLQSLLRPTLGEPIEVETMLAPDTWPIYVDRGQLESALVNLAVNARDAMPKGGKLTIES
FT                   CNVVVDSDLGKRLGDLAPDDYVMIAIADTGSGIPESIRSKVFDPFFTTKEVGKGTGLGL
FT                   SMVYGFIKQSGGHITLDSEEGQGTTFRLYLPRARAESDIEAEPAIEQSAVGGTETILVV
FT                   EDDAMVRSYVNAQLKSLGYTTLSVGNATAALSIGESDTVFDLLFTDVVMPGPMNGVQLA
FT                   AEMAKLRPGLKVLYTSGYSENALIHNDRIDSDVLLLSKPYRRSDLARMIRRALANHEAE
FT                   PSRPSPVAAEPAIAGKVVSARSV"
FT   gene            complement(148834..149139)
FT                   /locus_tag="Rpdx1_0131"
FT   CDS_pept        complement(148834..149139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0131"
FT                   /product="ribosomal protein L28"
FT                   /note="KEGG: bbt:BBta_7548 50S ribosomal protein L28;
FT                   TIGRFAM: ribosomal protein L28; PFAM: ribosomal protein
FT                   L28"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41775"
FT                   /db_xref="GOA:E6VG51"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG51"
FT                   /inference="protein motif:TFAM:TIGR00009"
FT                   /protein_id="ADU41775.1"
FT                   /translation="MSRRCELTAKGAQVGHKVSHSNIKTKRRFLPNLVNVTFQSDTLGR
FT                   SVRLRVSTNALKSVDHRGGLDAYLLKASDAELSPKAVELKRAIAKKTAAAPVAAAS"
FT   gene            149444..150319
FT                   /locus_tag="Rpdx1_0132"
FT   CDS_pept        149444..150319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41776"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG52"
FT                   /inference="similar to AA sequence:KEGG:Nham_0503"
FT                   /protein_id="ADU41776.1"
FT                   /translation="MNTSIRRLLSKAVPTMIRRAGLIGLLAGCAMAAATPAAAQGKLDA
FT                   RYEASLAGIEVGKGAWVIQVDDDFYSASATGTTSGVMQAFSSGNGRGESQGRVINGQLV
FT                   PGNYMASITGGKKTETIRMTLANGNIKTSTIEPEPPPDDDRIPVTDAHRRGVIDPMTAS
FT                   FLRVPGSGDLLSPDSCRVSTPIFDGRMRYDLRMEYKRTETVKAEKGYRGPALVCAVYFN
FT                   PVSGYIPDRAAIKYLTKQRDMEVWLAPIAGTRVLAPYKLKIPTPVGNAVLEATQFVTLV
FT                   TPAKAASGPQ"
FT   sig_peptide     149444..149563
FT                   /locus_tag="Rpdx1_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.926 at
FT                   residue 40"
FT   gene            150623..153883
FT                   /locus_tag="Rpdx1_0133"
FT   CDS_pept        150623..153883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0133"
FT                   /product="helicase domain protein"
FT                   /note="KEGG: nha:Nham_0504 helicase-like; PFAM: helicase
FT                   domain protein; SMART: helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41777"
FT                   /db_xref="GOA:E6VG53"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG53"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ADU41777.1"
FT                   /translation="MPNLQSEAFTNGRAPGAGVTAVLGPTNTGKTHLAIERMVAHPSGL
FT                   IGLPLRLLAREVYNKIVDRVGPDAVALVTGEEKIKPSKPRYWVSTVEAMPRDLDVSFLA
FT                   VDEIQIAADLERGHVFTDRILRRRGRDETLLLGAATMRPMIERLLPGASIVTRPRLSQL
FT                   EYAGDRKLTRQPRRTAIVAFSADEVYAIAELIKRQHGGAAVVLGSLSPRTRNAQVAMFQ
FT                   SGDVDYLIATDAVGMGLNLDVDHVAFASDRKFDGYQFRRLTPSEFGQIAGRAGRATRDG
FT                   TFGTTGRCAPFEPELVNALQNHSFEPVKMLQWRNAELDFASLGALQVSLAEAPRHEALT
FT                   RAPIAEDMRVLDHVARDGEVREFAQGKAAVERLWDVCQVPDYRKIAPAAHAELVITLYR
FT                   FLMQKARIPDSWFAAQVDQADRTDGGIDTLSARIAQIRTWTFVANRPDWLADPEHWQGI
FT                   SRDVENKLSDALHERLTERFVDRRTSVLMRRLRENTMLNTEIGKTGEVIVEGHVIGRLD
FT                   GFTFAPDSAEAGSDAKALQATAQKALAGEIDARAEKLSNAPDDQFILTSDGTIRWTGDA
FT                   VARLVGSDDVLRPRLRIIADERLAGAPREAVQARLDLWLKTHVEKILGPLFELAKAEDV
FT                   SGIARGIAFQLIECLGVIERAKIAAEMKDLDQPSRATLRKYGVRFGAYHIYFPSLLKPA
FT                   ARALASLLWAQKQDNVDLAALSSAQHLAGSGRTSFPADKALDRDAYRTLGYRLCGERAV
FT                   RVDILERLADLIRPALAWREGAPGEKPAGAFDGRSFVVTQAMTSLTGSAGEDFASILRA
FT                   LGYRMEKRPPLPPAPKAATPAIAEPTESAVATEMTAEDQAILAGAIAFEPAPAADADES
FT                   AEAAPSVDEPAPADEPAAAASEPAPESSATEASEQPAVTADAAIETPATDGEAAEATSD
FT                   TANAEAAPKAEPDLIEVWRPGGRSDDQRPRHDRNRHRNRPQHGSATTATESESGEAKGG
FT                   RRGKGDFRRDQRRPDGEGVKREASGEGRPPRERFKGRDKFQDKYQGGPKGGRDNQGGGS
FT                   HRQVHSSAPRERDRPMDPNSPFAKLAALKEQLTAGRKD"
FT   gene            153913..154182
FT                   /locus_tag="Rpdx1_0134"
FT   CDS_pept        153913..154182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0134"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: nha:Nham_0505 RNA-binding S4; PFAM:
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41778"
FT                   /db_xref="GOA:E6VG54"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG54"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADU41778.1"
FT                   /translation="MERQRLDKWLWHARVVRARSNAAALVERGHVRINGARETSPGHGV
FT                   KIGDVLTIALDRGVRVLKVVGFTERRGDAESVTGLYADLGMPRE"
FT   gene            154257..154595
FT                   /locus_tag="Rpdx1_0135"
FT   CDS_pept        154257..154595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0135"
FT                   /product="ferredoxin"
FT                   /note="KEGG: bja:bll0157 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41779"
FT                   /db_xref="GOA:E6VG55"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG55"
FT                   /inference="similar to AA sequence:KEGG:bll0157"
FT                   /protein_id="ADU41779.1"
FT                   /translation="MTYVVTENCIKCKYTDCVEVCPVDCFYEGENMLVIHPDECIDCGV
FT                   CEPECPAEAIKPDTEPGLEKWLELNAEHAKTWPNLTQKKDAPADAKEFDGQAGKFDKYF
FT                   SSEPGSGD"
FT   gene            155110..155904
FT                   /locus_tag="Rpdx1_0136"
FT   CDS_pept        155110..155904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0136"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: bbt:BBta_7543
FT                   CarD family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41780"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG56"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ADU41780.1"
FT                   /translation="MPTKSAKTAAKPAASKTAAATKPAAKPAKAAVAPRTEVKAEVKAA
FT                   KPEVKQPAAPVQARVEEPKKAVTQRQGFKANEFVVYPAHGVGQILAIEEQEIAGAKLEL
FT                   FVINFIKDKMTLRVPTAKVGNVGMRKLSDPALVKKALETLKGRARVKRTMWSRRAQEYE
FT                   AKINSGDIVAIAEVVRDLYRSESQPEQSYSERQLYEAALDRLSREIAVVQHITETEAVK
FT                   EVESQLAKSPRRGAKAEAESEAETDSDVDGDSDDESVTDEAA"
FT   gene            complement(155987..157444)
FT                   /locus_tag="Rpdx1_0137"
FT   CDS_pept        complement(155987..157444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0137"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; Peptidoglycan-binding
FT                   lysin domain; KEGG: nha:Nham_0508 peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41781"
FT                   /db_xref="GOA:E6VG57"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG57"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADU41781.1"
FT                   /translation="MAAWLLLSAALTLAGCGDPSRFETGAITTAAPARPPRPAVQSPAA
FT                   EREHERILATYGGAYDDPKLEGLISGIVNRLVAASDRPDLTYKVTILNSGAVNAFALPT
FT                   GQLYVTRGLIALATDTSELSSVLSHEMAHVLAKHAAIREDQARQAALVTRVVTDMGNDP
FT                   GLTALALAKTKLSMASFSRQQELEADGIGIGISARAQFDPYGAARFLSAMERNAALKAN
FT                   RGSGDSRTDFLSSHPANPERVSNAQNNARQYTAPQGGWRGERGERDREAYLNAIDNIVY
FT                   GEDPSEGFVRGRRFLHPKLGFTFQVPDSFTLDNTAQAVIGLREGGNQAMRFDVVRVPAE
FT                   QSLADYLNSGWMENVDKSSTEETSVNGFPTASVTARGEQWQFRVYALRFGSDVYRFIFA
FT                   TRQRTGESDRNARDTVNSFRRLSLDEIQAARPLRIKVITVQPGDTVESLSQRMSGVDRP
FT                   LERFRILNGLDAHAQVKPRELVKIVVD"
FT   gene            complement(157515..158306)
FT                   /locus_tag="Rpdx1_0138"
FT   CDS_pept        complement(157515..158306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0138"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   nha:Nham_0509 nuclease (SNase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41782"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG58"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ADU41782.1"
FT                   /translation="MTSFRRLRRSLLAAIGAVAFGVMPDGRAEAAGCADLPVQGDGVVT
FT                   EVVDARTLRLADGREVRLTGVEPIDEQREAGAAMLRSAALGHRVVLRGADDVPDRYGRQ
FT                   PAYVLLADGAELVQARLLSAGVALVGLGVESAECLQQLRAAEAAGRSAAAGAWVGIDVI
FT                   KNAANSGDILSRLGRFTVVEGRVNSVREVGSTVYLNFAGRWTRGFAVTISRRMVGGLEA
FT                   AGLAPKSLTGQRIRVRGWVEKRAGASIAVREAGQIERTGGD"
FT   sig_peptide     complement(158220..158306)
FT                   /locus_tag="Rpdx1_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.612 at
FT                   residue 29"
FT   gene            158687..159892
FT                   /locus_tag="Rpdx1_0139"
FT   CDS_pept        158687..159892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0139"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bja:bll0144 substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41783"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG59"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU41783.1"
FT                   /translation="MKPFRTTLLACLSIAAITTASAQPQPPLKLGAILDMSGLYADITG
FT                   TGSETAAKMAVEDFGGTVLGRKIEIIAADHLNKADNAANIARDMLDNQGVEAIIDVAAS
FT                   ATALAAGEIAKARNKIIMFSGPGSIRLSNEACGPYTVHYVFDTFAQANTTGLAAVKQGL
FT                   DTWFFLSADYAFGQDLERDTTNVIKASGGKVLGSVKHPLNTSDFSSFLLQAQSSKAKVI
FT                   GLANAGGDTITAIKQGAEFGITKGGQKISPLLAFISDIDSVGLETAQGLILAEAFYWDL
FT                   NDETRAFSKRFMERTKRMPTSAQAGLYSETMHYLQAVKAAGTTDAAAVTKKMKEMPIND
FT                   FFAKNGKIREDGRMVHDMYLFEVKKPSESKGRWDYYKLLATVPGDQAFQSLEQSRCPLV
FT                   KK"
FT   sig_peptide     158687..158755
FT                   /locus_tag="Rpdx1_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            160075..160863
FT                   /locus_tag="Rpdx1_0140"
FT   CDS_pept        160075..160863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0140"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bbt:BBta_7538 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41784"
FT                   /db_xref="GOA:E6VG60"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG60"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU41784.1"
FT                   /translation="MTDIVLQTLDRGLLTITMNRPERRNALNQDMIRGLVEAAHRAKDD
FT                   PEVRAVLLKGAGGTFCVGGDVKSMAAAGDPPPLEQKVANLRRGMEVSRLLYQMPKPVVA
FT                   QIDGAAAGAGLSMALACDLRVAGASAKITTAFAKVGLSGDFGGTYFLTHLIGAAKAREL
FT                   YLTSPVLTAEQAQALGIVSRVVPDAEVEAATRELALSLAQGPTITLGYIKTNINNAESL
FT                   SLEACFDAEALHHSRCAETADHKEAASAFVEKRAPAFQGR"
FT   gene            160866..161630
FT                   /locus_tag="Rpdx1_0141"
FT   CDS_pept        160866..161630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41785"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG61"
FT                   /inference="similar to AA sequence:KEGG:bll0142"
FT                   /protein_id="ADU41785.1"
FT                   /translation="MAPFLRLRQICLVTEPIEPAASQIAAILGLNICYRDPHVGKYGLE
FT                   NVLLPVDTTLLEIVAPTQPGTAAGRFLEKTGGRGGYMAIFCCDDPDARGRHAATLGVRT
FT                   ANVIDHAPYHGVQLHPRDCRAAFIELNHTEGSDNIRGPYPPAGPDWAAAIRTDTTQALT
FT                   AVEMQSPDPADLASHWGRILELPVDRDADSVAELRLPNATFRFVQGASETMTALKFKVA
FT                   DVNKVRAAAEAQGVGCTADGFNLAGVEFRLTN"
FT   gene            complement(161802..162608)
FT                   /locus_tag="Rpdx1_0142"
FT   CDS_pept        complement(161802..162608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0142"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bja:blr0140 putative enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41786"
FT                   /db_xref="GOA:E6VG62"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG62"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU41786.1"
FT                   /translation="MSSYTDIAVEKTGHVATIEIQRPPLNFFDISLIRQIADALDEIDA
FT                   DPQVRATVLAAQGKAFCAGANFGDPARQEADPAAAKGDPADSLGEIGHLYYEAVRIFRA
FT                   KKPIVAAVHGAAIGGGLGLAVSADFRVTCAEARFSANFTKLGFHPGFGLTVTLPELIGK
FT                   NNAELMFYTSRRVTGEEAVKMGLANVLVPINEVRSGALKLAREIAECSPLGLLSTRATM
FT                   RADLADRVMQATKHELAEQTRLRATEDFKEGVKATEERRAAHFKGR"
FT   gene            complement(162641..163801)
FT                   /locus_tag="Rpdx1_0143"
FT   CDS_pept        complement(162641..163801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0143"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   bja:blr0139 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41787"
FT                   /db_xref="GOA:E6VG63"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG63"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADU41787.1"
FT                   /translation="MTAALRFDPIRLPPVCEELRKEVRAFLAEEIAAGTFDPHKPQRED
FT                   SDAPEFSRRVGMRGWLGMTWPKQYGGHERTFLERYVVTEEMRIANAPTRRFFVADRQSG
FT                   PVLLKYAPEHIKMDILPRICRGELCFAIGMSEPNSGSDLFAAKTKATKTDGGYLINGSK
FT                   IWTTSAHIADYMIAIFRTSPPTRENRRHGLTQFLVDMKSPGVKVNPIAQITGQYEFNEV
FT                   VFTDVFVPDDHLLGEVDGAWKQATSELAYERSGPERFLETYYVLTELVRALGPDPDTRG
FT                   AEGIGRLVAQLHTMRRMSVSVAGMLQAGKEPVVEASIVKDIGTIWEQQLPHRVRELAAF
FT                   VDGEASNHATLDELTAFATKLAPKLTIQGGTTEVLRGIIARGLGLR"
FT   gene            complement(163828..164892)
FT                   /locus_tag="Rpdx1_0144"
FT   CDS_pept        complement(163828..164892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0144"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   bja:blr0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41788"
FT                   /db_xref="GOA:E6VG64"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG64"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADU41788.1"
FT                   /translation="MTETDNIVVETAEKIFADLADAQTINADKAETWKAPLWQALSESG
FT                   LPLSWVPEEFGGSGASLAEGFGVLNAAGRAGLAVPLAETMLAGWLLAQGKIAAPEGAMT
FT                   VAPAHPKDRIALDADGKLSGRARSVPFAQGVRHIAVLAQSAAGATIALVPASACRIDKG
FT                   LGVGGDASDVVTLDKVAPIATAPAPQGLGQTSLMLMGAVARSLQIAGALETLLDRSVTY
FT                   ANERVAFEKKIGKFQAVQHNLAKLAGETSAALAAATSAADAISSADGFDDALFLEAAAA
FT                   KIRCAEAAEKGAAIAHQVHGAIGFTAEHILHRFSLRALAWRDDFGNESHWAVELGRMVA
FT                   KRGADDLWPLVASR"
FT   gene            165153..165935
FT                   /locus_tag="Rpdx1_0145"
FT   CDS_pept        165153..165935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0145"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bja:bll0137 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41789"
FT                   /db_xref="GOA:E6VG65"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG65"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU41789.1"
FT                   /translation="MSDGLNVIVTGSASGLGAATAKILAKDGARLVINYASSKDDAEKT
FT                   AEECRKLGAAEVIVVQGDVAKDEDCKRIVEAAAPWGKLDALVNNAGTTKHVAHHLLDQL
FT                   SADDFQRIYAINTIGPYQMVRAARELLIAGAKATGRAAAVVNVSSVAGISGIGSSIAYA
FT                   ASKGALNTMTLSLSRALAPNIRVNAICPGYIDTPWFTKGRGAEEAKQVRDMVVSRVPLK
FT                   IASTAEDIAELVCFLATPKSSSMTGELVRMDAGMHLAG"
FT   gene            complement(166001..166297)
FT                   /locus_tag="Rpdx1_0146"
FT   CDS_pept        complement(166001..166297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0146"
FT                   /product="transglycosylase-associated protein"
FT                   /note="KEGG: oca:OCAR_4055 transglycosylase-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41790"
FT                   /db_xref="GOA:E6VG66"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG66"
FT                   /inference="similar to AA sequence:KEGG:OCAR_4055"
FT                   /protein_id="ADU41790.1"
FT                   /translation="MGGLIWILVVGFVAGIIARVLSPGPNNPQGFVLTTVLGIAGAFLA
FT                   TAVGQMIGHYGPNQGAGFITATVGAVAVLFIWNRLVARRVISDPGNRYPYDPR"
FT   gene            complement(166362..166916)
FT                   /locus_tag="Rpdx1_0147"
FT   CDS_pept        complement(166362..166916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0147"
FT                   /product="protein of unknown function DUF937"
FT                   /note="PFAM: protein of unknown function DUF937; KEGG:
FT                   nha:Nham_0511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41791"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG67"
FT                   /inference="protein motif:PFAM:PF06078"
FT                   /protein_id="ADU41791.1"
FT                   /translation="MGLLDILNGMQNGPRGPADPQDKSGGMSKFTMAILALLAWKAYNH
FT                   MTSGQQQTAPANQPRPMPPPANTGGGWGDFLKGGLGGLVLGGAAGSVLSGGLGDLLRQL
FT                   QHNGLGDAADSWVGRGPNQQIGPNDLASALGADQIDAMTRQTGMSRDELLDGLSRYLPD
FT                   VVDQLTPDGRLPTDDEASRWI"
FT   gene            complement(167050..168381)
FT                   /locus_tag="Rpdx1_0148"
FT   CDS_pept        complement(167050..168381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0148"
FT                   /product="Protein of unknown function DUF2134, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2134, membrane;
FT                   KEGG: bbt:BBta_7591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41792"
FT                   /db_xref="GOA:E6VG68"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG68"
FT                   /inference="protein motif:PFAM:PF09977"
FT                   /protein_id="ADU41792.1"
FT                   /translation="MAFAEAIARFHRDRRGNIAVIFALVLIPLISAIGCAVDYSRANAL
FT                   RTKLQAAADAASVGAVSRTSPAYIAAGSMSTDGAITSGADDALRIFNGNLANLTGYTLD
FT                   SVAATVSKSGEAVTSKVTFSAQISTMFMKAVAVSSMTVGGVSTATASMPKYIDFYLLLD
FT                   NSPSMGVGATPTDVAAMVAATANKSSDDHCAFACHDVNNKNNYYNLAKALGITTRIDVL
FT                   RSATQQLMDTAAATATYTNQFRMAIYDFGASAQTAGLRNLFALSASLSSAKTAAGAIDL
FT                   MTVKGQNDNNDQDTQYTAILPAIDKLIAAPGTGAAGSPLKYLFFVSDGVADEYNPACLK
FT                   PKTGNRCQSPINPALCKTLKDRGVRVAVLYTTYLDLPSNDWYKKWIAPFNEGPYGPSPN
FT                   SEIAKNMEACASPGFYFEVSPTQGIAEAMNALFKRAVADARITS"
FT   gene            168588..168664
FT                   /locus_tag="Rpdx1_R0003"
FT                   /note="tRNA-Arg1"
FT   tRNA            168588..168664
FT                   /locus_tag="Rpdx1_R0003"
FT                   /product="tRNA-Arg"
FT   gene            complement(168795..169796)
FT                   /locus_tag="Rpdx1_0149"
FT   CDS_pept        complement(168795..169796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0149"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bja:blr0103 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41793"
FT                   /db_xref="GOA:E6VG69"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG69"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADU41793.1"
FT                   /translation="MTATVNRQILLIEKPKEKLGPEHFRLAESPIPEPKDGEALVKVRY
FT                   ISLDAANRAWMQGATYRAAVETDSVMPGGSVAEVVSSKAPGLSPGDLVFADTGWQDYAA
FT                   LPAKHLARLPKVEPMTHLLSVYGIAGLTAYFGLLDIGKPRAGETVVVSAAAGSVGSIVG
FT                   QIAKIKGCRVVGIAGGKQKCDWLVNELGFDAAVDYKDGALFKALRAAAPNGIDVYFDNV
FT                   GGDILEACLPQMNLKGRIACCGAVSQYDRTPSATGPRGIPGLIVVKRLIMQGFIVMDYM
FT                   DQRDEAVARLQEWVASGKLKVQEDVIDGLENTPAALIGLLAGENRGKRMVKV"
FT   gene            complement(169889..170839)
FT                   /locus_tag="Rpdx1_0150"
FT   CDS_pept        complement(169889..170839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41794"
FT                   /db_xref="GOA:E6VG70"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG70"
FT                   /inference="similar to AA sequence:KEGG:blr0101"
FT                   /protein_id="ADU41794.1"
FT                   /translation="MQYADRVIVRIVEAYCGARGVDVTLELDGWLIVLAKGDARHFIYG
FT                   YDFGLNSSVTHRLANDKAATADILGAAGIACVPHRLFMNHEHFKYVPDRGHWSAMLEML
FT                   RDHPAGLVLKPNEGTCGHLVFKATTELELERAAAAIFAANQNLAIAPYFDIAREVRVIL
FT                   LDRAPLVVYEKKRPAIIGDGERSALQLLIGAVPADRLGTVLANLPAGHAALDAVVPAGA
FT                   QFPLDWRHNLEFGAEPELIGDGELRATCVTIAAEAARAIGLGFGAVDVVWTAQGPRVLE
FT                   INSGVMIESLSRRFPDLAEQVYTLALDRVMQAMPA"
FT   gene            171120..172751
FT                   /locus_tag="Rpdx1_0151"
FT   CDS_pept        171120..172751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0151"
FT                   /product="Glutamate synthase (NADPH)"
FT                   /EC_number="1.4.1.13"
FT                   /note="KEGG: bbt:BBta_7493 glutamate synthase
FT                   domain-containing protein; PFAM: ferredoxin-dependent
FT                   glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41795"
FT                   /db_xref="GOA:E6VG71"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG71"
FT                   /inference="protein motif:PRIAM:1.4.1.13"
FT                   /protein_id="ADU41795.1"
FT                   /translation="MGLLLLPLSPRYIVLTVCTVITALLAAIAVIDFHTPLFAMVLAPL
FT                   LVFGALTVLGIHDLLQTSHAVLRNYPIAAHLRFLLEEMRPEMRQYFFESEKDGKPFSRD
FT                   TRALIYQRAKMELDKRPFGTQKDVYGDGYEWMHHSVAPRPHAAEPFRITIGGPDCARPY
FT                   SASVLNISAMSYGALSPNAIRALNAGARKGGFAHDTGEGGVSPYHREAGGDLIWEIGSG
FT                   YFGCRTRDGRFDPEAFARVAADDQIKMVELKVSQGAKPGHGGVLPMAKISEEIAQIRGV
FT                   GMDEDCVSPPYHKAFSTPIEMMRFIAEMRRLSGGKPAGFKLCVGHPWEFLAICKAMLAT
FT                   GIYPDFIVVDGKEGGTGAAPLEFMDHLGMPMRDGVSFVHNALVGIGARDRIKLGASGKI
FT                   ATGFDMARAMALGADWCNSARGFMFALGCIQSLSCHTDRCPTGVTTQEPTRYRALVVPH
FT                   KLERVYNYHRATLQALGELVAAAGLDHPRDIRPYHFSQRTSSSDVVSLAQLYPALRSGE
FT                   LLDGTDDARFKRAWAMARAESFAPVC"
FT   gene            complement(172837..173649)
FT                   /locus_tag="Rpdx1_0152"
FT   CDS_pept        complement(172837..173649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0152"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: nwi:Nwi_0330 creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41796"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG72"
FT                   /inference="protein motif:PFAM:PF02633"
FT                   /protein_id="ADU41796.1"
FT                   /translation="MTALPPRDWCAIRWPEIADSQPERWIAVLPLAATEQHGPHLPLST
FT                   DVDIAEAYLARVHDLLPAELPASFLPLQAIGLSTEHLAFPGTLTLSAETALRVWTEIGD
FT                   SIARAGVRKLVMVTSHGGNSAAMGLVAQELRARHRMLVVTTGWARFGVPDGLFAADELR
FT                   HGIHGGAVETSIMLAHAPALVRTDRLAEFRPASVAMEQQYRWLSAQRPAPFAWAAEDLH
FT                   PGGAIGDATAATAEKGRQLLDHGARAFCELLDDIHRFDLAALSNTPRV"
FT   gene            173778..174908
FT                   /locus_tag="Rpdx1_0153"
FT   CDS_pept        173778..174908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0153"
FT                   /product="perplasmic binding protein of ABC transporter"
FT                   /note="KEGG: nha:Nham_0425 perplasmic binding protein of
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41797"
FT                   /db_xref="GOA:E6VG73"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG73"
FT                   /inference="similar to AA sequence:KEGG:Nham_0425"
FT                   /protein_id="ADU41797.1"
FT                   /translation="MPPAFLLRALTGAVVVALLALPVHASPPPAAEKPAAEKAPPPPPP
FT                   PKKPAPPKVQPVRKVPEGGFDKISFGTNWVAEAEHGGFFQAVADGTYKAYGLDVTIVPG
FT                   GPNVNNRTLLIAGKLDFFMTANTLQSLDAVANNVPVVAIAAMFQKDPQVFVSHPEARVE
FT                   TITDLKPLTLFVSKEGITSYFQWLKSEYGFSEAKVKPYTFNPQPFIIDRRSAMQGYVTS
FT                   EPFTVEQAAKFKPSVLLLADYGLNGYSTLIETRRDLIDKNPDMIQRFVDASIVGWYHYL
FT                   YGDNSAGNAMIKQLNPEMTDEMLAYSVDKMKEYGIVDSGDAIKNGIGAMTDARYASYFD
FT                   KMARAGAVARNLDFRKAYTLQFVNKGIGVDLRPKQK"
FT   sig_peptide     173778..173855
FT                   /locus_tag="Rpdx1_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            174917..175747
FT                   /locus_tag="Rpdx1_0154"
FT   CDS_pept        174917..175747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0154"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bbt:BBta_7481 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41798"
FT                   /db_xref="GOA:E6VG74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG74"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU41798.1"
FT                   /translation="MASSPRSSAADADATGPAIELRRITKTYRSGTLALGPVDLDIGRG
FT                   EFVSLLGPSGCGKSTALRMIAGLTRPSSGRIEVGTASPRGRGEHPVGFVFQEPTLMPWA
FT                   SVRHNVALPLKLAHVAGAEIDRRVDEVLARVDLSDFADAFPRELSGGMKMRASLARALV
FT                   TRPDILLMDEPFAALDEITRFRLNDDLLTLWDELQMTVVFVTHSVFESVYLSQRVVVMT
FT                   PRPGRIAATFDIDAPRSRGEEFRLSADYAARCREVSRALASSSEPARPSAVART"
FT   gene            175753..176568
FT                   /locus_tag="Rpdx1_0155"
FT   CDS_pept        175753..176568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0155"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: nha:Nham_0427
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41799"
FT                   /db_xref="GOA:E6VG75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG75"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU41799.1"
FT                   /translation="MPASRDDVQPLGARAGLRVVLPVVVLLAVIVAWDLVVRLNQIPPY
FT                   VLPGPLLVASTLIQDWPVLFGSLLTTLRTTLEGFVAAAAGGIALGLLFNQSRLLEFSLF
FT                   PYAVVLQVTPVIAIAPLLLIYLPQETAVIVCAWIVAFFPVLSNTTLGLNSVDRNLAGLF
FT                   RLYGASRWQTLLRLKLPAALPYILGGLRIAGGLSLIGAVVAEIAAGSAGAGSGLAYRIA
FT                   ESGYRLNIPRMFAALLLLSTAGIVIYLLLALVSHLLLRRWHESALGKDN"
FT   gene            176568..177554
FT                   /locus_tag="Rpdx1_0156"
FT   CDS_pept        176568..177554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0156"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: nha:Nham_0428 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41800"
FT                   /db_xref="GOA:E6VG76"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG76"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADU41800.1"
FT                   /translation="MPGETDASGPIDLLVYGPRKEVIDQGFPAGYVLHKCERADDLDGL
FT                   SEEVRGRIRGIAVTGLVPTGAAMLAGFPKLEIVASFGVGYDHVDAAWAAQHGVVVTNTP
FT                   DVLTEEVADTALGLLIATLREFVRADKYVRAGLWQTQDYPLSTGSLRDRKVGMVGMGRI
FT                   GQAIARRLDASLVPVVYHSRNPAAGVAYQHYPNLIEMAKEVDTLVVITPGGPATAKLIN
FT                   ADVLDALGPRGVVINVARGSVIDEDALIAALRSGRILAAGLDVFAAEPNVPEELRTMAN
FT                   VVLLPHIGSASVVTRNAMNQLVVDNLKAWFSGRPPLTPVAETPVKGR"
FT   gene            177557..178240
FT                   /locus_tag="Rpdx1_0157"
FT   CDS_pept        177557..178240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41801"
FT                   /db_xref="GOA:E6VG77"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR021140"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG77"
FT                   /inference="similar to AA sequence:KEGG:Nham_0429"
FT                   /protein_id="ADU41801.1"
FT                   /translation="MGRAIGTLILTALLAATATAQDASKMKQDLVGQWELATAERSKTC
FT                   VVTLASEPAAKGLKLTLEPDCAKTLPFTKEIAAWDVKGLDIVRLQTADGEPVIDLTEVE
FT                   SGIFEGHRNGEGIYILQNLVAARSLAKSMDQMIGDWTMVRGNGRQICALTLTNTEAGTD
FT                   NFQAFLKPRCDPLVAGFGPTMWRLEHGAMLLIAPNGTTWRFEADDNAQWRRMPDSADPL
FT                   IMLRQ"
FT   sig_peptide     177557..177619
FT                   /locus_tag="Rpdx1_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            178385..179818
FT                   /locus_tag="Rpdx1_0158"
FT   CDS_pept        178385..179818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0158"
FT                   /product="protein of unknown function DUF1254"
FT                   /note="PFAM: protein of unknown function DUF1254; protein
FT                   of unknown function DUF1214; KEGG: rle:RL1126 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41802"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG78"
FT                   /inference="protein motif:PFAM:PF06863"
FT                   /protein_id="ADU41802.1"
FT                   /translation="MVGWLKAMSAAATAALLLMTAPARCEPAPVSDEEALSLGIDAYLY
FT                   FYPLVTMDLTRKQSTNVEAGKEFGKGPMNSFVSVPAYPPADFKTIVRPNFDTLYSIAWL
FT                   DLSREPMVVTAPDTNGRYYLLPMLDMWTDVFASPGWRTTGTQAQKFLITAPGWSGTVPA
FT                   GMQRIEAPTPIVWIIGRTKTDGPADYAAVHQIQAGYTATPLSQSGKPPAPPAAFVPDPA
FT                   IDMKTPPKLQVDTMPAGQFFAYAAELLKQHPPHLTDQPIIARLRRIGLEPGKSFDLGKA
FT                   APHVRKAFAAAPGEALKLMSWKMPTMARVVNGWSMNIDTMGVYGNYYLKRAIVAQFGLG
FT                   ANVPEDAIYPVNFVDDAGKPLDGASNYVLHFGKGATPPVDAFWSLTLYDPDGFPVPNPL
FT                   QRQALSSWMPLKHNADGSLDLLIQNASPGTAHESNWLPAPKGPFTLTMRMYAPKQEALT
FT                   GRWAPPAVTRVQPPIPLGQ"
FT   gene            complement(179874..181367)
FT                   /locus_tag="Rpdx1_0159"
FT   CDS_pept        complement(179874..181367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0159"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="KEGG: bra:BRADO0028 succinate-semialdehyde
FT                   dehydrogenase [NADP+] (SSDH); TIGRFAM: succinic
FT                   semialdehyde dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41803"
FT                   /db_xref="GOA:E6VG79"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG79"
FT                   /inference="protein motif:TFAM:TIGR01780"
FT                   /protein_id="ADU41803.1"
FT                   /translation="MSPTAATRTADRAASLRDRLKDSSLLREQCFIDGAWSGTARIAVT
FT                   NPASGQTIARVPHLGAAEATQAVEAAAQAFPAWAKLTAKQRSNILRKWFELIIANREDL
FT                   ALILTSEQGKPLTEALGEVDIGAAYVEFFAEEARRVYGETIPTQRPDARLIAIKQPIGV
FT                   CGAITPWNFPSSMITRKVSPALAAGCTVVLKPAEETPLSAFALAALAEKAGVPKGVFNV
FT                   LTGDAPEIGKVLCEHPAVRFVGFTGSTEVGKILYKQASVGVKKLGLELGGNAPFIVFDD
FT                   ADVDAAVEGAMVSKYRNMGQTCVCANRLYVQDGVYDAFVEKLAAKVKAMKVGDGTEQGV
FT                   TQGPLINEAAVEKTERHIADALSNGAKVITGGKRHPLGGTFFEPTVLADVRPDALVAHE
FT                   ETFGPLAPVFRFKDEAEVIKLANNSPFGLASYFYARDLGRVWRVAEALESGMVGVNTGL
FT                   ITTEVAPFGGVKESGLGREGSHHGIEEYVEIKYVMMAGI"
FT   gene            complement(181524..181850)
FT                   /locus_tag="Rpdx1_0160"
FT   CDS_pept        complement(181524..181850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr0806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41804"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG80"
FT                   /inference="similar to AA sequence:KEGG:blr0806"
FT                   /protein_id="ADU41804.1"
FT                   /translation="MIPTWSDWKRYPQPGRGGNIEAPISPGIYEVRYAQTGALYGFEAV
FT                   DNLAVALAQLPVRSRAGSWFGRRAAQPFPELEYRVCATASRAHARTAADRMINLRSTWI
FT                   AGAA"
FT   gene            182095..183282
FT                   /locus_tag="Rpdx1_0161"
FT   CDS_pept        182095..183282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0161"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: bja:bll0805 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41805"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG81"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADU41805.1"
FT                   /translation="MQSSSQIDQSLRQMSENGAIPGVVAIAGNAQDVLYQGAFGKRDLS
FT                   KPPAMTTDSVFWIASMTKAITAAAAMQLVEQGKLSLDEPIGKVLPDLAEPLVLDGFDAD
FT                   GTPKTRPAKSPITLRQLLTHTAGFCYDMWNADMVKYMERHGIPGIIGCQEAALKTPLAS
FT                   DPGTRWEYGINIDFAGKAVEAASGMKLDAYLRDHLFAPLGMTDMGFKITDEQRNRLVAV
FT                   HARGEDGSLSPIPFEVAQEPEFHMGGGGLYGTAADYLKFTQMILNKGRGNGNQVLKPET
FT                   VALMGQNHIGDLNVTRLNSAIPFATNDVDLYPGMDKKWGLSFLINTEATPEGRSPGSLA
FT                   WAGLANTYYWIDPARDVCGVILMQVLPFADAKCLEAFGAFERGVYAGLGAGQQAA"
FT   gene            183415..185109
FT                   /locus_tag="Rpdx1_0162"
FT   CDS_pept        183415..185109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0162"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   met:M446_2319 AMP-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41806"
FT                   /db_xref="GOA:E6VG82"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG82"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADU41806.1"
FT                   /translation="MTPATPSYVCGVSDAPLLGITIGQALDRAATLWPDREALVSPSHD
FT                   TRWTWREFAARVDALAAGFVALGLERGARIGIWSMNRPEWTLTQFAAAKAGLILVTINP
FT                   AYRLSELEFALAKVGCAALVTATAFKTSHYMEMLNTLIPELATSSPGALQSAKLPKLRT
FT                   VIQIGGPKCPGTIAFDEVATMGGARHRDQIAAFASELQFDDAVNIQFTSGTTGSPKGVT
FT                   LTHHNILNNGYFVGRAMKLTEVDRICIPVPLYHCFGMVMGNLASVTCGAAMVYPGEGFD
FT                   PLVTLQTASREKCTALYGVPTMFIAELDHPEFAGFDLSSLRTGIMAGAPCPVEVMRRVN
FT                   DAMNMREVTIAYGMTETSPVSFQSAVDDPEDRRVSTVGRIHPHVEVKVVDLDGKIVPRG
FT                   TRGELCTRGYSVMLGYWDEPEKTADVLDAAGWMHTGDLATIDDEGFCNIVGRIKDMVIR
FT                   GGENLYPREIEEFLYRHPKIQDVQIFGVADDRYGEELCAWVRPRPGESLTADDVRAFCQ
FT                   GQIAHNKIPRYIEFVDEFPMTVTGKIQKFIMREKVEAKLGLKAAKTA"
FT   gene            complement(185270..186271)
FT                   /locus_tag="Rpdx1_0163"
FT   CDS_pept        complement(185270..186271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0163"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: nha:Nham_0010 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41807"
FT                   /db_xref="GOA:E6VG83"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG83"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADU41807.1"
FT                   /translation="MSSAQYDVLAIGNAIFDVLVRTEEDFLVKHGMAKGGMALIDEARA
FT                   AAIYADMGQATEMSGGSAANTIVGLASFGARTAYLGKVKDDQIGKLYSHDIRAAGVTFD
FT                   TKPATAGPATGCSYILVTPDGQRTMNTYLGAAQDLSPADIDEAKIAASAIIYLEGYLWD
FT                   PPQAKEAFLKASKIAHGAGRKVALTLSDAFCVDRYRGEFLELMRSKTVDLIFANEAELH
FT                   SLYQTSDFDAALTQLAQDVALGVVTRSEKGCAVVDKDGVTLVPAASIEKLVDTTGAGDL
FT                   FAAGFLFGLVRDLGYENAGRLGALAAAEVIQHIGARPQVSLKELAQQHGLAV"
FT   gene            186550..188106
FT                   /locus_tag="Rpdx1_0164"
FT   CDS_pept        186550..188106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0164"
FT                   /product="integral membrane protein MviN"
FT                   /note="KEGG: bja:bll0803 putative virulence factor;
FT                   TIGRFAM: integral membrane protein MviN; PFAM: virulence
FT                   factor MVIN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41808"
FT                   /db_xref="GOA:E6VG84"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG84"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ADU41808.1"
FT                   /translation="MLRPLLTVSAGTLSSRLLGFVRDALVAALLGAGVVADAFLLAFQL
FT                   VNVTRRLLTEGALNAALVPAWLKVREHNGAAAAAAFAGRLLGTIALATLLMAILLGVFM
FT                   PLLIAMLAPGFVGQPALLMATRDARLMLPYLAFAGPVAVMMGLFNAQGRVGLTAFSPLL
FT                   FNVSLIVVTAALLIGHDDPATAALILSGTVGVAGLLQLSILAFNGRGERLASPLRAGFD
FT                   AAMRTFFAKAIPGMIANSGPQLLIVAGAIIASAQPAAVSWLYFANRLIELPLGIVGVAM
FT                   GAVLVPELARAVRGGDRTALSDAASRGLELAVGVALPATFGLIVLAEPTVRLLFEHGAF
FT                   SAADSAATAQALAVLAIGLPAQVLAKNWSAAFFAREDTHTPLMATLISVTVALAAAVVL
FT                   GRLFGASGVAVAISLGAWSNAALLLGRGVQRFGVTIDAPAQRRLMLIVLAAGAMGALLW
FT                   QASGFVLPIAVAGSTLVQAAVLAVLVGGGVTVYAAALILLGVVRPNAALRALRRPRGLR
FT                   D"
FT   gene            188162..189214
FT                   /locus_tag="Rpdx1_0165"
FT   CDS_pept        188162..189214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0165"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; KEGG:
FT                   nha:Nham_0012 tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41809"
FT                   /db_xref="GOA:E6VG85"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG85"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ADU41809.1"
FT                   /translation="MAITQRVFSGIQPTGNLHLGNYLGAIVNFVKMQETHNCVYCVVDL
FT                   HAITVPVTVWGGPDELRKNIREVTAAFIASGIDPKKQIIFNQSQVAEHSELAWVLNCIA
FT                   RLGWLNRMTQFKEKAGKDRENVSVGLYDYPVLMAADILVYRATHVPVGEDQKQHVELTR
FT                   DIAQKFNNDFAASIAAQGFGDAYFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRI
FT                   NLTDDADAIAQKIRKAKTDPEPLPSEEKGLEPRPEADNLVGIYAALAGKPKAEVLTEFG
FT                   GAQFSAFKSNLVDLAVAKLSPIAGEMKRLSADHAYVDSVLADGSDRARAIAAETMVAVK
FT                   DIMGMVRKKG"
FT   gene            189425..189919
FT                   /locus_tag="Rpdx1_0166"
FT   CDS_pept        189425..189919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0166"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41810"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG86"
FT                   /inference="similar to AA sequence:KEGG:Nwi_0008"
FT                   /protein_id="ADU41810.1"
FT                   /translation="MSSQRRSYESGHKPKCLVIVDDTAEWDRAVYYGSRWAVRVGGGVV
FT                   MLRVIEILDKNQQWLGVADVMRAEAIETAELALDRASGRANGVAGITPERVIREGDTIG
FT                   QVREAIEQDVDIVMLVLAADDGPDGPGPIVSAMVRHLGTFPVPVMMVASNLTDDDIDAL
FT                   A"
FT   gene            190062..190628
FT                   /locus_tag="Rpdx1_0167"
FT   CDS_pept        190062..190628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0167"
FT                   /product="Scaffold protein Nfu/NifU"
FT                   /note="PFAM: Scaffold protein Nfu/NifU; nitrogen-fixing
FT                   NifU domain protein; KEGG: bbt:BBta_0040 putative NifU
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41811"
FT                   /db_xref="GOA:E6VG87"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG87"
FT                   /inference="protein motif:PFAM:PF08712"
FT                   /protein_id="ADU41811.1"
FT                   /translation="MFIQTEPTPNPATLKFIPGRSVLDSGTLEFTDAAQAARSPLAARL
FT                   FDIDGVSGVFYGADFVTVTKDRGEWQHLKPAILGAIMEHYMSGAPILADGKSDGDDGDD
FT                   DEFYAEGDAETVEIIKDLIETRVRPAVANDGGDITFRGFKDGIVYLNMRGACAGCPSST
FT                   ATLQHGIQNLLKHFVPEVVEVRPLA"
FT   gene            190764..191459
FT                   /locus_tag="Rpdx1_0168"
FT   CDS_pept        190764..191459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0168"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   nha:Nham_0018 peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41812"
FT                   /db_xref="GOA:E6VG88"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG88"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADU41812.1"
FT                   /translation="MLILAIDTALDACAAAVLDTEANRLLAGESQAMQRGHAEALMPLL
FT                   GRVMDASGLGFLDIDRIAVTTGPGSFTGLRVGLSAARGIALAAAKPVVGLTTLSAFAAP
FT                   LVSETDDTPILSVIDARHDHVYYQLVAGNGTMIVRPRVAPIAEALEAARYGAPRLVGNA
FT                   AQLVAERWPAMTPPPLAVDQRPAPDIGWLAWLGAAATPEAAPAKPFYLRPPDAKPKLDP
FT                   IAQSAQPAA"
FT   gene            191512..191997
FT                   /locus_tag="Rpdx1_0169"
FT   CDS_pept        191512..191997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0169"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="KEGG: bja:bll0798 putative acetyltransferase;
FT                   TIGRFAM: ribosomal-protein-alanine acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41813"
FT                   /db_xref="GOA:E6VG89"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG89"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADU41813.1"
FT                   /translation="MMTWLAEFWGYADAVVEQATLRDAPKLAELHAASFHRGWDEQEFA
FT                   DLLSERNTLVHRLRVGRRIIGFVASRIGADEAEILSIAIAASYRGRGLSREMLRTHLGH
FT                   LAGRGVATVFLEVEENNQPARRLYDRTGFRVVGRRERYYRQPNGEQLNAMIMRRDLS"
FT   gene            192060..192491
FT                   /locus_tag="Rpdx1_0170"
FT   CDS_pept        192060..192491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0170"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: bra:BRADO0039
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41814"
FT                   /db_xref="GOA:E6VG90"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG90"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADU41814.1"
FT                   /translation="MSEPKATEIEARCAATGMRMTEQRRVIARVLADSQDHPDVEELYT
FT                   RCVAIDDKISISTVYRTVKLFEDAGIIERHDFREGRARYEQMRDSHHDHLINLRDGKVI
FT                   EFTNEEIEKLQAEIARRLGYKLVDHRLELYCVPLEDEKS"
FT   gene            192577..193236
FT                   /locus_tag="Rpdx1_0171"
FT   CDS_pept        192577..193236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0171"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: bja:bll0796 hypothetical protein; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41815"
FT                   /db_xref="GOA:E6VG91"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG91"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADU41815.1"
FT                   /translation="MTPDLVIFDCDGVLVDSELISCRVHAETLTRYGYPITPDQVAARF
FT                   LGRSGREARREIEAELGRPFADDLETHLLDELLRAFAETLQPIPFVSAALDALGRPFCV
FT                   ASSGTLDRIRVALTHAGLHARFAPHLFSAEQVARGKPAPDLFLFAAARMGAPPERCVVI
FT                   EDSVPGVLGAKAAGMTVLGFHGGSHCVGATAAALRAAGADRCFADMRQLPRIIEEI"
FT   gene            193354..194745
FT                   /locus_tag="Rpdx1_0172"
FT   CDS_pept        193354..194745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0172"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="TIGRFAM: RNA modification enzyme, MiaB family;
FT                   tRNA-i(6)A37 thiotransferase enzyme MiaB; PFAM: Protein of
FT                   unknown function UPF0004; Radical SAM domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; KEGG: bja:bll0795
FT                   hypothetical protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41816"
FT                   /db_xref="GOA:E6VG92"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG92"
FT                   /inference="protein motif:TFAM:TIGR00089"
FT                   /protein_id="ADU41816.1"
FT                   /translation="MSPPRKLHIKSYGCQMNVYDAQRMVDALAPEGFVETANVDDADLV
FT                   ILNTCHIREKASEKVYSELGRLRVARDEAASHGRRMQIAVAGCVAQAEGEEIIRRAPVV
FT                   DVVVGPQSYHNLPQLLARANRDGRALETEFPIDDKFGVLPQPAPDAIRARGISAFVTVQ
FT                   EGCDKFCTFCVVPYTRGAEMSRPVAAIIADVQRLADHGVREVTLIGQNVNAYHGDGPNG
FT                   GAWSLGRLVRRLAEIPGIVRLRYSTSHPNDVDDDLLTAHRDLPALMPFVHLPVQSGSDR
FT                   ILAAMNRKHTADDYRRVIDRFRAASDAIAFSSDFIVGFPGETERDFSATLALVAQIGYA
FT                   GAYSFKYSPRPGTPAAEMPEMVPAAVMDERLERLQQLIDQQQAAFNKAAIGRTVEVLFE
FT                   RAGRKPGQIVGRTAYLQPAHVMAPDSIVGQVLPVRVDSLERYSLLGELASATSRPADAM
FT                   AATGA"
FT   gene            194752..195810
FT                   /locus_tag="Rpdx1_0173"
FT   CDS_pept        194752..195810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0173"
FT                   /product="PhoH family protein"
FT                   /note="KEGG: nha:Nham_0022 PhoH-like protein; PFAM: PhoH
FT                   family protein; K Homology, type 1, subgroup; SMART: KH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41817"
FT                   /db_xref="GOA:E6VG93"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG93"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ADU41817.1"
FT                   /translation="MVRSAPESSSLVSRRKPDRDSLNPPETQVVIDFDDNRAASALVGP
FT                   YGQNLAQIERKLGVVVDSRGNHISIGGSREGCDAARRVLETLYAQAVSGHDLSQGDVEG
FT                   AIRAVIAQGSLFEFDTKQPSGTAFEAINLRKRPVRARTAAQDSYIRALKRHELVFGIGP
FT                   AGTGKTWLAVAQAAQLFERKEVDRIILSRPAVEAGERLGFLPGDLREKVDPYLRPIYDA
FT                   LYDLMDARIVERALQSGEIEIAPLAFMRGRTLTNAAIILDEAQNTTSMQMKMFLTRLGE
FT                   NSRMIITGDPSQVDLPNGQTSGLSEAVRLLSGVEGIAQVEFRAEDVIRHELVARIVAAY
FT                   EGAPQKPANGKS"
FT   gene            195878..196381
FT                   /locus_tag="Rpdx1_0174"
FT   CDS_pept        195878..196381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0174"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   nha:Nham_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41818"
FT                   /db_xref="GOA:E6VG94"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG94"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ADU41818.1"
FT                   /translation="MTRTAHPVTEVVIEADCWQAESSAEAVVLRAIETAAEAIDAGTGG
FT                   AELAVMLTDDEHIRALNASFRGKDKPTNVLSFPAAQPEVQPDGAPRMLGDIAIAYQTVR
FT                   READDEGKPFGHHLSHLAVHGFLHLVGYDHETDQQADEMEDAERTILARLGIPDPYAGQ
FT                   DRVN"
FT   gene            196383..197522
FT                   /locus_tag="Rpdx1_0175"
FT   CDS_pept        196383..197522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0175"
FT                   /product="CBS domain containing protein"
FT                   /note="KEGG: bja:bll0792 magnesium and cobalt efflux
FT                   protein; PFAM: CBS domain containing protein;
FT                   transporter-associated region; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41819"
FT                   /db_xref="GOA:E6VG95"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG95"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADU41819.1"
FT                   /translation="MPDGDRAPSDSQPSAQDTARGQLPAVVHQGEVLNPHGSNWLIRAI
FT                   RSLFGWKPGSVRDDLQVVLDTSPPDDTGFSTLERTMLRNILGLHDRRIADVMVHRADIV
FT                   AIKQDIQLGELLSLFQNAAHSRLVVYNETLDDPVGIVHIRDLVAFMTANAKVPPETVAK
FT                   RKKALPAGLDLRAIDLKMPLTETGIIRKLLYVPPSMRAIDLLAQMQAARIHLALVVDEY
FT                   GGTDGLVSIEDIVEQIVGEIDDEHDSTEPPAIVRQADGSFIADAKASLEDVCAMIGDQF
FT                   VTGEAGEDVETLGGYLVNHVGRLPVRGEVIAGPGNFEFEVLDADPRRVKRLRIGPRKER
FT                   PAPRSRDSRRREAAAPDSIAQATESPGPTPPTGDGTGSP"
FT   gene            197522..199129
FT                   /locus_tag="Rpdx1_0176"
FT   CDS_pept        197522..199129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0176"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="KEGG: nha:Nham_0025 apolipoprotein
FT                   N-acyltransferase; TIGRFAM: apolipoprotein
FT                   N-acyltransferase; PFAM: Nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41820"
FT                   /db_xref="GOA:E6VG96"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG96"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ADU41820.1"
FT                   /translation="MRQGVLSRIASGIILAWGWKRAVIALLAGALSSLAMAPFNAWPIL
FT                   FVTFPVVVWLIDGAAAGKRRGVPAAAMAGWWFGFGYFVPGLYWIGYAFLVDADTFAWLL
FT                   PVAVCGLPAYLALFTALGFAVARLLWRPDGLRILSLALGLTISEWLRGHLLTGFPWNAF
FT                   GYALTEPLALAQSISLIGLWGLTLLAVAIFASPAVLIDGGPDARRRWAAPVAALCVLAA
FT                   MTVYGGIRLKLSPTQLVDNVRLRIMQPNLPQDARFNYSAKADVMQKYLSLSDRSTGPKS
FT                   TGVRDVSLLIWPESAFPFFLSREADAMAQIADLLPKGTVLLTGAVRPPELPPGRRITRA
FT                   YNSIYAIDHDGGILSIYDKLHLVPFGEFLPYQNLMEKVGFVQLTKVQGGFLSGVARHNL
FT                   DLPNAPPVLPLICYEAIFPDEISVGTPRPGWMLNLTNDGWFGISSGPYQHLQQARMRAI
FT                   EQGLPLVRAANTGVSAVIDPVGRIVAELGLGIEGVLDSGLPAPIAPTIYARVGELPAAV
FT                   LVALVMMLVLLRKRPAGS"
FT   gene            199330..199749
FT                   /locus_tag="Rpdx1_0177"
FT   CDS_pept        199330..199749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0177"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: nha:Nham_0026 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41821"
FT                   /db_xref="GOA:E6VG97"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG97"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU41821.1"
FT                   /translation="MLTKAPNPVDKYVGSRVRMRRIMLGMSQEKLGEALGLTFQQVQKY
FT                   EKGTNRVGASRIQQIAEVLQVPVSFLFEGGPSGGLANGSGFSEAPSPSYVSDFLATSEG
FT                   LALTRAFTKITDAKLRRSIVDLVERIAAREADETN"
FT   gene            199837..200652
FT                   /locus_tag="Rpdx1_0178"
FT   CDS_pept        199837..200652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0178"
FT                   /product="putative methyltransferase"
FT                   /note="PFAM: putative methyltransferase; KEGG:
FT                   bra:BRADO0048 tRNA (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41822"
FT                   /db_xref="GOA:E6VG98"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG98"
FT                   /inference="protein motif:PFAM:PF02390"
FT                   /protein_id="ADU41822.1"
FT                   /translation="MQGGLLQKCEHGRLMFNIDQPDSAPDSDDRDGDVTMHDGTMHDVT
FT                   MHGQGSFFGRRKGHKLRAHQADLIEHLLPHLALQIGGPAPEPLTALFDPPIEHVRLEIG
FT                   FGGGEHLIAEALAHPDTGFIGAEPYVNGMAKILARIEADNIRNIRLFAGDASELLAWVP
FT                   AGSLARIDLIHPDPWPKRRHWKRRFVQDGTVTAMSRALAPHGEFRFVSDIDGYNAWTLA
FT                   HLLRAPDFDWLAERADDWRKPWPNYTMTRYGRKAEREGRRANYLRFERA"
FT   gene            complement(200665..201513)
FT                   /locus_tag="Rpdx1_0179"
FT   CDS_pept        complement(200665..201513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0179"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: pla:Plav_0212
FT                   phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41823"
FT                   /db_xref="GOA:E6VG99"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG99"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="ADU41823.1"
FT                   /translation="MLSEAEITTHARRIRDDGYTVIERAADPALVAALIEAVERIERDH
FT                   QLDCAKTSFEGFKTLRVNNLLTYDEVFWQVPLHGSVLPIVEAVLDKECLLSSFCSLVLG
FT                   PGQEAQPIHEDTQLIPLPRPHIPITLNAIWALSDFTATNGATRIIPGSHKNETSPVYGQ
FT                   DYDAITATMPAGSVMLFDSALWHGGGPNTSEARRFAFSCAYCWGWMRQQENLQLGIPRE
FT                   IAQRFPRRLQELCGYSVYKGQFGHIDNHDPIELLGRERGKRMVWEATDVRNARRAAQTA
FT                   N"
FT   gene            complement(201598..202683)
FT                   /locus_tag="Rpdx1_0180"
FT   CDS_pept        complement(201598..202683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0180"
FT                   /product="Protein of unknown function DUF2336"
FT                   /note="PFAM: Protein of unknown function DUF2336; KEGG:
FT                   oca:OCAR_4513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41824"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:E6VGA0"
FT                   /inference="protein motif:PFAM:PF10098"
FT                   /protein_id="ADU41824.1"
FT                   /translation="MSAANSLLPELDDIVRQGDPVRRADAVRRISDLYVRGADSFRPDH
FT                   VALFDGILLTLVPEIDVEVRSELARRFSEVGNAPPQLIRQLVHDQDIGIAGPLLRRSAM
FT                   IDDSTLVELAKQRGQTHLLAISERSAIAPPVTDVIVRRGDRDVVRKVASNLGAQFSDTG
FT                   FNGLIRRAAQDGVLAIAVGTRDDLSAPRLKDLLACSTDLVRRRLFESARPSARIAINRA
FT                   MRELAGESRQPSVQREFDTAQRLVVSLHNKGELNEATVLGFAREHQYEETVAALSAMTG
FT                   TRISTLDQMMSGERHDPVLILGKALGFGWATVRALIGLRLGPDRSVVCPDVEEAQHNFE
FT                   RLAPSTAQRVLGFWKMRQADA"
FT   gene            203020..203799
FT                   /locus_tag="Rpdx1_0181"
FT   CDS_pept        203020..203799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0181"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   bbt:BBta_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41825"
FT                   /db_xref="GOA:E6VGA1"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:E6VGA1"
FT                   /inference="protein motif:PFAM:PF02576"
FT                   /protein_id="ADU41825.1"
FT                   /translation="MTEPTAVTPDTDLLAEPRLVIEPGVAARFCAVAEPVLLAMGYRLV
FT                   RIKVSGEAGCTVQIMAERPDGTMLIDDCEAVSRALSPVLDVADPIDRAYRLEISSPGID
FT                   RPLVRRSDFARYAGHLVKVEMAVAHQGRKRFRGLLDGVEGDAVRIQRDEAPKGEDPLVL
FT                   LAMHDIGDARLVLTDELVAESMRRGKQAERDLKQSLGLAPEPPPHAKRSDPTKSQAPKR
FT                   GAKAAKAAAKPKPQNTKQHRLAADRARRGEIDTSEGD"
FT   gene            203802..205415
FT                   /locus_tag="Rpdx1_0182"
FT   CDS_pept        203802..205415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0182"
FT                   /product="transcription termination factor NusA"
FT                   /note="KEGG: bja:bll0785 transcription elongation factor
FT                   NusA; TIGRFAM: transcription termination factor NusA; PFAM:
FT                   NusA domain protein; RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41826"
FT                   /db_xref="GOA:E6VGA2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:E6VGA2"
FT                   /inference="protein motif:TFAM:TIGR01953"
FT                   /protein_id="ADU41826.1"
FT                   /translation="MAVSANRLELLQIADAVAREKTIDRGIVIAAMEDAIAKAARARYG
FT                   SETDVHAEIDPKKGELRLSRHMLVVEQVENPANQISLKDAQRANPGAQIGDTIADTLPP
FT                   LEYGRIAAQSAKQVIVQKVREAERDRQYMEFKDRIGDIVNGVVKRVEYGSVIVDLGRGE
FT                   AIIRRDEMLPRESFRNGDRVRAYVFDVRRETRGPQIFLSRTHPQFMAKLFAQEVPEIYD
FT                   GIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWS
FT                   PDIATFVVNALAPAEVSKVVIDEDRERIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGW
FT                   DIDILTETEESERRQADFEKTTRAFMDALNVDEIVGQLLASEGFTSVEELALVDPRELA
FT                   SIEGFDEETAAELQTRAREYLDQIESELEARRTELGVEDALKDVPGVTSKMLVKFGEND
FT                   VKTVEDLAGCATDDLVGWTERKDGGEPVKYPGILDGMELSREDAEHLIMQARVKAGWID
FT                   ESELASDEEPADDVSEAAAD"
FT   gene            205477..206268
FT                   /locus_tag="Rpdx1_0183"
FT   CDS_pept        205477..206268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0183"
FT                   /product="protein of unknown function DUF448"
FT                   /note="PFAM: protein of unknown function DUF448; KEGG:
FT                   nwi:Nwi_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41827"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:E6VGA3"
FT                   /inference="protein motif:PFAM:PF04296"
FT                   /protein_id="ADU41827.1"
FT                   /translation="MLAAAAAADLDDGPRAKTPATERMCAVTRQVRPTGELIRFVVGPQ
FT                   GEVVADLKRKLPGRGLWVTASRAMVAQAVRRRVFAKGFKRDVKAPADLADAVERLLVRS
FT                   AQDALAITAKAGQVVCGFGKVETALKSREAVALIHAADGAADGIRKLDGLCRQIDGETA
FT                   ASRDFPRLTALSSEELDLALGRSNVIHAAVLAGSAGQTFLSRCQILVRYRLADDGDATA
FT                   AIAGTPINTPKDVADDAADERAADEVRANAHDVEGLGRLNG"
FT   gene            206261..208927
FT                   /locus_tag="Rpdx1_0184"
FT   CDS_pept        206261..208927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0184"
FT                   /product="translation initiation factor IF-2"
FT                   /note="KEGG: bja:bll0783 translation initiation factor
FT                   IF-2; TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; translation initiation factor IF-2 domain
FT                   protein; Initiation factor 2 associated domain protein;
FT                   elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41828"
FT                   /db_xref="GOA:E6VGA4"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:E6VGA4"
FT                   /inference="protein motif:TFAM:TIGR00487"
FT                   /protein_id="ADU41828.1"
FT                   /translation="MVDTKTPGDKTLTMPTKTLTLKPRVEQGVVRQSFSHGRSKQVVVE
FT                   KRGKRRIGGDEPAAAPAAPEVAKKPAPAPAAPSRQQQSRPAPQQSRSGMVLRTLTEDER
FT                   TARATALADARVREIEERKQAEIEAQRRAEQEKIDRAEREAAEARRKAEEERHRHEEEA
FT                   KRKAETEAKKRFGDSEPAKKPADATAASPARPATTTARTTTTTTARPATPGGRPPAVAA
FT                   EAGDDDEAPRMIRRPGGPARPAPPPKQPAAKPGASKQRGRLTVVTALNADDVRERSIAS
FT                   FRRRTQRLKGHASNEPKEKLVREVVIPEVIAIQELANRMSERAVDVIRLLMKQGAMHKI
FT                   TDVIDADTAQLIAEELGHTVKRVAASDVEEGLFDVVDDSTDTEPRSPVVTVMGHVDHGK
FT                   TSLLDALRHANVVSGEAGGITQHIGAYQVTSPESGKKITFIDTPGHAAFTAMRARGAKV
FT                   TDIVILVVAADDGVMPQTIEAINHAKAAGVPIIVAINKIDKPDARPERVRTDLLQHNVQ
FT                   VESMGGDVVDVEVSAKNKINLDKLLEMIALQAELLELKTNTQRPAEGTVIEAKLDRGRG
FT                   PVATVLVQRGTLRVGDIIVAGAEMGRVRALISDQGETVQEAGPSVPVEVLGFNGPPEAG
FT                   DRLAVVENEARARQITDYRAHQKREKSAATTSGMRGSLEQMMTQLKTSGRKDFPLIVKA
FT                   DVQGSLEAILGSLEKLGTDEVAARILHAGVGGISESDVTLAEGFNAVILGFSVRANKEA
FT                   AAAAKRNGIEIRYYNIIYDLVDDIKKAMSGLLAPTLRETMLGNAQILEIFNISKVGKVA
FT                   GCRVTDGTVERGANVRLIRDNVVVHEGKLSTLKRFKDEVKEVVAGQECGMAFENYTDMR
FT                   AGDIIECYRVETIQRSL"
FT   gene            209143..209556
FT                   /locus_tag="Rpdx1_0185"
FT   CDS_pept        209143..209556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0185"
FT                   /product="ribosome-binding factor A"
FT                   /note="KEGG: bja:bll0782 ribosome-binding factor A;
FT                   TIGRFAM: ribosome-binding factor A; PFAM: ribosome-binding
FT                   factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41829"
FT                   /db_xref="GOA:E6VH57"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH57"
FT                   /inference="protein motif:TFAM:TIGR00082"
FT                   /protein_id="ADU41829.1"
FT                   /translation="MSRHHQKSSPSGGSTRSLRVGELVRHAVAEILSQGGVHDPVLESH
FT                   LVTVPEVRMSPDLKLATIYVMPLGGRDEKLVLDALEHHKRFLRGEIAHRVALKFAPDIR
FT                   FRIDERFAEAERIDRLLRSPAVQKDLEPDSDQD"
FT   gene            209556..210653
FT                   /locus_tag="Rpdx1_0186"
FT   CDS_pept        209556..210653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0186"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="KEGG: nwi:Nwi_0026 tRNA pseudouridine synthase B;
FT                   TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41830"
FT                   /db_xref="GOA:E6VH58"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH58"
FT                   /inference="protein motif:TFAM:TIGR00431"
FT                   /protein_id="ADU41830.1"
FT                   /translation="MTVTTPDALLAPHDAQQDAAATPTAMPDRKPRDNNDPRNGGRGGG
FT                   KQPRRDKRDVHGWVVMDKPIGMTSTQAVAVVKRLFSAKRAGHAGTLDPLASGGLPIAMG
FT                   EATKTVPFVMDGRKRYRFTVAWGEERDTDDTEGRAVATSAERPTAEAIMALLPRFTGVI
FT                   EQIPPQYSAVKIQGERAYDLARDGEVVPLVARPVEIHELTLVEHHDTGQSVFEAECGKG
FT                   TYVRALARDMGRLLGCYGHICALRRTLVGPFDEADMIPLEELQALCDRAASGEGSLADA
FT                   LLPVETALDDIPALAVTRADAARLHRGQAVLLRGRDAPHCSGTVYVTVAGRLLALAEVG
FT                   NGELIPKRVFNLTGLTASPSLKESH"
FT   gene            210656..210925
FT                   /locus_tag="Rpdx1_0187"
FT   CDS_pept        210656..210925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0187"
FT                   /product="ribosomal protein S15"
FT                   /note="KEGG: nwi:Nwi_0027 30S ribosomal protein S15;
FT                   TIGRFAM: ribosomal protein S15; PFAM: ribosomal protein
FT                   S15"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41831"
FT                   /db_xref="GOA:E6VH59"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH59"
FT                   /inference="protein motif:TFAM:TIGR00952"
FT                   /protein_id="ADU41831.1"
FT                   /translation="MSIAAERKAEVIKTNATKAGDTGSPEVQVAILSERIANLTAHFKT
FT                   HTKDNHSRRGLLKLVSTRRSLLDYVKKKDEARYKALLEKHGIRR"
FT   gene            211269..213437
FT                   /locus_tag="Rpdx1_0188"
FT   CDS_pept        211269..213437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0188"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="SMART: KH domain protein; TIGRFAM:
FT                   polyribonucleotide nucleotidyltransferase; KEGG:
FT                   nwi:Nwi_0028 polynucleotide phosphorylase/polyadenylase;
FT                   PFAM: 3' exoribonuclease; Exoribonuclease, phosphorolytic
FT                   domain 2; Polynucleotide phosphorylase, phosphorolytic
FT                   RNA-binding; K Homology, type 1, subgroup; RNA binding S1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41832"
FT                   /db_xref="GOA:E6VH60"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH60"
FT                   /inference="protein motif:TFAM:TIGR03591"
FT                   /protein_id="ADU41832.1"
FT                   /translation="MFNIHSVEIDWGGRPLKLETGKVARQADGAVVATYGETVVLATVV
FT                   AAKAPREGVDFLPLTVDYQEKAYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFA
FT                   DGWRNETQVIVTVLSHDMENDPDVLAMVAASAALTLSGAPFRGPIGAARVGFINDEYVL
FT                   NPVLDEMAETQLELVVAGTADAVLMVESEAKELSEEIMLGAVMFGHRHFQPVIDAIIEL
FT                   AEKAAKEPRELIEIDNAAIEKEMLGLIEQELRAAYAIPVKQERYAAVGKVKEKALAHFF
FT                   PEGQEPKYDKLRIAGVFKELEAKIVRWNILDTGKRIDGRDSKTVRSILAQAGVLPRAHG
FT                   SALFTRGETQALVVTTLGTGEDEQYVDSLAGTYKETFLLHYNFPPYSVGETGRLGGTKR
FT                   REIGHGKLAWRAIHPVLPPHHEFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPL
FT                   KRPTAGIAMGLILEGERFAVLSDILGDEDHLGDMDFKVAGTEQGITSLQMDIKIGGITE
FT                   EIMKVALGQAKDGRIHILGEMSKALDRARAELGEHAPRIETFKIPTDKIREVIGTGGKV
FT                   IREIVEKTGAKVNIEDDGTVKVASSDGESIKAAIKWIKSIASDPEVGEIYEGTVVKVME
FT                   FGAFVNFFGAKDGLVHISQLAAGRVQKTSDVVKEGDKVKVKLLGFDDRGKTRLSMKVVD
FT                   QATGEDLEAKQKAEAKTEGDAPAQAAGE"
FT   gene            213645..214379
FT                   /locus_tag="Rpdx1_0189"
FT   CDS_pept        213645..214379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0189"
FT                   /product="Manganese/iron superoxide dismutase-like protein"
FT                   /note="PFAM: Manganese/iron superoxide dismutase-like;
FT                   KEGG: oca:OCAR_4502 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41833"
FT                   /db_xref="GOA:E6VH61"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH61"
FT                   /inference="protein motif:PFAM:PF00081"
FT                   /protein_id="ADU41833.1"
FT                   /translation="MSLLSRRRLMIAATGLVAVAAAPRLVFAQGPAAPPDGPFKLPPLP
FT                   YPATALQPHIDARTMEIHHGKHHQAYVTAMNNFAKDHPKLAETPVPDLLAKLGDVPEAI
FT                   RTGVRNNLGGHANHSMFWQIMGPDGGKPAGEVLAAIDRDLGGMEKFQSDFNAAGGRQFG
FT                   SGWVFVTVTKDGKLAIEARPNQDTPLMDGKRVLLGNDVWEHAYYLNYQNRRADYLKAWW
FT                   NTVNWTKVGERYAAAKAGTLGI"
FT   sig_peptide     213645..213731
FT                   /locus_tag="Rpdx1_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            214879..216564
FT                   /locus_tag="Rpdx1_0190"
FT   CDS_pept        214879..216564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0190"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: PAS fold-3 domain
FT                   protein; chemotaxis sensory transducer; KEGG: bbt:BBta_2308
FT                   methyl-accepting chemotaxis sensory transducer with PAS/Pac
FT                   sensor; SMART: chemotaxis sensory transducer; PAC
FT                   repeat-containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41834"
FT                   /db_xref="GOA:E6VH62"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH62"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADU41834.1"
FT                   /translation="MFSFSRRSASTASPAAVLDALDRSQAMIEFDLEGNVIDANDNFLA
FT                   ALGYSLAEIKGKHHRMFVDPAEQGSAAYREFWTALRAGQFQSGEFHRIGKGGREVWIQA
FT                   SYNPILDKSGKPTGVVKFAADITAAKTHSLEDAGKLTAIDRAQAVIEFAMDGTILTAND
FT                   NFLAAIGYSLAEIKGKHHSMFVEPAVRESRDYREFWERLNRGEYFPGEFKRIGKGGREI
FT                   WILASYNPILDARGKPFKVVKYATDVTAQKLKNADFSGQIDAIRKSQAVIEFSIDGTVL
FT                   DANDNFLHALGYSLAEIKGRHHSMFVDPAEREGAAYRAFWAALGRGEYQAGEYKRIGKG
FT                   GKEVWIQASYNPILDLNGRPFKVVKYATDTTRQVLIRMGNERVRAMMESVAAGAEELNA
FT                   SVREISEAMTKSRQTALAAVGEVDAADAQANQLNDAAQAMSGIVELINHITGQINLLAL
FT                   NATIESARAGEAGRGFAVVAAEVKNLANQAKQATDKIGSEIGNLTGISGDVVGALGKIK
FT                   SAIQNVSEYVNSTAAAVEEQSTVTNEMSSSMQRAANEAAAIAAG"
FT   gene            complement(216574..217512)
FT                   /locus_tag="Rpdx1_0191"
FT   CDS_pept        complement(216574..217512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0191"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: nwi:Nwi_0029 regulatory protein, LysR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41835"
FT                   /db_xref="GOA:E6VH63"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH63"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU41835.1"
FT                   /translation="MISLRQLRYLSALARHGHFGRAADACSVTQPALSMQIAELERTLG
FT                   IKVVERRPGEVLLTDIGREIARRAEEVLAATRDLVDFARHRSRPLTGRLSLGVIPSLAP
FT                   YLLPKVLPLLQQGFPELRLELRESQTRQLVADVASGVLDAALLALPAGHSDLAALPLFD
FT                   DPFLLAVPADDPRSENEPVGVEEIDQSRLILLEDGHCLRDQALAFCATARNRGIQMGSA
FT                   GSASFGASSLTTVIQMVAGGYGITLIPQIAAEVEWRDSRVKFLRLKRPQPGRSVGLIFR
FT                   KTSPRRGDFEAFGEVVKRGICGEAQVEAAVA"
FT   gene            217780..219990
FT                   /locus_tag="Rpdx1_0192"
FT   CDS_pept        217780..219990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0192"
FT                   /product="catalase/peroxidase HPI"
FT                   /note="KEGG: mes:Meso_0626 catalase/peroxidase HPI;
FT                   TIGRFAM: catalase/peroxidase HPI; PFAM: Haem peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41836"
FT                   /db_xref="GOA:E6VH64"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH64"
FT                   /inference="protein motif:TFAM:TIGR00198"
FT                   /protein_id="ADU41836.1"
FT                   /translation="MDAKTDDKGAGKCPFSGGSRGHRNRDWWPDQLDISVLHNNSKKSD
FT                   PMGAAFDYAEEFKKLDLEAVKKDLHALMTDSQEWWPADFGHYGGLFIRMAWHSAGTYRI
FT                   TDGRGGAGAGQQRFAPLNSWPDNANLDKARRLLWPIKQKYGRKISWADLMVLTGNVALE
FT                   SMGFKTFGFAGGRADVWEPEELYWGPEGTWLGDERYSGERQLSEPLGAVQMGLIYVNPE
FT                   GPNGNPDPIAAAKDIRETFYRMAMNDEETVALIAGGHTFGKTHGAGDPSLIGPAPEGGL
FT                   LEEQGLGWTSKFGTGFGADAITGGPEVIWTTTPTKWSNNFFWNLFGYEWELEQSPAGAK
FT                   QWRAKGAGATIPDPFDPEKKHVPKMLTTDLSLRFDPIYEKISRRFMENPDQFADAFARA
FT                   WFKLTHRDMGPRVRYLGPEVPKEELIWQDPIPAVDHELVSDADIEALKAKILASGLSVS
FT                   QLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNHPAELAQVLGKLEAIQAEFNG
FT                   AQQDGKKISLADLIVLGGAAAVEKAAKDAGTAVKVPFTPGRMDASEEQTDAESFKVLEP
FT                   RADGFRNYINTKRHQFMHPEEALVDRAQLLTLTGPELTVLVGGLRVLGANYEHSTHGVL
FT                   TERPEKLTNDFFVNLLDMGTKWTKASGEIEIYEGRDRKTNELRWTGTRVDLIFGSHSQL
FT                   RALAEVYACSDAQEKFVADFVAAWTKVMNADRFDIVANKQAA"
FT   gene            220102..220374
FT                   /pseudo
FT                   /locus_tag="Rpdx1_0193"
FT   gene            complement(220592..221467)
FT                   /locus_tag="Rpdx1_0194"
FT   CDS_pept        complement(220592..221467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0194"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo3831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41837"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH65"
FT                   /inference="similar to AA sequence:KEGG:azo3831"
FT                   /protein_id="ADU41837.1"
FT                   /translation="MRNSLLTSLATALIAVTASINLAAAADGPIDNSSLSKSGFRDHAR
FT                   TFGLVYTLPTSVNDVLDATIRGPLKEKLLIAKLDTEAQTFNIPHVTVVHVHSADPSTPE
FT                   KMLAAMPKLPPVLQVTLKKFYTTEAAKGAGHPWWLDLGVVKEGDSFEQMMAFNTTATAA
FT                   LTPLRDGPLPRCTGPVYAAMGDAAKDLVRTVGVSGVNVVKDGKEQRSHNPHTTLVYSMA
FT                   KFTPELQAQMNQAAKEFDQILPNGIDTTFKTVSIVEIGFAGNVLREIYRISLEDGSVLT
FT                   VATGKTASLK"
FT   sig_peptide     complement(221390..221467)
FT                   /locus_tag="Rpdx1_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.694 at
FT                   residue 26"
FT   gene            221771..222646
FT                   /locus_tag="Rpdx1_0195"
FT   CDS_pept        221771..222646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0195"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="KEGG: nha:Nham_0446 beta-lactamase; PFAM:
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41838"
FT                   /db_xref="GOA:E6VH66"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH66"
FT                   /inference="protein motif:PRIAM:3.5.2.6"
FT                   /protein_id="ADU41838.1"
FT                   /translation="MINRRTMVGAAACLAGVGMIGRRAATATEPGDAIAARFAELEARS
FT                   GGRLGVCVLDSSNGRMIGHRLDERFPMCSTFKVLAAGLVLARVDRKQESLDRRVSYTKS
FT                   DLVTYSPATETRVEGGMTIAELCEAAITLSDNTAGNLLLGSFGGPAGLTAFARSLGDQT
FT                   TRLDRIETELNEALPGDARDTTSPRTIAQDLRALALGDALTPSSRALLVAWMKANTTGG
FT                   ARIRAGVPSGWIVADKTGTGERGTANDIAVLWPPQRAPLIVTVYLTGATVSRDQQNRLI
FT                   AAAGAEATAG"
FT   sig_peptide     221771..221854
FT                   /locus_tag="Rpdx1_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.558 at
FT                   residue 28"
FT   gene            222768..223130
FT                   /locus_tag="Rpdx1_0196"
FT   CDS_pept        222768..223130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_1339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41839"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH67"
FT                   /inference="similar to AA sequence:KEGG:Nham_1339"
FT                   /protein_id="ADU41839.1"
FT                   /translation="MGDILSAIATGYSQAGLLNPSRTPYKNVDPEAYKGTWSGTYSNTK
FT                   KFAITVSNVEGFRAQVKYQSEGTIKYQSVLIKDNSFRIGDTKFTLGSNGSASIRTAVTD
FT                   PVTNQVSLVQGTAKRS"
FT   gene            complement(223229..224128)
FT                   /locus_tag="Rpdx1_0197"
FT   CDS_pept        complement(223229..224128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0197"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="KEGG: bja:blr7337 RNA polymerase factor sigma-32;
FT                   TIGRFAM: RNA polymerase sigma factor RpoH; RNA polymerase
FT                   sigma factor, sigma-70 family; PFAM: sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41840"
FT                   /db_xref="GOA:E6VH68"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH68"
FT                   /inference="protein motif:TFAM:TIGR02392"
FT                   /protein_id="ADU41840.1"
FT                   /translation="MARAATLPVLNGESGLARYLAEIRKFPMLEPEQEYMLAKRWREHG
FT                   DRDAAHQLVTSHLRLVAKIAMGYRGYGLPISEVVSEGNVGLMQAVKRFEPEKGFRLATY
FT                   AMWWIKASIQEYILRSWSLVKMGTTANQKKLFFNLRKAKSKISALDEGDLHPDHVKLIA
FT                   SRLGVTEQDVVDMNRRLGGDASLNAPIRDDGEPGEWQDWLVDQSPSQEAVLAEHEELDQ
FT                   RRAALNGAIQVLNPRERRIFEARRLADEPMTLEDLAAEFGVSRERVRQIEVRAFEKVQS
FT                   AVKGTIARQEQAALEAAH"
FT   gene            complement(224349..225353)
FT                   /locus_tag="Rpdx1_0198"
FT   CDS_pept        complement(224349..225353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0198"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase; RNA-binding S4 domain protein;
FT                   KEGG: bja:blr7336 pseudouridine synthase-like protein;
FT                   SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41841"
FT                   /db_xref="GOA:E6VH69"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH69"
FT                   /inference="protein motif:TFAM:TIGR00005"
FT                   /protein_id="ADU41841.1"
FT                   /translation="MNDSAQTLVEVTVAGDEGSARLDRVLAARCPELSRSRLKALILDG
FT                   RVAIAGNPVRDPAYHASPGETITIDVPPPAPAEPAGEAIALDIAHEDADIIVLNKPRGL
FT                   VVHPAAGHETGTLVNALIAHCGASLSGIGGVRRPGIVHRLDKDTTGLMVVAKNDRAHQS
FT                   LSAQFADHGRTGELRRGYFAFVWGVPGRTYGTIDAPIDRHPHAREKMAVRQGGREAITH
FT                   WEVLESFAGKDGKPVASLIACQLETGRTHQIRVHLAHIGHPLLGDDVYGPHFKTKANQL
FT                   APAARAALAQLGRQALHAYLLTLEHPSTGEILTWESPLPADLAHLQAALIATE"
FT   gene            225392..225727
FT                   /locus_tag="Rpdx1_0199"
FT   CDS_pept        225392..225727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll7335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41842"
FT                   /db_xref="GOA:E6VH70"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH70"
FT                   /inference="similar to AA sequence:KEGG:bll7335"
FT                   /protein_id="ADU41842.1"
FT                   /translation="MTDTATPDPTPEQAALFARVRRMMLIAGLTTTLAVAAVLIAIGYK
FT                   LFRAEGSAPAATEHTLRLPKGARVVSTASAGDYVVVTLDIGGATELRTFEAKTLKPTGR
FT                   LTFASEP"
FT   gene            225936..226010
FT                   /locus_tag="Rpdx1_R0004"
FT                   /note="tRNA-Glu1"
FT   tRNA            225936..226010
FT                   /locus_tag="Rpdx1_R0004"
FT                   /product="tRNA-Glu"
FT   gene            226108..227979
FT                   /locus_tag="Rpdx1_0200"
FT   CDS_pept        226108..227979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mea:Mex_1p0058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41843"
FT                   /db_xref="GOA:E6VH71"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH71"
FT                   /inference="similar to AA sequence:KEGG:Mex_1p0058"
FT                   /protein_id="ADU41843.1"
FT                   /translation="MGFMTYLIRRGVTWHFRFRLPDDLRGRAVDAHWPNNLTALINPKL
FT                   GRIKQEITESLRTSDNSIARARAGVRISDTELLVREARRFLAEGPARTIPEDVIEHLAQ
FT                   RRLQELLAADDAVRAKGLGLDLTAMRCAASSRLLIRKPENQPPPVGPTPPDQSGMTRDD
FT                   LDLLAFGVDRLAADLRLGVALRRPPNWVQAAVDAALAERGIALPPDAPEREALDIEFLA
FT                   ATQRAFAALKMRNEGQFVPTPPAPLDPAEQLGPTLSETFEQWKAGTLLPGMKVPRQSTA
FT                   DEAEFCVRRFRELHGDPRIGAITREQARSLRDGLWRLPIRLPAHVEKLPLPDILARSDL
FT                   GDYPHRSSGTLGKHITLISAILNKGADAYDLKFNGAGWSNPFEGLKPENNDDELNRDPL
FT                   SPEELAIVFSSPIYTQGERPRGGRGEAAFWLPVLSVMTSARLSELAQLRVCDVRRDEGT
FT                   GIDYLDINDERRKRLKTASAKRQVPLHTVLLRIGFLDFVAWRHAAAEDATAKLFPGLEP
FT                   TGKGGRIGKSWSKWFNNWRRGKLKIIGEDSRKDFHSLRHTFKDMCRAARIEEEVHDALT
FT                   GNSFKGGGKGVGRRYGNGVPLEVRAEAVASLKPPSAILELRWIVPFS"
FT   gene            228243..228602
FT                   /locus_tag="Rpdx1_0201"
FT   CDS_pept        228243..228602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0201"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: bmb:BruAb1_0263 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41844"
FT                   /db_xref="GOA:E6VH72"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH72"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU41844.1"
FT                   /translation="MLNPLGKALRKLRIDRGWLLKDMAQGIGVATSFLSGIETGRKAVP
FT                   AGFVEKIAVWAHLDRGELEELLKAAAKSQREFKITVRSDFSDGDREAAALLARFGELPR
FT                   EKRDSLHLLLKKTFE"
FT   gene            228599..229135
FT                   /locus_tag="Rpdx1_0202"
FT   CDS_pept        228599..229135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0202"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   bov:BOV_0254 zinc-dependent metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41845"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH73"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADU41845.1"
FT                   /translation="MSDIIFEAPPRSGENIEDLADAVREAFGLSDETYFPVVAFVEKGL
FT                   QHLVSGILFDVVEADTMGARLGAVNPLTGAFMIREDVYDAAVADNPRHRFTVAHEAGHA
FT                   LMHVGTLNRMPASDGKVPAYRDPEWQANRFAAALLMPRQLVKKCRSVEEIMQRFGVSRE
FT                   AAELRIKTLKLRIQI"
FT   gene            229300..229428
FT                   /locus_tag="Rpdx1_0203"
FT   CDS_pept        229300..229428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpf:Rpic12D_4679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41846"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH74"
FT                   /inference="similar to AA sequence:KEGG:Rpic12D_4679"
FT                   /protein_id="ADU41846.1"
FT                   /translation="MVKAVAPKKHRNVIFRRYRKLPNGTVLDAFDYGLKAWPIHLK"
FT   gene            complement(229604..230146)
FT                   /locus_tag="Rpdx1_0204"
FT   CDS_pept        complement(229604..230146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0204"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: met:M446_7059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41847"
FT                   /db_xref="GOA:E6VH75"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH75"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ADU41847.1"
FT                   /translation="MTVIGYARVSTTDQNLSLQEAALRAAGCDLIRSEKRSGTTTTGRA
FT                   ELQTVLDFLRDGDVLMVTRIDRLARSIGDLQDIARAVRAKGASLKATEQPIDTSTAAGK
FT                   AFFDMLGVFAEFETNLRKERQLEGIADAKARGVYKGRRPSIDPAKVRALKEQGMGPSAI
FT                   AKALNIGRASVYRALET"
FT   gene            complement(231121..231399)
FT                   /locus_tag="Rpdx1_0205"
FT   CDS_pept        complement(231121..231399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbi:SORBI_01g043300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41848"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH76"
FT                   /inference="similar to AA sequence:KEGG:SORBI_01g043300"
FT                   /protein_id="ADU41848.1"
FT                   /translation="MQEALNPTTTPSNTALGRIASAPLRLVTVREWWDEMDEPTEMLAD
FT                   PEAVFAADEAKLLSLCTVNAITFRAATDEQPAAFPAWVFLAAIPANP"
FT   gene            231592..231738
FT                   /locus_tag="Rpdx1_0206"
FT   CDS_pept        231592..231738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0206"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scb:SCAB_19301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41849"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH77"
FT                   /inference="similar to AA sequence:KEGG:SCAB_19301"
FT                   /protein_id="ADU41849.1"
FT                   /translation="MSDKAKQLIAGALFLTVCFALLAWNDAQVRRDGGRYGPDGIWRSY
FT                   GER"
FT   sig_peptide     231592..231663
FT                   /locus_tag="Rpdx1_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.576 at
FT                   residue 24"
FT   gene            complement(232530..235052)
FT                   /locus_tag="Rpdx1_0207"
FT   CDS_pept        complement(232530..235052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0207"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="SMART: EAL domain protein; GGDEF domain containing
FT                   protein; PAC repeat-containing protein; manually curated;
FT                   TIGRFAM: diguanylate cyclase; PAS sensor protein; KEGG:
FT                   tgr:Tgr7_2681 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); PFAM: EAL domain protein; GGDEF domain
FT                   containing protein; PAS fold-3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41850"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH78"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADU41850.1"
FT                   /translation="MAVRGASLRQPYPREPRGWHQEWSLRRAMRMARVAYWESHSAAET
FT                   DFWMSPEFASLYDFQTPDGSVPIAAMRERDLTESRDVLQAHYAACWAEGRPFAVETKLP
FT                   KPDGSPLDCVVHGEPEFDSNGQVQRVFGVVRDVTPETSALRQLAESEQRLADFVSTASD
FT                   WCWESGPDHRLLPYPKSVDGNAALQSVASGGRARWELSYAPEEEDSMASHRADMEAHRP
FT                   FRDFVYTSIGNDGSRVSICTSGKPIFADDGRFLGYRGTASDITQLEAARTLLDQRTGAL
FT                   EEAHRLGKIGTWYHRLDTGRTVWSPELYQLLGLEPDAFEPTYDGTKAYFLDDDAERLLK
FT                   IQKRVLRSSKTEATDIRVLHTDGAPRDLAIICKAETSNGKITGLIGTAQDVTERKDAER
FT                   RLEQLAYTDPLTGLANRALFKRQLVDLFEKPISESEQNALLLIDLDRFKEVNDSLGHST
FT                   GDALLIHVAGVLRQELDPQAFIARIGGDEFAVLTNSPTTSAEATTALADRLIAKLSIPV
FT                   ELAEGEACIGATIGIAILPEHGATAEKASRNADLALYMAKEAGRGRALLFEPIYAEAVD
FT                   QRLDLGRRLRHAVDSGGLETHYQPQIDLKTGRVIGFEALLRWSHPERGPISPAEFIPIA
FT                   ETTGLIVDLGHWVLRDACKQMRGWLDAGLPARTISVNVSPAQIWNGDFEKVVATVLGDT
FT                   GLPPELLCLELTENLFVDHTKQKVSTTLAALSKLGIGLALDDFGSGYSSLGYLTRLPFN
FT                   RLKIDRTFVDGIATVPEKRKLLGGIIALSHGLGMSVVAEGAELAAEVDLLTAFDCDFVQ
FT                   GYVFSRPVAADQAVVVAEEIERRAKTRP"
FT   gene            complement(235276..236460)
FT                   /locus_tag="Rpdx1_0208"
FT   CDS_pept        complement(235276..236460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0208"
FT                   /product="methionine gamma-lyase"
FT                   /note="KEGG: mgm:Mmc1_0771 methionine gamma-lyase; TIGRFAM:
FT                   methionine gamma-lyase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41851"
FT                   /db_xref="GOA:E6VH79"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006237"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH79"
FT                   /inference="protein motif:TFAM:TIGR01328"
FT                   /protein_id="ADU41851.1"
FT                   /translation="MTEPTRPPGFATTAIHHGYDPLAHHGALNPPLFLTSTYAFASAAE
FT                   GAARFAGEAEGFVYSRVGNPTVAVLESRLAALEGGEAALATSSGVGALTALIWTLLQAG
FT                   DHIVADQMLYGCTFGLFEHHLPRFGIQVTFADLTEPANLQAALAPNTRLVFTETPTNPN
FT                   MRLVDIAACAEICRRAGIRLVVDNTYCTPYLQRPLDLGADLVTHSATKYLGGHGDLLAG
FT                   AVVGQKEIIDQLRFVGIKELNGACISAFDAFLILRGLKTLNLRMDRHSATAAKLAHDLE
FT                   AHPAVTAVYYPGLDSHPQRKLAQQQMRQPGGMIALELTGGLAAGRSFMDKVKLATRAVS
FT                   LGDAETLIQHPASMTHATYDPAERARHGFTDGLIRISVGLEDYEDLREDLLGAL"
FT   gene            236569..237054
FT                   /locus_tag="Rpdx1_0209"
FT   CDS_pept        236569..237054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0209"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: oan:Oant_0505 AsnC family transcriptional
FT                   regulator; PFAM: Transcription regulator AsnC-type-like;
FT                   SMART: Transcription regulator AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41852"
FT                   /db_xref="GOA:E6VH80"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH80"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADU41852.1"
FT                   /translation="MQNSAKIALDAIDLKILAELQADARIPNIVLAERVGLSPSPCSRR
FT                   VKLLEQAGVLASYRALVDRAAVGLAVTAFAFIRVERHSRDNAESFIAAVQTMPEVIACH
FT                   LVSGDSDFLLEVVVPDIASYEATVLRGLLALPTVRDIRTSFAMRSYKLSGPLPLPAV"
FT   gene            complement(237055..237492)
FT                   /locus_tag="Rpdx1_0210"
FT   CDS_pept        complement(237055..237492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0210"
FT                   /product="thioredoxin"
FT                   /note="KEGG: mlo:mll6589 thioredoxin; TIGRFAM: thioredoxin;
FT                   PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41853"
FT                   /db_xref="GOA:E6VH81"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH81"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADU41853.1"
FT                   /translation="MSDQLVVCTHCGGVNRLPEQRPALDGKCGKCGARLFEGHPADVGG
FT                   ELFDKQVARSSVPVLVDVWAPWCGPCRAMAPAYEQAARELEPNVRLIKLNSDNEQQIAA
FT                   RLGIQGIPTMILFENGRERARTSGAMPAQQIVRWVRQHLPA"
FT   gene            complement(237575..238558)
FT                   /locus_tag="Rpdx1_0211"
FT   CDS_pept        complement(237575..238558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0211"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /note="KEGG: bja:blr6070 putative alcohol dehydrogenase;
FT                   TIGRFAM: zinc-binding alcohol dehydrogenase family protein;
FT                   PFAM: Alcohol dehydrogenase GroES domain protein; Alcohol
FT                   dehydrogenase zinc-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41854"
FT                   /db_xref="GOA:E6VH82"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH82"
FT                   /inference="protein motif:TFAM:TIGR02822"
FT                   /protein_id="ADU41854.1"
FT                   /translation="MDAMVLTAPGTPLQWQQRDTPHPGDGEVLVTVSACGVCRTDLHVV
FT                   DGELPNIRYPIIPGHEIVGRVAAIGGGVTTHRIGDRVGIPWLGHTCGVCRYCRSGMENL
FT                   CDAPLFTGYTRDGGFASHAIADARYAFPLGEADDDVAIAPLLCAGLIGWRSLVIAGPAE
FT                   RLGIYGFGAAGHIVAQVARWQGRQVYAFTRGGDVAAQEFARSLGAVWAGASEELPPEPL
FT                   DAAIIYAPVGSLVPAALKAVRKGGRVVCAGIHMSDIPSFPYDLLWEERQLVSVANLTRQ
FT                   DGIDFLAVAARAGIRTETHAFPLREANAVLTKLRAGELLGAAVLVP"
FT   gene            complement(238635..238856)
FT                   /locus_tag="Rpdx1_0212"
FT   CDS_pept        complement(238635..238856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0212"
FT                   /product="ChaB family protein"
FT                   /note="PFAM: ChaB family protein; KEGG: tcx:Tcr_2071 ChaB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41855"
FT                   /db_xref="InterPro:IPR009317"
FT                   /db_xref="InterPro:IPR037205"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH83"
FT                   /inference="protein motif:PFAM:PF06150"
FT                   /protein_id="ADU41855.1"
FT                   /translation="MPYGSTDDLPPGLQVRLPLHAQEIYIAAFNNAFAEYQDRGPDEQE
FT                   ATAHRVAWAAVKKLYRKQGENWVARERS"
FT   gene            239038..239763
FT                   /locus_tag="Rpdx1_0213"
FT   CDS_pept        239038..239763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0213"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="TIGRFAM: protein-L-isoaspartate O-methyltransferase;
FT                   KEGG: bja:bll4651 hypothetical protein; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41856"
FT                   /db_xref="GOA:E6VH84"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH84"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ADU41856.1"
FT                   /translation="MTSPASGIPPPLNGRSFAVLRELMVERQIVARGVHDPRVLAAIRK
FT                   VPREAFLPEPMRDLAYEDAPVPIAGEQTMSQPYIVALMMEALLLQGGDNVLEIGTGSGY
FT                   AAAVLGEIAGHVATVERIATLADTAAAKLAELGYVDVHVHQGDGTRGWPPDAPYDAIVV
FT                   AAGGPQVPDSLKAQLKIGGRLVMPVGADQHAQQLVRLTRLGEADFKRDHLGDVRFVPLL
FT                   GAEGWQRVEPADKTARDNG"
FT   gene            239914..240738
FT                   /locus_tag="Rpdx1_0214"
FT   CDS_pept        239914..240738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0214"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: nha:Nham_1926
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41857"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH85"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADU41857.1"
FT                   /translation="MIKDLIVNLERSKERQQITDIAIGLARMFDAHVAGCCFAYDSLPS
FT                   FTMPDFPSDVLSKMLAASEEAAAAAVAQFEAACKREGVSAEHHLLETAYGTSGRFPKMA
FT                   RRFDLSVIMQSDAENGDNDILIEQVLFDSGRPLLILPYIQKNPLKLDRVICGWDGSRAA
FT                   TRAINDARPFLRRAGQVELVIVRDHKVRDPNELRGIEIANHLARHDVKVDIKTITAPDI
FT                   GVAATILSHAADTSTDLLVMGGYGHSRLREFVLGGVTREMLASMTVPVLMSH"
FT   gene            complement(241020..242300)
FT                   /locus_tag="Rpdx1_0215"
FT   CDS_pept        complement(241020..242300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0215"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   bra:BRADO2867 putative alpha-galactosidase (melibiase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41858"
FT                   /db_xref="GOA:E6VH86"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH86"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ADU41858.1"
FT                   /translation="MPRTTKIVFLGASSASFGLSMFRDLFASPVLAGSTLTLVGRNPAT
FT                   LGRMTELAKLLNARSGAGLVIEHTTDRRAALDGAGFVINATAIDRNRLWKQDFEVPKKH
FT                   GIRHTLGENGGPGGLFFTLRTLPLVFDFIRDIEELCPNALFLNYSNPESRIILALGRYT
FT                   KVRHIGLCHGIFMGRDAIAYIMQMPREEIEVWGAGLNHFQCLMQIRHRDTGEDLYPRFR
FT                   AAEQSFDPDAWRFTRRLYRAFGYWLTCSDDHLGEYLPYGWEAGENGYDFDQDERWRGEF
FT                   LNQLDGVLGGTMPIPQWWTEPSGERGAAVIAAMLHDQKRFIESGIVLNRGVIPNLPAEL
FT                   AVEVPVTVDAAGVHPVSLGPLPDPIAKLMLMQASVQQLAVEAAVHASKELALQALLIDP
FT                   VINSAVAAEKLLDELWEINRPYIRKCV"
FT   sig_peptide     complement(242202..242300)
FT                   /locus_tag="Rpdx1_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.599 at
FT                   residue 33"
FT   gene            242542..243480
FT                   /locus_tag="Rpdx1_0216"
FT   CDS_pept        242542..243480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0216"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="TIGRFAM: 1-phosphofructokinase; KEGG: bbt:BBta_6479
FT                   6-phosphofructokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41859"
FT                   /db_xref="GOA:E6VH87"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH87"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ADU41859.1"
FT                   /translation="MADIVTLTPNPAIDLSTSVERLVPSRKLRCAAQKRDPGGGGINVA
FT                   RVVRRFGGDVEAIFPAGGFTGKLLKLLLDEESVPSRIVEAVAETREDFSVSENATGEQY
FT                   RFVLPGLPLAEHEWRGMLDTLAATSPAPKIVIGSGSLPPGVPVDFYAQAAAVAKQLGAK
FT                   FFLDTSGKPLTAALAQGVTLIKPNLREMQELAGRPLGCEKEWVDAARAHISAGQVEIVA
FT                   LSLGHLGALLVTKDQALRSPALPVTPVSTVGAGDSFLGAIAYRLAQGGSIADAFRLGLA
FT                   AGSATLTVHGTQLCGPDEVERLYAQVIIEPI"
FT   gene            243587..245899
FT                   /locus_tag="Rpdx1_0217"
FT   CDS_pept        243587..245899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0217"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="KEGG: bbt:BBta_3664 putative oxidoreductase alpha
FT                   (molybdopterin) subunit; TIGRFAM: oxidoreductase alpha
FT                   (molybdopterin) subunit; PFAM: molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41860"
FT                   /db_xref="GOA:E6VH88"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH88"
FT                   /inference="protein motif:TFAM:TIGR01701"
FT                   /protein_id="ADU41860.1"
FT                   /translation="MSQDESRLHDTDIPDRPDRTVAYDGPAGGWGSLQGISRIFGKEWS
FT                   SPAAIETLMRQNKPKGFMCVSCSWAKPADYHTFEFCENGAKATLWELTSARCTPEFFAE
FT                   HSVTELRGWSDYDLEMQGRLTHPMRYDAATDHYVACEWDEAFQAIGEHLRSLDPKSVVF
FT                   YASGRASLETSYLYALFARLYGTNNLPDSSNMCHETTSVALKKLLGVGVGTVVFDDLSN
FT                   CDAMFFFGQNTGSNSPRFLHPLQEAAKRGVEIVTFNPVREKGLESFVNPQNPAEMLTGR
FT                   ETRISSQYHQVKAGGDVAVLIGLCKHVFARDDEAKREGRRVLDVDFIEAHTHGLDEFET
FT                   KVRATSWEEIERESGLSRAAIAAAGDVYVKADRVIGIYGMGLTQHAHGFLNVAMFVNLL
FT                   LLKGNIGRDGTGISPVRGHSNVQGQRTVGISEKPELVPLDKMAEQFGFTPPRDKGMNTV
FT                   EACHGILEGKVGAFIGLGGNFVRAIPERDAMEAAWTRMQLTVQIATKLNRSHLINGKSA
FT                   YLLPCLGRTEQDVQANGPQAVTMEDTFSHIQGSIGLRKPASEHLKSELAIVAGIAKATL
FT                   PGNPKLKWDDWVGDYGLVRDLIEESYPEMFGEFNARMFTPGGFYKGNAARERIWKTESG
FT                   KAEFTTPDRLNSIGFDDAPGRYRLITMRSNDQFNTTVYGMSDRLRGIEGRRDVLLINPD
FT                   EMARAGLTEGQAVWLEGDAGDGVHREAGPLVVTPFKLPDGCLGAYYPEMNPLIPVWHHD
FT                   GPSKTPAAKSVPVRIRI"
FT   gene            246168..247430
FT                   /locus_tag="Rpdx1_0218"
FT   CDS_pept        246168..247430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0218"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="KEGG: bra:BRADO6613 glucose-1-phosphate
FT                   adenylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41861"
FT                   /db_xref="GOA:E6VH89"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH89"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ADU41861.1"
FT                   /translation="MSQGVTAPFARHAMAYVLAGGRGSRLMELTDWRAKPAVYFGGKSR
FT                   IIDFALSNALNSGIRRIAVATQYKAHSLIRHLQRGWNFFRPERNESFDILPASQRVSEE
FT                   MWYRGTADAVYQNIDIIESYDPKFIVLLAGDHVYKMDYEKMLQQHVEQGADVTVGCLEV
FT                   DRMEATAFGVMHIDETDRIMSFLEKPADPPAMPGKADKSLVSMGIYVFETKFLLDELRR
FT                   DAADPNSSHDFGKDIIPYIVKHGKAVAHHFDKSCRRSSSEAISYWRDVGTVDAYWAANI
FT                   DLTDIVPELDLYDREWPIWTYGEITPPAKFVHDKEGRRGEAVSSLVSGGCIISGASLRH
FT                   TLLFTGVRVHSFSHVENTVVLPYADIGRSCRLTNVVVDAEVKLPAGLVVGEDPELDAKR
FT                   FRRTENGVCLITRAMIEKLDA"
FT   gene            247427..248878
FT                   /locus_tag="Rpdx1_0219"
FT   CDS_pept        247427..248878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0219"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="KEGG: msl:Msil_0213 glycogen synthase; TIGRFAM:
FT                   glycogen/starch synthase, ADP-glucose type; PFAM: Starch
FT                   synthase catalytic domain protein; glycosyl transferase
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41862"
FT                   /db_xref="GOA:E6VH90"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH90"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ADU41862.1"
FT                   /translation="MTTLAVLSIASELFPLIKTGGLADVAGALPAALRANDIAVTSLLP
FT                   GYPAVLGGIENPQQVHSFNELFGGTARLLAARCGDLDLFVLDAPHLYVRPGNPYVGPDG
FT                   KDWPDNGLRFAALAQVGAAIGQGLLSHYKPDVLHAHDWQTGLLPAYLKYSGRPGPKTVF
FT                   TIHNLAFQGRFPYELLTRLGLPERAFGLDGIEYYGGIGYLKAGLQLADRITTVSPTYAA
FT                   EIQGSEAGMGLDGLLRLRSNRLSGILNGVDTDVWNPANDALISATYDVESIAARTRNKK
FT                   VLQARFGLKPEPGALLYGVISRLSWQKGLDLLLEALPQLIAGGAQLALLGSGDAELEQA
FT                   YAAAARRYPGQIGAVIGYDEALAHQIQAGADALLVPSRFEPCGLTQLCALRYGAVPVVA
FT                   RVGGLADTVVDANEMATATGVATGVQFAPVTTDALIKAFGKTRALFADVVAWRNLQING
FT                   MTTDVSWKNPAQHYAKLYRDLVAER"
FT   gene            248995..249786
FT                   /locus_tag="Rpdx1_0220"
FT   CDS_pept        248995..249786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0220"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   pzu:PHZ_c3300 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41863"
FT                   /db_xref="GOA:E6VH91"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH91"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU41863.1"
FT                   /translation="MPSQDTVRIERDGPVTIVTIDRPERRNAVDGATAKKLYDAFLAFD
FT                   ADETASVAVFTGAGGTFCAGADLKAVAAGDAEKKREIAGHNTLAPMGPSRLRLSKPVIA
FT                   AVEGFAVAGGLELALWADMRVVAEDATFGVYCRRFGVPLIDLGTIRLPRLIGHSQAMDL
FT                   ILTGRPVAADEAHRIGLANRLVPRGEALPRAVELAKQIAQFPQTCLRADRLSALQQWDL
FT                   PEEDAIMNEMRGGLKVIQSGETLSGATRFAQGEGRHGAFTS"
FT   gene            complement(249969..250682)
FT                   /locus_tag="Rpdx1_0221"
FT   CDS_pept        complement(249969..250682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0221"
FT                   /product="DNA repair protein RadC"
FT                   /note="KEGG: nwi:Nwi_0335 DNA repair protein RadC; TIGRFAM:
FT                   DNA repair protein RadC; PFAM: DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41864"
FT                   /db_xref="GOA:E6VH92"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH92"
FT                   /inference="protein motif:TFAM:TIGR00608"
FT                   /protein_id="ADU41864.1"
FT                   /translation="MDDAERSPQPGFAEAPHYHGHRERLRERFREAGADALSDYELLEL
FT                   VLFRALPRRDVKPLAKALIARFGSFAEAVHAPAERLREVSGLGEAAIIEVKLIAAAAAR
FT                   VTKGQVKQRTVLSSWSAVIDYCRTTMAFADKEQFRILFLDKRNQLIADELQQVGTVDHT
FT                   PVYPREIVKRGLELSATAVIMVHNHPSGDPTPSQADIQMTKSIVAIAEPLGIAVHDHII
FT                   VGKNGHASLKGLKLI"
FT   gene            complement(250794..251036)
FT                   /locus_tag="Rpdx1_0222"
FT   CDS_pept        complement(250794..251036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll5764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41865"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH93"
FT                   /inference="similar to AA sequence:KEGG:bll5764"
FT                   /protein_id="ADU41865.1"
FT                   /translation="MVDRPRDLPRDLARRMARRSTPADGFLRETYVLPRPDARAKAKAF
FT                   LEAWPKAAYMSSVESWRELPGDTIEFTMRRLPSAD"
FT   gene            251143..252135
FT                   /locus_tag="Rpdx1_0223"
FT   CDS_pept        251143..252135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0223"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   nha:Nham_0450 hypothetical protein; SMART: Ku domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41866"
FT                   /db_xref="GOA:E6VH94"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH94"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ADU41866.1"
FT                   /translation="MAPRANWKGFLRLSLVTCPVALYPATSDSEKISFNQINRATGHRI
FT                   KYLKVDAETGDEVPADEIMKGYKVDTDSYIEITRDELDNIALESTRTIEIDQFVPRPEI
FT                   DDLYLVRPYYLVPDGKVGHDAYAVIRETIRSMDKVALARVVLTNREHVIALEARDKGLV
FT                   GMLLRYPYEVRDAADYFDDIQDVKITKDMLDLAKHIVEQKSGHFQPDLFEDHYESALTE
FT                   LINSKMAGQPVKPQARPRGDNVVDLMDALRRSLGESGKLAPAAAPKSSAADKPAAAKPA
FT                   KAKKRKTAAGQKEMLLPISGQGAGKAKEGPAKAKKPARSVAGSKARKAG"
FT   gene            complement(252357..253181)
FT                   /locus_tag="Rpdx1_0224"
FT   CDS_pept        complement(252357..253181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0224"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: nha:Nham_0431 methionine aminopeptidase, type
FT                   I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41867"
FT                   /db_xref="GOA:E6VH95"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH95"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADU41867.1"
FT                   /translation="MSYVDASEAALRKTGQIKLHGPAGFAGMRKAGQLVARCLDELVDI
FT                   VKPGVPTSRIDDFVREFAFSHGAYPATLMYRGYRYSTCTSLNHVVCHGMPGDRPLKEGD
FT                   IVNVDVTYIVDGWYGDSSRMYPVGPVARKAERLIDVTYESLMRGIAAVKPGATTGDIGH
FT                   AIQSFVEPQQMSVVRDFCGHGLGRLFHDEPNIIHVGSPGQGAVLKPGMFFTIEPMINLG
FT                   KPYVKILSDGWTAVTRDRSLSAQFEHSIGVTENGCEIFTLSPKNLDKPPFQS"
FT   gene            253386..255182
FT                   /locus_tag="Rpdx1_0225"
FT   CDS_pept        253386..255182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0225"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger;
FT                   transporter-associated region; KEGG: nwi:Nwi_0337
FT                   potassium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41868"
FT                   /db_xref="GOA:E6VH96"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH96"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADU41868.1"
FT                   /translation="MESLDSVSIAILLGSVLVMAGILSSLLALRFGAPLLLVFLVIGIL
FT                   AGESGPGGLAFNDLGTTYLVGSVALALILFDGGLKTRFSSIKAVLAPSMGLATVGVLLT
FT                   ALLTAPVAKYMLDLSWIEALLAGAVVASTDAAAVFLLVHSQGLRLRPRVGATLEVESGT
FT                   NDPFAVFLTLMLVELITHGGQGSIWDVVLELLQQGVLGALIGVVGGRIVVMALNRVALP
FT                   QGLHAPFVTTAALVVFGAAQISHASGFLAVYLAGMIIGNQPTRAHNSVVAFLDAATWLA
FT                   QIVMFVLLGLLVSPQRLMSSIGPAVVIALALMLVARPLAVFICLAPFRFNWRERLFIAW
FT                   VGLRGAVAIFLASIPMLVGLSNAYQYFDVAFVVVLISLMLQGWTLGPAARKLHVALPRT
FT                   DRGPRRIELDLPGQLEQQLVGYAVRPKSLYLKRGLIPSWSKPTLVIRDERILTPEEAEP
FT                   VAPGDYVYLLAPPEKAAALDRFFVDMPPSTAPDPHLLGDFIVPGETSLGDLAAAYGVGV
FT                   PPGQEALTLADYFDIHLDQAPVVGATLPLDSIVLVARSLGGGRVNVVGLRLPEDEDDAP
FT                   PPTRFAKLKAKLSEIWSLLAGV"
FT   gene            complement(255204..256166)
FT                   /locus_tag="Rpdx1_0226"
FT   CDS_pept        complement(255204..256166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0226"
FT                   /product="peptidase U6 penicillin-insensitive murein
FT                   endopeptidase"
FT                   /note="PFAM: peptidase U6 penicillin-insensitive murein
FT                   endopeptidase; KEGG: nwi:Nwi_0341 penicillin-insensitive
FT                   murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41869"
FT                   /db_xref="GOA:E6VH97"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH97"
FT                   /inference="protein motif:PFAM:PF03411"
FT                   /protein_id="ADU41869.1"
FT                   /translation="MHHTILAAPMWFAALLATTVSFLAVAQAQDKGRLDPKPLPPLANP
FT                   NDPALAARELFARKLRPAALPPQPVGFYAKGCMAGGLALPIDGPTWQVMRLSRNRNWAL
FT                   PDTVRLIQILADKAHAQAGWPGILVGDMSQPRGGPMLTGHASHQVGLDADIWLTPMPDR
FT                   RLSRNEREEMSAVMMVRKDRLDIEPSAWTPSHWMVIRAAALEPAVDRIFVNAAIKKALC
FT                   REARGDRGWLQKVRPMYGHDYHFHIRLRCPPGVDGCVSQPEPPSGEGCSASDFAYWFSD
FT                   AVLHPKPPTKPPPPRHQLTLAELPGECRAVLNAPDKKPD"
FT   sig_peptide     complement(256086..256166)
FT                   /locus_tag="Rpdx1_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.607 at
FT                   residue 27"
FT   gene            256532..258769
FT                   /locus_tag="Rpdx1_0227"
FT   CDS_pept        256532..258769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0227"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold-4 domain protein; KEGG: bja:bll8156 hypothetical
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41870"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH98"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADU41870.1"
FT                   /translation="MPQVRLKKKKTARNRPGTGSGRMHRCGWTAPRLASKPRRRANAAE
FT                   VVAGERAVEAALEEARRSHERLREAIDLIPQGIVFLDADGRYILWNKRYAEIYKATADQ
FT                   FRAGARIQDTMRIGIARGDYPEAIGREEEWIAERLQRMFNPGHSHEQVLADGRCIQIEE
FT                   RTTSDGGIIGLRVDITELKQREASFRLMFDSNPVPMIVCELNDERILAVNDAAVEHYGY
FT                   SPSEFASLTIRRLQAFDTELPWSGDQTHEERTARTWKHVKADGSLIDLAIYSRQLTYNG
FT                   EPAVLLALMDITERKRAEMRLAFMAHHDGLTGLPNRNSLRKRLDDLLIQTRRTGEKIAV
FT                   LFLGIDNFKAVNDTLGHAVGDKLLRGVARRLRSTLREEDPLARLNSDEFAVIQTGIKRP
FT                   EDIVLLAKRLLHAVAEPYLLQGHSVVIGASIGIAVAPGDGDDSEKLLMNADMALSRAKK
FT                   DTRGTFSFFEVGMDARAQARRKIETDLRAALQHEVLRPYYQPLVRLADGRITGSEALVR
FT                   WPHPERGMISPAEFIPVAEDTGLINAIGAQILRSACMDAARWPDDVRIAVNLSPLQFRV
FT                   GNLLSVVMDALKQSGLPPRRLELEITETLLLEKSSQVLATLHALRALGVRISMDDFGTG
FT                   YSSLSYLRSFPFDKIKIDQSFVRGLCDNRESQAIVRAIISLGNGLGVTITAEGVESEAE
FT                   LSWLRAEGCQEAQGFLFSHARPNAEITGLLELQQSGASVGTPFAMGSARVA"
FT   gene            complement(258794..260551)
FT                   /locus_tag="Rpdx1_0228"
FT   CDS_pept        complement(258794..260551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0228"
FT                   /product="Alkaline phosphatase"
FT                   /note="KEGG: rru:Rru_A1289 alkaline phosphatase; PFAM:
FT                   Alkaline phosphatase; SMART: Alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41871"
FT                   /db_xref="GOA:E6VH99"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E6VH99"
FT                   /inference="protein motif:PFAM:PF00245"
FT                   /protein_id="ADU41871.1"
FT                   /translation="MMIRHVVAAALASLMFVSAASAQTIYPIDRAELLAGAKFDLKVEF
FT                   AGEVAADTASLTINGADAASVFGKAPELIAREAGQPRSALLLRDVTLNRPGRYTIEAGD
FT                   GAERRSVSWTVYDTGPRRARNVILFIGDGMSPAHRVAARILSKGIDQGRARGKLAIDDM
FT                   PQMALVSTAGSDSIITDSANAASAYATGHKAAVNAMGVYADRTPDPFDDPKVETLASLA
FT                   KRKLGLAVGIVTNTEVQDATPAAVIAHTRRRAAYDAIVAQFYAAQPDVLMGGGSAYFLP
FT                   KSAGGKRKDDVDYLAKFRDAGYSVATTATELEAVGQQSPAKLLGLFAPGNMDGVLDRRF
FT                   LKGGGVAKNPDQPDLTRQVAVALEVLAKNDAGFFLMVESGLIDKYAHALDMERAVYDTI
FT                   MLDNAVRQTRDWAKARGDDTLILVVADHNHPNALVGTVRDDLAEGDDVPLRERIGVYDR
FT                   AGFPNYPAPDQDGYPERVDVSRRLAIFSASLPDHYETLRPKLDGPNQPTEAGDKPGTFK
FT                   ANDKYKGVPGAVLRIGNLPAMMNASVHSGEDVILTAAGPGSDRVHGALENSDLFRVMAD
FT                   ALGLGADAK"
FT   sig_peptide     complement(260483..260551)
FT                   /locus_tag="Rpdx1_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 23"
FT   gene            complement(260661..261620)
FT                   /locus_tag="Rpdx1_0229"
FT   CDS_pept        complement(260661..261620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0229"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: met:M446_5547 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41872"
FT                   /db_xref="GOA:E6VHA0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHA0"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADU41872.1"
FT                   /translation="MTIALPLTVAAGVDAGQRFLDVALAPSGQTFRMPNLAEGIAEIIA
FT                   RLERSGVRRVVLEAIGPYAEPLIKALSVAGFEVGIVNPRRIKAFREAEGGRAKTDRLDA
FT                   RLIARFALTMPETLRPLPTDTQLELKALSLRRRQLTEMIAMEKTRMKQVCGTLLLDSHR
FT                   AAIAALSAQCQAIEAELARRIGDDAELRRVLHILKSIPGIGERVATLLITDLPELGQRD
FT                   RKAIASLAGLAPHVSQSGAAPPRAAIAGGRPCVRAALYMAALVAARHHPKLRDDYNALR
FT                   LQGKPGKVALIAIARKLLVTANALVKADTQYQGKTLDT"
FT   gene            261985..262728
FT                   /locus_tag="Rpdx1_0230"
FT   CDS_pept        261985..262728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0230"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: cak:Caul_4355 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41873"
FT                   /db_xref="GOA:E6VHA1"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHA1"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADU41873.1"
FT                   /translation="MLADTSRFAAYRTLIGQNAKSDTSDARLLAAYAASPDEIRGRKPD
FT                   HVELEENPVREALHECASRRDQLKQMIHAESCRLATTRLAEIRQAIEQHLDMLRAEDKS
FT                   LQQRMQTLLRQSADLIAAQRLLTTIKGIGVTSAMTLIAMVPELGRVDNKAAAALVGVAP
FT                   FVRQSGTMTAPARIRGGRAAVRHILYMAAVAASRHNKILRPFYERLIADGKPVKVALIA
FT                   VLRRLVVFANAVLRSGQPWKGASLT"
FT   gene            complement(262796..264133)
FT                   /locus_tag="Rpdx1_0231"
FT   CDS_pept        complement(262796..264133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0231"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="TIGRFAM: argininosuccinate synthase; KEGG:
FT                   oca:OCAR_4294 argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41874"
FT                   /db_xref="GOA:E6VHA2"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHA2"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ADU41874.1"
FT                   /translation="MTTILKSLPKGENVGIAFSGGLDTSAALLWMKQKGAKVFAYTANL
FT                   GQPDEADYDAIPRKAMEFGAEKARLVDCRTQLVHEGIAAIQAGAFHVSTGGIAYFNTTP
FT                   LGRAVTGTMLVSAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNPALRIYKPWLDQQFI
FT                   DELGGRAEMSAFMTSHGFAYKMSAEKAYSTDSNLLGATHEAKDLEHLDSGIKIVVPIMG
FT                   VPFWRDDCAVKAETVTVRFEEGQPVALNGKTFTDPVALFYEANAIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQYRINGMKLGRLLYQGRWFDSQ
FT                   ALMLRETAQRWVARAVTGEVTLELRRGNDYSILNTVSPNLTYAPERLSMEKVEDAPFTP
FT                   ADRIGQLTMRNLDITDTRAKLGLYAKTGLLSSGEGTPIPKLENDKG"
FT   gene            complement(264230..265009)
FT                   /locus_tag="Rpdx1_0232"
FT   CDS_pept        complement(264230..265009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0232"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   nwi:Nwi_2804 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41875"
FT                   /db_xref="GOA:E6VHA3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHA3"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADU41875.1"
FT                   /translation="MNRNGLLIALALFAGIGLTFGLFPELDLWLAGLFYDSATKTFPLR
FT                   SVDDLEFVRDLAMWIAWAIAAPSIFALVYKMIRPDLPLVMPGRTVAFLLISITLSAGVL
FT                   TNMTFKSHWGRPRPAAVTEFNGPWQFKAWWDNSGACPKNCSFFSGEGATAYWTFAPAAL
FT                   TPPTVRPYAYAAAFVFGTVTSGLRMAFGGHFFTDVVIAGLVTFLVIWLLYALIYRWAWS
FT                   RTSDAAIDAALTRAFWPGYRWRSKWRGRDVGPAPATT"
FT   gene            complement(265006..265506)
FT                   /locus_tag="Rpdx1_0233"
FT   CDS_pept        complement(265006..265506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO0245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41876"
FT                   /db_xref="GOA:E6VHA4"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHA4"
FT                   /inference="similar to AA sequence:KEGG:BRADO0245"
FT                   /protein_id="ADU41876.1"
FT                   /translation="MALLFRLFVIAIGFLFASIAGGLVVVGMLLFPELSQIADGPIDPD
FT                   ALNIMMGFGFIFVSGFALLPALVVVLITEAFSIRSALAYAIGGALVGVACYLGLVPFDP
FT                   ATLHFDGIIRRHLEIMTGAGIVGGMVYWLIAGRNAGAWRDPPRPRAPLPPSQPAPPPVN
FT                   RAP"
FT   sig_peptide     complement(265438..265506)
FT                   /locus_tag="Rpdx1_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.752) with cleavage site probability 0.377 at
FT                   residue 23"
FT   gene            complement(265506..266099)
FT                   /locus_tag="Rpdx1_0234"
FT   CDS_pept        complement(265506..266099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0234"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: bac:BamMC406_4894 metal-dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41877"
FT                   /db_xref="GOA:E6VHA5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHA5"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADU41877.1"
FT                   /translation="MLPADEIQGVLAFLREAERLKSVIRSGYTSTGRPESTAEHTWRLC
FT                   LMAMLLADGLGDIDVARLLKICIVHDLGEALHGDVPAVAQVEGDDRAARERADIETLTQ
FT                   PLDDKRRAELLGLWHDYETGATPEGRLAKGLDKLETILQHTQGLNPAEFDYAFNLDYGT
FT                   KQTAVHPLIGAIRAELDSDTRARMAAQQSTGATR"
FT   gene            complement(266103..267302)
FT                   /locus_tag="Rpdx1_0235"
FT   CDS_pept        complement(266103..267302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0235"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="TIGRFAM: radical SAM enzyme, Cfr family; PFAM:
FT                   Radical SAM domain protein; KEGG: bbt:BBta_0241 putative
FT                   pyruvate formate lyase activating enzyme 2 (YfgB); SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41878"
FT                   /db_xref="GOA:E6VHA6"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHA6"
FT                   /inference="protein motif:TFAM:TIGR00048"
FT                   /protein_id="ADU41878.1"
FT                   /translation="MTPSATSTLVEKTPLETYVPPAKPSLIGLSRAQLCDRLGEIGVAP
FT                   PQRKMRAQQLWHWMYVRGARDFSEMTNVSKEMRATLAEHVTVDRPEVVAEQISADGTRK
FT                   WLLRLPSGGDGQKAHEVECVYIPETDRGTLCVSSQVGCTLNCAFCHTGTQRLVRNLTAG
FT                   EIVGQVMVARDRLNDWIDRETPNGNRLITNIVMMGMGEPLYNFDAVRDALLIVSDNEGI
FT                   GISRRRITLSTSGVVPNIKRTGDEIGVMLAISLHAVRDELRDELVPLNRKYPLKELLQA
FT                   CRDYPGASNARRITFEYVMLKGVNDTIDDARKLVQLLKGIPAKINLIPFNPWPGSKYEC
FT                   SDWDQIEKFSEYIFNAGYSSPVRTPRGRDILAACGQLKSETEKLSVRERDALRAMAMTD
FT                   "
FT   gene            complement(267485..268039)
FT                   /locus_tag="Rpdx1_0236"
FT   CDS_pept        complement(267485..268039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41879"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHA7"
FT                   /inference="similar to AA sequence:KEGG:Nham_3627"
FT                   /protein_id="ADU41879.1"
FT                   /translation="MTALAGSLLVAAGNAAVAREAKGKAGATPAAASGGAEPTLIGQFG
FT                   SWGAYTAAPGGKKVCFALAKPSSSKTNPPNRPRDPAYAFISTRPAEKVVNEVSVMVGYP
FT                   LKPGSESTIDVGSASFAMYSQGDGIWIKNAAEEDRLVEAMRKGAEITVKGVSSRGTAST
FT                   DVFSLKGLSQALDKVAQACGS"
FT   sig_peptide     complement(267983..268039)
FT                   /locus_tag="Rpdx1_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.924 at
FT                   residue 19"
FT   gene            complement(268213..269049)
FT                   /locus_tag="Rpdx1_0237"
FT   CDS_pept        complement(268213..269049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0237"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bja:bll0527 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41880"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHA8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU41880.1"
FT                   /translation="MFEAGLLANKRILITGGGSGLGAAMAARFAELGASLVLCGRRAEV
FT                   LQHTAERIRSHGGEVDAIVCDVRDPQAVEGMLDAIWRDAPLDVLINNAAATFIAQTERL
FT                   SARAADAILAPTLHGAMYCTLGAGRRWIDGGRAGVVLSILSTSTITGRAFTVPSAMAKS
FT                   AVLAMTKSLAVEWGPKQIRLVAIAPGAFPTAGATAQLQPDGRAADPVARVPLGRVGNHD
FT                   ELANLASFLISDHAGYINGEMVVQDGGAHLRSSGAEDLLHWSDQQWTAHRAARAKS"
FT   gene            269281..270255
FT                   /locus_tag="Rpdx1_0238"
FT   CDS_pept        269281..270255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0238"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bbt:BBta_0243 putative quinone oxidoreductase (NADPH) and
FT                   Zn-dependent alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41881"
FT                   /db_xref="GOA:E6VHA9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHA9"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADU41881.1"
FT                   /translation="MKAILCQQYCGPDDLVYADVPDPVAGPGEAVIAIKAAALNFFDIL
FT                   MIQGKYQIKPPFPFSPGAEVAGVIESVGEGVTDLKIGDRVVASCGHNGAREKIALPAQQ
FT                   IVKIPDSLDFDRAAGIIIIYGTALHALEDRASPKPGETLAVLGAAGGTGLAACELGKLM
FT                   GLKVIACASSEEKLEFAKQHGAELTLNYATEDLKEGLKKLTGGKGVDIVFDPVGGAYAE
FT                   AALRSIAWEGRFLVIGFAAGDIPKMPLNLALLKGCDIRGVFWGAWTRINPEKNRANLEK
FT                   LVKWAAEGKISSHVDRTFPLAQTADALKVLAGRQAMGKVILHP"
FT   gene            complement(270371..272509)
FT                   /locus_tag="Rpdx1_0239"
FT   CDS_pept        complement(270371..272509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0239"
FT                   /product="All-trans-retinol 13,14-reductase"
FT                   /EC_number="1.3.99.23"
FT                   /note="KEGG: bbt:BBta_7528 putative phytoene dehydrogenase
FT                   and related proteins; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41882"
FT                   /db_xref="GOA:E6VHB0"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHB0"
FT                   /inference="protein motif:PRIAM:1.3.99.23"
FT                   /protein_id="ADU41882.1"
FT                   /translation="MKTFLTVKLVLVPFAVFWILLALHQPAWAIWLGLGLSLAGNAWRG
FT                   HRRELFVLEAGGLVLFAGLAALHLVAPAIAVANALWLSFAGLSTISVLSLAARRPWTAD
FT                   YSRAAHPDNAGTPQFFMINAAITALWAVLFAVIAAGRHLGAPAEVIGAIVTVGALVSIF
FT                   GPKLAIRFVMQRLADAPESYRWPAPSFAADQPEDCDVVVIGAGIGGLTAAALLADAGLK
FT                   VKVFDQHVVPGGYCHSYLRKAHHLNEPVLYRFDAGPHDFSGVQPGGPFATLLRRLGVTD
FT                   RIVWERVTQSFHTEHGVIDVAPDWRDYVRMLGERFPGSAAGIQALFDEIKAIFDDMFAT
FT                   AAGRGGIPGPPATIEELLAFPRAHPHAYKWMNRPFAELVAAHVDDPAVVAVIDGLSGYI
FT                   GDGSERPSCARMVPIFGYYFHGGYYPRGGSGVVAEAMVAAIEARGGEVRVKTAVQRILV
FT                   ENGCAAGVILAGGETVRARAVVSNADFKRTMLELVPPDALPRRFRNRVADAAPANSCFS
FT                   VHLGIDCVPDLGPSTHLQAPIKLGIAMMSKLDPSAAPPGHAILSLIALVPHAEARSWFP
FT                   HDHDGNDYKAWRRSDDYLRRKREFGDRMIAAAETAIPNLARHIVYRTDASPVTYARYDW
FT                   ASFGSIYGMSTAGQLRGSKTPLRNLVIAGGGNIGAGIEAVVISGANAAEALMPGLLANA
FT                   QPVASEPAAATRPELMPA"
FT   gene            272653..273273
FT                   /locus_tag="Rpdx1_0240"
FT   CDS_pept        272653..273273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0240"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ank:AnaeK_2962
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41883"
FT                   /db_xref="GOA:E6VHB1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHB1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU41883.1"
FT                   /translation="MDKKQENTADPRRAAILQAAFEVFVEKGFDAATTAEIVRRARISK
FT                   RTLYEFFASKQEILTALVRYGAAKMQPSPQLPEPQDKAQFLAVLEQFGRIFLSELLHAE
FT                   RTAMYRLAIAEAGRGGGSVARELEASGRGPVTQAATRFFEHAAARGIIRRDDIATLISV
FT                   FFSVLIGIAPLQALLGEPPLSAEAIAQRAKLATQVMARMSETA"
FT   gene            complement(273289..273663)
FT                   /locus_tag="Rpdx1_0241"
FT   CDS_pept        complement(273289..273663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0241"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   bja:bll0531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41884"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHB2"
FT                   /inference="protein motif:PFAM:PF06803"
FT                   /protein_id="ADU41884.1"
FT                   /translation="MTSDYSVGFEPADRLAQDPEQVRRRFWRKLKGVAARLPFAEDILA
FT                   AYYCAFDRQTPRHVQIALLGAIAYFVLPFDLAPDILPVLGFTDDAAILAAAIRMVAGNI
FT                   TPAHREAARVAMQRGLEDEA"
FT   gene            complement(273743..274048)
FT                   /locus_tag="Rpdx1_0242"
FT   CDS_pept        complement(273743..274048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0242"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: nwi:Nwi_2809
FT                   pterin-4-alpha-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41885"
FT                   /db_xref="GOA:E6VHB3"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHB3"
FT                   /inference="protein motif:PFAM:PF01329"
FT                   /protein_id="ADU41885.1"
FT                   /translation="MVEPLSAGELRSALQDLPGWSACTDRAAIGRSFVFADFSEAFGFM
FT                   ARVALAAEKADHHPDWRNVYKTVDVTLTTHDAGGVTARDVALAKAIDAIAGPLGAG"
FT   gene            274234..275679
FT                   /locus_tag="Rpdx1_0243"
FT   CDS_pept        274234..275679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0243"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: bja:blr0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41886"
FT                   /db_xref="GOA:E6VHB4"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHB4"
FT                   /inference="protein motif:TFAM:TIGR02122"
FT                   /protein_id="ADU41886.1"
FT                   /translation="MNSARLLSRSMDGPDPGEAVLQPSPRSPRRRMTLILLATILALIG
FT                   AVSAGYYFAMRPVTLKIAVGPQTGDDYKLIQALAQVFARERNTVRLRPVVTDGPAASAV
FT                   ALKSGTVDLAVIRGDLPVPKVAQSVAVLHKNVAVLWAPASAEQKAKRKSGKSSAIAGIT
FT                   DLAGKRVGVVGRTEANAGLLGVILQQYGVDPAKVQSIALPAGEVAEAVRSRKVDALLAA
FT                   GPLNSKTIADAVLATAHTGREPVFLSVDSAEALAANHPSYEATSIPAGAFGGAPVRPDN
FT                   EIKTVSFSHYIVARDGASDTTIATFTEQLFTARQIVMSEVPLAAKIETPDTDKDAVIPV
FT                   QPGAAAYVDGEERSFLDRYSDLIWFSLMGLSLIGSAGAWFASYLRKDERTSTAAQRQRL
FT                   LDMLATARRCSSAEELDTMQTEADAILRDTLDAYENGAIDSAALTAFSIALEQFHNAVA
FT                   DRKLLLSDASPLPPVRGVRPQAV"
FT   gene            complement(275689..277134)
FT                   /locus_tag="Rpdx1_0244"
FT   CDS_pept        complement(275689..277134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0244"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="KEGG: mpo:Mpop_0228 PepSY-associated TM helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41887"
FT                   /db_xref="GOA:E6VHB5"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHB5"
FT                   /inference="similar to AA sequence:KEGG:Mpop_0228"
FT                   /protein_id="ADU41887.1"
FT                   /translation="MQSVVRRGKRWLYLGHRWLGIAGCLLFAMWFISGVVMMYVAFPHL
FT                   DKQERWAALPDLAWQRVTLSPDQAMQVAGAKAYPRELRLVMLDTEPVYRLLDWSGRRTT
FT                   VSAIDGRKIDQVSADQALGIARHHPAAAAPRLIETVDRDQWSVTSRYDPFRPLYLIGLG
FT                   DAAGTDLYVGSRGGEIVLDTTRGERVWNWLGAIPHWIYFTVLRQDGPLWRQVVLWVSGV
FT                   LMLVAISGIWIGLLRAGLRRRYASGRVTPYRGWMAWHHIAGLIGGVVVLTWMFSGWLSM
FT                   NPGEAFARRGESRDMLQRHAGHDAPTIADRLPATAMPGVVEARFVWIGSTPLMLVAHRD
FT                   GRQTLIDPQSGAPTRLPEDAVVAAAARLLPDAAIVLRQRLDRYDVYWYQHHRQRVLPVL
FT                   RVGFDDPAATWVHLDPATGELLGRSDTSARSYRWLFNALHSFDFPVLLAWRPAWDLLVI
FT                   ALSLAGLVISISGVVIGWRRLLR"
FT   gene            complement(277139..279418)
FT                   /locus_tag="Rpdx1_0245"
FT   CDS_pept        complement(277139..279418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0245"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="KEGG: azl:AZL_004810 iron complex outermembrane
FT                   recepter protein; TIGRFAM: TonB-dependent siderophore
FT                   receptor; PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41888"
FT                   /db_xref="GOA:E6VHB6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHB6"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ADU41888.1"
FT                   /translation="MTPAVLPLGRNRRLLSSVALVPLLWPVDGLAQTASANPRGLDPIV
FT                   VEGQTARPAKPRATANAGSSRQRRAAARPAAAPAPAPAEAATTRAATAPTFNLGTPSST
FT                   GSRLGLTPLQTPASVEVIRAETIAERGQHNVIDAVTQNATGFTASPAPGNGGLSFATRG
FT                   FTGNGTVMSLYDGTRMYVGSGTMTFPFDTWTAQRIEVLRGPASVMYGEGAIGGAVNVIS
FT                   KKPLDVQRNEAEISLDTNLLRRLAVDSGGPINPNVSYRLAAIGNMSDGWVDRDTMSNVA
FT                   VSGSVRVQAADNLAFTLSEDYADRSPSRYFGTPLVNGRIDESLRFKNYNVGDSSIRYRD
FT                   NWTQFKTEWDVAEGVSVKNVTYYLSSHRHWKDVESYAYSPTTGNINRSSYIEIFHDQEQ
FT                   VGNRFDTTFKGHLFGLANQFVAGFDVNRITFTHTNNSPYAGNSSVNPYSFDPGNFLWVS
FT                   STRPSFHTQTTQYGLFAENRLSLTDQLAVIGGVRSDHPTVERTDFLTPANSFEKTYSAP
FT                   SWRVGVVYNPIPDLSLYGQYATAVDPVTNLITMTGVNRDFALSTGKQIEVGIKQQLAGG
FT                   RAEWTLSAYQIVKNNLLARDPQNPANTNPLQIGQQSSRGIEASAGLKVTDTLRLDANVA
FT                   WLRAKYDDFTQVVGGQVVNYAGNVPANVPQVVSNIWATWAFAPSWSANAGVQLVGDTWA
FT                   DNANTLVRPAYSVVNAGLMWKPDTRQTLALRVYNVFDTVYATSGGTSQWILGMPRTAEL
FT                   SYNVKF"
FT   misc_binding    complement(279527..279724)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 117.51"
FT   gene            280153..281976
FT                   /locus_tag="Rpdx1_0246"
FT   CDS_pept        280153..281976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0246"
FT                   /product="GTP-binding protein TypA"
FT                   /note="KEGG: bra:BRADO0265 GTP-binding protein TypA/BipA
FT                   (tyrosine phosphorylated protein A); TIGRFAM: GTP-binding
FT                   protein TypA; small GTP-binding protein; PFAM: protein
FT                   synthesis factor GTP-binding; elongation factor Tu domain 2
FT                   protein; elongation factor G domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41889"
FT                   /db_xref="GOA:E6VHB7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHB7"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ADU41889.1"
FT                   /translation="MTLRNIAIIAHVDHGKTTLVDKLLQQSGTYRDNQRQVERAMDSND
FT                   LERERGITILAKCTSVVWGDTHINIVDTPGHADFGGEVERILSMVDGVIVLVDAAEGPM
FT                   PQTKFVVGKALKLGLKPIVAINKVDRSDARVTEVVNEVFDLFAALDATDEQLDFPILYG
FT                   SGKNGWMSDKPDGDHSEGMKPLFELVLKHVHAPVVEEGPFRLLGTILEANPYLGRIITG
FT                   RIASGSVKPNQAVKVLSRDGKLVEQGRISKILAFRGLERVPLDIAEAGDIVAIAGLTKG
FT                   TVADTFCDPAVDTPIQAQAIDPPTVSMSFIVNNSPLAGTEGDKVTSRLIRDRLLREAEG
FT                   NVALRVVESADKDAMEVSGRGELQLAILIENMRREGFELSVSRPRVVLTRDENGQLLEP
FT                   VEEVVIDVDEEFSGVVVQKMSERKAEMIEMRPSGGNRLRLVFYAPTRGLIGYQGELMTD
FT                   TKGTAIMNRLFHDYLPYRGEIQGRRNGVLISNDQGEAVAYAMFKLEDRGPMMIEPGWKV
FT                   YKGMIVGEHTRDNDLEINVLKGKQLTNIRTTSKDEAVRLTPPIRMTLEKALAYIEDDEL
FT                   VEITPKSIRLRKRLLDPNERKRAEKSKQAVA"
FT   gene            282083..283351
FT                   /locus_tag="Rpdx1_0247"
FT   CDS_pept        282083..283351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0247"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: bja:blr0541 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41890"
FT                   /db_xref="GOA:E6VHB8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHB8"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADU41890.1"
FT                   /translation="MPSSSFPSSVDIAIIGAGAAGLGAARALEGAGLSVIVLEARDRIG
FT                   GRAWTRMVTPEIAFDVGCGWLHSADENSFVGIAGLLGIGIDKTHPPWSEASFGDVFPKR
FT                   DRAAFGKALDAFYERVWRAAKHKTDVAAATLLEPGNRWNPMIDAVSTYVNGAELDRISV
FT                   HDLESYRDTGINWRVREGYGTLIAAYGGPCPVVLTCVVERIDHSGRQIKLETSLGTLVA
FT                   GQVIVTVPTNLIASEAIRFAPALPDKLDAARNLPLGVDDKVMLKLSDPNDFPADGNLRA
FT                   ATMRSAMGTYHLRPFGHDCIEGFFGGRYARELEDAGDGAFAAQAIDEIADLLGNNIRRK
FT                   LSPLAESRWAHDPFARGAYSHALPGHAGARALLAAPVDGRLFFAGEATSPQFFSTAHGA
FT                   RDSGERAARQAIDCRSDVGFAAN"
FT   gene            283525..284034
FT                   /locus_tag="Rpdx1_0248"
FT   CDS_pept        283525..284034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0248"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bja:blr0547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41891"
FT                   /db_xref="GOA:E6VHB9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHB9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU41891.1"
FT                   /translation="MSTTLIEVRAAKAADASAVAATHDEAWRSAYQGIIPGAELEKLIN
FT                   RRGPTWWDSAIRKGSRISVLCFGDKIAGYANYGRNRARSLQFEGEIYELYLRPEFQGLG
FT                   FGRRLFAAARRDLVQSGLKSMVIWALSDNEPATEFYRALGGRMVARSSERFGPKSLDKV
FT                   AFAWSN"
FT   gene            284113..284649
FT                   /locus_tag="Rpdx1_0249"
FT   CDS_pept        284113..284649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0249"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: bja:blr0548 inorganic pyrophosphatase; PFAM:
FT                   Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41892"
FT                   /db_xref="GOA:E6VHC0"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHC0"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADU41892.1"
FT                   /translation="MRIDAIPVGVNPPYDVNVIIEVPVGGEPIKYEMDKAAGTLVVDRF
FT                   LYTSMHYPGNYGFIPHTLSDDGDPCDVLVANTRGIVPGAVMSVRPVGVLYMSDEAGHDE
FT                   KIIAVPSSKLTQRYDRIKTYSDLPEITLAQFQHFFEHYKDLEPGKWVKVLRWGGAEEAH
FT                   KLILEGLDRAKQAKG"
FT   gene            284685..286166
FT                   /locus_tag="Rpdx1_0250"
FT   CDS_pept        284685..286166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0250"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: bra:BRADO0276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41893"
FT                   /db_xref="GOA:E6VHC1"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHC1"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ADU41893.1"
FT                   /translation="MRRLLRWIRNLVAIAVLAVAVLAGVLAYNTFRHGSRQIAVAAVPP
FT                   IAIDEQGAAQRLSQSIRFPTISNFLNPEQGADALRDLRAHIESSFPAFHAAAKREIVGG
FT                   HSLLYTWEGSDPQAKPIGLLAHQDVVPIAPKTEADWQQPPFSGAIEGGYVWGRGSWDDK
FT                   GNLYAMLEAAELMAKQGFRPKRTIYFAFGHDEEVSGLRGAAKIAELLASRNVRLDFVLD
FT                   EGLLITDGVLKGLDKPAALIGVSEKGYATLVLTARGTPGHSSMPPRDTAIGMLAAALTH
FT                   LEDNRLPMRIRGSVAEMFDTLAPEMSGFSRVALSNLWLFRPLLLREFAKSGTTAAMVQT
FT                   TTALTVFNAGDKDNVLPGVAEASVNFRLLPGDTQTSVTDHVRSVVANDKIAIQGFDGNF
FT                   DPPPVTGTKSASYLALNRTIREVFPDVIVAPGLMIAATDSRHYAQVADNIFRFSPVRAT
FT                   PEDLKRFHGTNERISIKNYADMIRFYVRLMQSTAG"
FT   sig_peptide     284685..284768
FT                   /locus_tag="Rpdx1_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.762 at
FT                   residue 28"
FT   gene            complement(286341..287228)
FT                   /locus_tag="Rpdx1_0251"
FT   CDS_pept        complement(286341..287228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0251"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /EC_number="1.5.1.5"
FT                   /note="KEGG: nha:Nham_0609 methylenetetrahydrofolate
FT                   dehydrogenase (NADP+); PFAM: Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain;
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41894"
FT                   /db_xref="GOA:E6VHC2"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHC2"
FT                   /inference="protein motif:PRIAM:1.5.1.5"
FT                   /protein_id="ADU41894.1"
FT                   /translation="MTARIIDGKIISAELRARVAAEVARLKTDHGITPGLAVVLVGNDP
FT                   ASEVYVRSKHKQTQEAGMASFEHRLPADVPQAELMALIAKLNADPAVHGILVQLPLPKG
FT                   LDSNAVIDAIDPAKDVDGLNPTNAGRLASGLFALTPCTPLGSIIMAKTVHASLEGMNAL
FT                   VIGRSNLVGKPLVQLLLNENATVTIAHSRTRDLPALSRQADLVFAAVGKAEMVKGDWIK
FT                   PGATVIDVGINRTPGKDGGKDKLLGDVAFDEAKEVAGAITPVPGGVGLMTVACLLVNTV
FT                   RAACAIHGLPKPAV"
FT   gene            complement(287335..287661)
FT                   /locus_tag="Rpdx1_0252"
FT   CDS_pept        complement(287335..287661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0252"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   nwi:Nwi_0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41895"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHC3"
FT                   /inference="protein motif:PFAM:PF02594"
FT                   /protein_id="ADU41895.1"
FT                   /translation="MAEAWRYSAQGVAVAVRVTPRGGRDDIDGLETLSDGRPVLKVRVR
FT                   AIADGGEANRAVTELLAKAVGVPKRNVRLLSGATSRQKQIAIDGDPKQLGEVLRRLVAA
FT                   KPAE"
FT   gene            complement(287671..288030)
FT                   /locus_tag="Rpdx1_0253"
FT   CDS_pept        complement(287671..288030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0253"
FT                   /product="protein of unknown function YGGT"
FT                   /note="KEGG: nwi:Nwi_0478 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41896"
FT                   /db_xref="GOA:E6VHC4"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHC4"
FT                   /inference="protein motif:PFAM:PF02325"
FT                   /protein_id="ADU41896.1"
FT                   /translation="MDGGEPIFTAQPFRDRNREFSPAMRAILDIVLIILDLYIWLLIAS
FT                   AILSWLIAFNVVNTRNQFVGAVSDFLYRITEPLLAPIRNLLPSLGGLDISPIILILLIM
FT                   FLQRVITYYIYPAVF"
FT   gene            288164..288239
FT                   /locus_tag="Rpdx1_R0005"
FT                   /note="tRNA-Ala1"
FT   tRNA            288164..288239
FT                   /locus_tag="Rpdx1_R0005"
FT                   /product="tRNA-Ala"
FT   gene            complement(288548..289366)
FT                   /locus_tag="Rpdx1_0254"
FT   CDS_pept        complement(288548..289366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0254"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bja:bll0552 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41897"
FT                   /db_xref="GOA:E6VHC5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHC5"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU41897.1"
FT                   /translation="MPLSYQDILYEVADRIATITLNRPDRMNAWTPVMEREVRVAMQQA
FT                   AEDGGVRVIVLTGAGRGFCAGADMQVLQNIDPSDVRRAADLPPFDMNRRADWQTRYAFY
FT                   PSIGKPIIGMLNGATAGIGLVHALYCDVRFAADTAVFTTAFARRGLIAEHGISWMLPLI
FT                   VGHANALDLLLSARRVSADEALRMGLVNRLYPADQLREQTYAYARDLADNVAPASMRVI
FT                   KRQLYEVPFQTLAEATIEANREMAISLASDDFKEGVASFVEKRPPQFKSA"
FT   gene            complement(289441..289941)
FT                   /locus_tag="Rpdx1_0255"
FT   CDS_pept        complement(289441..289941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_3840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41898"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHC6"
FT                   /inference="similar to AA sequence:KEGG:Veis_3840"
FT                   /protein_id="ADU41898.1"
FT                   /translation="MTSEEFARLLESLTRAAESGDGAAFAGHFTEDATYHDYIYGPHSG
FT                   RAEIASMMQDLFHRDATDYRWEMFDPVCNHDLGYAWSLSSFTSTVPDFAGRRVVIDGMS
FT                   RFVLRGGLIAEYRESVNGGVAMAQLGVAPERMARVFGKWSGWLQQRPETQDYLARPKGS
FT                   RRA"
FT   gene            complement(290093..290902)
FT                   /locus_tag="Rpdx1_0256"
FT   CDS_pept        complement(290093..290902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0256"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   nha:Nham_0606 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41899"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHC7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU41899.1"
FT                   /translation="MANLKHEFPVVTERVTLITGASAGIGAELAQIFADNAHRVVLVAR
FT                   RGERLETLAADIRAKGGPDPIVIACDLGKPDAAEQIASTLAAAGVEVEYLVNNAGYGLF
FT                   GRAVELDREDQLGMIDLNIRMLTDLSFRFADSIAGLRGGILNVASIAGFMPGPGMAVYY
FT                   ASKAYVLSLTEALHQELGPKGVRVTALCPGPVPTEFQQRAGFEPGFDSAVLNVSPAEVA
FT                   RQAYHGLMHNKRIVLPGLGVKIVPFLLRFFPRGFIATAVGRFQLRRR"
FT   gene            complement(291042..291536)
FT                   /locus_tag="Rpdx1_0257"
FT   CDS_pept        complement(291042..291536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41900"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHC8"
FT                   /inference="similar to AA sequence:KEGG:Nham_0605"
FT                   /protein_id="ADU41900.1"
FT                   /translation="MLDKLRQFITDVVAPSAPEELTLDEGGYRLAATALLIHVISIDGD
FT                   PSEVEKQKLHSLLEQRFGLDAATATRLIASATLIEGEAVDLYHFTSVIMRSVNEQGRLR
FT                   IVEMMWELVYADGAVTEFEENVVWRAADLLAVSTRDRVNLRQKVAAAHDMQTVSEVDPA
FT                   N"
FT   gene            complement(291673..293058)
FT                   /locus_tag="Rpdx1_0258"
FT   CDS_pept        complement(291673..293058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0258"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: bbt:BBta_0276 putative
FT                   cytochrome P450 hydroxylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41901"
FT                   /db_xref="GOA:E6VHC9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:E6VHC9"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADU41901.1"
FT                   /translation="MSIAVIDDRPASRAPLIPPTPPRAPDDISALGRLAAIRHNAIASW
FT                   GDRAYQDDIVKGRFFTHASYILNAPDAIRHVLIDNADNYRRTATGIRVLRPMLGDGLLL
FT                   AEGRAWKHQRRTLAPAFTPRAVATLVPHMLSATEEAIAGLHRNAGAPVDLREAMQHLAL
FT                   EIAGRTMFSFEMGTHGRALRSFVIDYGTRLASPRFLDLLLPLGWPTPQDIARARFRRRW
FT                   TRFVGELIAARRASGKTADAPPRDLFELMLAARDPETGEAFSDAQLGDQVATMILAGHE
FT                   TTATALFWALYLLALDPDAQERLASEVRRLGPGAVEIERLPFTRAVLDETLRLYPPAFL
FT                   IVREAAGADQVAGFAVRKHDVMLIAPWLLHRHEKLWHEPDAFVPARFLPGAAPPDRFAY
FT                   LPFGLGPRVCIGAHFALVEATLALAKIVGTFRIELIDTTPVMPIGVVTTQPDRSPSFRL
FT                   TPR"
FT   gene            complement(293178..294179)
FT                   /locus_tag="Rpdx1_0259"
FT   CDS_pept        complement(293178..294179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0259"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="KEGG: bja:bll0766 2-hydroxyacid dehydrogenase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41902"
FT                   /db_xref="GOA:E6VI06"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI06"
FT                   /inference="protein motif:PRIAM:1.1.1.26"
FT                   /protein_id="ADU41902.1"
FT                   /translation="MSVKKKPLVVVTRKLPDSIETRMRELFDARLNLDDVPMTAEQLAE
FT                   AARTADVLVPTVTDTITAEMLNQPDCQLKLIAHFGNGIDNLDVAAAHARGITVTNTPKV
FT                   LTEDTADMTMALILAVPRRLIEGAALLTDGGDWPGWSPTWMLGRRLGGKRLGIIGMGRI
FT                   GQAVARRARAFGLQIHYHNRKPVAPRIADELGATYWDSLDQMLARMDIISVNCPHTPAT
FT                   FHLLSARRLKLIRKDAFIVNTARGEVIDEETLTRLIESGDIAGAGLDVYEHEPAVNPKL
FT                   VRLAKHGKVVLLPHMGSATIEGRVEMGEKVIINIRTFLDNHKPPDRVLPGML"
FT   gene            294414..294938
FT                   /locus_tag="Rpdx1_0260"
FT   CDS_pept        294414..294938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0260"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; KEGG:
FT                   bja:blr0767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41903"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI07"
FT                   /inference="protein motif:PFAM:PF06347"
FT                   /protein_id="ADU41903.1"
FT                   /translation="MTMKYLMAVTAFAGAMTCAASFAQAGKDSPLSASGLPVPRYVSLK
FT                   SDHVNVRVGPTKDNDVAWVYTRAGLPVEVTAEFENWRRVRDSEGAEGWVYHSLLSGRRT
FT                   AVVIMKDKDELAPLYERATAGSAVVARLQAGVVAQVRRCDMKWCRIVGSGFDGWIEKLQ
FT                   LWGVYADEQVN"
FT   sig_peptide     294414..294485
FT                   /locus_tag="Rpdx1_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.649 at
FT                   residue 24"
FT   gene            complement(295046..295537)
FT                   /locus_tag="Rpdx1_0261"
FT   CDS_pept        complement(295046..295537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0261"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="KEGG: oca:OCAR_4496 ferric uptake regulator, FUR
FT                   family; manually curated; PFAM: ferric-uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41904"
FT                   /db_xref="GOA:E6VI08"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI08"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADU41904.1"
FT                   /translation="MDIGEHVAFLREEPAQEAHSHAEPRLNGCPWHDVNEMLQSVGLRP
FT                   TRQRMALGWLLFGKGDRHLTAEMLYEEASQAKVPVSLATVYNTLNQLTEVGLLRQVSVD
FT                   GTKTYFDTNVSAHQHFYLENNHELIDIPNADLELKATPEVPDGYEIARVDVVVRLRKRG
FT                   "
FT   gene            295796..296323
FT                   /locus_tag="Rpdx1_0262"
FT   CDS_pept        295796..296323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0262"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA; KEGG: nwi:Nwi_0034
FT                   3-hydroxydecanoyl-(acyl carrier protein) dehydratase; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41905"
FT                   /db_xref="GOA:E6VI09"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI09"
FT                   /inference="protein motif:TFAM:TIGR01749"
FT                   /protein_id="ADU41905.1"
FT                   /translation="MRDRRSSYEYEDLLACGRGELFGAGNAQLPLPPMLMFDRITTITE
FT                   DGGEFGKGHIRAELDVNPDLWFFACHFKNDPVMPGCLGLDAMWQMVGFFLGWVGGEGPG
FT                   RALGLGELKFTGQVLPHISKIVYNVDIKRVMRSKLWLGIADGWLSADDEIIYRAKDLKV
FT                   GLFKQTAQPVGG"
FT   gene            296390..297616
FT                   /locus_tag="Rpdx1_0263"
FT   CDS_pept        296390..297616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0263"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: oca:OCAR_4498
FT                   3-oxoacyl-(acyl carrier protein) synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41906"
FT                   /db_xref="GOA:E6VI10"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI10"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ADU41906.1"
FT                   /translation="MRRVVVTGMGIVSSIGNNTQEVLASLYDAKPGISRAEKHAELGFR
FT                   SQVQGAPTLNPADVVDRRAMRFLGEGAAWNHVAMEQAIADSGLEESEISNERTGIVMGS
FT                   GGPSARTIVEAADITRTKGPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAYELIQWGKQDVMFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDI
FT                   SRDGFVIAGGAGVLVLEELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKM
FT                   ALATTGGIKIDYINPHATSTPAGDPPEINALRNVFGAGDKCPPISATKALTGHSLGATG
FT                   VQEAIYSLLMMQNGFICESANITELDPVFADMPIVRKRVENAKLGAVLSNSFGFGGTNA
FT                   TLVFKRLEA"
FT   gene            297791..298603
FT                   /locus_tag="Rpdx1_0264"
FT   CDS_pept        297791..298603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0264"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bja:blr0771 enoyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41907"
FT                   /db_xref="GOA:E6VI11"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI11"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU41907.1"
FT                   /translation="MQQLMQGKRGLIMGVANDHSIAWGMAKTLAAHGAELAFTYQGEAL
FT                   ARRVKPLAQSLNSDLVLPCDVEDIASVDAVFETLKEKWGKLDFVIHAIGFSDKNELRGQ
FT                   YIDTSRANFSRTMVISCFSFTEVAKRAAALMPDGGAMITLTFGASERAMPNYNVMGLAK
FT                   AALEASVRYLACDLGPKGIRVNAVSAGPVRTLAGAGIGDSRAMFGFMEKHSPLGRGVTL
FT                   EELGGSALYLLSDLSGGVTGETHYVDSGYNIVLMPKPDALKGGDKAGE"
FT   gene            298700..298780
FT                   /pseudo
FT                   /locus_tag="Rpdx1_0265"
FT   gene            complement(298954..300567)
FT                   /locus_tag="Rpdx1_0266"
FT   CDS_pept        complement(298954..300567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0266"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /note="KEGG: bbt:BBta_7365 phosphoenolpyruvate
FT                   carboxykinase; TIGRFAM: phosphoenolpyruvate carboxykinase
FT                   (ATP); PFAM: phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41908"
FT                   /db_xref="GOA:E6VI12"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI12"
FT                   /inference="protein motif:TFAM:TIGR00224"
FT                   /protein_id="ADU41908.1"
FT                   /translation="MQETGVHNGAYGADKFGLKNLTGVYWNFGAPQLYEHALKNGEAVL
FT                   SSDGALVADTGVFTGRSPKDKFTVRDATTENTMWWGGNQSITADQFETLYQDFLKHAEG
FT                   MTLFAQDLYGGADPTFRIKTRVYTELAWHSLFIRTLLRRPERAELESFVPELTLIDLPS
FT                   FRADPARHGCRSENVVAIDFARKIVLIGGTQYAGEMKKSVFTTLNYYLPEKGVLPMHCS
FT                   ANVGPSGDTAIFFGLSGTGKTTLSADPNRTLIGDDEHGWGKDGVFNFEGGCYAKCIKLS
FT                   AENEPEIYAASTRFGAVLENVVLGEIDRKPDFDDGSKTENTRSAYPLESIPNASLTGRA
FT                   GQPKNVVMLAADAFGVMPPIAKLTPAQAMYHFLSGYTAKVAGTERGVTEPTPEFSTCFG
FT                   SPFLPRDPSVYGNMLRELIAKHNVDCWLVNTGWTGGIYGTGHRMPIKVTRALLTAALDG
FT                   SLRNVEFRTDPYFGFAVPTALPGVPSEILDPVKTWADKAAFDTTARKLVGMFQKNFAKF
FT                   EAQVDAEVRAAAPDVKIAAE"
FT   gene            complement(300759..301493)
FT                   /locus_tag="Rpdx1_0267"
FT   CDS_pept        complement(300759..301493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0267"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: bja:bll8143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41909"
FT                   /db_xref="GOA:E6VI13"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI13"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADU41909.1"
FT                   /translation="MQPTSEFSAPKLAKSLLRRRREGALATLMQSGGAPYCSLVNLASH
FT                   PDGSPLLLISRLAVHTRNLLADPRVSLMLDERAAGDPLEGARIMLLGTAVEAGADDGPL
FT                   WRRRYLAAHPAAEGYIDFADFSLFKIETSGLHLVAGFGRILDLAPDRYLTDLRGAEALL
FT                   DVEASAVAHINADHSGTMKLYATQLLGAAEADWRCTGIDPEGLDLQCGRATLRLDFPDR
FT                   VENPVALRDMLKRMADIARKAE"
FT   gene            301727..302428
FT                   /locus_tag="Rpdx1_0268"
FT   CDS_pept        301727..302428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0268"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: bja:blr8144 two-component response regulator;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41910"
FT                   /db_xref="GOA:E6VI14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI14"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU41910.1"
FT                   /translation="MPTIALVDDDRNILTSVSIALEAEGYRIMTYTDGASALDGFRTTP
FT                   PDLAILDIKMPRMDGMETLRRLRQKSDLPVIFLTSKDEEIDELFGLKMGADDFIRKPFS
FT                   QRLLVERVKAVLRRSAPKDPAAAPKENDAKALDRGPLRMDPERHTCTWKNEPVTLTVTE
FT                   FLILQALATRPGVVKSRNALMDAAYDDQVYVDDRTIDSHIKRLRKKFKAVDDEFEMIET
FT                   LYGVGYRFKEI"
FT   gene            302564..304336
FT                   /locus_tag="Rpdx1_0269"
FT   CDS_pept        302564..304336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0269"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: nha:Nham_0442 periplasmic sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41911"
FT                   /db_xref="GOA:E6VI15"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR025919"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI15"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU41911.1"
FT                   /translation="MRDTEDASSSRDETPARGRRWPRPLDWVRRTGQFFFTLSFSSLTR
FT                   RILSLNLAGLLALSTSILYLSQFRAGLIDARAQSLLVQAEIIAGAIAASATVETNTITI
FT                   DPDRLLDLKTGESYGPPDEYALLDFPINPERVAPVLRRLISPTKTRARIYDRDGVLILD
FT                   SRSLYGRGDVMRFDLPPPTAEKPGIVERAMIAIRTWFNRGDLPLYRELGPENGNGYQEV
FT                   AQSLKGHKSSMVRINDRGEVIVSVSVPVQRFRAIYGSLMLSTQGDDIDQMVTAERLAIL
FT                   KVFGVAAVVMFVLSVLLASTIAGPVRRLADAAERVRRRIRARVEIPDFTKRRDEIGHLS
FT                   GALRDMTDSLYNRIEAIERFAADVSHELKNPLTSLRSAVETLPLAKTDNSRARLLSVIE
FT                   HDVKRLDRLISDISDASRLDAELQRQDAAQVDLRRLLTTLTLVANETRLGHSTMVEVKF
FT                   DGPASDQFSVPGHDSRLGQVISNLLSNAQSFSCEGGKVRILCRRRKAEIEIIVEDEGPG
FT                   IREDALEKIFERFYTDRPHQGFGQNSGLGLSISKQIVEAHGGRIWAENRVGPRGEDGEP
FT                   TVAGARFVVRLPAK"
FT   gene            304333..304800
FT                   /locus_tag="Rpdx1_0270"
FT   CDS_pept        304333..304800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0270"
FT                   /product="HPr kinase"
FT                   /note="KEGG: bbt:BBta_7369 HPr kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41912"
FT                   /db_xref="GOA:E6VI16"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI16"
FT                   /inference="similar to AA sequence:KEGG:BBta_7369"
FT                   /protein_id="ADU41912.1"
FT                   /translation="MTAASPRTVHASAVKVGDHAVVIRGASGSGKSRLAWALIMAGRAG
FT                   QIPPAELIGDDRVVLEPEHGRLTVRQVPGLAGLIEIRGLGLRRTAAAAAAVAGLVVDLQ
FT                   AADASRMPEAAALWTEIGGVQLPRVAVGAGYDPLPLVVAALTTTDATGDEA"
FT   gene            304988..305389
FT                   /locus_tag="Rpdx1_0271"
FT   CDS_pept        304988..305389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0271"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: nha:Nham_0440 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41913"
FT                   /db_xref="GOA:E6VI17"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI17"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ADU41913.1"
FT                   /translation="MIGLVLVTHGRLADEFKAALEHVMGPQQQIEAVTIGAEDDADLCR
FT                   SDIIEAVNRVDSGEGVAILTDMFGGTPSNLAISCMSRPKVEVLAGINLPMLVKLAKVRE
FT                   ERSLPEAIALAQEAGRKYVTIASRVLAGK"
FT   gene            305386..305718
FT                   /locus_tag="Rpdx1_0272"
FT   CDS_pept        305386..305718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0272"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="KEGG: nha:Nham_0439 HPrNtr; TIGRFAM: phosphocarrier,
FT                   HPr family; PFAM: phosphoryl transfer system HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41914"
FT                   /db_xref="GOA:E6VI18"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI18"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADU41914.1"
FT                   /translation="MIADAPQPGSEPDHAAGASAEKISREIPVINKRGLHARASAKFVQ
FT                   MAERFNAEVWVTRNGETVGGTSIMGLMMLAAGIGTTVTVSASGPEARQALDAITELMGS
FT                   KFGEEE"
FT   gene            complement(305726..307264)
FT                   /locus_tag="Rpdx1_0273"
FT   CDS_pept        complement(305726..307264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO0839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41915"
FT                   /db_xref="GOA:E6VI19"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI19"
FT                   /inference="similar to AA sequence:KEGG:BRADO0839"
FT                   /protein_id="ADU41915.1"
FT                   /translation="MSAKSPPRRAFAPLTRWLDALLDPKRQELTVVWTLLAYMAIWTAY
FT                   RIIATWPRDLHADETELYGWSRHLALGTDKHPPFSAWVARAWFTLVPPSDLSVHLLATA
FT                   NIALTLYIAWRTMRRYMDADKSLFGLALLTLIPFFNFIALKYNANAVLLPLWALTIHCF
FT                   LRALEGRAALWAALAGVFAGASMLGKYWSIVLIVALGLAALIDPRRGRFFGSMAPWLMI
FT                   LCGGAVLAPHLWWLYAHDFPTLSYAEAHEAGSFADNLRDTLGYLAGCVGYAAVALIVAA
FT                   LLLRPSRAALADIAWPADPQRRTILVAQVLLIVAAVPVALVTGIRIVPLWAMPAYTLLP
FT                   IVLLASPLIAVGRETVRRGLIVASAVSLGSLALSPAVALVIHLSDPPGPFEYASLLAEH
FT                   VEREWRRNSDRPVPLVAGETVLAGNTAFYLRTDTKGFETADVAALKQRAEANGAVLVCP
FT                   ADNGGCIATAERIVAGQPQILRGKVWLSRPLFGQPGGRVSDVFFLVLPAGTSAK"
FT   gene            307409..309220
FT                   /locus_tag="Rpdx1_0274"
FT   CDS_pept        307409..309220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0274"
FT                   /product="GTP-binding protein LepA"
FT                   /note="KEGG: bbt:BBta_7374 GTP-binding protein LepA;
FT                   TIGRFAM: GTP-binding protein LepA; small GTP-binding
FT                   protein; PFAM: GTP-binding protein LepA domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; elongation factor G domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41916"
FT                   /db_xref="GOA:E6VI20"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI20"
FT                   /inference="protein motif:TFAM:TIGR01393"
FT                   /protein_id="ADU41916.1"
FT                   /translation="MTTVPIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKE
FT                   QVLDSMDIERERGITIKAQTVRLNYRANDGKDYIFNLMDTPGHVDFAYEVSRSLAACEG
FT                   SLLVVDASQGVEAQTLANVYHALDANHEIVPVLNKVDLPAAEPEKIKQQIEDVIGLDAS
FT                   DAVMISAKTGLGVPDVLEAIVTRLPPPKGDREATLKALLVDSWYDVYLGVVVLVRVVDG
FT                   VLKKGQRIRMMGTGAAYDVERVGFFTPKMVNVDELGPGEVGFITAAIKEVADTRVGDTI
FT                   TDDKKPITEMLPGFKPAIPVVFCGLFPVDADDFETLRGAMGKLRLNDASFSFEMETSAA
FT                   LGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYHMKLTDGTEMEIHNPVDMPD
FT                   VVKIAEIQEPWIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVV
FT                   FDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRA
FT                   MVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQK
FT                   EGKKKMRQFGKVDIPQEAFIAALKVDG"
FT   gene            complement(309227..310048)
FT                   /locus_tag="Rpdx1_0275"
FT   CDS_pept        complement(309227..310048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41917"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI21"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3444"
FT                   /protein_id="ADU41917.1"
FT                   /translation="MAKTKKIARKFATDQANLLENSIRRELDWAGDRSVVEKGSATDKK
FT                   NYAEGLSRALSQRFADALRKSFDGILPDVDGFGQESKARTGKGLKKLDVNYSTVELGLG
FT                   LGVSIKTINFRDAKTKRYTKNYTRVDNELRAEAADYHERQPYAVLSAVVFIPLDACDDG
FT                   GSAPSSFGQAVQIFRYRAGRERPVDDATLFERILVGLYDAGSPSFGTTGFFDVMDAPPR
FT                   TGRPSSLMTFEEAIDKIVEAYDARNKSAFKWAEGETEILAAPEAEDDEDET"
FT   gene            complement(310053..310469)
FT                   /locus_tag="Rpdx1_0276"
FT   CDS_pept        complement(310053..310469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0276"
FT                   /product="DNA mismatch endonuclease Vsr"
FT                   /note="KEGG: DNA mismatch endonuclease Vsr; TIGRFAM: DNA
FT                   mismatch endonuclease Vsr; PFAM: DNA mismatch endonuclease
FT                   vsr"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41918"
FT                   /db_xref="GOA:E6VI22"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI22"
FT                   /inference="protein motif:TFAM:TIGR00632"
FT                   /protein_id="ADU41918.1"
FT                   /translation="MTSPGFERPTDPARSALMRRVRQIGTKAEDEVAAILRQSGLRFRR
FT                   NVKSLPGSPDFANKTNQWAIFVHGCFWHRHEGCRRTTTPTRNRDFWLAKFAANVNRDKI
FT                   KARLLRAMGFKVLTIWECETRNPSNVRRRLQRLR"
FT   gene            complement(310466..311638)
FT                   /locus_tag="Rpdx1_0277"
FT   CDS_pept        complement(310466..311638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0277"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="KEGG: ade:Adeh_3442 DNA-cytosine methyltransferase;
FT                   TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41919"
FT                   /db_xref="GOA:E6VI23"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI23"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ADU41919.1"
FT                   /translation="MKIAGLFAGVGGLELGLHRAGHDTLVFSEIWEPAGAVLERRFGGV
FT                   PNVGDVASLKSLPADVDLMTAGFPCQDLSQAGKTAGIKGRKSGLVSHVFRLIDRSRPKW
FT                   VMLENVSFMLRLDAGSAMTRLVTEFEQRGYRWAYRVVNSLSFLPHRRARVFFLASLEGD
FT                   PADVLLVDDAEPAELQTNLQSHAHGFYWTEGTRGLGWGPDCVPTLKNGSTIGIPSPPAI
FT                   LLTNGEIVTPDIRDAERLQGLPADWTKPAAQVTRASFRWSLVGNAVSTPVAAWIGKRLV
FT                   KPGRFDPARDGAAVVKGNWPKAARSDGDVRREVMISEFPKWAKRESLQDFLRHQPNLLS
FT                   VRATAGFLSRIEKSSLRFVPGFKDKVRAHLEHVRAIDSFVEPSRLLVAAE"
FT   gene            311859..312707
FT                   /locus_tag="Rpdx1_0278"
FT   CDS_pept        311859..312707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0278"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mac:MA2691
FT                   lipolytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41920"
FT                   /db_xref="GOA:E6VI24"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI24"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADU41920.1"
FT                   /translation="MRLTQFLISGACALLLTATSALADPIAPAGKAIGQDAGGRTIYQV
FT                   DANGISIGYRLIGQGAPMVMIMGLGGTAENWPPQVVEALSKNHQLILMDNRGMGHSTAN
FT                   DTTFSYPLFAADVIGLLDALKVERSDVLGYSMGSTITQELLLEYPTRFNKALIHATSTD
FT                   GSNVAKALHGRVPADPIVARQVEATTHWKTPLDKLPAIPNQVMLVVGTADDVVGTDSSK
FT                   TIASAIPGAWLVQFKGATHHLMYETPDGFSAAALTFFETNETVTPKIEPNASVAPPPAQ
FT                   P"
FT   sig_peptide     311859..311930
FT                   /locus_tag="Rpdx1_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            313060..314892
FT                   /locus_tag="Rpdx1_0279"
FT   CDS_pept        313060..314892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0279"
FT                   /product="(Isocitrate dehydrogenase (NADP(+))) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /note="KEGG: bpt:Bpet0058 bifunctional isocitrate
FT                   dehydrogenase kinase/phosphatase protein; PFAM: Isocitrate
FT                   dehydrogenase kinasephosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41921"
FT                   /db_xref="GOA:E6VI25"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI25"
FT                   /inference="protein motif:PRIAM:2.7.11.5"
FT                   /protein_id="ADU41921.1"
FT                   /translation="MTATISHPRARPLGAAEIEHATRIAEPDFDLLDALYRTDDPDDQA
FT                   RLLARVVLSAFDNYYAVSRRIPALAQAAFEARDWPVTVRLSKTRIGLYTACIDQLVPLL
FT                   KAGLPELTTDEQLWPAAEAELLAAIEGRYEADFAFAFWQSLRRKLVSDEWRPVSYDAGA
FT                   TARRTTSPAAVLKTTTTTLPITAEVIARILDEAGFSVPWRDRDGDAALAAQAIETALEP
FT                   LGPRPGEPVKIEIADSGFFRNRGACLVGRIKLRDRGDMPMRNLPLLIALLNEKDGLVVD
FT                   AVLTDSDELQYAFSSTLANYHATNPRYHELARLLYELMPKRPLGTQYSCIGFHHLGKVA
FT                   VMTEILAEHRRTKEKLATAPGFKGTVAIAFTMPSSAYVLKIIRDHPTDDYKFDYFDGLD
FT                   AVLRKYNLVHEIDRAGSMLDNIIYSNVKLDRAMFAPDLLDELLEAGIGTVTLDRGALVF
FT                   RHLIVQIKLTPLPLYLANASAAESRAAVINLGDCIKNNAAADIFNKDLDGRNYGVSRIR
FT                   KVYLFDYDAVEPLTSVTVRRDGAIPGEFDNGMVFRPQEMLEGLRIDDPGLRRAFRDAHP
FT                   ELMQPDYWEGMQQALRDGKVPKVMNYPASRRLRR"
FT   gene            314982..315725
FT                   /locus_tag="Rpdx1_0280"
FT   CDS_pept        314982..315725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0280"
FT                   /product="CysZ-like protein"
FT                   /note="KEGG: nwi:Nwi_0060 CysZ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41922"
FT                   /db_xref="GOA:E6VI26"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI26"
FT                   /inference="similar to AA sequence:KEGG:Nwi_0060"
FT                   /protein_id="ADU41922.1"
FT                   /translation="MLDAAFKALTQILSPPMRSILWRSVGFALALIAVAAIGLQRLLSW
FT                   AATSSELWAEAALGGFQTPLNILSWVLSIAAGLGIVVGAVFLMPAVTSLVAGIFVDEAA
FT                   EHVERASYPHEAPGVALPIGLATWETVKTALLTILVYLVALPFLFFAGAGAIVFFVATA
FT                   WLLGREYFELAAMRFRPAPEAKAMRRDNATTVFIGGLIIAAFVSIPIVNLATPLFGMAF
FT                   MVHLHKRLSGSRPEVIAPDQRSMLR"
FT   sig_peptide     314982..315122
FT                   /locus_tag="Rpdx1_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.610 at
FT                   residue 47"
FT   gene            complement(315749..315859)
FT                   /locus_tag="Rpdx1_0281"
FT   CDS_pept        complement(315749..315859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41923"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI27"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU41923.1"
FT                   /translation="MKMSHLANFLMMIVGGAVQEVSSAVRRKLRNVPQNQ"
FT   gene            316350..317321
FT                   /locus_tag="Rpdx1_0282"
FT   CDS_pept        316350..317321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0282"
FT                   /product="magnesium chelatase accessory protein"
FT                   /note="KEGG: rce:RC1_2083 magnesium-chelatase 30 kDa
FT                   subunit; TIGRFAM: magnesium chelatase accessory protein;
FT                   PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41924"
FT                   /db_xref="GOA:E6VI28"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR017497"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI28"
FT                   /inference="protein motif:TFAM:TIGR03056"
FT                   /protein_id="ADU41924.1"
FT                   /translation="MVPHSAHDPHQTSSSVATATVRSDLGPDWERDGHDWPNRHGSSFV
FT                   RAAGLRWHVQQIGHGPALLLLHGTGASTHSWRHLAPLLAEHFTVIAPDLPGHGFSETPE
FT                   RARMSLDGMASGLAALLHTLGHRPVVVGGHSAGAAVLARMCLDGGIAPAALVSLNGALL
FT                   PIGGRAGRWMLPLARLLAASAMVPRLVARFARTQGMVERMIADTGSTLDPQGVELYRRL
FT                   VCSPGHVAAALTMMAGWRLERLAAELPQLAPRLLLIAGSNDRTIASSDAERVKTMVPGA
FT                   RTVIMPGLGHLAHEERPQDVAGLIVEFARDHGALPPELAAAE"
FT   gene            317449..319014
FT                   /locus_tag="Rpdx1_0283"
FT   CDS_pept        317449..319014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0283"
FT                   /product="peptidase S10 serine carboxypeptidase"
FT                   /note="PFAM: peptidase S10 serine carboxypeptidase; KEGG:
FT                   bja:bll5514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41925"
FT                   /db_xref="GOA:E6VI29"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI29"
FT                   /inference="protein motif:PFAM:PF00450"
FT                   /protein_id="ADU41925.1"
FT                   /translation="MPLSTRSAVTAAVLIAALALPPLGLNAAIAQEQRAAPHADRAKPG
FT                   SEHAESAPGKADASPARAELSSLPPDVSTKHSLVLPGRTLAFTATAGSIRLYNGKGEPQ
FT                   ADIAITAYKLDGADARTRPVTFLFNGGPGASSAWLQLGAAGPWRLPIGNSVVASSPPVL
FT                   QANAETWLDFTDLVFIDPVGTGYSRFAASGDEVRKQFYSVDGDISAIALAIRRWLEKND
FT                   RLTSPKYIAGESYGGIRGPRVVRNLQTKQGIGVNGLILVSPALDFRDLSGSSLLQYAAR
FT                   LPSLAAVARQQKGKVTRADLADVESYARSEFITDLIKGEADKEATTRLADRVAALTGID
FT                   KTVSRRLAGRFDTREFQREFDRDRGRVTGRFDGARLGLDPFPDSSGAHFGDPSADSLIA
FT                   PLTSAAVDLTRNTLNWKPDGSYELLNGSVAEQWDFGRGRQPLESTTQLREILSVDPSLQ
FT                   VLVTGGLFDLAVPYYGTQMILDQLPPTLADKRVKYIIYPGGHMFYADDTARRSLHDEVK
FT                   AMMK"
FT   sig_peptide     317449..317532
FT                   /locus_tag="Rpdx1_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.889 at
FT                   residue 28"
FT   gene            complement(319141..319923)
FT                   /locus_tag="Rpdx1_0284"
FT   CDS_pept        complement(319141..319923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0284"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="SMART: HhH-GPD family protein; iron-sulfur cluster
FT                   loop; TIGRFAM: endonuclease III; KEGG: bbt:BBta_0201
FT                   DNA-(apurinic or apyrimidinic site) lyase / endonuclease
FT                   III; PFAM: HhH-GPD family protein; iron-sulfur cluster
FT                   loop"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41926"
FT                   /db_xref="GOA:E6VI30"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI30"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ADU41926.1"
FT                   /translation="MPKTTRRPAKLAAKPPATSPAKPTKRVAAAKPKSAPAKPVARPGK
FT                   SPRRWSAAEVHEAFSRFAKANPEPKGELEHLNPFTLLVAVVLSAQATDAGVNKATRPLF
FT                   AVADTPQKMLALGEERVREYIKTIGLFRTKAKNVIALSQKLITDFGGEVPDTREALETL
FT                   PGAGRKTANVVLNMAFGQPTMAVDTHVFRVGNRTGLAPGETPLAVELELERVIPAEFMQ
FT                   HAHHWLILHGRYTCLARKPRCEVCLIADLCRWPEKTVS"
FT   gene            319946..320461
FT                   /locus_tag="Rpdx1_0285"
FT   CDS_pept        319946..320461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0285"
FT                   /product="Protein of unknown function DUF2244,
FT                   transmembrane"
FT                   /note="KEGG: nwi:Nwi_0204 hypothetical protein; manually
FT                   curated; PFAM: Protein of unknown function DUF2244,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41927"
FT                   /db_xref="GOA:E6VI31"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI31"
FT                   /inference="protein motif:PFAM:PF10003"
FT                   /protein_id="ADU41927.1"
FT                   /translation="MATEPDLGPDSREPKLFSARLKAHRALSHNGFLILIGLVGTVSFA
FT                   AGLAFWMMGAWPVFGFFGLDVLALAVAFRVSFARARASEEISMTCSELRVRRTSARGEV
FT                   AEWVLNPLWVRLEKIVHHEAGIERLYLVSSGRRLAIAGFLGAEEKASFANALMAALDAA
FT                   RRGPLYQA"
FT   gene            320477..321409
FT                   /locus_tag="Rpdx1_0286"
FT   CDS_pept        320477..321409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0286"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; helix-turn-helix- domain
FT                   containing protein AraC type; KEGG: bja:bll0687
FT                   transcriptional regulatory protein; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41928"
FT                   /db_xref="GOA:E6VI32"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI32"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADU41928.1"
FT                   /translation="MAADAAIGNIGGMMNLAIADHHPVKPGARDSALADYDCVRRAIAF
FT                   ISQKWKAQPTIEAIADAAGLTPDELHHLFRRWAGLTPKAFMQALTLDHAKSLLRDSASV
FT                   LDAALESGLSGPGRLHDLFVTHEAMSPGEWKAGGAGLGLRYGFHPSPFGTAVIIASDRG
FT                   LAGLAFADPGEEQTALVDLQQRWPRAVCVPDQDTTAPLAQRIFDPAHWCPEQPLRVVLI
FT                   GTDFEVRVWETLLKIPLGKAVCYSDIAAKISLPKASRAVGAAVGKNPISFVVPCHRALG
FT                   KGGALTGYHWGLTRKQAMIGWEAGQLGGE"
FT   gene            321496..323010
FT                   /locus_tag="Rpdx1_0287"
FT   CDS_pept        321496..323010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0287"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; KEGG:
FT                   mrd:Mrad2831_4623 phosphoglyceromutase; PFAM:
FT                   BPG-independent PGAM domain protein; metalloenzyme domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41929"
FT                   /db_xref="GOA:E6VI33"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI33"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ADU41929.1"
FT                   /translation="MQSRRPVMLVILDGWGWREDPADNAVLQAKTPTFDALWGNGPHAF
FT                   LRTSGKSVGLPNGQMGNSEVGHLNIGAGRVVMQDLPRISDAIASDEIERAPGLVTFIEK
FT                   LRASGGTCHLMGLVSPGGVHSHQDHACALAKILTKAGVPTVLHAFTDGRDTPPKSAVDD
FT                   IVRLRADLPPNVPIATVSGRYYAMDRDNRWERVSKAYGVIADADGPRFANADAVIADGY
FT                   AAGVNDEFIVPAVVGDYQGMRDGDGVLCFNFRADRVREILAALLDPAFAGFPRKQVKKI
FT                   AAAVGMTQYSTALDALMGTIFPPQSLVNGLGQVVADAGLHQLRMAETEKYPHVTYFLNG
FT                   GEEVPYPGEDRIMVPSPKVATYDLQPEMSAPELGDKAVAAIESGKYDLIVLNFANPDMV
FT                   GHTGSLPAAIKAVETVDTQLGRIVAAIRNAGGALLVTADHGNCEMMRDPETGGPHTAHT
FT                   TNPVPVLLVGHDGPLSDGQLSDLAPTLLKLMELPQPTEMTGKSLIG"
FT   gene            complement(323088..323903)
FT                   /locus_tag="Rpdx1_0288"
FT   CDS_pept        complement(323088..323903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0288"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="TIGRFAM: dihydrodipicolinate reductase; KEGG:
FT                   nha:Nham_0158 dihydrodipicolinate reductase; PFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41930"
FT                   /db_xref="GOA:E6VI34"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI34"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ADU41930.1"
FT                   /translation="MSEMRLIVAGAGGRMGRALTRAISETDGVVLTGALESPNSELLGQ
FT                   DAGTLAGLPANGVLLSADLWSLSANADGIVDFTVPQATIANVAIAAQRGIAHIIGTTGL
FT                   SASDNAVIQSVTNRAVVVKSGNMSLGVNLLAAIAKRVAQSLDDSFDIEIVEMHHRAKVD
FT                   APSGTALLLGEAVAAGRKIDLATHSARGRDGLTGARKPGDIGFASLRGGTVTGDHTVIF
FT                   AGASERIELTHKAEDRMIFAHGALTAARWARGQKPGLYSMADVLGLGDI"
FT   gene            complement(324000..324308)
FT                   /locus_tag="Rpdx1_0289"
FT   CDS_pept        complement(324000..324308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0289"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   bra:BRADO0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41931"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI35"
FT                   /inference="protein motif:PFAM:PF07045"
FT                   /protein_id="ADU41931.1"
FT                   /translation="MPKGYWVGRIDVHDLDGYRRDYVAHNGAVFAKYGAKFLTRGGTYE
FT                   AKEGQARSRNVVIEFKDYETALACYNSPEYQALIKARAPFSEGEIVVVEGYDGPQPS"
FT   gene            complement(324334..325047)
FT                   /locus_tag="Rpdx1_0290"
FT   CDS_pept        complement(324334..325047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0290"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; KEGG:
FT                   bja:blr0683 orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41932"
FT                   /db_xref="GOA:E6VI36"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI36"
FT                   /inference="protein motif:TFAM:TIGR01740"
FT                   /protein_id="ADU41932.1"
FT                   /translation="MTTADIPDRDRLIVALDLPDLRVAEAMVDRLGDSVTFYKIGYQLA
FT                   YAGGLPLARALVGAGKQVFVDLKLHDIGNTVARGVESLSHLGASFLTVHAYPQTMKAAV
FT                   EARGSSKVKILAVTVLTSYDDHDLADAGYRFGVRDLVEARARQALAIGVDGLVCSSEEA
FT                   AHLRGIVGPEMALVTPGIRPAGAAAGDQKRIMTPARAIAAGASHLVVGRPVLEAPDPKA
FT                   AADAIVAEIAAARGS"
FT   gene            complement(325044..325637)
FT                   /locus_tag="Rpdx1_0291"
FT   CDS_pept        complement(325044..325637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0291"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bja:blr0682 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41933"
FT                   /db_xref="GOA:E6VI37"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI37"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADU41933.1"
FT                   /translation="MSAVKILIIPGSLRTGSHNVRLAAAAARELARADVDATWLSLADY
FT                   PLPIYDADLEAKSGVPKNAVGLKRMIGAHHGVLIVSPEYNSAPPPLLKNAIDWVSRVAD
FT                   PHEAPGQVFRDRAFALAAASEGKLGGARCLARAAADSDRLPRTGDSQSARAVVRSHGLR
FT                   RRRQAQAPRRQRCPAGDGPAIDRFRPADDEVTSS"
FT   gene            complement(325747..326352)
FT                   /locus_tag="Rpdx1_0292"
FT   CDS_pept        complement(325747..326352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0292"
FT                   /product="ribosomal RNA adenine methylase transferase"
FT                   /note="KEGG: bbt:BBta_0193 phospholipid
FT                   N-methyltransferase; PFAM: ribosomal RNA adenine methylase
FT                   transferase; SMART: Ribosomal RNA adenine methylase
FT                   transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41934"
FT                   /db_xref="GOA:E6VI38"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI38"
FT                   /inference="protein motif:PFAM:PF00398"
FT                   /protein_id="ADU41934.1"
FT                   /translation="MALQSSVRAFKKPARPLDDEVRFLRSWIEKPLRMGAVMPSGRLLA
FT                   RTMARYVDIDSNGPVIELGPGTGAITSALVEHGVDQKRLVLLEFDPGFCALLRERFPQA
FT                   KVVQGDAYRLRDSLWDALDVPATAVVSGLPLVTKPMLTRMKLIRDAFNLLEPGAPFVQF
FT                   TYSVAPPIPKSLSGVATEASERIWMNVPPARVWVYRKR"
FT   gene            complement(326446..327585)
FT                   /locus_tag="Rpdx1_0293"
FT   CDS_pept        complement(326446..327585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0293"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: chaperone
FT                   DnaJ domain protein; heat shock protein DnaJ domain
FT                   protein; DnaJ central domain protein; KEGG: nha:Nham_0156
FT                   chaperone DnaJ; SMART: heat shock protein DnaJ domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41935"
FT                   /db_xref="GOA:E6VI39"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI39"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADU41935.1"
FT                   /translation="MSTTKRCYYETLEVERNADDSTLKSAFRKLAMKWHPDRNPGDPQC
FT                   EIKFKEINEAYEVLKDGDKRAAYDRYGHAAFEQGGFGGGAGFGTGFASSFSDIFEDLFG
FT                   MASQRGRGTGRERGADLRYNMEITLEDAFKGKTAQIEIPVSVTCEACSGTGAKAGTKPK
FT                   TCSTCGGAGRVRQAQGFFTLERTCPSCQGRGQTIEDPCPSCTGSGRVTRERTLSVNIPQ
FT                   GVEDGTRIRLAGEGEAGLRGGPPGDLYIFLSLANHAIFQRDGADLHCRVPISMVTAALG
FT                   GEFEVPTIDRGKTKVKVPSGTQTGRRFRIGGKGMPVLRSRQVGDMYVQVVVETPQNLTK
FT                   KQQELLAEFEKLSSGETQPEAVGFFSKVKEFFGSRASAP"
FT   gene            complement(327800..329695)
FT                   /locus_tag="Rpdx1_0294"
FT   CDS_pept        complement(327800..329695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0294"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: bbt:BBta_0191 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41936"
FT                   /db_xref="GOA:E6VI40"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI40"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADU41936.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMDGKSAKVIENAEGMRTTPSIVAITDD
FT                   GERLVGQPAKRQAVTNPERTFFAVKRLIGRRYDDPMVEKDKGLVPYKIVKASNGDAWVE
FT                   ADGKTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKAKTGTIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVNYLADEFQKEQGIDLRKDKLALQRLKEAAEKAKIELSSTTQTEINLPFI
FT                   TADQSGPKHLTMKLTRAKFEALVDDLVQKTIEPCRKALKDAGLTAGEISEVVLVGGMTR
FT                   MPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIP
FT                   PAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSDSEIDKMVKDAEAN
FT                   AAEDKKRREAVDAKNHADALVHSTEKALAEHGSKIDEGERRSIEDALSDLREALKGDDA
FT                   EAIKAKSNTLAQASMKLGEAMYKQAEAGGGAQQAGKDDVVDAEFTEVDDDKKKSA"
FT   gene            330028..330969
FT                   /locus_tag="Rpdx1_0295"
FT   CDS_pept        330028..330969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll0679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41937"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI41"
FT                   /inference="similar to AA sequence:KEGG:bll0679"
FT                   /protein_id="ADU41937.1"
FT                   /translation="MRQIARLFAIALLSVAATHAVAADTVYPRGIRVGIVPMPGLTQSN
FT                   AFLGFESDDHGVKVLVSELPGPAFEKVDAAFKAAPEGSLGNVKPEKIETPAGSGYFTAE
FT                   DAVIGPDKVRRYSMIVPGSKLFSGYVAVQVAAVKSETYSDEAVKKMLASVSVRQQVPAD
FT                   EQIAQMPFKVRELGDFKTVRTLAPGVALLLTDGNEEAVETGPFMVLGLIGSVPEKTDDR
FT                   ARFAQQAAEAIPGLRDGKITMSEPMRIDGAQGFETRITGVSGKDNTPVTVVQWLRFGSA
FT                   NVAMRVIGSSPKEQWAEAFPRFRKVRDGLQPR"
FT   sig_peptide     330028..330096
FT                   /locus_tag="Rpdx1_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.821 at
FT                   residue 23"
FT   gene            complement(331076..331699)
FT                   /locus_tag="Rpdx1_0296"
FT   CDS_pept        complement(331076..331699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0296"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: bbt:BBta_0188 protein GrpE
FT                   (HSP-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41938"
FT                   /db_xref="GOA:E6VI42"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI42"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADU41938.1"
FT                   /translation="MTETDGQKDNNQDTAQAAADPVVSKPYIMPDDPEEGSNEALVREA
FT                   ADARDKMLRTLAEMENLRRRTQKEVADARTYGVTSFARDVLDIADNLQRALDAVPADAR
FT                   ANAEPGLKALIEGVELTERSLLNALEKNGVKKFDPKGQKFDPNFQQAMYEVPDPSVPAG
FT                   TVVQVVQAGFTIGERVLRPALVGVAKGGAKAAPSDGGTEAGNAG"
FT   gene            complement(331790..332878)
FT                   /locus_tag="Rpdx1_0297"
FT   CDS_pept        complement(331790..332878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0297"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="KEGG: nha:Nham_0152 heat-inducible transcription
FT                   repressor; TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Winged helix-turn-helix transcription
FT                   repressor, HrcA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41939"
FT                   /db_xref="GOA:E6VI43"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI43"
FT                   /inference="protein motif:TFAM:TIGR00331"
FT                   /protein_id="ADU41939.1"
FT                   /translation="MVQHDPIGLIAPNAGLAQLNERSREIFRQIVESYLATGEPVGSRN
FT                   ISRLISVPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLTEP
FT                   ERQSIQAQLSSVGRAHTVEAALGEALTRLSGLTRAAAVVLTAKANVRLKHIEFVRLEPE
FT                   RALVILVAEDGQVENRVLTLPPGVPSSALVEAANYLNARIRGRTLAEARLELESLMVQN
FT                   KAELDQLTQKVIAAGVASWSGGDGDDRQLIVRGHANLLEDLHALDDLERVRLLFDDLET
FT                   KRGVIDLLGRAESADGVRIFIGSENKLFSLSGSSTIIAPYSDGAGHIVGVLGVIGPTRL
FT                   NYARVIPMVDYTARIVSRMLGG"
FT   gene            333033..333746
FT                   /locus_tag="Rpdx1_0298"
FT   CDS_pept        333033..333746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0298"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="TIGRFAM: ribonuclease PH; KEGG: nha:Nham_0151
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41940"
FT                   /db_xref="GOA:E6VI44"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI44"
FT                   /inference="protein motif:TFAM:TIGR01966"
FT                   /protein_id="ADU41940.1"
FT                   /translation="MRPSRRAPDELRAVSLERGVVKYAEGSCLVKFGDTHVLVTATLEE
FT                   RLPPWLKGQGRGWVTAEYGMLPRATLERTRREASAGKQNGRTVEIQRLIGRSLRTIVDL
FT                   EALGERQITVDCDVLQADGGTRTASITGAWVALADCLNWMKARNMIKTQVLRDNVAAIS
FT                   CGIYNGTPVLDLDYAEDSEAETDANFVMTGDGRLVEVQGTAERTPFSQDEFLQLMALAQ
FT                   KGVARLVDLQKMAVG"
FT   gene            333798..334430
FT                   /locus_tag="Rpdx1_0299"
FT   CDS_pept        333798..334430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0299"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="KEGG: bbt:BBta_0185 putative deoxyribonucleotide
FT                   triphosphate pyrophosphatase; TIGRFAM: non-canonical purine
FT                   NTP pyrophosphatase, rdgB/HAM1 family; PFAM: Ham1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41941"
FT                   /db_xref="GOA:E6VI45"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI45"
FT                   /inference="protein motif:TFAM:TIGR00042"
FT                   /protein_id="ADU41941.1"
FT                   /translation="MHRRITGKLVIATHNPGKLAEMRELLAPYGIEAISAGELGLAEPD
FT                   ETGDSFQANARIKAEAAAKAAQLPAFADDSGLAVDALDGAPGIYSARWAGDSKDFGGAM
FT                   ARIERLLQERGATAPERRTAHFVSALCVAWPDGHVEEVEAHAGGTLVWPPRGTAGFGYD
FT                   PIFLPDGHDRTFGEMTSVEKHGLPPLGLGLSHRAKAFVKLAEICLAG"
FT   gene            334420..335577
FT                   /locus_tag="Rpdx1_0300"
FT   CDS_pept        334420..335577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0300"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="TIGRFAM: oxygen-independent coproporphyrinogen III
FT                   oxidase; PFAM: HemN domain protein; Radical SAM domain
FT                   protein; KEGG: bra:BRADO0175 coproporphyrinogen III
FT                   oxidase; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41942"
FT                   /db_xref="GOA:E6VI46"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI46"
FT                   /inference="protein motif:TFAM:TIGR00539"
FT                   /protein_id="ADU41942.1"
FT                   /translation="MRASPDPAFGVYVHWPFCLSKCPYCDFNSHVRHAAIDEERFARGF
FT                   AREIATTAERIGPRQVSSIFLGGGTPSLMQPSTVAAILDAIARHWHVEPGAEVSLEANP
FT                   TSVEATRFRGYRAAGVNRVSLGVQALDDASLKALGRLHSAEEAINAVAIAKSAFDRYSF
FT                   DLIYARPGQTAAMWEAELRYAIGEAAEHLSLYQLTIEPDTPFYSLHKAGKLPTPDEAEA
FT                   RALYDVTQSVCAELGLPAYEISNHARPGAECRHNLIYWRGQEYAGIGPGAHGRLDIGAV
FT                   RYATATEKRPESWLMRVEATGHGLIADERLTSEERADEFLLMGLRLAEGIDPQRYQALS
FT                   GRPLDPSRIALLREEGAIAVDADGRLRVTQEGFPVLDAVVADLAA"
FT   gene            complement(335646..336845)
FT                   /locus_tag="Rpdx1_0301"
FT   CDS_pept        complement(335646..336845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0301"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   nha:Nham_0148 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41943"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI47"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU41943.1"
FT                   /translation="MGSLHDPHTKPLRTTRRAALGLILGAPLLSACSGVQQTLSDRFGQ
FT                   SQPATGPAQQPTAVGNGRVKVGLVLPLSAPGNAGVAAQSMKNAAEMALAEFHNPDVQLL
FT                   IKDDGGNPLGAQSATQQALDEGAEIILGPLFAQSVPAAAQAARARGVTVIAFSTDSSVA
FT                   GRGVYLLSFLPESDVNRIVGYAGSIGKRSYAALLPDNAYGSVVEAAFKQIANQKGGRIV
FT                   AFEKYGADRSGPARSIAASLGNADALLLADDGDALAGIAETLTASGADLKRVQLLGTGL
FT                   WDNPRVFSTAALQGGLFAAPDPSGFRAFSGRYRTRYGQDPVRTATLAYDGVALVAALSR
FT                   TQGPQRFSSETLTNPSGFAGIDGLFRFRADGTNERGLAVMKVATGGAQAVAGSPKSFGA
FT                   "
FT   gene            337067..338017
FT                   /locus_tag="Rpdx1_0302"
FT   CDS_pept        337067..338017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0302"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: bja:bll0670
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41944"
FT                   /db_xref="GOA:E6VI48"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI48"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADU41944.1"
FT                   /translation="MRVKPQISVPSSDPSEPDARTFLIAGQRLVAPRATPGLHLVATPI
FT                   GHLGDITLRALETLAGADLIACEDTRITHRLLERYGISARLKPYHEHNAAQARPKLLEI
FT                   LGQGGSVALVSDAGTPLISDPGYKLVRDVYAAGHQVISLPGPSAVMVALTLAGLPTDRF
FT                   FFGGFLPPKQGARRARLAELAAIDATLVLFEAGSRIQNAVRDLADLLGEAREAAICREL
FT                   TKLHQEVRRAPLAELAARADEMETRGEFVVVIAPPDPAAQVMSDDALDRWLEEALTRHS
FT                   VKDAVAQGVELSGRPRRDIYARALALARRRETDDG"
FT   gene            338010..338402
FT                   /locus_tag="Rpdx1_0303"
FT   CDS_pept        338010..338402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0303"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   bra:BRADO0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41945"
FT                   /db_xref="GOA:E6VI49"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI49"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ADU41945.1"
FT                   /translation="MAKIEPSRRSVLARLAAFRTGLSAEASAADYLERQGYRILARRFK
FT                   VRCGEIDLVAQRGALVAFVEVKARRNVDDAAYAVTPRQQARIVAAAEAWLSRHPEHAMS
FT                   ELRFDAILISPDTAPRHLPGAFDATP"
FT   sig_peptide     338010..338096
FT                   /locus_tag="Rpdx1_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.608 at
FT                   residue 29"
FT   gene            338472..339413
FT                   /locus_tag="Rpdx1_0304"
FT   CDS_pept        338472..339413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0304"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutathione synthetase; KEGG: nha:Nham_0145
FT                   glutathione synthetase; PFAM: glutathione synthetase
FT                   ATP-binding; glutathione synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41946"
FT                   /db_xref="GOA:E6VI50"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI50"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ADU41946.1"
FT                   /translation="MTLKVAVQMDPIARINIRGDSTFALLLEAQARGHSISYFTPDKLS
FT                   LRGNEVIASVQSLKVRDQEGDHFTLGEPARVDMRSFDVVLLRQDPPFDLAYITSTHLLE
FT                   RIHPHTLVVNDPASVRNAPEKLFVMDFTELMPPTLISRDKDEINAFRAEHGAVVMKPLH
FT                   GHGGAAVFRVLPQDINFGSLYDMFAVTFREPWVIQRFLPEVKHGDKRIILVDGEFAGAV
FT                   NRVPAADDLRSNMVRGGAAAATDLSPREQQICAALGPKLRERGLLFVGIDVIDGYLTEI
FT                   NVTSPTGIRAVARLGGPDIAARVWDVIAAKRA"
FT   gene            339651..340382
FT                   /locus_tag="Rpdx1_0305"
FT   CDS_pept        339651..340382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0305"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: bbt:BBta_7112 LuxR family transcriptional
FT                   regulator; PFAM: Autoinducer-binding domain protein;
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41947"
FT                   /db_xref="GOA:E6VI51"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI51"
FT                   /inference="protein motif:PFAM:PF03472"
FT                   /protein_id="ADU41947.1"
FT                   /translation="MIVGEDQLWGRRALEFVDAVERLDAPALVSQFESLIASCGFTAYI
FT                   IAGLPSRNAGLPELTLANGWPRDWFDLYVSENFSAVDPVPRHVASTVHPFVWSEAPYDR
FT                   DRDPAAHRVMTRAAEFGLVEGYCIPLHYDDGSAAISMAGKDPDLSPAARGAMQLVSIYA
FT                   HSRLRTLGRPKPGRRNKLTARECEILQWAAQGKTAWEISMILCIAERTVKFHLIEAARK
FT                   LDAANRTAAVAKALTLGLIRL"
FT   gene            340468..341124
FT                   /locus_tag="Rpdx1_0306"
FT   CDS_pept        340468..341124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0306"
FT                   /product="autoinducer synthesis protein"
FT                   /note="PFAM: autoinducer synthesis protein; KEGG:
FT                   bra:BRADO0941 putative autoinducer (acylhomoserine lactone)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41948"
FT                   /db_xref="GOA:E6VI52"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI52"
FT                   /inference="protein motif:PFAM:PF00765"
FT                   /protein_id="ADU41948.1"
FT                   /translation="MQVHVIRRENRALYAGLLDNYFRIRHQIYVVERGWKELARPDGRE
FT                   IDQFDTEDAVYLLGVDNDEIVAGMRMVPTTSPTLLSDVFPQLALAGPVHRSDAYELSRI
FT                   FVVPRKRGEHGGPRAEAVIQAAAMEYGLSIGLSAFTIVLETWWLPRLVDQGWKAKPLGL
FT                   PQDINGFSTTAVIVDIDDEAWVGICSRRSVPGPTLEWRGLEAVRRQSLPEFQVIR"
FT   gene            341121..341354
FT                   /locus_tag="Rpdx1_0307"
FT   CDS_pept        341121..341354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smt:Smal_0037 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41949"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI53"
FT                   /inference="similar to AA sequence:KEGG:Smal_0037"
FT                   /protein_id="ADU41949.1"
FT                   /translation="MNASSKPRAARPVVLNAANAPIKQQAVSIDTLALTINRAIEQAED
FT                   LGIPSAVQLLMMARLEVDLTEIALESRHKTSA"
FT   gene            341451..342989
FT                   /locus_tag="Rpdx1_0308"
FT   CDS_pept        341451..342989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0308"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: bja:bll0661 hypothetical
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41950"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI54"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ADU41950.1"
FT                   /translation="MVQHVSTVAFEGIEARSVDVQVQVSPGLPAFAVVGLADKAVSEAR
FT                   ERVRSALIASGLALPARRITVNLAPADLPKEGSHYDLPIALGLMAAIGAIPADALEGFT
FT                   VLGELGLDGSIAAVAGVLPAAIAANGREHGLICPAACGSEAAWASPDIEIIAAGSLIQI
FT                   ANHFKGSQLLGRPQPRVREAEPSRIDLRDIKGQESAKRALEIAAAGGHHLLMIGAPGAG
FT                   KSMLAARLPSILPPLSPAELLEVSMIASVAGEIRDGALTSRRPFRAPHHSASMAALTGG
FT                   GIKARPGEISLAHQGVLFLDELPEFDPRVLDSLRAPLETGEVAVSRANHRITYPARVML
FT                   VAAMNPCRCGQAFEPGFACKRGRIERCTSDYQSRISGPLMDRIDLRIEVPAVSAADLIL
FT                   PPPTEGSAEVAARVAAAREVQRARYASIGLPQVRTNAEAPAAVLETTAQPDSAGLKLLH
FT                   EAAETMRLSARGYHRVLRVARTLADLDGCDRIGQVHLAEALSYRALADDLRRAA"
FT   gene            343125..345047
FT                   /locus_tag="Rpdx1_0309"
FT   CDS_pept        343125..345047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0309"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="KEGG: nha:Nham_0129 multi-sensor hybrid histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; response regulator
FT                   receiver; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41951"
FT                   /db_xref="GOA:E6VI55"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI55"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU41951.1"
FT                   /translation="MAGKLRIRSRLRLMARRHPRIVLAGRAAMAFSAGFGGAYGLLLSS
FT                   TPEISGYDPHTFAIGASFLFALACLALAIQTMRLRRMRNRLRMLTGSHDALPDRPIKDG
FT                   NRSGSNAAGDDDSATGDPASRARSRLLAMASHEIRTPLNGIIGMSQLLLDTSLTAEQTT
FT                   YARAVKTSGEALLALTDELLDNARVEAGKIELDRCPFVLGNLIEDVVELLAPRAQARGL
FT                   EIAADIDERLPASLIGDAARLRQVLLNLCGNAIKFTEAGGVTLTAEPGDQAAEFRLIVR
FT                   DTGIGIAPDAQARIFREFEQADADIARHFGGTGLGLSISDRIVAAMGGRIALDSTPGQG
FT                   TTFTVTLPLVAAEDAGAAATLEPPDLRGASVMIVAPHAVEASLIARRLARWGATTCTCH
FT                   DADVAVARLAERSWHAVLIDHAFGSASLETLARQAALHATHRLVMLTPAARHELLPSLP
FT                   AAFTGYLMKPLRAVSLATRLGPLAEVAAPNIADGDPPELQDAPPAVPQAQLAILVAEDN
FT                   DINALLIRALLSRLGHRAEIARDGRSAVASWRTARQAGTPFDLVLMDVQMPVLDGLEAA
FT                   RQIRRCEAEQTGTRVPILALTANTLAEDRDACRTAGMNGVLIKPLDPDRLAGILADLAA
FT                   TRQTA"
FT   gene            345207..346160
FT                   /locus_tag="Rpdx1_0310"
FT   CDS_pept        345207..346160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oca:OCAR_4402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41952"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI56"
FT                   /inference="similar to AA sequence:KEGG:OCAR_4402"
FT                   /protein_id="ADU41952.1"
FT                   /translation="MHTDHLARSKKFIKLLRPETAGAAAQTAITWFKPAAKLAETGKPL
FT                   GSPSPATLGRLGPLEVRLAQTKQDVKRAQKLRYRVFYKDGTAIADAPTMLARRDKDAFD
FT                   PICDHLLVVDHAAKPSLSGKQPVVGTYRLLRQDVANRNGGFYTESEFDIGGLIGRHPEL
FT                   RFLELGRSCVLPPYRNKRTVELLWHGIWTYVRQHGVDVMLGCASFDGTDPDRLAMPLSF
FT                   LHHYAPAPEAWRARAHPSRYVEMNRLPKEAVDQKAALRELPPLIKGYLRLGATIGEGAV
FT                   IDYQFGTTDVLIILPVSAISARYIEHFGADASRHAA"
FT   gene            complement(346293..347249)
FT                   /locus_tag="Rpdx1_0311"
FT   CDS_pept        complement(346293..347249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0311"
FT                   /product="pantothenate kinase"
FT                   /note="TIGRFAM: pantothenate kinase; KEGG: nha:Nham_0128
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41953"
FT                   /db_xref="GOA:E6VI57"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI57"
FT                   /inference="protein motif:TFAM:TIGR00554"
FT                   /protein_id="ADU41953.1"
FT                   /translation="MDARSDLHHYNPYRVFSRSEWASMREDTPMTLDAAEVAALRSMHD
FT                   RLDLTEVEEIYLPMSRLLSIHVAAMQQLYYAQRRFLGVVERKMPFIIGVAGSVAVGKST
FT                   TARVLQALLARWSPRPTVDLVTTDGFLHPNAYLERAGLMQKKGFPESYDLPALLGFLSD
FT                   IKSGRRKVKAPIYSHLTYDIVPNKFTVIDRPDILIVEGVNVLQTGRLPRDGQAVPVVSD
FT                   FFDFSVYLDADEPVLRDWYVRRFLALRDTAFHDPRSYFHRYAVLSDEEATATAIAIWER
FT                   TNLANLEDNILPTRPRATLILKKGADHVVESVALRRL"
FT   gene            complement(347329..347652)
FT                   /locus_tag="Rpdx1_0312"
FT   CDS_pept        complement(347329..347652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0312"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="KEGG: bja:blr0655 phosphoribosyl-ATP
FT                   pyrophosphatase; TIGRFAM: phosphoribosyl-ATP diphosphatase;
FT                   PFAM: Phosphoribosyl-ATP pyrophosphohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41954"
FT                   /db_xref="GOA:E6VI58"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI58"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ADU41954.1"
FT                   /translation="MARFTLHDLAATVDARAASGGESSYTKKLLDKGPEHCAKKFGEEA
FT                   VEMVIAAVENDRGHLISEAADVLFHMLVLLKSREVKLEEVEAALAQRTSMSGLEEKASR
FT                   KRD"
FT   gene            complement(347706..348473)
FT                   /locus_tag="Rpdx1_0313"
FT   CDS_pept        complement(347706..348473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0313"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="KEGG: nha:Nham_0126 imidazole glycerol phosphate
FT                   synthase subunit HisF; TIGRFAM: imidazoleglycerol phosphate
FT                   synthase, cyclase subunit; PFAM: histidine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41955"
FT                   /db_xref="GOA:E6VI59"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI59"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ADU41955.1"
FT                   /translation="MFKVRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEAAIAYDAAGAD
FT                   ELCFLDITATHENRGIMLDVVRRTAEACFMPVTVGGGVRTVDDIKTLLRSGADKVSINS
FT                   AAVARREFVKEAAEKFGDQCIVVAIDAKRVPGRDRWEIFTHGGRKGTGIDAIEFAQEVV
FT                   SLGAGEILLTSMDRDGTRVGFDIPLTRAIADSVGVPVIASGGVGNLDHLVDGIREGHAT
FT                   AVLAASIFHFGEYTIRQAKDHMVQAGLPMRLDP"
FT   gene            complement(348484..349221)
FT                   /locus_tag="Rpdx1_0314"
FT   CDS_pept        complement(348484..349221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0314"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; KEGG: bbt:BBta_0145
FT                   1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase; PFAM: histidine
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41956"
FT                   /db_xref="GOA:E6VI60"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI60"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ADU41956.1"
FT                   /translation="MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQAQSFAAQGFQ
FT                   YLHVVDLDGAFAGKPMNAQAVEAMLKVVSMPVQLGGGIRDLKTIDAWLSKGIARVIIGT
FT                   AAVRDPALVKEAAKAFPGRVAVGLDARDGKVAVEGWAESSQVTALEIAQRFEDAGVAAI
FT                   IFTDIARDGLLKGINWDATIALAEAISIPVIASGGLASIEDVRTLLSPRAKKLEGAIAG
FT                   RALYDGRLDPAEALALIGAAKAA"
FT   gene            complement(349218..349517)
FT                   /locus_tag="Rpdx1_0315"
FT   CDS_pept        complement(349218..349517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0315"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC1202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41957"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI61"
FT                   /inference="similar to AA sequence:KEGG:CAC1202"
FT                   /protein_id="ADU41957.1"
FT                   /translation="MKVIYKVTYPNGKIYVGKDLTDSINYFGSAASALIAADFTREQRR
FT                   DFAIRREILWESEDATDAEVSAQEVCWIRHFKSNDPSIGYNRWPKLKLKSEAAS"
FT   gene            complement(349519..350169)
FT                   /locus_tag="Rpdx1_0316"
FT   CDS_pept        complement(349519..350169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0316"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="KEGG: bbt:BBta_0146 imidazole glycerol phosphate
FT                   synthase subunit HisH; TIGRFAM: imidazole glycerol
FT                   phosphate synthase, glutamine amidotransferase subunit;
FT                   PFAM: glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41958"
FT                   /db_xref="GOA:E6VI62"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI62"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ADU41958.1"
FT                   /translation="MSVAIIDYGSGNLHSAAKAFERAARSMENPEPILVTRDPDQVFRA
FT                   DRVVLPGVGAFADCRKGLDSIDGMVEALNETVRVRARPFFGICVGMQLMATRGKEHVTT
FT                   DGLNWISGDVVKIAPDRDDLKIPHMGWNTLDQVREHPVLDRLPLGSKGLHAYFVHSFHL
FT                   AAEHEGDVLARADYGGPVTAVVGKDTAIGTQFHPEKSQRFGLALISNFLKWKP"
FT   gene            complement(350166..350687)
FT                   /locus_tag="Rpdx1_0317"
FT   CDS_pept        complement(350166..350687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41959"
FT                   /db_xref="GOA:E6VI63"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI63"
FT                   /inference="similar to AA sequence:KEGG:Nwi_0125"
FT                   /protein_id="ADU41959.1"
FT                   /translation="MPVFTVHAPRADDDEPQRAAPDQFRFVRDGFYVWAFVFGPLWLLY
FT                   RRLWLATLGYLVVIAASAVALTALQAGAGTRFLVALLLASLLGLEAGSLWRWTLARRGW
FT                   QPIGVAVGDDREIAERRFFDRWVAGQPQPISFTLPVDRGAPPPARNIPLPASSIHGDIF
FT                   GSFPNPGGSR"
FT   gene            complement(350715..351308)
FT                   /locus_tag="Rpdx1_0318"
FT   CDS_pept        complement(350715..351308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0318"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="KEGG: bja:blr0650 imidazoleglycerol-phosphate
FT                   dehydratase; PFAM: imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41960"
FT                   /db_xref="GOA:E6VI64"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI64"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ADU41960.1"
FT                   /translation="MRTATIKRKTKETDIEVTVDLDGTGVAKAATGIGFFDHMLDLLAK
FT                   HSRIDITVKAVGDLHVDFHHTTEDVGIALGQAVKQALGNMAGITRYASVLMPMDETLTR
FT                   VVIDVSGRPFLVFKADFPRDKIGEFDTELVREWFQAFAMNAGVTLHVETLYGENSHHIA
FT                   ESCFKGLARSLRAAVAIDPKTAGEVPSTKGQLGG"
FT   gene            351496..352059
FT                   /locus_tag="Rpdx1_0319"
FT   CDS_pept        351496..352059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0319"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   nha:Nham_0121 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41961"
FT                   /db_xref="GOA:E6VI65"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI65"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ADU41961.1"
FT                   /translation="MALHSSSGDAGPPVWHGTTILTVRKGGKVVIGGDGQVSIGQTVIK
FT                   ANAKKVRKLGKGDVIGGFAGATADAFTLFERLEAKLEQYPGQLTRAAVELAKDWRTDRY
FT                   LRRLEAMMIVADKDVSLVLTGTGDVLEPEAGVMAIGSGGNYALAAARALIDTDQDAEAI
FT                   VRKSLGIAADICVYTNGNLTIETL"
FT   gene            352211..353512
FT                   /locus_tag="Rpdx1_0320"
FT   CDS_pept        352211..353512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0320"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: ATPase AAA-2 domain protein; Clp ATPase-like;
FT                   KEGG: nwi:Nwi_0129 ATP-dependent protease ATP-binding
FT                   subunit HslU; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41962"
FT                   /db_xref="GOA:E6VI66"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI66"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ADU41962.1"
FT                   /translation="MTDFSPREIVSELDRFIVGQADAKRAVAIALRNRWRRLQLEGALR
FT                   EEVLPKNILMIGPTGVGKTEIARRLAKLAGAPFLKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVAIAQVREKKRKDVQARAQIAAEERVLDALVGPGSGPATRDSFRKKLRSGELNDKEIE
FT                   IETQAGAGSPMLEIPGMPGAQIGAISLGDIFGKMGGRTKTRRLTVADSHEILVNEEADK
FT                   LLDNDQLVQEAITAVENNGIVFLDEIDKICVRDGRSGGEVSREGVQRDLLPLIEGTTVS
FT                   TKHGAVKTEHILFVASGAFHIAKPSDLLPELQGRLPIRVELNALSRDDMRRILTEPEAS
FT                   LIKQYVALMKTEGVTLEFTDDAIDALADVAVAVNSTVENIGARRLQTVMERVLDEISFV
FT                   APDRHGETFRVDADYVKTNVGDLAKNTDLSRFIL"
FT   gene            complement(353876..354454)
FT                   /locus_tag="Rpdx1_0321"
FT   CDS_pept        complement(353876..354454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0321"
FT                   /product="Smr protein/MutS2"
FT                   /note="KEGG: bra:BRADO0206 putative Smr protein/MutS2
FT                   C-terminal; PFAM: Smr protein/MutS2; SMART: Smr
FT                   protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41963"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI67"
FT                   /inference="protein motif:PFAM:PF01713"
FT                   /protein_id="ADU41963.1"
FT                   /translation="MKRIIPPLDPPMSRRKRSLTEDERALWDGVARQIKPLRGRPRPIK
FT                   AEIADPLSESPSIKPSPAAPPQPLKRAAKPSVAPPPLASLGRRERAHLSRGRKDIDARI
FT                   DLHGMTQARAHHALLHFLQRASHDGLGFVLVITGKGKSGDAERGVLRRQVPQWLALPEF
FT                   RAYVVGFDEAHIGHGGEGALYVRVRRARG"
FT   gene            complement(354460..355887)
FT                   /locus_tag="Rpdx1_0322"
FT   CDS_pept        complement(354460..355887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0322"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   nha:Nham_0118 MltA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41964"
FT                   /db_xref="GOA:E6VI68"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI68"
FT                   /inference="protein motif:PFAM:PF03562"
FT                   /protein_id="ADU41964.1"
FT                   /translation="MIAAALMLVPTTSDARSRHHHHGAKSSHHAGSHPRHRHVLWPLQI
FT                   ADGQYLPAGWDQLPGWEDDDHLAAFKTFRASCRPILAGRGRADAKPLGDSLREPCRAAR
FT                   ASAISTEPVARAFFERHFVPLLISRIGETQGFVTGYYEPVIDGSPVKTDDYTVPVYRRP
FT                   SNLFVRGYTQGAALPNGGPVFRKVGRRKLVPYYDRGAIEDGAIEGRGLEICWLKSQTDL
FT                   LFAQIQGSARIRLPDGRVVRINYDAHNGYPYTPVGRILIERGIIPREEMSMHRIREWMD
FT                   ANPDGAKELRRANRSYVFFRKVDLNDDDEAVGAQGVPLTPWRSIAVDKGLHVYGTPFFI
FT                   SGELPIESVNARTPFRRLMIGQDTGSAIVGPARADLYFGAGAEAGAVAGRIRHPIGFAI
FT                   LVPTSLDPVASGRTLPLPEPRPPAKARKPAATPAKSGGKDGAAIVPTPEARPAATPSQP
FT                   QARRHHPHHHRHHRRPH"
FT   gene            complement(355925..356701)
FT                   /locus_tag="Rpdx1_0323"
FT   CDS_pept        complement(355925..356701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0323"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="KEGG: bja:blr0642 hypothetical protein; manually
FT                   curated; PFAM: import inner membrane translocase subunit
FT                   Tim44"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41965"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI69"
FT                   /inference="protein motif:PFAM:PF04280"
FT                   /protein_id="ADU41965.1"
FT                   /translation="MAPRGRRPKPRRQAPARSESECDVDIYTIIFLALAVFIFLRLRNV
FT                   LGQRTGNERPPFDRAAARDMISGKQDNNVISMPGTVIDQAPIAPNADVVPPSDRWKGIA
FT                   EPDSELEHGLNAIAQHDSSFDARHFVDGAKSAYEMIVMAFANGDRRSLRDLLSSEVYES
FT                   FDAAIKDREKNDLKVESRFVAIEKAELISAELRDRTAMLTLKFVSQMISATRDKTGAVV
FT                   DGSPDKVTDITDVWTFARDTSSRDPNWKLVGTGSGT"
FT   gene            357093..357566
FT                   /locus_tag="Rpdx1_0324"
FT   CDS_pept        357093..357566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0324"
FT                   /product="protein-export protein SecB"
FT                   /note="KEGG: nwi:Nwi_0106 preprotein translocase subunit
FT                   SecB; TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41966"
FT                   /db_xref="GOA:E6VI70"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI70"
FT                   /inference="protein motif:TFAM:TIGR00809"
FT                   /protein_id="ADU41966.1"
FT                   /translation="MTNGNGTPPEGAPPQLNVLAQYTKDLSFENPNAPASLAPQQQQPA
FT                   INIQINVGANNVGENEFEVTLSIEGKAESGSSVLFSFELAYAGVFRVLNVPQENLHPLI
FT                   MIECPRLLFPFAREIIASAVRDGGFPPLMLDPVDFIGLYRQNLERAQQQGQPS"
FT   gene            complement(357646..358344)
FT                   /locus_tag="Rpdx1_0325"
FT   CDS_pept        complement(357646..358344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0325"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: Exonuclease; TIGRFAM: DNA polymerase III,
FT                   epsilon subunit; KEGG: bja:blr0640 DNA polymerase III
FT                   epsilon chain; PFAM: Exonuclease RNase T and DNA polymerase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41967"
FT                   /db_xref="GOA:E6VI71"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI71"
FT                   /inference="protein motif:TFAM:TIGR00573"
FT                   /protein_id="ADU41967.1"
FT                   /translation="MREIVLDTETTGLDPLRGDRLVEIGCVEIFNRMPTGRTYHRYLNP
FT                   ERDMPAEAFAVHGLSAEFLADKPLFAQVADEFLEFIGDDPLVIHNASFDIGFINAELSR
FT                   LSRAPVPRDRLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLAEVY
FT                   IDLIGARQSQLILADVPAEVVGAASENRRRQRPAPLPNRLTDADLEAHRAFIATMGEKA
FT                   IWPDYLAAGA"
FT   gene            complement(358384..358983)
FT                   /locus_tag="Rpdx1_0326"
FT   CDS_pept        complement(358384..358983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0326"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="TIGRFAM: dephospho-CoA kinase; KEGG: nha:Nham_0114
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41968"
FT                   /db_xref="GOA:E6VI72"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI72"
FT                   /inference="protein motif:TFAM:TIGR00152"
FT                   /protein_id="ADU41968.1"
FT                   /translation="MLVLGLTGSIGMGKSTTAKLFAEAGVPVYDADATVHKIYENEAVP
FT                   AIEAAFPGTTVGGKVDRALLSAKVVHDPAAMKRLEAIVHPMLRAHHQQFLDDAESSGAA
FT                   VAVVDVPLLFETGGEKRVDAVVVVTTSPEVQRERILARDNMTPDKLDAILARQMPDAEK
FT                   RKRADFVVDTSNGLDPVRAQIREILEAAARMPRRRD"
FT   gene            complement(359074..359682)
FT                   /locus_tag="Rpdx1_0327"
FT   CDS_pept        complement(359074..359682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0327"
FT                   /product="Maf family protein"
FT                   /note="PFAM: Maf family protein; KEGG: bja:blr0638 Maf-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41969"
FT                   /db_xref="GOA:E6VI73"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI73"
FT                   /inference="protein motif:PFAM:PF02545"
FT                   /protein_id="ADU41969.1"
FT                   /translation="MTLWLGPQPLVLASQSSARKTVLANAGIPFDAIPAEIDERGIAAA
FT                   SGIAAPCAIAALLAEQKAAFVSNHHPGRLVLGADQTLALGARGFNKPADRAAAARQLRE
FT                   LAGRRHELHSAIAVVRNGITLFADVSIARMTMRPLTEAEIDAYLDVVGDKATTSVGAYQ
FT                   IEGLGVHLFDGIHGDHFTILGLPLLPLLGFLRSQNLLAV"
FT   gene            complement(359679..360518)
FT                   /locus_tag="Rpdx1_0328"
FT   CDS_pept        complement(359679..360518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0328"
FT                   /product="protein of unknown function DUF299"
FT                   /note="PFAM: protein of unknown function DUF299; KEGG:
FT                   bbt:BBta_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41970"
FT                   /db_xref="GOA:E6VI74"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI74"
FT                   /inference="protein motif:PFAM:PF03618"
FT                   /protein_id="ADU41970.1"
FT                   /translation="MLTDGSYFHLHLVSDSTGETLITVSRAVTAQYANVTPVEHVYPLV
FT                   RSQKQLDRVLQEIEEAPGIVLFTLLETELVNRLEAKCQEINSPSLSIIGPVMQLFEAYL
FT                   GASTMGRVGAQHTLNAEYFQRIDALNYSMMHDDGQHVEGLEEADVVLVGVSRTSKTPTS
FT                   IYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPERLIQVRQNRLLSLGAGAG
FT                   NDSYIDRQAVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRGPE"
FT   gene            360972..361412
FT                   /locus_tag="Rpdx1_0329"
FT   CDS_pept        360972..361412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bbt:BBta_0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41971"
FT                   /db_xref="GOA:E6VI75"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI75"
FT                   /inference="protein motif:PFAM:PF03653"
FT                   /protein_id="ADU41971.1"
FT                   /translation="MIEWIYVYPWVKTLHVVAVISWMAGMLYMPRLFVYHCTAEVGSKQ
FT                   SETFKIMERRLYRAIMNPAMLVAWVAGLAIAWEQDYFASGWFHGKLAAVVLMTVIHLLL
FT                   GRYVRDFAADRNTRSHKFYRVINEIPTVLMVAAVIFVIVKPF"
FT   gene            361675..362940
FT                   /locus_tag="Rpdx1_0330"
FT   CDS_pept        361675..362940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0330"
FT                   /product="transcription termination factor Rho"
FT                   /note="TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor RNA-binding; Rho termination
FT                   factor domain protein; KEGG: nwi:Nwi_0100 transcription
FT                   termination factor Rho; SMART: Cold shock protein; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41972"
FT                   /db_xref="GOA:E6VI76"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI76"
FT                   /inference="protein motif:TFAM:TIGR00767"
FT                   /protein_id="ADU41972.1"
FT                   /translation="MREIKLQDLKAKTPAELVSFAEELGVENASTMRKQELMFACLKQL
FT                   SAKETDIIGEGVVEVLSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHI
FT                   RSPKEGERYFALLKVNSLNFEDPEKSKHKVNFDNLTPLFPDERFRLEIDDPTRKDLSAR
FT                   VIDIVAPIGKGQRALIVAPPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDM
FT                   QRSVKGEVISSTFDEPAVRHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVV
FT                   PSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKG
FT                   TGNSELILDRKVADKRTFPAIDISRSGTRKEELITDPQLLKKMYVLRRILNPMGTMDAI
FT                   EFLLDKLRNTKNNSEFFDSMNT"
FT   gene            363031..364359
FT                   /locus_tag="Rpdx1_0331"
FT   CDS_pept        363031..364359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0331"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="SMART: AAA ATPase; manually curated; TIGRFAM: tRNA
FT                   modification GTPase TrmE; small GTP-binding protein; KEGG:
FT                   bja:bll0634 tRNA modification GTPase TrmE; PFAM:
FT                   GTP-binding protein TrmE-like; GTP-binding protein
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41973"
FT                   /db_xref="GOA:E6VI77"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI77"
FT                   /inference="protein motif:TFAM:TIGR00450"
FT                   /protein_id="ADU41973.1"
FT                   /translation="MHPSDQTIFALATGPLPSAIAIFRLSGPQAGNVVTALTGSLPAPR
FT                   RAVRCDLRNRSGEMIDDGVALWFPGPASATGEDVAELHIHGSRAVAAALIKTLSAFEGV
FT                   RPAEPGEFTRRAFENGKLDLTEAEGLDDLIHADTEVQRRQALRQLQGVLGDRARRWRDQ
FT                   IIEALALVEAGIDFSDEGDVAADLMAPARAKIAALSAEIAEVLAEQGQGEKLRDGMVVA
FT                   IAGPPNVGKSTLINRLARRDVAIVSPHAGTTRDVIEVHLDLGGYPVTVIDTAGLRDSDD
FT                   PIEQEGVRRARARAAAADLVLWLSTPTDASDPDLSGPEVWRVRNKIDLAKTDAGRKKGS
FT                   SDADFRISASSGEGVGGLLRELTQFAAQYFASAEAGLITRDRHRLLLADAGAALGRSLA
FT                   PGLAEEIVAEELRAASHDLGRLLGRVDVEDVLGEIFGRFCIGK"
FT   gene            364640..366508
FT                   /locus_tag="Rpdx1_0332"
FT   CDS_pept        364640..366508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0332"
FT                   /product="glucose inhibited division protein A"
FT                   /note="KEGG: nwi:Nwi_0097 tRNA uridine
FT                   5-carboxymethylaminomethyl modification enzyme GidA;
FT                   TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41974"
FT                   /db_xref="GOA:E6VI78"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI78"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ADU41974.1"
FT                   /translation="MRTSFDVIVIGGGHAGCEAAAAAARIGAATALVTHRYATIGAMSC
FT                   NPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRMLNRRKGPAVRGPRAQADRKLYAA
FT                   AMQTAIFATPNLSVIEGEADVLLWRDGRVTGIRLGDGRELAAAAVVITTGTFLRGLIHL
FT                   GERSWPAGRIDEAPAMGLSGSFEALGFTLGRLKTGTPARLDGRTIDWGAVEMQPGDDPP
FT                   EPFSVLTPAITTPQIECGITRTTPATHEVIRANVHRSPMYSGQIQSTGPRYCPSIEDKI
FT                   VKFGDRDGHQIFLEPEGLDDPTVYPNGISTSLPEEVQRAILKTIPGLEQTEMFRPGYAI
FT                   EYDHVDPRELEPTLQTRRLRGLFLAGQINGTTGYEEAAAQGLVAGLNAALAAGGGDQAV
FT                   FDRADGYLGVMIDDLVTRGIAEPYRMFTSRAEYRLTLRADNADQRLTDKGVSLGCVGEE
FT                   RSAFHRGKMAALFEARALAQSLAITPNEAAKYGLALNRDGQRRSAFDLLSYPEIDWAQV
FT                   RAIWPELGKVDPVIATHVEIDAKYHVYLERQTADVEAFRRDESLRLTDVDYAAVPGLSN
FT                   EARTRLERHRPHTVGQAGRLDGITPAALGILAAYLRREERKRKSAG"
FT   gene            366677..367348
FT                   /locus_tag="Rpdx1_0333"
FT   CDS_pept        366677..367348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0333"
FT                   /product="methyltransferase GidB"
FT                   /note="KEGG: bbt:BBta_0166 16S rRNA methyltransferase GidB;
FT                   TIGRFAM: methyltransferase GidB; PFAM: glucose inhibited
FT                   division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41975"
FT                   /db_xref="GOA:E6VI79"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI79"
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /protein_id="ADU41975.1"
FT                   /translation="MQRAAKPLVSLSDLDADKAAALRLVSISPALEARLDAYVALLQQW
FT                   QAKTNLVAPSTLPQLWTRHVADSLQLVSLVPNARRWLDFGSGGGFPGVVLACAMADVGG
FT                   HVTLVERIAKKAAFLREALRVAGAPGTVMLADIGDNVDRFPQALDCITARAVAPLHQLI
FT                   GFAEPLMTPRTTKALFLKGQDVEAELTEATKYWKFQPKLYASVTGGQGWIVEIDHIERR
FT                   T"
FT   gene            367375..368229
FT                   /locus_tag="Rpdx1_0334"
FT   CDS_pept        367375..368229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0334"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="KEGG: nha:Nham_0103 cobyrinic acid a,c-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41976"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI80"
FT                   /inference="similar to AA sequence:KEGG:Nham_0103"
FT                   /protein_id="ADU41976.1"
FT                   /translation="MTVIDEIYQGDRANSQPGRPRIIALANQKGGVGKTTTAINLGTAL
FT                   AAIGERVLIVDLDPQGNASTGLGIDRRDRNTSTYDVLAGEAPLRDAVVATAVPRLHIAA
FT                   STMDLSGLELELGHRGDRAYRLRDAIGVLNKDIDPPLDYTYVLIDCPPSLNLLTVNAMA
FT                   AADAILVPLQCEFFALEGLSQLLQTVEQVRANLNPSLTIHGIVLTMFDSRNNLSSQVVA
FT                   DVRQFMGKKVYDTMIPRNVRISEAPSYGKPVLVYDLKCVGSEAYLKLATEVIQRERELR
FT                   TTH"
FT   gene            368401..369291
FT                   /locus_tag="Rpdx1_0335"
FT   CDS_pept        368401..369291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0335"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: nwi:Nwi_0094 ParB-like
FT                   partition protein; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41977"
FT                   /db_xref="GOA:E6VI81"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI81"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ADU41977.1"
FT                   /translation="MADEHRSRLGRGLASLIGDVGGEATQAERPRAQRKVPIEFIKANP
FT                   RNPRRTFTDAELGELSDSIKQHGVIQPIVVRPVKGAADRYEIIAGERRWRAAQRAGLHE
FT                   VPIVPVDVSDALALEIAIVENVQREDLNPLEEALGYQALAAEFNRSQEEIAKIVGKSRS
FT                   HVANMMRLIKLPDDVKSLIASGELTAGHARALIGLPDPSAIAKRIVAEGLNVRQTEALA
FT                   HEEGVPERKPQKPRATAAAKSVKDADTLALEKRLSDALGMKVTIDDHEGAGALQIRYAD
FT                   LDQLDDIIRRLEAGG"
FT   gene            369766..370767
FT                   /locus_tag="Rpdx1_0336"
FT   CDS_pept        369766..370767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0336"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: sme:SM_b20636 putative transposase of insertion
FT                   sequence ISRm19 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41978"
FT                   /db_xref="GOA:E6VFP1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E6VFP1"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADU41978.1"
FT                   /translation="MVEGTEGSHHKEGMTKMAKLSMVCAGIDIGKLKLDATINGTNEYL
FT                   QVDNSPDGYIALAAWLRRHHVKRVGMEASGGYEQPVMAALRRAGFVVVCLQPMQVRAYA
FT                   TFKLQRAKNDRIDAALIATCTAAVAEVRPPPDPRFAALACRLTMIEQLTEDVARLKTRC
FT                   EACRDPHGLEFWRAEIARLKGCIRTELKQLVADIRIHPDLAARLDLITSVDGVGLRTAV
FT                   AVLIRMPEIGNVSREQAAALAGLAPYDDDSGSRTGQRHIAFGRQRLRTSLYAAALPAAF
FT                   KWNQQLVALYRRLTGQGKPHKVALVACARKLIIFLNTVVARGTPWIAKSAAI"
FT   gene            complement(370834..371865)
FT                   /locus_tag="Rpdx1_0337"
FT   CDS_pept        complement(370834..371865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0337"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /note="KEGG: bja:blr0629 DNA polymerase III subunit delta;
FT                   TIGRFAM: DNA polymerase III, delta subunit; PFAM: DNA
FT                   polymerase III delta"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41979"
FT                   /db_xref="GOA:E6VI83"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VI83"
FT                   /inference="protein motif:TFAM:TIGR01128"
FT                   /protein_id="ADU41979.1"
FT                   /translation="MVALRGKDATSFLARPDPGRPIVLLYGPDAGLVRERADALIAASL
FT                   DDAKDPFALVRLDGDELASEPSRLVDEALAIPMFGGRRAIRVRAGSRSFVAGVEALIAS
FT                   PPKECRVVIEAGDIKPDNALRKVCEKATTGAVAIGCYPDAEADIARLIDDELRGSSLQI
FT                   GKDAKAVLTTLLGGDRQASRNELRKLALYAHGKGEVTLDDVITCVSDASDLKLDAIVDA
FT                   AFSGKPVIVETEFAKAMVAGTYPGQIILAAQRHAAFLHKTSLAVEGGTPAAMVLDSGFP
FT                   RLHFSRKAAAETALRNLSATRLAQIIEQLASAALETRRQATLGAAIAQRTLLSIAVSAR
FT                   RRS"
FT   gene            complement(371922..372485)
FT                   /locus_tag="Rpdx1_0338"
FT   CDS_pept        complement(371922..372485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0338"
FT                   /product="Protein of unknown function DUF2159, secreted"
FT                   /note="PFAM: Protein of unknown function DUF2159, secreted;
FT                   KEGG: nha:Nham_0099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41980"
FT                   /db_xref="GOA:E6VIV0"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIV0"
FT                   /inference="protein motif:PFAM:PF09927"
FT                   /protein_id="ADU41980.1"
FT                   /translation="MSSAKPAELRKFVVRLALAVALAAPVAGCFQPMYADRGDGSPTLR
FT                   DKLAAIEVPPLDIPNGSRNSRLGVELRNKLMFKLYGSATGVPPLYTLKISITTSRSSLI
FT                   VDPSTQLPTIENYAIDASYQLKDIATGKIVTTGNTFSRVEYDVPGQSQRFARTRAGRDA
FT                   EDRAVQEIAENINTRLASFFYAGM"
FT   gene            complement(372472..375102)
FT                   /locus_tag="Rpdx1_0339"
FT   CDS_pept        complement(372472..375102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0339"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="KEGG: bbt:BBta_0171 leucyl-tRNA synthetase; TIGRFAM:
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41981"
FT                   /db_xref="GOA:E6VIV1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIV1"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADU41981.1"
FT                   /translation="MSNERYNARESEPKWQSKWDEAKIFATRNDDLRKKYYVLEMFPYP
FT                   SGRIHMGHVRNYTMGDVVARTMRARGYNVLHPMGWDAFGLPAENAAIERKVAPKAWTYD
FT                   NIAAMKKQLQTMGLSLDWAREFATCDPSYYKHQQKMFLDFLKVGLVEREKRKLNWDPVD
FT                   MTVLANEQVIDGRGWRSGAVVELREMNQWVFKITRYAQELLDALDTLDRWPDKVRLMQR
FT                   NWIGRSEGLMVRFALDGATTPAGETELKIFTTRPDTLFGAKFMAIAADHPLAQAAAAKD
FT                   PKVAAFIDDCKKRGTAQAEIDTAEKQGIDTGIRAVHPFDPNWQLPVYVANFVLMEYGTG
FT                   AIFGCPAHDQRDLDFVNKYQLGNTPVVCPEGQDPVSFVITDTAYDGDGRLINSRFLDGM
FT                   TIAEAKEEVAKRLETAQLGGAPVGERKVNFRLRDWGISRQRYWGCPIPIIHCPTCDVVP
FT                   VPAADLPVVLPEDVSFDKPGNALDHHPTWKHVTCPQCGGKAVRETDTMDTFVDSSWYFA
FT                   RFTDPWNTEAPTTPDVVNRMMPVDQYIGGVEHAILHLLYSRFFTRAMKAAGHIDIQHDE
FT                   PFAGLFTQGMVVHETYRKADGHFASPAEVAITVDGDQRRATLIEGGGPVEIGPIEKMSK
FT                   SKRNTVDPDDIIGTYGADTARWFMLSDSPPDRDVIWSEEGVKGASRFVQRLWRMVNDAA
FT                   PIAAAAPAERPASFGADALGLRKAAHGALDKVLSGIERLAFNVSLAHIREFSNTLGDVL
FT                   ARSQTPSPDLAWAIRESTMILVQLFHPMMPHLAEECWSVLGQTGLVSEALWPQIERDLL
FT                   VEDSITLPVQVNGKKRGEVTVPRDAPTGEIEAAVLALDTVKQALGDKPVRKVIVVPQRI
FT                   VNVVG"
FT   gene            complement(375307..376980)
FT                   /locus_tag="Rpdx1_0340"
FT   CDS_pept        complement(375307..376980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0340"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; histidine kinase HAMP region domain
FT                   protein; KEGG: bja:blr0624 hypothetical protein; SMART:
FT                   GGDEF domain containing protein; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41982"
FT                   /db_xref="GOA:E6VIV2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIV2"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADU41982.1"
FT                   /translation="MSRIAIVRKKAKLRAMLGIRARLVVLALILVCPLMLDRVRLLEQT
FT                   RTDQLAAMASELSTLAQRTADAEREVISSVEAVLKSAAYVHAAAAQAGRSCSILRASLR
FT                   VDLPSIRMLMVADRDGIVRCSTASMFVGSDISDRAYFRKALETHDFVVSDFLVGRQTQK
FT                   GTILAAYPVSAIDTGEDAVIVAGMNLDWLSDMMSNLAGRAGVSAALIDGEGTVLATPPD
FT                   ERGLVGKKLDRLALLPAMAQKSQGRETASIRDEDGRLLTVTRIPGTSARLVVTVDENKV
FT                   SAGINYDIRTAYLQLALVCLFVLLGALFAAERLIVQPISVLTAVANRFAEGDWSARVAR
FT                   KRLPSEFVPLARAFNAMAAQLGQRERELVASNSRLSVMASMDLLSGLANRRGFQSRLDF
FT                   EWMKSQQTGQRLALMMIDVDHFKLFNDSYGHPEGDACLSRIGETLAAVAAETGGFAARY
FT                   GGEEFCLLLPEAGIGRAIQVGEMVRTTVEQLTLPHRTSPFERVTVSIGVACTLPSEQAS
FT                   PAELIEAADAALYAAKHRGRNNVVEHGFIRVTDGPVAIAS"
FT   gene            377149..377808
FT                   /locus_tag="Rpdx1_0341"
FT   CDS_pept        377149..377808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0341"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bra:BRADO0186 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41983"
FT                   /db_xref="GOA:E6VIV3"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIV3"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADU41983.1"
FT                   /translation="MSAAANLAAVEAEIARACADARRDRSEVTLIAVSKTFEADAIRPV
FT                   LAAGQRVFGENRVQEAKGKWPALVEEYPGTELHLIGPLQSNKAKDAVALFDAIHSVDRD
FT                   SLCEALSKALPQAGRRLDLFVQINTGEEPQKAGIAPHDADAFLVACQERWGLTICGLMC
FT                   IPPVDEAPAPHFALCAKIARRNGLSKLSMGMSADFDIAIQFGATHVRVGSAIFGHR"
FT   gene            complement(377822..378391)
FT                   /locus_tag="Rpdx1_0342"
FT   CDS_pept        complement(377822..378391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0342"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   nha:Nham_0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41984"
FT                   /db_xref="GOA:E6VIV4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIV4"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADU41984.1"
FT                   /translation="MKKQARSTPSKQWTQPAAVPLVRVRRAAGAVSRGWLIAGGRAIPV
FT                   ALGRGGILANKREGDGGTPRGTFRPLRLWWRADRGPRPRTALPIRAITADDAWCEDPAS
FT                   RHYNRPIRRSSAGEGDRLMRDDHLYDLIIEIDHNTRPRIAGRGSAVFLHLARDNFGPTA
FT                   GCVAMTRPNLMRLLARLGPRTRIAIG"
FT   gene            378558..379244
FT                   /locus_tag="Rpdx1_0343"
FT   CDS_pept        378558..379244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0343"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: bja:bll0620 two-component response regulator;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41985"
FT                   /db_xref="GOA:E6VIV5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIV5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU41985.1"
FT                   /translation="MPNARKILIVDDDNDLRDALVEQLSLHEEFEASAVDTGAKGVQTA
FT                   KALSPDLVLMDVGLPDTDGREVVRSLRKGGFKAPIIMLTGHDTDSDTILGLESGANDYV
FT                   AKPFRFAVLLARIRAQLRQHEASEDAVFAVGPYSFRPGSKMLTGANAKKVRLTEKETAI
FT                   LRFLYRAGQAPVSRETLLQEVWGYNSGVTTHTLETHIYRLRQKIERDAANPEILVTEAG
FT                   GYKLVP"
FT   gene            379284..379733
FT                   /locus_tag="Rpdx1_0344"
FT   CDS_pept        379284..379733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0344"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: bja:bll0619 hypothetical protein; PFAM: cyclic
FT                   nucleotide-binding; SMART: cyclic nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41986"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIV6"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADU41986.1"
FT                   /translation="MSIEDDVALLARVPTLRLLGEQALRMLAIGSEQRDFARGDVMFNA
FT                   GEAADAGYVVQRGAFQITMEDGGLHEMVARPGDLIGELALIMPMPRPTTAVALEYSSAI
FT                   RIARSLFQRVLESDPGAALRLRDEFAARTTQVASDIVTVGSKLTS"
FT   gene            complement(379734..380546)
FT                   /locus_tag="Rpdx1_0345"
FT   CDS_pept        complement(379734..380546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0345"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="KEGG: bra:BRADO0181 putative exodeoxyribonuclease
FT                   III (XthA); TIGRFAM: exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41987"
FT                   /db_xref="GOA:E6VIV7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIV7"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ADU41987.1"
FT                   /translation="MRLTLTTWNINSVRLRIDLVAKFLKAQRPDILCLQETKCPDDAFP
FT                   LKRFKRLGYDHIALNGQKGYHGVAVISKLPFAATDIRTFCDIIDSRHISVSVKTADDAP
FT                   PLVLHNFYVPAGGDIPDPAVNPKFKHKLSFLDEMKACEPLHPAGDQRHILVGDLNVAPH
FT                   EHDVWSHKQLLKVVSHTPVECEKLLAVLRAGNWVDVARERIPLDQKVYTWWSYRAADWT
FT                   VGDRGRRLDHIWVSEALKDRVTDFKILRDARSWDRPSDHVPVTMTMEL"
FT   gene            complement(380599..381195)
FT                   /locus_tag="Rpdx1_0346"
FT   CDS_pept        complement(380599..381195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0346"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: msl:Msil_3873
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41988"
FT                   /db_xref="GOA:E6VIV8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIV8"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADU41988.1"
FT                   /translation="MTADAIIGLYTRHAQQWDRERGRTLFERAWLEQFRRCAGDGAAIL
FT                   DLGCGSGEPIARFLIAAGHGLTGLDASPGLIELAQQRFPDQHWVVGDMRRADLKRRFGG
FT                   ILAWDSFFHLPPDDQRAMFAVFRAHAAPGAALMFTSGPAEGVAIGTYQGEPLYHASLAP
FT                   AEYRQLLARHGFTVVAHRADDPDCGGHTVWLAKSG"
FT   gene            complement(381207..382148)
FT                   /locus_tag="Rpdx1_0347"
FT   CDS_pept        complement(381207..382148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0347"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: bra:BRADO0223 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41989"
FT                   /db_xref="GOA:E6VIV9"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIV9"
FT                   /inference="protein motif:PFAM:PF03548"
FT                   /protein_id="ADU41989.1"
FT                   /translation="MQGSDAGSRNRHSVPVAADGQHGGAVPALQDMSLIKQLNDLMQNE
FT                   MTGTGLRQLCAAAAIAIAGAAVQPASAEPVPSPKPSARATQLSAAEPKQRNPQVPAQPP
FT                   VAKLTAPPEPVIPDPRRNVPASIFTTFDSAQKAEAAKVSAYLSSLQTLVGQFVQVGPDG
FT                   SKLTGDFYIVKPGKIRFEYDEPSPVSMIADGQSVVVRDRKLATQDVYPLSQTPLRYLLS
FT                   DRIDLLRDTNVVSITSDDLYSNIIIEEKNAIIGTSRLLLMFGTKDGQLKQWTVTDPQGY
FT                   DTTVAVYNLDTSRRPDPSMFKIDYTNYQTPPG"
FT   gene            complement(382163..384637)
FT                   /locus_tag="Rpdx1_0348"
FT   CDS_pept        complement(382163..384637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0348"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="KEGG: bja:blr0616 cell division protein; PFAM: cell
FT                   divisionFtsK/SpoIIIE; DNA translocase ftsK gamma; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41990"
FT                   /db_xref="GOA:E6VIW0"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIW0"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADU41990.1"
FT                   /translation="MSMPAIERAFPLVGHLPPSIREVLARRLRELAGFGLIAVAAVAAA
FT                   ALATWSVQDPSLSHATSRRIHNLLGYPGAIGADLAMQILGLGAIGLLMPVAVWGWRMLN
FT                   HRPFDRTALRMGTWFLCTICAAGFASSFPHDTAWPLPTGLGGVVGDALVRAPSLVFGPG
FT                   LIFRVILSFILGVATLATFLIASGFGSREREPDETSADDDLPLEDEEETDRGSVSLGWL
FT                   VHAVLSAKARLWRLLKLSYRGLVSSAPAAGKQTFERQEPRLGGRAAPPIAPEVDHRDDY
FT                   EPEPVDEIEDEDDEEEEAPPVARAPRKKAAPKPAAKKARFDLPSVNVLSAPKASDRQPL
FT                   SKSELEANSRALEGVLQDFGVRGEIIKASPGPVVTLYELEPAPGIKSSRVIGLSDDIAR
FT                   SMSALSARVAVVPGRNAIGIELPNAHREKVYLRELLSVKDSNETVHKLPLCLGKNIGGE
FT                   SIIVDLARMPHLLIAGTTGSGKSVAINTMILSLVYRLRPDQCRLIMVDPKMLELSVYDG
FT                   IPHLLTPVVTDPKKAVVALKWAVREMEERYKRMAKLGVRNIDGYNTRLGEAKARGEELT
FT                   RTVHTGFDKETGKAIYEEEKLDLEPLPYIVIIVDEMADLMMVAGKDIEGAVQRLAQMAR
FT                   AAGLHVILATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGQGDML
FT                   YMAGGGRISRVHGPFVSDEEVEKVVKHLKAQGAPEYLEAVTAEEPAEGEDGAVFDATGM
FT                   GGDGGGDLFQQAVAIVKRDRKASTSYIQRRLQIGYNRAASLMERMELEGIVGQANHAGK
FT                   REILVAEEDSNF"
FT   gene            complement(384651..385877)
FT                   /locus_tag="Rpdx1_0349"
FT   CDS_pept        complement(384651..385877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0349"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   nha:Nham_0089 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41991"
FT                   /db_xref="GOA:E6VIW1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIW1"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADU41991.1"
FT                   /translation="MALSASTSPARAAGSVDATGQSERSPFARLTELLAPYQPGQSLIN
FT                   LSVGEPQHPVPDFVGAVLARHTAEFGRYPLAKGIEPFRQAASSWLTSRFALDRAPDPES
FT                   EVLVLNGSREGLFLAAIAAARYVPKRDGTPAILMPNPFYPAYAAGARAAGCEAVFLPTT
FT                   LGNGFLPDLDGLDEATLKRTVAIYLASPANPQGSVASRDYFVRLKQLADRYGFMILSDE
FT                   CYSEIYTQIAPCSALQAAGSDFSNVVVFQSLSKRSNLPGMRVGFVAGDAGFLKAYHELR
FT                   NVAAPQVPIPLQHVAVAAYSDEAHVEENRRLYRLKFDLADQILGARYGYRRPAGGFCLW
FT                   LDVSAHGGDEAAAVKLFKDGGVRVVPGSYLARTQSDGSNPGAGYIRIAMVQDSETTAEA
FT                   LHRLVRILG"
FT   gene            complement(386014..386358)
FT                   /locus_tag="Rpdx1_0350"
FT   CDS_pept        complement(386014..386358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0350"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   mrd:Mrad2831_3537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41992"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIW2"
FT                   /inference="protein motif:PFAM:PF01934"
FT                   /protein_id="ADU41992.1"
FT                   /translation="MRSDASEIALRDIRHHIELAIEFTGGLTEAEFKADLRTVYAVTRC
FT                   LEIISEASRRVSDDVRQRPSSVPWKQIAGSGNVYRHDYEDVAAQMIWDTIHRGLPALKA
FT                   AVAEELARSV"
FT   gene            complement(386348..386773)
FT                   /locus_tag="Rpdx1_0351"
FT   CDS_pept        complement(386348..386773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0351"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: cak:Caul_1178 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41993"
FT                   /db_xref="GOA:E6VIW3"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIW3"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADU41993.1"
FT                   /translation="MESKVPANGEDFVSSLGSQRKLGPLSLWSRTHAPRVQVCYTEVMD
FT                   HRTALAILRNSEAPLRARGVRRAALFGSMARGTNLPDSDIDVLVEIDPAAHITVFDYAE
FT                   LRDYIAGLFDHPVDVVNRDQLKPWVAPSATADAIYAF"
FT   gene            386779..388148
FT                   /pseudo
FT                   /locus_tag="Rpdx1_0352"
FT   gene            complement(388330..389772)
FT                   /locus_tag="Rpdx1_0353"
FT   CDS_pept        complement(388330..389772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0353"
FT                   /product="ammonium transporter"
FT                   /note="KEGG: bja:blr0613 ammonium transporter; TIGRFAM:
FT                   ammonium transporter; PFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41994"
FT                   /db_xref="GOA:E6VIW4"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIW4"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ADU41994.1"
FT                   /translation="MTFKRPYGAGLAVLVAGTFATTAAFAAPTINKGDNAWMMTSTVLV
FT                   LLMTIPGLALFYGGLVRSKNMLSVLAQVFYTVCVACIIWALYGYSLAFTGGSEFIGGFS
FT                   KAFLSGVTTDSMGGTFTVDANINELIFVCFQMTFCAITPALIVGAFAERTRFAAVALFI
FT                   PLWITLIYLPMAHMVWYWAGPDAVNDAVKALAAATDEAAKAAAQAKLDEVMADGGFLFK
FT                   KGALDFAGGTVVHINAGITGLVGALLIGKRTGYGRELMAPHSLTMTMIGASLLWVGWFG
FT                   FNAGSNLEASGGAALAMVNTFVATAAAALAWMFAEWIFKGHPSVLGALSGAIAGLVAVT
FT                   PAAGFSGPMGAIVLGIVAGVVCLLFCTVIKNALGYDDSLDVFGVHGVGGIIGALGTGIL
FT                   VNPALGGTGVYDYTLGKVGEYDFANQMISQSWGVGTTLLLSGIGSAILFKVVDVIVGLR
FT                   APVEVEREGLDLVEHTERAYNM"
FT   sig_peptide     complement(389692..389772)
FT                   /locus_tag="Rpdx1_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(389810..390148)
FT                   /locus_tag="Rpdx1_0354"
FT   CDS_pept        complement(389810..390148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0354"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   bja:blr0612 nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41995"
FT                   /db_xref="GOA:E6VIW5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIW5"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADU41995.1"
FT                   /translation="MKIVMAIIKPFKLEEVRDALTAIGVHGLTVTEVKGYGRQKGHTEI
FT                   YRGAEYAVSFLPKIKIEVAIANEQVEKTIEAITSAAKTGQIGDGKIFVLGLDHAVRIRT
FT                   GEADAAAL"
FT   gene            complement(390490..390828)
FT                   /locus_tag="Rpdx1_0355"
FT   CDS_pept        complement(390490..390828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0355"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   bbt:BBta_0295 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41996"
FT                   /db_xref="GOA:E6VIW6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIW6"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADU41996.1"
FT                   /translation="MKLVVAIIKPFKLDEVRQALTEIGVHGMTVTEVKGYGRQRGHTEI
FT                   YRGAEYIVNFLPKLRIEIAVDSALADKAVEVITRGARTGQIGDGKIFVSPIDRALRIRT
FT                   GETDSDAL"
FT   gene            complement(390967..391842)
FT                   /locus_tag="Rpdx1_0356"
FT   CDS_pept        complement(390967..391842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0356"
FT                   /product="acyl-CoA thioesterase II"
FT                   /note="KEGG: bbt:BBta_0297 acyl-CoA thioesterase II;
FT                   TIGRFAM: acyl-CoA thioesterase II; PFAM: acyl-CoA
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41997"
FT                   /db_xref="GOA:E6VIW7"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIW7"
FT                   /inference="protein motif:TFAM:TIGR00189"
FT                   /protein_id="ADU41997.1"
FT                   /translation="MSKSLIDLISILDLEPIEVNLFRGTSPKTSWQRVFGGQVIGQAMV
FT                   AGCRTVENRLPHSLHCYFILPGDPQVPIIYQVERLRDGKSYTTRRVTAIQHGNAIFSLM
FT                   MSFHDDEPTNFDHQDRMPDVPPPDALSAEEIIKQPFFKEMPDFIKRYYESDRPIELRPV
FT                   ELSRYFGQKIDDGRIHVWIKTAAKLPDDPALHMCALAYASDFSLLDAAMARYGRTLFDK
FT                   RMMPASLDHAMWFHRPFRADEWLLYAQDSPSAQGGRALTRGQIFKTDGTLVASVVQEGS
FT                   IRERREPPKS"
FT   gene            391974..393194
FT                   /locus_tag="Rpdx1_0357"
FT   CDS_pept        391974..393194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0357"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="KEGG: nwi:Nwi_0079 2-octaprenyl-6-methoxyphenyl
FT                   hydroxylase; TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase
FT                   FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41998"
FT                   /db_xref="GOA:E6VIW8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIW8"
FT                   /inference="protein motif:TFAM:TIGR01988"
FT                   /protein_id="ADU41998.1"
FT                   /translation="MTAPRSIVIGGGAFAGLALALALRQGLGPEVPVIVADPALAMRPS
FT                   KDPRATAIVAACRRLFEALEVWDEVAPTAQPIVDMIVTDSHLEDATRPVFLTFAGEVQP
FT                   GEPFAHMVENKYLVEALARRAEAEGVELRATPVTSYDARPEAIGVTLGDGSVIDASLLV
FT                   AADGARSKLRQRAGIATYGWDYDQSGIVVTVEHERDHNGCAEEHFLPAGPFAILPLTGR
FT                   RSSLVWSESRRDAERIVALPEKEFQRELEKRFGLRLGDVKPLDKPKSFPLGYFVAQSFI
FT                   APRLALIGDAAHVIHPIAGQGLNMGLRDVAALAEVVVDAARLGTDPGQVDVLERYQRWR
FT                   RFDTMAMGVATNGLNFLFSNNSSLLRGIRDIGLGLVDRLPPLKGAFIRQAAGLSGEIPR
FT                   LLKGEAL"
FT   gene            complement(393325..393522)
FT                   /locus_tag="Rpdx1_0358"
FT   CDS_pept        complement(393325..393522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0358"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   nha:Nham_0083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADU41999"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIW9"
FT                   /inference="protein motif:PFAM:PF03966"
FT                   /protein_id="ADU41999.1"
FT                   /translation="MTLSPSERPDAVDRKLLDILVCPITKGPLEFDAARQELISRGAKL
FT                   AYPIRDGIPIMLPEEARKIG"
FT   gene            complement(393610..394287)
FT                   /locus_tag="Rpdx1_0359"
FT   CDS_pept        complement(393610..394287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0359"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="KEGG: bja:blr0595 hypothetical protein; PFAM:
FT                   peptidase S16 lon domain protein; SMART: peptidase S16 lon
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42000"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIX0"
FT                   /inference="protein motif:PFAM:PF02190"
FT                   /protein_id="ADU42000.1"
FT                   /translation="MPINAAYRGPADLPEVIPVFPLPGALLLPRGQMPLNIFEPRYLAM
FT                   IDDALRDGHRLIGMIQPDTAHSSEAAEKPALFSVGCVGRITQLAESGDGRYILELTGVS
FT                   RFKVVEELQVLTPYRQCKVDYFPFVDDFVARKGEDEVDRETLLAVLTDFLKANNLKVDW
FT                   DGVESAPNEALVNALAMMSPYGPPEKQALLEAPDLKTRAEILIAVTEMDLAKKRTSGDP
FT                   PLQ"
FT   gene            complement(394315..395235)
FT                   /locus_tag="Rpdx1_0360"
FT   CDS_pept        complement(394315..395235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0360"
FT                   /product="thioredoxin"
FT                   /note="KEGG: bra:BRADO0321 putative thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42001"
FT                   /db_xref="GOA:E6VIX1"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIX1"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADU42001.1"
FT                   /translation="MTIMEQGSGAASQAAADLIKDTTTQSFVRDVIEESKQQPVLIDFW
FT                   APWCGPCRQLTPMLEKAVRAASGKVKLVKMNIDEHPSIPGQMGIQSIPAVIAFVDGRPA
FT                   DGFMGAVPESQVAAFIEKLTAGMPGGAPSAAELLQEAEAILAEGDVQTAASIYAEVLRS
FT                   DAANIPAIAGLARCYMQTGATEQAKKTLALVAEAGREDAAVKAVQAMIDLAEQAESLGP
FT                   IAELEQKVAADPLDHQARFDLAVALNAAGRREEATGHLLDIVKRDRKWNDDGARKQLVQ
FT                   FFEAWGPTDDATIEGRKRLSTILFS"
FT   gene            395547..395621
FT                   /locus_tag="Rpdx1_R0006"
FT                   /note="tRNA-Gly1"
FT   tRNA            395547..395621
FT                   /locus_tag="Rpdx1_R0006"
FT                   /product="tRNA-Gly"
FT   gene            395866..397278
FT                   /locus_tag="Rpdx1_0361"
FT   CDS_pept        395866..397278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0361"
FT                   /product="membrane bound O-acyl transferase MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase MBOAT family
FT                   protein; KEGG: azl:AZL_019970 membrane bound O-acyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42002"
FT                   /db_xref="GOA:E6VIX2"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIX2"
FT                   /inference="protein motif:PFAM:PF03062"
FT                   /protein_id="ADU42002.1"
FT                   /translation="MLFYDPLFLTCFPLLYVLYFAADAARTKRWILLIGSGLFYLWGEP
FT                   LFVPVVVASALIDHLLARAIDRSSNPSMRRALLALGVAQNIAILIVYKYTSFALESLNV
FT                   LLAAGQLGALPVWQIALPIGVSFVTFEKITYLVDTYRGVSQPARRFSDYCLFVFFFPKL
FT                   LAGPILKYHEIDRQIAVPRGFDWNDCGAGLARFAQGAFKKLLIADPLGHYADQVFGADP
FT                   ATLSMGAAWLGTVCFTLQIYFDFSGYSDMAIGIARMLGFSLRENFNMPYISRSITEFWR
FT                   RWHISLTTWIRDYLYIPLGGNRGGAFLTYRNLWICFLLSGLWHGASWNFVLWGAYNGLF
FT                   LTLDRMFLERWLQRSGAVIATAATLLIVMLGWVIFRSPDAAHLGGFFAALAGFGQATAW
FT                   LPPPVSVLWTATLGIALSLIPALPVFGSLCAAWRSVSVLRLAGYVGLGALGTIAIARAV
FT                   AIPFQPFIYFRF"
FT   gene            397281..398450
FT                   /locus_tag="Rpdx1_0362"
FT   CDS_pept        397281..398450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bav:BAV2623 cellulose acetylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42003"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIX3"
FT                   /inference="similar to AA sequence:KEGG:BAV2623"
FT                   /protein_id="ADU42003.1"
FT                   /translation="MAALTTSRGRWLRRLAAGAFLAMPALTVWNLAVPSHAVRIGPALV
FT                   GVTQQRPLDVSLHGFLDGALQKVAALRIADAMPLRRTLIRLNNQIAYSLFGEIVAPGVL
FT                   VGRDGQLVQRSYLEEYCSRTIGQADAMADAAIPLLRDIQAFYRGRGGGFLYIVTPSKVA
FT                   DMPDKFTHLMTCPSTPQARAELVPAYVARLRAAGIEVVDAASSTHARQHGDAVEPFPRG
FT                   GIHWNELAMARASRQIVDAVNAQVGRELLPPFSFTARIVRPAEGRDRDLAELANLLVAP
FT                   IDYPAPKLTYSHPPCAGREATRIDAALVGTSFIDPVSEVLTEQACLTRLGQYFYLKLGR
FT                   SRGGVRQDHLSEADLREVRDVDLMLLEENESLIGRQQYLSLLHQIVTTP"
FT   gene            complement(398579..399415)
FT                   /locus_tag="Rpdx1_0363"
FT   CDS_pept        complement(398579..399415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0363"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: msl:Msil_2835
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42004"
FT                   /db_xref="GOA:E6VIX4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIX4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU42004.1"
FT                   /translation="MSLDLTLDDAPAVATSRRTSGRLAGPARSFGYVLLGIATLLAVWW
FT                   LGGAIVAANPRTASFADFAPLPTFERLWSMLVSGEAAKMALPSLARIGGGLAWAIALGV
FT                   PLGILVGRFKGMRQASSVPFQFLRMISPLAWMPIAVMAFSSWNGAIVFLIGVAAIWPIL
FT                   FSTAHGFRRIDPAWFKVARNLGARPWHMLFTIIVPAIMQDSLAGIRLAVGVAWIVLVPA
FT                   EFLGVTSGLGYAINDARDTLEYDRLAATVVIIGLIGFTLDFLCERAVKRASWAREE"
FT   gene            complement(399412..400650)
FT                   /locus_tag="Rpdx1_0364"
FT   CDS_pept        complement(399412..400650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0364"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: msl:Msil_2834 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42005"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIX5"
FT                   /inference="similar to AA sequence:KEGG:Msil_2834"
FT                   /protein_id="ADU42005.1"
FT                   /translation="MCINCGDDVVHPEDDRFRITRRQTLDMLAAGGLAALGTMLGGFGQ
FT                   AARAADDEVVRIGYLPITDATALLVAHGMGYFKDEGLEAERPTLIRGWSPLVESFAAGK
FT                   FNLVHLLKPIPVWMRYNNNFPVKIMAWAHTNGSGLVVGGETGIQSFKDLGGRQVAVPFW
FT                   YSMHNIVLQYALRKSGIKPVIKGQGEQLAPDECNLQVMAPPDMPPALAAKKIDAYIVAE
FT                   PFNALGETKAGGRMLRFTGDIWKNHPCCVLCMNEEVTTKKPEWTQKVLNALVRAEIYAS
FT                   ANKKEVARLLSKDGEGYLPLPAAVIERAMTYYDDKAYAETGAITHPDWKIGRIDFQPWP
FT                   YPSATKLIVEAMNDTVVSGDTTFLKKLDPDFVAKDLVNYDFVKQAMMKYPDWKSSPSVD
FT                   PADPFTRTEVLAL"
FT   gene            complement(400664..401536)
FT                   /locus_tag="Rpdx1_0365"
FT   CDS_pept        complement(400664..401536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0365"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: msl:Msil_2833 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42006"
FT                   /db_xref="GOA:E6VIX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIX6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU42006.1"
FT                   /translation="MPAYQSKKSWPGAHIAIQGISHRYRRSTSNVLSSIDLEIRPCEQI
FT                   ALVGRSGCGKSTLLHIISGLTKPTSGEIRIDGALVEGPSPNWIVMFQQPNLYPWMSVAQ
FT                   NVGLGMKFAGRPKKEIAARVDELLHLVELDGYAGRNAQELSGGQQQRVALARSLAVNPD
FT                   VLLLDEPFSALDAVTRRALQRDVRRIAEEMKITLVIVTHDIPEAVTMADRAVVMASDPG
FT                   RIAETVAIEFDRHDSDPERRATGVQTAQARLQAAFERATGRALHGGVSTTACEPSRPEP
FT                   LKIVAAGAR"
FT   gene            complement(401616..402497)
FT                   /locus_tag="Rpdx1_0366"
FT   CDS_pept        complement(401616..402497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0366"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: bra:BRADO2770 putative thiosulfate
FT                   sulfurtransferase (rhodanese-like protein); PFAM: Rhodanese
FT                   domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42007"
FT                   /db_xref="GOA:E6VIX7"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIX7"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADU42007.1"
FT                   /translation="MTDKVLVTPAELSEMITAGGTVVIDTRDPATYAAGHIPGAVNIHD
FT                   IFTYLATSTPEGVAEMRDKFAAIFGAAGLSGEETAVIAEQSMNTGFGQSCRGYVLLSYL
FT                   GYPKVKILHGGTSAWVAAGLPTTTEVPTPTPKTVKVDPAAASILVDLEGMKAAVGDSGK
FT                   VKLDTRDVDEWGGESSSPYGKDFCPRKGRIPGAVWIEWYRMMKPSPAGPMFKSPSEILA
FT                   ECATVGITPDTPVVLYCFKGARASNTLVALKEAGIKDVSLYFGSWNEWSRDPSLPIEQG
FT                   PPYAAQPLLAAE"
FT   gene            complement(402625..403755)
FT                   /locus_tag="Rpdx1_0367"
FT   CDS_pept        complement(402625..403755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0367"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mno:Mnod_1706 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42008"
FT                   /db_xref="GOA:E6VIX8"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIX8"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADU42008.1"
FT                   /translation="MLDVQSVSKGDGTVLPGAEVIEAVRALAARELPPLVNTIDVDGYY
FT                   PEAQMRAFGRLGAYAHHLPGMSPSVDLMTAINAMAAAGEHCLSTSFCMWCQDALAWYIY
FT                   ASDNQHLRTGIGPQIASGAALGGTALSNPMKSLFGIEPMRLKGRRGDGGYVVKGLLPYV
FT                   SNLGADHYFGAIFEVEDSGTTRNVMAVIPCAADGVSLADNAKFTALDGTRTFAVQMRDV
FT                   VVPDAWVLADPVDPFIKRIRAGFILLQAGMAFGLIRDCLRLMEQTRGPLGHVNKYLDVQ
FT                   PEPIAEQLEAMEVEVARLAATPFEDDLGYWRAVIEARLAAGDASVAAAHAAMLHCGARG
FT                   YVAGATAQRRLREAYFVAIVTPATKQLRKMLADMAH"
FT   gene            complement(403790..404362)
FT                   /locus_tag="Rpdx1_0368"
FT   CDS_pept        complement(403790..404362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0368"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: xau:Xaut_2612 OsmC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42009"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIX9"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADU42009.1"
FT                   /translation="MTKAATAVTACLTPDSPTALTGCLAPIDKAGLDDLIAKGKADPTV
FT                   IKTLKCKTIAEGRFRHLNFIRSLPPYIVDEPPGLLGDDTAPNPSEASLAALGSCLAVGI
FT                   HANAVARGITVYKLEIELEGDLNITGVWGTGDLSEKPVGFTDVRAKVSFEADRPREELE
FT                   ALVAHARLWSPVANTFSRPVNLDVAMA"
FT   gene            404621..405229
FT                   /locus_tag="Rpdx1_0369"
FT   CDS_pept        404621..405229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0369"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bja:blr5739
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42010"
FT                   /db_xref="GOA:E6VIY0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIY0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU42010.1"
FT                   /translation="MCRSMADAANLVIEHPAEAKLSPRDRLIDSARNLFCRYGINSVGV
FT                   DAIIEQAGTAKTTLYKLFGSKDGLVEAVLEREGQSWRSWFLESIDGPGGTARERLGRIG
FT                   PALKDWFTRGDFYGCPFINAVGESDKNDDRMRNLAIAHKTIVLDRLTALCAEAGIEHPT
FT                   EVAHTLGLVIDGAIVMALVTRDPSAADVAGRACAAVLPA"
FT   gene            complement(405234..407195)
FT                   /locus_tag="Rpdx1_0370"
FT   CDS_pept        complement(405234..407195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0370"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: oca:OCAR_5879
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42011"
FT                   /db_xref="GOA:E6VIY1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIY1"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADU42011.1"
FT                   /translation="MRPVYRSDIDGLRAIAVLLVVGFHAFPAAVTGGFIGVDVFFVISG
FT                   FLITSIVCQALDRGDFSFATFYARRINRIFPALALVLAACAIGGWFLLFPVDYRDAGKA
FT                   IGFGAAFLANIALLHDSGYFDTSSELNPLLHLWSLGVEEQFYLLWPPVIILAWRWKNGA
FT                   VVVAVAILLASFATNLLLTPTQPSAAFYLPVTRFWELMTGCLLAIVAADPARRGNAPLR
FT                   TMFARHATTLRNVGAVAGIALIAAGAALIDRSRAFPGWWAVLPVLGAALLIAAGPGTWT
FT                   ARRLLGNRAMVYVGLISYPLYLWHWPVLAAIRIARLGEEPPPLMKLIAVLVAFALADLT
FT                   YRFVEPKIRYRPTRAKTAAAFAGVAVVGLIGAGIFVAGGVPSRFSAGVQIVTRDHQAEA
FT                   MPAFRLGSCFLGSGSSFARECNDAPSPGVPRVALWGDSHGAHLYPGLRAVQQSDGGFSL
FT                   SQYTTAGCPPIFGYVSTQTPGCTAANDNARERLKALKPDTVVLVARQWHDYDGPDRDPA
FT                   AIDTMIKATLAELRSIGIRRIVVVGKFPSWRTPPKRILAQAYRAEAAGLITAAEIPTRD
FT                   GAPRLDRSEADANERLRRFFTEQGVEFISPTPVYCNDQGCLLAVPGSGTPVTFDGSHLT
FT                   VASSQFFVRQVARDLLGR"
FT   gene            407419..407847
FT                   /locus_tag="Rpdx1_0371"
FT   CDS_pept        407419..407847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0371"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   cts:Ctha_1708 protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42012"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIY2"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADU42012.1"
FT                   /translation="MQIQRHRIELATTAPIQLIDITDQVRRFVAGSGVKEGLVTVSCLH
FT                   TTARINVNEREEKLERDMLTFLKRFAPRDGDYLHNLDPVDGRDNAHSHLIGLFMNSSET
FT                   IPIAHGSMVLGEWQSVFFIELDGPRQRRGVELQIIGQG"
FT   gene            407852..409150
FT                   /locus_tag="Rpdx1_0372"
FT   CDS_pept        407852..409150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0372"
FT                   /product="Ribulose-bisphosphate carboxylase"
FT                   /EC_number="4.1.1.39"
FT                   /note="KEGG: alv:Alvin_2545 ribulose-bisphosphate
FT                   carboxylase; PFAM: ribulose bisphosphate carboxylase large
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42013"
FT                   /db_xref="GOA:E6VIY3"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIY3"
FT                   /inference="protein motif:PRIAM:4.1.1.39"
FT                   /protein_id="ADU42013.1"
FT                   /translation="MTPDDIAGFYARRSELNLDDYIELDFDFECAGDPREAAAHLCSEQ
FT                   STAQWRRVGFDEDFRPRFAAKVLELSAEPRPSGFSTSVECAARGEVHACRVTIAHPHGN
FT                   FGAKIPTLLSAVCGEGVFFSPGIPLIRLQDIRFPDAYLAAFDGPRFGIAGLRERLQAFD
FT                   RPIFFGVIKPNIGLPPQPFAELGYQSWSGGLDIAKDDEMLADVEWCPLAERAALLGDAC
FT                   RRASAETGVPKIYLANITDEVDRLTELHDVAVANGAGALLVNAMPVGLSAVRMLRKHAT
FT                   VPLMAHFPFIAAFSRLANYGIHSRVMTRLQRLAGFDVVIMPGFGPRMMTPEHEVLDCIR
FT                   ACLEPMGPIKPCLPVPGGSDSAATLENVYRKVGSADFGFVPGRGVFGHPMGPAAGAASI
FT                   RQAWDAIAAGIPVADHAAGHPELAAALQAFGGR"
FT   gene            complement(409179..410264)
FT                   /locus_tag="Rpdx1_0373"
FT   CDS_pept        complement(409179..410264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_2399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42014"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIY4"
FT                   /inference="similar to AA sequence:KEGG:Nwi_2399"
FT                   /protein_id="ADU42014.1"
FT                   /translation="MQSETKSYPFDHLPMIDYDAHPAYGRVMSMPMLGARLKAITIFGY
FT                   GFFLTTAQRMIDAEHLPPPAETGNRFAAVLRSLPTYLRLIMLQRLGRFSAGSAYAPKTE
FT                   RGSAVFAPLSRDGFAAVQLGSDKIVELRNQLDAAFKTLEHRVAIPGDPDSTRVVIDPAA
FT                   APDLYRWFNQVAADAGVTEAASGYLKRPVGIGRIAAEVTEASGGALSSPFADVSVDASP
FT                   CDGFKVDSGYNVLKMVVYLGETGVANGPLTYVAGSNRAGRRFWDAMIRRANDLCGLSST
FT                   LPAARETFYALPAGLQRKATFGADLVADSNFTAAIAESQVAVTSREGNAAIYDPAGIHR
FT                   DGAPSQGRRSAVIVTFTELPR"
FT   gene            complement(410438..411229)
FT                   /locus_tag="Rpdx1_0374"
FT   CDS_pept        complement(410438..411229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0374"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: rce:RC1_2117 coenzyme
FT                   B12-binding aerobic repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42015"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIY5"
FT                   /inference="similar to AA sequence:KEGG:RC1_2117"
FT                   /protein_id="ADU42015.1"
FT                   /translation="MRAVQTESIVSTVIPHLVVKHTTARTRIAQDPAEIRAAELARLLI
FT                   APNLADAFDLIDKSLARAASPTALFTGLFEPTARSLGNLWSEDACSEFEVTIGLCHLQT
FT                   AMRRISFDLLSAPLARSQPRSVLLVSQPGEPHSFCAALHAELLRQAGWNTVSEFPDSDR
FT                   ALADLVASGWFDAVNISLSPSLRREHWLPRVAETIRKLRAASRNPALAVVASGRVFAER
FT                   SDAVALVGADAATISSVQIERCLMRALLNRTARPAANFAWI"
FT   gene            412079..412861
FT                   /locus_tag="Rpdx1_0375"
FT   CDS_pept        412079..412861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0375"
FT                   /product="histidine kinase HAMP region domain protein"
FT                   /note="KEGG: avi:Avi_4013 methyl-accepting chemotaxis
FT                   protein; PFAM: histidine kinase HAMP region domain protein;
FT                   SMART: histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42016"
FT                   /db_xref="GOA:E6VIY6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIY6"
FT                   /inference="protein motif:PFAM:PF00672"
FT                   /protein_id="ADU42016.1"
FT                   /translation="MQFDLSNRNLAQKISILVLGITLFASVAIGGVGEMVLHKVTDSHA
FT                   KQSARVASLDRLVGQGGATLSPVRAADGSIVGMLVMQQDSGPVVMPASFEGQGLVVQAS
FT                   ETVVTSTPDYGVGAARTMLLLAGIAVFAVVGLVGTRISRGLLAPLGELEKDVERLASGD
FT                   TSVRIHALSRSDEIGRIARSIAKIQQSLIELAKLKSHRVLDGTNGILANLKEMWMDLKG
FT                   AVSNAREMLFTDGRTVSETLSRSWSNWLHNGLGVPKRA"
FT   gene            complement(413401..413476)
FT                   /locus_tag="Rpdx1_R0007"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(413401..413476)
FT                   /locus_tag="Rpdx1_R0007"
FT                   /product="tRNA-Thr"
FT   gene            complement(413624..415321)
FT                   /locus_tag="Rpdx1_0376"
FT   CDS_pept        complement(413624..415321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0376"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein; KEGG: bja:bll0564
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42017"
FT                   /db_xref="GOA:E6VIY7"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIY7"
FT                   /inference="protein motif:PFAM:PF07219"
FT                   /protein_id="ADU42017.1"
FT                   /translation="MLRIVLFLVIIALAAAGAAWVAEQPGEVVLSWNDWRASMTLPVFA
FT                   AALGAGVVAVMLAWAIVLGVVRAPGWMKRGRSSRRSERARNAITQGLLAVGHGDSAAAR
FT                   AHANAARRHAPHDPLALLLQAQSAQLEGDREGARRAFLAMASRKDTKSLGMRGLYIEAQ
FT                   RADDPYAALAIAEEALRLQPNCAWASQAVLGFRCARSDWTGALEILERNLSAGLIDKKA
FT                   FRRQRAVLLTARAIDLEESDESLARDSALEANKLAPTLVPAAVLAAKHLAGAHQVRRAM
FT                   KVIEAAWQAQPHPELASTYANLKPGDTATARLGRVENLVGKGPQQLESAVAIARAAIDA
FT                   GSFGRARTALEPYLEMPTQRVAMLMAEIEHGDRGDTAKARAWTLRAVRALHDPVWTADG
FT                   YVSDHWRPVSPVTGRLDAFQWQVPVSALPSSKAVVIDDKFHDALIASATTEALPASETS
FT                   EAVTVTVEAAPEAPIVTPKEPTVAAEEPAKADKPAKAAEAPAETMAAPASSPSPLFHRR
FT                   KEAAPVIPIVRAPDDPGVDDDAAPEEFTERTPAPAGQGSGWRGYRPPR"
FT   sig_peptide     complement(415256..415321)
FT                   /locus_tag="Rpdx1_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            complement(415330..416745)
FT                   /locus_tag="Rpdx1_0377"
FT   CDS_pept        complement(415330..416745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42018"
FT                   /db_xref="GOA:E6VIY8"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIY8"
FT                   /inference="similar to AA sequence:KEGG:Nham_0564"
FT                   /protein_id="ADU42018.1"
FT                   /translation="MVENRPEHEQAAEPAGHSKPAGEETSAAAPGTEADAPAETTPDAE
FT                   PARGPEQAFDIAADQREQAEQAAGLPEPEFATTTATADASATSQSSTPPRSSIASLMLP
FT                   PVLTIAIATGLVVGAAQLGLLPQFLSSTSVSAPQTDPAALDALNARIAKLEAAPAAGGA
FT                   TATTPGDSAALEALAIRITNLEAQPKPAAVASTAADPADAGRIDALEKTVASLRDDLTA
FT                   LRGQADQLAATVKDLKTLPANGAGSDDTKPGTAAGPDNAAALEQTTAALAAIDRRLGAL
FT                   ETAAKAEAEKPAPKPAPAEDSALRRAVAATLLDLAVTQGQPFQPLLKAATPLAPDAAAL
FT                   KPLDRFAATGVPSAHALGHELVDLLPKLLPDKTSANANFLDRFQANAERLVKIQRSDAV
FT                   EGIDRTAIVGRLTAAGKQGDIAAALKELKALAPGDRAPVQSWIDKAEARDQALAASHQF
FT                   ATAALGALQKPSP"
FT   gene            complement(416797..417543)
FT                   /locus_tag="Rpdx1_0378"
FT   CDS_pept        complement(416797..417543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0378"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   bja:bll0566 uroporphyrinogen III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42019"
FT                   /db_xref="GOA:E6VIY9"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIY9"
FT                   /inference="protein motif:PFAM:PF02602"
FT                   /protein_id="ADU42019.1"
FT                   /translation="MALLVTRPQPDGDATAKALRAKGYDVLLAPMLRFEPVPFPDDPDA
FT                   RYTGVIVTSANALRALEDQPVLARLLGLPLFAVGKHTARKAQDAGFNDIIVADGDAARL
FT                   RIKIGDSLRGTDKRAGALLYLAGADLSRDLAGELREDGFEVVMQTAYRMAPVPTLPAEV
FT                   CEAFAANRIEAVLHYSRRSARAFIDATRTSGIEISALAIPQCCLSEAVSEVVREAGANQ
FT                   VMVARKPDEKALLEALDRALGPAKVN"
FT   gene            417783..418874
FT                   /locus_tag="Rpdx1_0379"
FT   CDS_pept        417783..418874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0379"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: metalloendopeptidase, glycoprotease family;
FT                   KEGG: nwi:Nwi_0470 putative DNA-binding/iron
FT                   metalloprotein/AP endonuclease; PFAM: peptidase M22
FT                   glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42020"
FT                   /db_xref="GOA:E6VIZ0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIZ0"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADU42020.1"
FT                   /translation="MTSEQALLVLGIETTCDETAAAVVERRADGSGRLLSNIVRSQTDE
FT                   HAPFGGVVPEIAARAHVDVLDGIIAAAMNEAGVAFAGLSGVAAAAGPGLIGGVIVGLTT
FT                   AKAIALVHGTPLIAVNHLEAHALTPRLTDAVEFPYCLFLASGGHTQIVAVLGVGNYVRL
FT                   GTTVDDAVGEAFDKIAKMLGLPYPGGPQVERAAEAGDPNRFAFPRPMLGRQDANFSLSG
FT                   LKTAVRNEAGKLTPLDPQDIADLCAGFQAAVLDSVADRLGAGLRLFKERFGPPKALVAA
FT                   GGVAANQAIRRMLREVAAKAQTTLIVPPPALCTDNGAMIAWAGAERLALGLTDPMDTAP
FT                   RARWLLDAGATAPAKFANTRAGF"
FT   gene            418911..419900
FT                   /locus_tag="Rpdx1_0380"
FT   CDS_pept        418911..419900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0380"
FT                   /product="NAD-dependent glycerol-3-phosphate dehydrogenase
FT                   domain protein"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: bbt:BBta_0290
FT                   NAD(P)H-dependent glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42021"
FT                   /db_xref="GOA:E6VIZ1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIZ1"
FT                   /inference="protein motif:PFAM:PF01210"
FT                   /protein_id="ADU42021.1"
FT                   /translation="MSSLKSIAVLGGGAWGTALAQTAARAGRNVMLWEHDAGNAEHLIA
FT                   ARESRFLPGVRLEPSIQVTRDLAEAARADALLLVVPAQVLRQVVTSLQPLIAPKMPLVA
FT                   CAKGIEHGTHRFMTEIIAEAAPAAIPAILSGPSFAADVARGLPTAVTIAATDAACAQAL
FT                   AQAMNSGSFRPYHSTDVRGVELGGATKNVLAIAAGIVEGRQLGASALAAMTTRGFVELV
FT                   RFGKAYGARIETMHGLSGLGDLTMCCSTPQSRNFSFGMALGRGEQIETAAHGKLAEGYY
FT                   TAPVLLEMAQAKDIDMPISTAVAAVLSGKLSVDAAIEGLLTRPLKAEE"
FT   sig_peptide     418911..418973
FT                   /locus_tag="Rpdx1_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.935 at
FT                   residue 21"
FT   gene            419903..420316
FT                   /locus_tag="Rpdx1_0381"
FT   CDS_pept        419903..420316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0381"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   bja:blr0569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42022"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIZ2"
FT                   /inference="protein motif:PFAM:PF01878"
FT                   /protein_id="ADU42022.1"
FT                   /translation="MAYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRR
FT                   GDRAFYYHSNEGKEIVGIAEIIREAYPDPTDASGKFVCVDIKADKPLKTPVTLAAVKAE
FT                   PRLAEMALLKYSRLSVQPVTAEEWKLVCKMGGL"
FT   gene            420495..421157
FT                   /locus_tag="Rpdx1_0382"
FT   CDS_pept        420495..421157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42023"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIZ3"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1107"
FT                   /protein_id="ADU42023.1"
FT                   /translation="MSSSAVADPIAFIHANTRLREVPLVPEVMLHVADEALPLWSKTEE
FT                   ELGEAGLPPPFWAFAWAGGQALARYVLDHPQDVAGKDVIDLASGSGLVAIAAMKAGARK
FT                   VTAFDIDGFAREAILVNAAANGVAIEVCDHDLLAGPHPLPAQAVLAGDIFYQQDIAGLA
FT                   FAFLKSRVALGARVLIGDPGRYYLPKDQLVQLATYGVPVTRELEDSEIKHTGVWTLK"
FT   gene            complement(421167..422438)
FT                   /locus_tag="Rpdx1_0383"
FT   CDS_pept        complement(421167..422438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0383"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="TIGRFAM: MiaB-like tRNA modifying enzyme; RNA
FT                   modification enzyme, MiaB family; PFAM: Radical SAM domain
FT                   protein; Protein of unknown function UPF0004; KEGG:
FT                   bra:BRADO0384 putative MiaB-like tRNA modifying enzyme;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42024"
FT                   /db_xref="GOA:E6VIZ4"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIZ4"
FT                   /inference="protein motif:TFAM:TIGR01579"
FT                   /protein_id="ADU42024.1"
FT                   /translation="MAVEVITFGCRLNAFESELIRREAEGAGLADTIVVNSCAVTNEAV
FT                   AQARQQIRKLKRARPEALIIVTGCAAQTEPATFAAMQEVDRVIGNDDKTRSHAWHAAKG
FT                   ALDAGPSFGLDTEQKIAVADIMAVREMAPHLLDGYQSGLPRVFVQVQNGCDHRCTFCII
FT                   PYGRGNSRSVPVGAVVEQVRRLAERGHAEIVLTGVDLTSYGADLPGTPKLGTLVKKVLR
FT                   HVPELQRLRISSIDQVEADRDLIDALATEPRLMPHLHLSLQAGDDLILKRMKRRHARAD
FT                   AIAFCAEARRLRPDIALGADLIAGFPTETDEMFQRSLDLVEECGLTFLHVFPYSPRPGT
FT                   PAARMPQLDGRVIRDRAARLRAAGEAALQRRLDAETGASRAVLIESPTQGRTEHFLPVA
FT                   ISGATPGDVQSLRITGHDGTRLTV"
FT   gene            complement(422438..423319)
FT                   /locus_tag="Rpdx1_0384"
FT   CDS_pept        complement(422438..423319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0384"
FT                   /product="diaminopimelate epimerase"
FT                   /note="KEGG: nwi:Nwi_2776 diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42025"
FT                   /db_xref="GOA:E6VIZ5"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIZ5"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADU42025.1"
FT                   /translation="MSALDNRLFAKMNGIGNEIVVVDLRDQSAPVTPADARAVAAHVPY
FT                   DQLMLLQPARLPGTEAFVRIYNNDGSESGACGNGMRCVARQMFAGSDQNGLTFETRAGL
FT                   LNCWRGPADGFYTVDMGEPKFGWQDIPLAEEFRDTRMIELQIGPIDAPVLHTPSVVSMG
FT                   NPHAIFWVDDVNAYDLGRFGPLLENHPIFPERANITLAHIVDRQHITMRTWERGAGLTK
FT                   ACGSAACATAVAAARLKRTERTVDMTLPGGRLTIEWRDSDNHVLMTGGAEFEFEGRFDP
FT                   ALFAGALNPTGA"
FT   gene            423556..424350
FT                   /locus_tag="Rpdx1_0385"
FT   CDS_pept        423556..424350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0385"
FT                   /product="transcription activator effector binding protein"
FT                   /note="PFAM: transcription activator effector binding;
FT                   KEGG: bja:blr0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42026"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIZ6"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADU42026.1"
FT                   /translation="MERPCLFGLMRVGLVPALVLTLGIAGASAQTAPDASKDAKDKPLA
FT                   AAPAQAQTPPAQPAPAQAAPTPATAAPATPPAASETPAASPAPATPPAPSATQTPAAPV
FT                   APAPVQTADPFGEESTLEPKTVVILKGKANWDNAFDSLMDAFKALTALLDKQGIAPNGN
FT                   PMIVYTSTDDSGFTFQAQIPVPQEPKNLGKSMSIGKSPDGKALKFVHRGSYDNMDNTYE
FT                   AITNFLDDKKLEAKDTFIEEYVTDPLKTAEDKLVINVYVPMK"
FT   sig_peptide     423556..423645
FT                   /locus_tag="Rpdx1_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.852 at
FT                   residue 30"
FT   gene            424347..425042
FT                   /locus_tag="Rpdx1_0386"
FT   CDS_pept        424347..425042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0386"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   nha:Nham_3577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42027"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIZ7"
FT                   /inference="protein motif:PFAM:PF04402"
FT                   /protein_id="ADU42027.1"
FT                   /translation="MNMLRSLSIAAACCLIVALPARAQDAPPPGIVVRGEAQKSVAPDA
FT                   ALIEAGVSNFAKSARAAAEATNLAMGKVLLELKNAGIEAKDVQTSQLSLQPQYADRPGP
FT                   SEVTGYVVKNIVSVRVRDIAAVAGILDRLVTAGANEVRGISFTVSNASKLLDEARTEAV
FT                   ADARRKAEIYARAAGLALGAPQSIAEDSGPGVMPMRKMAADFAAGAQVAPGEQTLNVSV
FT                   TVNWGIKAQ"
FT   sig_peptide     424347..424418
FT                   /locus_tag="Rpdx1_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(425052..426026)
FT                   /locus_tag="Rpdx1_0387"
FT   CDS_pept        complement(425052..426026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0387"
FT                   /product="putative metallo-hydrolase/oxidoreductase"
FT                   /note="KEGG: bra:BRADO0380 putative
FT                   metallo-hydrolase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42028"
FT                   /db_xref="GOA:E6VIZ8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIZ8"
FT                   /inference="similar to AA sequence:KEGG:BRADO0380"
FT                   /protein_id="ADU42028.1"
FT                   /translation="MSYYQGPVTDHFDGTRFFDPDGAPPKSFWEVMRWRFSHKPAQWPE
FT                   WAPSPFADTPPPRVDGAGVRLVYVGHASWLIQTAGLNILIDPVWSERVSPVSFAGPKRH
FT                   NDPGVAFDRLPKIDVVLVSHGHYDHLDLATLSRLAAAHGPRVITPLGNDLTMTAHDATI
FT                   RAEAYDWSDRVELNDRVAMTLVPTRHWTARGLFDRNRALWASFVLETPAGKIYVVCDSG
FT                   YGDGRHFRRVRDAHAPLKLAILPIGAYEPRWFMQDQHMNPADAVKALADCGAERALANH
FT                   HGTFQLTDEAIDAPEQALYAALDAGGIPRDRFPVLKPGQVFQL"
FT   gene            complement(426118..426522)
FT                   /locus_tag="Rpdx1_0388"
FT   CDS_pept        complement(426118..426522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0388"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   sus:Acid_1772 PilT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42029"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E6VIZ9"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADU42029.1"
FT                   /translation="MPFVIDVSLMAVWHFPDERNSTADAALARLEHEGAVVPLIWWFEV
FT                   RQVLLKGERRGRTSPEQSAQFLAFLDSLPLRVAPLPVGDAVMQLARRHQLSFYDAAYLE
FT                   LAQRERIELATLDAALARATTAEGVALVGA"
FT   gene            complement(426525..426770)
FT                   /locus_tag="Rpdx1_0389"
FT   CDS_pept        complement(426525..426770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0389"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   sus:Acid_1771 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42030"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ00"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADU42030.1"
FT                   /translation="MKHVSLADARANIAKLLDEVERGETVTISREGVSEAELAPPFDEK
FT                   RREAARQAIEGIRALRSGAAGATIDEIIAWKNEGRE"
FT   gene            427037..428581
FT                   /locus_tag="Rpdx1_0390"
FT   CDS_pept        427037..428581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0390"
FT                   /product="signal recognition particle protein"
FT                   /note="TIGRFAM: signal recognition particle protein; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; Signal peptide binding (SRP54) M- domain protein;
FT                   KEGG: bbt:BBta_0368 signal recognition particle subunit
FT                   FFH/SRP54 (SRP54); SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42031"
FT                   /db_xref="GOA:E6VJ01"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ01"
FT                   /inference="protein motif:TFAM:TIGR00959"
FT                   /protein_id="ADU42031.1"
FT                   /translation="MFDNLSEKLGGILDRLTGRGALSEADVDAAMREIRRALLEADVAL
FT                   EVVRSFTERVREQAVGATVVKSVKPGQMVVKIVNDELIATLGAEVQSIDLNAVPPVPIM
FT                   MVGLQGSGKTTTTAKLARRMTERDKRKVLMASLDVYRPAAMEQLAVLGRDLSIDTLPIV
FT                   AGQQPPDIARRAMEAGKLGGYDVVLLDTAGRTTLDEEMMTEAAEIKAAANPHEVLLVAD
FT                   SLTGQDAVNLARAFDQRVGLTGIVLTRIDGDGRGGAALSMRAVTGKPIKLMGTGEKTDA
FT                   LEDFHPSRIASRILGMGDIVSLVEKAAATLDAEKAAAVAEKMRKGKFDLTDLRDQLLQM
FT                   TKMGGIGGLMGLMPGISKMKNQIAASGIDDKVLKRQVAIIDSMTREERKNPDILKASRK
FT                   KRIAAGAGIKVEDVNKLLKMHRNMADMMKAVGRGKGGPMAGFAKAMGFGGGLPSPDEIK
FT                   AMQEKMKSGDMPEGLPELPKDLPASLRGGMPNLPGLTGLSGKPTLPGLGGLFGKKK"
FT   gene            428753..429073
FT                   /locus_tag="Rpdx1_0391"
FT   CDS_pept        428753..429073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0391"
FT                   /product="ribosomal protein S16"
FT                   /note="KEGG: bra:BRADO0378 30S ribosomal protein S16;
FT                   TIGRFAM: ribosomal protein S16; PFAM: ribosomal protein
FT                   S16"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42032"
FT                   /db_xref="GOA:E6VJ02"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ02"
FT                   /inference="protein motif:TFAM:TIGR00002"
FT                   /protein_id="ADU42032.1"
FT                   /translation="MSVVIRLARAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMA
FT                   KDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDTAGVRKREARNNPEKAVPRKERKAAD
FT                   GK"
FT   gene            429086..429616
FT                   /locus_tag="Rpdx1_0392"
FT   CDS_pept        429086..429616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0392"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="KEGG: bja:blr0483 16S rRNA-processing protein RimM;
FT                   TIGRFAM: 16S rRNA processing protein RimM; PFAM: RimM
FT                   protein; PRC-barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42033"
FT                   /db_xref="GOA:E6VJ03"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ03"
FT                   /inference="protein motif:TFAM:TIGR02273"
FT                   /protein_id="ADU42033.1"
FT                   /translation="MPSGLICVARIGAPHGVRGAVRLWSFTADPFAVNDYGPLVTKDGA
FT                   RQFEIASAREAKSHLVVTLKGVTTRDEAERLNGVELYVARDKLPPTEADEYYHADLIGL
FT                   AAVTTAGDALGKVVAIHNFGAGDIIEIAPPSGPTLLLPFTNAVVPTVDLAAGQVVIELP
FT                   NEIEGDTPNHPEA"
FT   gene            429755..430501
FT                   /locus_tag="Rpdx1_0393"
FT   CDS_pept        429755..430501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0393"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="TIGRFAM: tRNA (guanine-N1)-methyltransferase; KEGG:
FT                   bja:blr0486 tRNA (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42034"
FT                   /db_xref="GOA:E6VJ04"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ04"
FT                   /inference="protein motif:TFAM:TIGR00088"
FT                   /protein_id="ADU42034.1"
FT                   /translation="MTWRATVLTLFPEMFPGPLGVSLAGRALASGLWALEARDIRDSAT
FT                   DRHRSVDDTPAGGGPGMVLRADVLAAAIDAVDAAADRPRLVMSPRGRPLTQARVAELAA
FT                   GPGPLIVCGRFEGIDQRVIDARGLEEVSIGDYVLSGGEIAAMALIDACVRLLPGVMGKL
FT                   ESSTDESFSAGLLEYPQYTRPQTFEGRPIPEVLLSGDHGKVAAWRLGEAEALTKARRPD
FT                   LWAARPAQTIRAKGESQKTPKNKTDG"
FT   gene            430615..431004
FT                   /locus_tag="Rpdx1_0394"
FT   CDS_pept        430615..431004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0394"
FT                   /product="ribosomal protein L19"
FT                   /note="KEGG: nha:Nham_3582 50S ribosomal protein L19;
FT                   TIGRFAM: ribosomal protein L19; PFAM: ribosomal protein
FT                   L19"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42035"
FT                   /db_xref="GOA:E6VJ05"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ05"
FT                   /inference="protein motif:TFAM:TIGR01024"
FT                   /protein_id="ADU42035.1"
FT                   /translation="MNLIQTLEKEQFDKLSAGKTIPEFGPGDTVIVNVKVVEGERSRVQ
FT                   AYEGVCIGRSGGGINESFTVRKISYGEGVERVFPLLSPMIDSIKVVRRGKVRRAKLYYL
FT                   RNLRGKSARIVEKKQDRTAAVAAAE"
FT   gene            431315..432724
FT                   /locus_tag="Rpdx1_0395"
FT   CDS_pept        431315..432724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0395"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="KEGG: nha:Nham_3584 isopropylmalate isomerase large
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42036"
FT                   /db_xref="GOA:E6VJ06"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ06"
FT                   /inference="protein motif:TFAM:TIGR00170"
FT                   /protein_id="ADU42036.1"
FT                   /translation="MSAKPTTLYDKIWNDHLVHEAEDGTCLLYIDRHLVHEVTSPQAFE
FT                   GLRTAGRKVHAPEKTLAVVDHNVPTTDRSKPNPDPESAEQIAALAENARDFGITYYNEF
FT                   DKRQGVVHVIGPEQGFTLPGTTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLIQ
FT                   KKAKNMRVTVDGQLPDGVTAKDVILAIIGEIGTAGGTGYVLEYAGDAIRSLSMEGRMTV
FT                   CNMSIEGGARAGLIAPDERAYEFLKGRPLAPKGDAWDAALRYWDTLRSDDGAHFDHELK
FT                   LDAAALPPIVTWGTSPEDVISVTGRVPNPADIADEAKRLSKERALAYMGLTPGTKITDI
FT                   KIDRMFIGSCTNGRIEDLRAAAKVAEGKTVNANVNAIIVPGSGLVKEQAEAEGLDKIFI
FT                   KAGFEWREPGCSMCLAMNPDKLAPEERCASTSNRNFEGRQGFKGRTHLVSPAMAAAAAI
FT                   AGHFVDIRDWH"
FT   gene            complement(432883..433170)
FT                   /locus_tag="Rpdx1_0396"
FT   CDS_pept        complement(432883..433170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42037"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ07"
FT                   /inference="similar to AA sequence:KEGG:Nham_3587"
FT                   /protein_id="ADU42037.1"
FT                   /translation="MAAALGAASPADASPSVSDQVPVVTASQPTDVGARQRRHRVEQRR
FT                   HARRSPAPRRTHVYAPRGAYDYNAHPHWYRPDPVSPFFPFSYGWGLGPSW"
FT   gene            complement(433308..433595)
FT                   /locus_tag="Rpdx1_0397"
FT   CDS_pept        complement(433308..433595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0397"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42038"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ08"
FT                   /inference="similar to AA sequence:KEGG:BBta_0355"
FT                   /protein_id="ADU42038.1"
FT                   /translation="MKIWKFAGLAAIAGLLLIAAPGDRAQAAPLATPGIATAVQRGAMP
FT                   EVTEVQYRRHRHYHRHHPRAYRHHHVRRYYAPPRHYRHHRHHYRHHRHWR"
FT   sig_peptide     complement(433518..433595)
FT                   /locus_tag="Rpdx1_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.707 at
FT                   residue 26"
FT   gene            complement(433834..434163)
FT                   /locus_tag="Rpdx1_0398"
FT   CDS_pept        complement(433834..434163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0398"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO0367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42039"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ09"
FT                   /inference="similar to AA sequence:KEGG:BRADO0367"
FT                   /protein_id="ADU42039.1"
FT                   /translation="MYRVEMERVTIAAATLGLALALGLPTVASAQAQQAAPARAERSTD
FT                   FSAQERARPPRRLPIYPRDDSDGVIPRYDPGRNAVRDCSATYVQEYRPSGTVIVPRMNC
FT                   FWRRG"
FT   sig_peptide     complement(434071..434163)
FT                   /locus_tag="Rpdx1_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.533 at
FT                   residue 31"
FT   gene            434270..434671
FT                   /locus_tag="Rpdx1_0399"
FT   CDS_pept        434270..434671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0399"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   bja:blr0494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42040"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ10"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ADU42040.1"
FT                   /translation="MWIAAKAPSLAELEQMAHEMFAKLPAEFRSLCEDVVIRVDDFATE
FT                   EVLDELGAESEFDVLGLFQGIGLPQRSSQDVAPMPNMIWLYRRPILDYWADHDDSLGEI
FT                   VRHVLVHEIGHHFGLSDDDMEAIEANAEG"
FT   gene            434757..435362
FT                   /locus_tag="Rpdx1_0400"
FT   CDS_pept        434757..435362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0400"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="KEGG: bja:blr0495 isopropylmalate isomerase small
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42041"
FT                   /db_xref="GOA:E6VJ11"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ11"
FT                   /inference="protein motif:TFAM:TIGR00171"
FT                   /protein_id="ADU42041.1"
FT                   /translation="MDKFTTLEGVAAPLKIINVDTDMIIPKQYLKTIKRTGLGKGLFSE
FT                   QRYKDDGSENPDFILNKPAYRGAKILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFG
FT                   DIFYNNCFKNGVLPIRVSQADLDKLFDDAERGANATMTIDLPAQEIRGPDGGAIKFEID
FT                   PFRKHCLINGLDDIGLTLEKKPSIDAYETKLKTERAWA"
FT   gene            436094..437785
FT                   /locus_tag="Rpdx1_0401"
FT   CDS_pept        436094..437785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0401"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: mag:amb3991 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42042"
FT                   /db_xref="GOA:E6VJ12"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ12"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADU42042.1"
FT                   /translation="MKIRLSITTMIVTFAVVVLVSITAMLSVNLLALNQLRIGGPLYSQ
FT                   IKLGNDLVADILPPPAYVIEAYLETTLALRRPAEWSAHASKLEQLRRNYLDRHRYWSAS
FT                   GLEPTAKARLTVDSDAEVQKFWTVAEQELIPALRAGDQAAAEAAYAKLEKAYAAHRAII
FT                   DDIVERAHAANAELETEAARQVGSYSTIVWSLSGFAVLLIGLGVAGLAFGMVRPLVRLT
FT                   AAMQAMAAGVRDVVIPGAGRSDEIGGMAKAIAAIKANAEHKAGEEAAEKSRQEHLAAER
FT                   RRADMSRLADGFEDAVGEIIKTVSAAANELEAAAHSLSSTAARSLDLAAGVAESSQEAS
FT                   AGVQSVASASEELTASVHEIGRQVQTSATVANEAADQARRTNERVGELSAAAARIGDVV
FT                   ELISTIAGQTNLLALNATIEAARAGDAGRGFAVVAAEVKALAEQTGKATGEIGQQITGI
FT                   QAATGESVAAIKEICSIIGQMSEISSSIASAVEEQGMATKDIAVNIQHAAHGASQVDAD
FT                   IARVQAGARETGAASVQVLSAAQSLSSESSRLRVEVGNFLASVRAA"
FT   sig_peptide     436094..436192
FT                   /locus_tag="Rpdx1_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.811) with cleavage site probability 0.752 at
FT                   residue 33"
FT   gene            complement(437954..438832)
FT                   /locus_tag="Rpdx1_0402"
FT   CDS_pept        complement(437954..438832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0402"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /note="KEGG: bbt:BBta_0347 putative citrate lyase beta
FT                   chain; PFAM: HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42043"
FT                   /db_xref="GOA:E6VJ13"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ13"
FT                   /inference="protein motif:PRIAM:4.1.3.34"
FT                   /protein_id="ADU42043.1"
FT                   /translation="MIRPRRSLLFMPGSNARALEKARLLPADGLILDLEDAVAPDAKDV
FT                   ARDQIAAAVAAKGYGKREVLVRINALDTAWWQDDVAMAAKAGPDGILVPKVSTIEDIAT
FT                   VGNRLAELGADPSIRVWIMIETARGVLHAEELAAQKHDAKSRLEGFVFGPNDISRETGI
FT                   RMLPGRSTMLPMITRCVLAARVHGLIALDGPYSDIGNVDGLSEECAQARDLGFDGKTLI
FT                   HPGQIDACNAAFTPPAEDVAQARKILAAFERPENQGRGAIQLDGRMVERLHAEIARKTI
FT                   AIADAIETAGH"
FT   gene            439012..439656
FT                   /locus_tag="Rpdx1_0403"
FT   CDS_pept        439012..439656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0403"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: bbt:BBta_0346 putative carbonic anhydrase 2;
FT                   PFAM: carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42044"
FT                   /db_xref="GOA:E6VJ14"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ14"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADU42044.1"
FT                   /translation="MTSFPTSLISGYEAFRSQRLPTEQSRYRELSERGQSPEVMVIGCC
FT                   DSRVSPEVIFDAGPGEIFVVRNVANLVPVYEPDGGAHGVSAALEFAVQVLKVKHIVVLG
FT                   HAQCGGIKAFTDKTPPLTESDFIGRWMQMFTKPGEVVEKRDHETVQDFRTRIEKAAVFR
FT                   SIENLMTFPCIQILVERGRLQLHGAYFGVADGELYVLDQDSKQFVPVVKVV"
FT   gene            complement(439804..440358)
FT                   /locus_tag="Rpdx1_0404"
FT   CDS_pept        complement(439804..440358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bbt:BBta_0345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42045"
FT                   /db_xref="GOA:E6VJ15"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ15"
FT                   /inference="protein motif:PFAM:PF03350"
FT                   /protein_id="ADU42045.1"
FT                   /translation="MTDQPDPPTSSSATKRVERGFETVLFNSRWLMAPFYFGLVISLLV
FT                   LLYKFVVLLGELILHATLAKESDIILGVLSLIDVSLTGNLVLIVVFSGYENFVSRIDPG
FT                   DHPDWPEWMTKVDFAGLKQKLLASIVAISAIQVLKAFMNIDSYDQTKLAWLIGIHLVFV
FT                   ISTLIMALSDRWGHSDDKGGH"
FT   gene            complement(440493..441527)
FT                   /locus_tag="Rpdx1_0405"
FT   CDS_pept        complement(440493..441527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0405"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; KEGG:
FT                   bbt:BBta_0344 aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase dimerisation region;
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42046"
FT                   /db_xref="GOA:E6VJ16"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ16"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ADU42046.1"
FT                   /translation="MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSVGVEV
FT                   SYGDKTLKCKALEHYDFSDVDICLMSAGGEVSKEWSPKIGQQGAVVIDNSSAWRMDPDV
FT                   PLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALKPLHDHAKIKRVVVSTYQSVSGAG
FT                   KDAMDELFSQTKAVYTNDELVNKKFPKRIAFNLIPQIDVFMEDGFTKEEWKMVVETKKI
FT                   LDPKIKLTATCVRVPVFVSHSEAVNIEFENPITADEAREILRKAPGCLVIDKHEPGGYV
FT                   TPYEAAGEDATYISRIREDATVENGLVLWCVSDNLRKGAALNAIQIAEALINRKLITAK
FT                   KQAA"
FT   gene            441643..442452
FT                   /locus_tag="Rpdx1_0406"
FT   CDS_pept        441643..442452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42047"
FT                   /db_xref="GOA:E6VJ17"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ17"
FT                   /inference="similar to AA sequence:KEGG:BBta_0343"
FT                   /protein_id="ADU42047.1"
FT                   /translation="MRSNPALRAAAHPSRIHPALRSFADECRDTVLRMLAYVGALALIG
FT                   LIVFYSANPLTDAAITAAVTAEPEPGWSVAPRSSPAFAVSQLDWPGKSDSTEILRHPDG
FT                   GRKDVVRIAAPGEPVAAEIEVYRIGSEASRLAPEAELAARMDPGGTAALEAAGVIETKF
FT                   GPVPLFGTAGGDRPAGACLGFVKPIETAGLRISGFSCRGDTGPQRRAAVACLLDRLVLL
FT                   SGDAATAAAFAQAELRRERCAPNQLPAASASADWVTSVQDPVLRGRL"
FT   gene            442596..442997
FT                   /locus_tag="Rpdx1_0407"
FT   CDS_pept        442596..442997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42048"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ18"
FT                   /inference="similar to AA sequence:KEGG:Nham_3594"
FT                   /protein_id="ADU42048.1"
FT                   /translation="MRLPMGTPMLVKSTAARLLPVLLAAAAVALIGTSTADAAPKKKRV
FT                   YSTSDQIRYGARGPNVVYQSGPRTRVYVTKRSWLDAGTEVLPGDRKFSDYAFPPGYSFA
FT                   RENGQRPLDRWPLNPASDLGGYPTAFPLY"
FT   sig_peptide     442596..442712
FT                   /locus_tag="Rpdx1_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.779 at
FT                   residue 39"
FT   gene            443096..444466
FT                   /locus_tag="Rpdx1_0408"
FT   CDS_pept        443096..444466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0408"
FT                   /product="transposase IS4 family protein"
FT                   /note="KEGG: rle:RL2002 putative transposase-related
FT                   protein; manually curated; PFAM: transposase IS4 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42049"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:E6VG21"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADU42049.1"
FT                   /translation="MLRKPSPQQTSIEMVSLDGLVPKDHLLRKIDAVIDFSFIHDRVAG
FT                   LYCPDNGRPPLDPTLMFKALFIGYLFGIRSERQLVREIEVNVAYRWFLGLKLTDPVFDA
FT                   STLSQNRRRRYNDTAVAQDIFDAIVTQAIAKGLVDGTVLYTDSTHLKANANKNRYDTAV
FT                   VAKSRADYWDDLDAAIEADRAAHGKKPLPEKERQPVEKETKVSRTDPDAGYMVREGKPK
FT                   GFFYLDHRTVDGRLGIITDTHATPANVHDSIVYLGRLDRQRQRFGFDVAAVGLDAGYAT
FT                   SGIAHGLEQRSIPGVIGYRRPTPPRPGMMPNKAFTYEAELDGYRCPQGQLLGYATTDRT
FT                   GYRHYKSDPAICKTCPMLASCTSNRNAVRLITRHVWTEARERTDANRLTPWGKRIYKRR
FT                   KETVERSFADAKQLHGHRYARFRGLVAVKCQCLLAAAAQNIKKIALALAPGPIPASG"
FT   gene            complement(444668..445780)
FT                   /locus_tag="Rpdx1_0409"
FT   CDS_pept        complement(444668..445780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0409"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; KEGG:
FT                   nha:Nham_3595 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42050"
FT                   /db_xref="GOA:E6VJ20"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ20"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ADU42050.1"
FT                   /translation="MATHKLLLLPGDGIGTEVMAEVSRLIDWLNKAGIASFETEHGLVG
FT                   GAAYDADKVAITDATMALAHASDAVIFGAVGGPKWDGVPYDARPEAGLLRLRKDLGLFA
FT                   NLRPAVCYPALADSSSLKRDVVEGLDIMIVRELTGGVYFGEPKTITDLGGGQKRAIDTQ
FT                   VYDTYEIERIARVAFDLAQKRRNKVTSMEKRNVMKTGVLWNEVVTQVHDREYKTVQLEH
FT                   QLADSGGMNLVKWPKQFDVIVTDNLFGDMLSDIAAMLTGSLGMLPSASLGAVDTKTGKR
FT                   KSMYEPVHGSAPDIAGKGMANPVAMLASFGMALRYSLDMGALADKLDQAIAAVLAKGLR
FT                   TADIKSEGTTVVSTSQMGEAIVAEMQALHG"
FT   gene            445809..446006
FT                   /locus_tag="Rpdx1_0410"
FT   CDS_pept        445809..446006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_7330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42051"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ21"
FT                   /inference="similar to AA sequence:KEGG:BBta_7330"
FT                   /protein_id="ADU42051.1"
FT                   /translation="MPGLDPGIHPSRKKLDCRVEPGNDAVRNSRGRVLDRRCGLGKTVL
FT                   RSGCLPVGRGGCQNGGGRNA"
FT   gene            446003..447196
FT                   /locus_tag="Rpdx1_0411"
FT   CDS_pept        446003..447196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr0503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42052"
FT                   /db_xref="GOA:E6VJ22"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ22"
FT                   /inference="similar to AA sequence:KEGG:blr0503"
FT                   /protein_id="ADU42052.1"
FT                   /translation="MTLLDRTEAAPAHPARLILILSLAPTVGLGIGRFAYSLLLPDMRD
FT                   SLAWSYSAAGFMNTINAAGYLVGALVTSRLVARFGMAAIVRAGTLACVLSLALCAISGN
FT                   FAVLSGARLIAGVGAALAFVAGGALATTIAQAQPARSAFLLSLFYAGPGIGILSSGLIA
FT                   PFLLQAAGPSSWWLGWLVLAALSAAMTLPVLLAPIGVDAGLGGGRAAPFRIAPVLIYLA
FT                   GYFMFGAGYIAYMTFMIAYVRDAGGGAAAQSAFWCLIGISAFVTPWVWRRVMALHRGGL
FT                   STTIILAVNAVGAVLPLFSLSPLMLATSALVFGVSFFAVVASTTAFVRFNYPQAAWPGA
FT                   IAAMTIAFGIGQTLGPLVVGAITDAIDSLSSALAVSAATLALGALLSAFQRPLRCAS"
FT   gene            complement(447351..448130)
FT                   /locus_tag="Rpdx1_0412"
FT   CDS_pept        complement(447351..448130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0412"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   nha:Nham_3598 oxidoreductase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42053"
FT                   /db_xref="GOA:E6VJ23"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJ23"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ADU42053.1"
FT                   /translation="MLRINKLLIPGVDKQLLVRDAARLMPDVSRRRFLAGGASLGALTL
FT                   LTGCDVVDGASAETLLAKVSKFNDAVQAAIFDPNTLAPTFSESDITRPFPFNAYYALDQ
FT                   APTIDGGDWKLEVSGLVQNNKSWTLQELTQLPEVSQITRHVCVEGWSAIGQWSGVRLRD
FT                   FLELIGADTKANYVWFRCADDYTSPIDMPTALHPQTQITFKFGGEVLPRAYGHPMKIRI
FT                   PTKLGFKNPKYVVSMEVTNDYKGGYWEDQGYNSFSGL"
FT   gene            complement(448150..448788)
FT                   /locus_tag="Rpdx1_0413"
FT   CDS_pept        complement(448150..448788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42054"
FT                   /db_xref="GOA:E6VJQ4"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJQ4"
FT                   /inference="similar to AA sequence:KEGG:Nham_3599"
FT                   /protein_id="ADU42054.1"
FT                   /translation="MATTLTDPAPATPALAETGAVLQPLWVRVMHWINAAALLAMIMSG
FT                   WQIYNAAPLFDFQFSRTITLGGWLGGGLLWHFAAMWVLVINGVLYVMLGFATGRFRRRL
FT                   WPITLSGVVSDLSQAVRLRLSHDDLGRYNSVQKLLYVGVLLVGLVSVASGLAIWKPVQF
FT                   QTLTSLLGGYDAARYVHFFAMSAIVAFSAIHIVLAALVPKALRAMIIGR"
FT   gene            complement(449012..449587)
FT                   /locus_tag="Rpdx1_0414"
FT   CDS_pept        complement(449012..449587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0414"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="KEGG: bbt:BBta_0336 Fas1 domain-containing protein;
FT                   PFAM: beta-Ig-H3/fasciclin; SMART: beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42055"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJQ5"
FT                   /inference="protein motif:PFAM:PF02469"
FT                   /protein_id="ADU42055.1"
FT                   /translation="MTKRIALLTAAAFSALALAGTVTAPASAESGKMMKSSGDTVMVGG
FT                   APMYPSKNIVENAAKSKDHTTLVAAVKAAGLVKTLEGKGPFTVFAPTNMAFDKLPAGTV
FT                   DTLVKPENKKQLTKILTYHVVPGKLEAADLTDGKKLKTVEGETLTVKRMGDQVMLIDTK
FT                   GGSSTVTIPNVNQSNGVIHVIDTVLMPS"
FT   sig_peptide     complement(449501..449587)
FT                   /locus_tag="Rpdx1_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.629 at
FT                   residue 29"
FT   gene            449861..451372
FT                   /locus_tag="Rpdx1_0415"
FT   CDS_pept        449861..451372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0415"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bbt:BBta_0226 malonyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42056"
FT                   /db_xref="GOA:E6VJQ6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJQ6"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADU42056.1"
FT                   /translation="MNANLFARLFDSLDDPHMLAIETAAGDKISYADLVARAGRVANVL
FT                   VARGLKVGDRVAAQTEKSVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPKIV
FT                   VCDPSRRDGVAAIAAKVGATVETLGPDGQGSLTDAAAQASEAFATVERGDDDLAAILYT
FT                   SGTTGRSKGAMLSHDNLASNSLTLVEFWRFTPDDVLIHALPIYHTHGLFVASNVTLFAR
FT                   GSMIFLPKFDPDRILDLMARATVLMGVPTFYTRLLQSPRLTKETTSHMRLFISGSAPLL
FT                   ADTHREWSAKTGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGR
FT                   ELPRGEIGMIEVKGPNVFKGYWRMPEKTKSEFRDDGFFITGDLGKIDDRGYVHILGRGK
FT                   DLVITGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRDKGASIDEAQV
FT                   IKGLDGQLAKFKMPKKVLFVDDLPRNTMGKVQKNVLRDTYKDIYK"
FT   gene            complement(451729..452676)
FT                   /locus_tag="Rpdx1_0416"
FT   CDS_pept        complement(451729..452676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0416"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: met:M446_3953 cation diffusion facilitator
FT                   family transporter; TIGRFAM: cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42057"
FT                   /db_xref="GOA:E6VJQ7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJQ7"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADU42057.1"
FT                   /translation="MSHDHHHHHHGPGAVHDVGGHDHVPKDFGRAFAIGIALNVGFVIA
FT                   EAAFGYFSNSMALIADAGHNLSDVAGLVVAWIAAGLSKRPPSARYTYGLRGSSILAALF
FT                   NAIFLLLAVGAIGWEAIVRLFAPEPVAGTTVMIVAGIGIVINAATAWLFASGRHSDLNI
FT                   RGAYLHMAADAAVSAAVVVAGVIILVTGWYWIDPAVSLLVAVVIVWGTWGLLRDSTALS
FT                   LAAVPRGIDPAAVRTFLSKLPGVTQVHDLHIWGMSTTEVALTCHLVMPGGAPGDPFLVD
FT                   LAHELQHDFGIAHTTVQIETDPDTVCALAPDHVV"
FT   gene            453057..453455
FT                   /locus_tag="Rpdx1_0417"
FT   CDS_pept        453057..453455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0417"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="manually curated; TIGRFAM: succinate dehydrogenase,
FT                   cytochrome b556 subunit; KEGG: bja:blr0512 succinate
FT                   dehydrogenase cytochrome b-556 subunit; PFAM: succinate
FT                   dehydrogenase cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42058"
FT                   /db_xref="GOA:E6VJQ8"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJQ8"
FT                   /inference="protein motif:TFAM:TIGR02970"
FT                   /protein_id="ADU42058.1"
FT                   /translation="MTARIERPLSPHMQAYRWSLTMTMSIVHRATGIALYSGTLLLAWW
FT                   LIACAAGPAAYANVQAFTGSWIGRLIVFGYTWALMHHLLSGVRHFVWDLGYGFKTADRE
FT                   WLTWAALIGGIVLTVLLWVIAYSMGVAR"
FT   gene            453452..453865
FT                   /locus_tag="Rpdx1_0418"
FT   CDS_pept        453452..453865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0418"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="KEGG: nha:Nham_3617 succinate dehydrogenase,
FT                   cytochrome b subunit; TIGRFAM: succinate dehydrogenase,
FT                   hydrophobic membrane anchor protein; PFAM: succinate
FT                   dehydrogenase cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42059"
FT                   /db_xref="GOA:E6VJQ9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJQ9"
FT                   /inference="protein motif:TFAM:TIGR02968"
FT                   /protein_id="ADU42059.1"
FT                   /translation="MSGDAHGARKPTSMRTPIGKVRKFGPAGSGTSDFWRQRITGVAMT
FT                   LLILPTIVVIMMLLGRNQAAAAQILGSPLIALVMILFIIASAIHMKIGMQVVIEDYIQN
FT                   EKLKLVTVMANNFFSIAVALAAIFAIFKMASGV"
FT   gene            453869..455692
FT                   /locus_tag="Rpdx1_0419"
FT   CDS_pept        453869..455692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0419"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /note="KEGG: bbt:BBta_0230 succinate dehydrogenase
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase,
FT                   flavoprotein subunit; succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42060"
FT                   /db_xref="GOA:E6VJR0"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJR0"
FT                   /inference="protein motif:TFAM:TIGR01816"
FT                   /protein_id="ADU42060.1"
FT                   /translation="MAVSGNGAAAAGGTAYPIEDHTYDVVVVGAGGAGLRAVVGCSEAG
FT                   LRTACITKVFPTRSHTVAAQGGISASLGNMHKDDWRWHMYDTVKGSDWLGDQDSIEYMV
FT                   RNAPEAVYELEHWGVPFSRTEDGKIYQRPFGGMTMEFGKGQAQRTCAAADRTGHAMLHT
FT                   MYGQALRHSAEFYIEFFAIDLIMDDQGCCRGVVALKLDDGTIHRFKAQTTILATGGYGR
FT                   AYASCTSAHTCTGDGGAMALRAGLPLQDMEFVQFHPTGIYGSGCLVTEGARGEGGYLVN
FT                   SEGERFMERYAPSAKDLASRDVVSRAMTIEMREGRGVGKKKDHIFLHLDHLAPEVLHER
FT                   LPGISESARIFAGVDVTREPIPILPTVHYNMGGIPTNFHGEVVTKKDGDDNAVVPGLMA
FT                   IGEAACVSVHGANRLGSNSLIDLVVFGRAAALRCAEKLVPNGKQPELPADSAEMSLGRL
FT                   DKYRYAKGGTPTAKLRERMQHVMQNNCAVFRTGEVLAEGKELIANVYGSVGDVGVSDRS
FT                   LVWNSDLVETLEFDNLIVQAVVTMNSAANRTESRGAHAREDFPDRDDAAWMKHTLAWIG
FT                   DKGDVTIDYRPVHDYTMTNDVQYIPPKPRVY"
FT   gene            455831..456613
FT                   /locus_tag="Rpdx1_0420"
FT   CDS_pept        455831..456613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0420"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: bja:blr0515 succinate dehydrogenase
FT                   iron-sulfur subunit; TIGRFAM: succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42061"
FT                   /db_xref="GOA:E6VJR1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJR1"
FT                   /inference="protein motif:TFAM:TIGR00384"
FT                   /protein_id="ADU42061.1"
FT                   /translation="MVEFALPKNSKIVGGKTWPKPEGATEVREFRVYRWNPDDGKNPSV
FT                   DTYYVDKHDCGPMVLDGLIWIKNNIDPTLTFRRSCREGVCGSCAMNIDGENTLACTKAM
FT                   DDVRDDAVKVSPLPHQPVVKDLVPDLTNFYAQYASIQPWLQTVTPTPQKEWRQSHSDRE
FT                   KLDGLYECILCACCSTSCPSYWWNSDRFLGPAALLQATRWVEDSRDEATGERLDNLEDP
FT                   FRIYRCHTIMNCAKACPKGLNPSEAIANLKLKLVERQI"
FT   gene            456849..457337
FT                   /locus_tag="Rpdx1_0421"
FT   CDS_pept        456849..457337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0421"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: bbt:BBta_0235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42062"
FT                   /db_xref="GOA:E6VJR2"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJR2"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADU42062.1"
FT                   /translation="MAVTRNEGNAQHAWDLMKKITFAMLATRDGEKIRSRPMAAYVRPE
FT                   EEAIYFLTDVRRHKDEEIANDHHVNLGFANASAQKYVSVTGYAAISDDRAKIKELFGTE
FT                   AKAWWDSPDDPNIRVLKVTPEEAEYWDSPGTLVSYAKMMVAAATGGRPDLGDNAKVAI"
FT   gene            457338..457598
FT                   /locus_tag="Rpdx1_0422"
FT   CDS_pept        457338..457598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJR3"
FT                   /inference="similar to AA sequence:KEGG:BBta_0236"
FT                   /protein_id="ADU42063.1"
FT                   /translation="MSPGEPQEVPNDPGPSTPPPEVPPSTPGTPTEPPLEQPPGNPNPD
FT                   IPPPIEEPGGPPQPNELPGQTPDEVPLRSPPGPGAPNPGVA"
FT   gene            complement(457814..458842)
FT                   /locus_tag="Rpdx1_0423"
FT   CDS_pept        complement(457814..458842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0423"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lma:LmjF35.0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42064"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJR4"
FT                   /inference="similar to AA sequence:KEGG:LmjF35.0290"
FT                   /protein_id="ADU42064.1"
FT                   /translation="MWAQRPRARLAAGPAAVGLSAVGLAAERQPGRRRDRLAAGVADHL
FT                   RGRPVAGHVLPADERPAQRLDPTDLAMSALLAAEPSEPAPAQRAAADWQKRAVAAGHGG
FT                   ALRPAAGSCPAQPHSVASRPAHREADHGAAGPRPEAVWRHPAQPRSAVSHRGAGHDAAE
FT                   LRQRAVSADGLEQRRAAAQPDALPARPRAAPGASEPAGAAGAAGARRAWARAPGRQPAE
FT                   EEAAAQPSAGRAAAGAAEQRGAERQPVEVAAGAERPWAALAQGAGRAAALPSSFPRTGP
FT                   ALGRPAPPARAASARTRFRPPRDDRSATRASAPWSRAVQHSTSSSTDPQWSRRMSRDAV
FT                   ER"
FT   sig_peptide     complement(458765..458842)
FT                   /locus_tag="Rpdx1_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.913 at
FT                   residue 26"
FT   gene            458866..459870
FT                   /locus_tag="Rpdx1_0424"
FT   CDS_pept        458866..459870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0424"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bbt:BBta_0237
FT                   OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42065"
FT                   /db_xref="GOA:E6VJR5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJR5"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ADU42065.1"
FT                   /translation="MTAPIPPAPPPPQALTPLPQGAAPQGPRNISDFRNQRREVQQNGR
FT                   IVITEPGRIIVRDPSGQEFIRHNEVDRFRYGARDIRVDDRGDERRTIVIRPDGSEIINV
FT                   TGRDGQLLRRIRRDRDGREIIIIDNSYGPRDRANFYVDLPPPVIRIPRDRYIVDYDDAS
FT                   PELIYETLEAPPVERIERRYTMDEIRYSPAVRQRMPSIDLNTINFDTGSWDIPPDQAAK
FT                   LQVIADGLNRAIQRNPREVFLIEGHTDAVGNDTDNLSLSDRRAESAAALLTQQFGVPAE
FT                   NLTSQGYGEQYLKVNTQAAERQNRRVTIRRITPLLNGGQASLPPPPPGVAPPR"
FT   gene            complement(459966..460493)
FT                   /locus_tag="Rpdx1_0425"
FT   CDS_pept        complement(459966..460493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0425"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   bja:blr0574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42066"
FT                   /db_xref="GOA:E6VJR6"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJR6"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADU42066.1"
FT                   /translation="MSFGLRSAKWAMAVAALAGAGVLTAPRAEARPDLVVFRGDYSPGT
FT                   IVVRTAERRLYLVVEPGHAVRYPVGVGKAGKQWAGITKIDGKYRNPAWAPPADVKRDVP
FT                   AIPDVIPGGSPANPMGVAAMTLEGGEYAIHGTNRPQSIGGFVSYGCIRMLNDDITDLYE
FT                   RVPVGTQVVVMR"
FT   sig_peptide     complement(460401..460493)
FT                   /locus_tag="Rpdx1_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.813 at
FT                   residue 31"
FT   gene            complement(460889..462841)
FT                   /locus_tag="Rpdx1_0426"
FT   CDS_pept        complement(460889..462841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0426"
FT                   /product="acetate/CoA ligase"
FT                   /note="KEGG: bra:BRADO0344 acetyl-CoA synthetase; TIGRFAM:
FT                   acetate/CoA ligase; PFAM: AMP-dependent synthetase and
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42067"
FT                   /db_xref="GOA:E6VJR7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJR7"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ADU42067.1"
FT                   /translation="MSDKIYDVPAEWASRAFVDDAKYRQMYDRSVTDPTGFWAEHAKRV
FT                   DWINAPTKIDNWSYAPGNVSIKWFEDGVLNAAYNCIDRHLDKRGDQVAIIWEGDDPSQS
FT                   RSITYRELHDEVCKFANILRNRNVGKGDRVTIYLPMIPEAAFAMLACARIGAIHSVVFA
FT                   GFSPDSLAGRINDCQSKIVITADEGLRGGRKVPLKANVDAALKKCDGVDWVMVVKRTGA
FT                   AIEMDDVRDFWYHEAAEMVTTECPVEHMNAEDPLFILYTSGSTGQPKGVLHTTGGYLVF
FT                   ASMTHQYVFDYHDGDIYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPTNSRFW
FT                   EVIDKHKVNIFYTAPTAIRALMQAGDEPVKKTSRKSLRLLGSVGEPINPEAWEWYHRVV
FT                   GEDRCPIVDTWWQTETGGILITPLPGATKLKPGSATRPFFGVVPEILDPEGNVLDGECT
FT                   GNLCLARSWPGQMRTVYGDHARFEQTYFSAYKGKYFTGDGCRRDADGFYWITGRVDDVI
FT                   NVSGHRMGTAEVESSLVAHPKVSEAAVVGYPHDIKGQGIYAYVTLMAGEEPTEELRKEL
FT                   VAWVRKDIGPIASPDLIQFAPGLPKTRSGKIMRRILRKIAEDEPSSLGDTSTLADPAVV
FT                   DDLVEHRQNKHHKAG"
FT   gene            complement(463195..464097)
FT                   /locus_tag="Rpdx1_0427"
FT   CDS_pept        complement(463195..464097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0427"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: bra:BRADO0385
FT                   putative RNA pseudouridine synthase (uracil hydrolyase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42068"
FT                   /db_xref="GOA:E6VJR8"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJR8"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ADU42068.1"
FT                   /translation="MNESHPDQFDVPELTADEIQARVLYRDGLMLVIDKPPGLPVHRGP
FT                   KGGPNLEASFDALRYGLPRPPVLAHRLDRDTSGCLVLGRHRKATATLGLLFKHSRISKT
FT                   YWAIVEGGPAEDEGSIDLPIGKLNAERGWWQKIDQESGLPSLTKWRVMGRSSPPVCGDG
FT                   SGVGAHSGTPSLGRPHPGPLPQAGEGALSAGAKGDDLSRKPGAKSGAPPPAQLTWLALE
FT                   PITGRTHQLRVHCAAMGWPIFGDNIYGNGPRFGEPRLHLHAREIVIPLSRNKPPVVVIA
FT                   PPPAHMHPRLSACGWTGAA"
FT   gene            464126..465073
FT                   /locus_tag="Rpdx1_0428"
FT   CDS_pept        464126..465073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0428"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="TIGRFAM: signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; KEGG: nha:Nham_0402 signal recognition
FT                   particle-docking protein FtsY; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42069"
FT                   /db_xref="GOA:E6VJR9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJR9"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ADU42069.1"
FT                   /translation="MSDTPENSKQSWWRRLSSGLKRTSSSIGTALSEFVSKRKLDRAML
FT                   EEIEDVLLRADLGAEVASRIASAVGEGRYDKMISASDVKEIVAAEVEKVLAPVAQPLVV
FT                   DAGKKPFVVLMVGVNGSGKTTTIGKLSARFASEGHKVMLAAGDTFRAAAIDQLKVWGER
FT                   TGTPVVAGAQGSDAAGLAFNALTAAKEQGRDVLLIDTAGRLQNRTELMSELEKVVRVIK
FT                   KVDATAPHAVLLVLDATVGQNALSQVEAFTKTAGVTGLVMTKLDGTARGGILVAIAEKH
FT                   KLPVHFIGVGEGVDDLSPFTARDFAKAIAGTEAA"
FT   gene            465070..465687
FT                   /locus_tag="Rpdx1_0429"
FT   CDS_pept        465070..465687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0429"
FT                   /product="intracellular septation protein A"
FT                   /note="KEGG: nwi:Nwi_0317 intracellular septation protein
FT                   A; TIGRFAM: intracellular septation protein A; PFAM:
FT                   Intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42070"
FT                   /db_xref="GOA:E6VJS0"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJS0"
FT                   /inference="protein motif:TFAM:TIGR00997"
FT                   /protein_id="ADU42070.1"
FT                   /translation="MSDELLEKNRPHPLFKLATELGPLLVFFVVNAKFNLFAATGAFMV
FT                   AVVAAMIASYAVTRHVPVMALVTAVVVLVFGTLTLVLHDETFIKMKPTIVYALFAAVLG
FT                   GGLLFGRSFIAIMFDQVFNLTAQGWRKLTLRWALFFFAMALLNEAVWRTQSTDFWVNFK
FT                   VFGMVPLTMLFAMTQMPLIKRYAAEPATLEQSAAGEGDVSGR"
FT   gene            complement(465719..466102)
FT                   /locus_tag="Rpdx1_0430"
FT   CDS_pept        complement(465719..466102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mch:Mchl_2719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42071"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJS1"
FT                   /inference="similar to AA sequence:KEGG:Mchl_2719"
FT                   /protein_id="ADU42071.1"
FT                   /translation="MSISTLRRLTLAPLAAAVALGLFAAAPAMAQAPQPATPPTAKSDK
FT                   MAPPPKADSKAAAPAKSEKTEPLDINSATAEQLDALPGVGKAYSAAIIKGRPYKGKDEL
FT                   VHKKIVPQKTYDGIKDKIIAKQK"
FT   sig_peptide     complement(466010..466102)
FT                   /locus_tag="Rpdx1_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            complement(466243..466839)
FT                   /locus_tag="Rpdx1_0431"
FT   CDS_pept        complement(466243..466839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0431"
FT                   /product="periplasmic protein thiol/disulfide
FT                   oxidoreductase DsbE"
FT                   /note="KEGG: nwi:Nwi_0318 periplasmic protein
FT                   thiol-disulfide oxidoreductase DsbE; TIGRFAM: periplasmic
FT                   protein thiol/disulphide oxidoreductase DsbE; PFAM: Redoxin
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42072"
FT                   /db_xref="GOA:E6VJS2"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJS2"
FT                   /inference="protein motif:TFAM:TIGR00385"
FT                   /protein_id="ADU42072.1"
FT                   /translation="MTDTLDPASSKRRSWLVVLPALLFAGLAVLFWFRLGDSDVSRIPS
FT                   ALIGRPAPQTPLPPLEGLSRDGTQVAGLDPAMFKGRVSVVNVWASWCVPCHDEAPLLMT
FT                   LAEDSRIQLVGIDYKDKPDNARRFLGRYGNPFAAVGVDVSGRAAIEWGVYGVPETFVVG
FT                   RDGRIAYKLVGPITPDNLEKVLKPEIAKALAAPQS"
FT   gene            complement(466855..467028)
FT                   /locus_tag="Rpdx1_0432"
FT   CDS_pept        complement(466855..467028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0432"
FT                   /product="heme exporter protein CcmD"
FT                   /note="KEGG: nha:Nham_0412 heme exporter protein D (CcmD);
FT                   TIGRFAM: heme exporter protein CcmD; PFAM: Heme exporter
FT                   protein D (CcmD)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42073"
FT                   /db_xref="GOA:E6VJS3"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJS3"
FT                   /inference="protein motif:TFAM:TIGR03141"
FT                   /protein_id="ADU42073.1"
FT                   /translation="MFGKYADFIVSSYAATAIVVLLLIGWVVLDYRKQKARLRDLEARG
FT                   AVRRSGRSATDH"
FT   gene            complement(467028..467762)
FT                   /locus_tag="Rpdx1_0433"
FT   CDS_pept        complement(467028..467762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0433"
FT                   /product="heme exporter protein CcmC"
FT                   /note="KEGG: nwi:Nwi_0320 cytochrome c-type biogenesis
FT                   protein CcmC; TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42074"
FT                   /db_xref="GOA:E6VJS4"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJS4"
FT                   /inference="protein motif:TFAM:TIGR01191"
FT                   /protein_id="ADU42074.1"
FT                   /translation="MKLTELANPTRFLTLAGRLLPWLAAATALALAAGLTQAMLAPDDY
FT                   QQGATVKIMFVHVPNAWLAMAVWGVMSIAALGTLVWRHPLADVAAKTAAPIGAAFTFLA
FT                   LVTGSLWGRPMWGTYWEWDARLTSMLVLFLMYLGLIALWRAVEDPSRAARAAAVLTLVG
FT                   AINLPIIKFSVDWWNTLHQPASVVRMGGSTLDKAFLIPLLVTAIGFSLLFLTLHLAAMR
FT                   NEILRRRVRSLQMLQASRAEAA"
FT   sig_peptide     complement(467664..467762)
FT                   /locus_tag="Rpdx1_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.444 at
FT                   residue 33"
FT   gene            complement(467933..468601)
FT                   /locus_tag="Rpdx1_0434"
FT   CDS_pept        complement(467933..468601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0434"
FT                   /product="heme exporter protein CcmB"
FT                   /note="KEGG: bja:blr0468 heme exporter protein B; TIGRFAM:
FT                   heme exporter protein CcmB; PFAM: cytochrome c-type
FT                   biogenesis protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42075"
FT                   /db_xref="GOA:E6VJS5"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJS5"
FT                   /inference="protein motif:TFAM:TIGR01190"
FT                   /protein_id="ADU42075.1"
FT                   /translation="MTALGAIIRRDIRIALRVGGGALIGVLFFLTVVVLMPFAVGPDLA
FT                   LLKRLGPAILWLGALLASLLTLDRLFTADSEDGSLDLIVMSRTPLELTCAAKALAHWLA
FT                   AGLPLIVATPVLGLLLNLDGSASLAVMATLLAGTPALTFTGMIGAALAVTLRRGGLLLA
FT                   VLVLPLSIPVLIFGVSASQAAIVGPVSFGTPFSILCAISLLSLVIGPFAAAASLRQGLD
FT                   "
FT   gene            complement(468598..469200)
FT                   /locus_tag="Rpdx1_0435"
FT   CDS_pept        complement(468598..469200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0435"
FT                   /product="heme exporter protein CcmA"
FT                   /note="TIGRFAM: heme exporter protein CcmA; PFAM: ABC
FT                   transporter related; KEGG: bja:blr0467 cytochrome c
FT                   biogenesis protein CcmA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42076"
FT                   /db_xref="GOA:E6VJS6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJS6"
FT                   /inference="protein motif:TFAM:TIGR01189"
FT                   /protein_id="ADU42076.1"
FT                   /translation="MRLSGRDLRCVRGGREVFAGLAFDASGGEALALVGHNGAGKTSLL
FT                   RLIAGLLTPEAGTITLDGGEPDTPVAELAHYLGHRDALKPSLSVAENLGFWRDFLGGDR
FT                   TDLSAAIKAVGLGHAAELPAAYLSAGQRRRLSIARLLVVRRPIWLLDEPTSALDVKGQE
FT                   LFVGLMQDHLAGGGIIVAATHTPLGIPVREQRIGASA"
FT   gene            469416..472133
FT                   /locus_tag="Rpdx1_0436"
FT   CDS_pept        469416..472133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0436"
FT                   /product="aconitate hydratase 1"
FT                   /note="KEGG: bbt:BBta_0382 aconitate hydratase; TIGRFAM:
FT                   aconitate hydratase 1; PFAM: aconitate hydratase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42077"
FT                   /db_xref="GOA:E6VJS7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJS7"
FT                   /inference="protein motif:TFAM:TIGR01341"
FT                   /protein_id="ADU42077.1"
FT                   /translation="MTSLDSFKCRKILKVGSKSYVYYSLPTAEKNGLKGISRLPYSMKV
FT                   LLENLLRNEDDRTVKKADIMAVAKWMRKKALEHEIAFRPARVLMQDFTGVPAVVDLAAM
FT                   RNAMQKLGGSAEKINPLVPVDLVIDHSVIVNFFGNNQAFKKNVAEEYKQNQERYEFLKW
FT                   GQKAFSNFSVVPPGTGICHQVNLEYLAQTVWTKKEKMTIGRKTGTFEVAYPDTLVGTDS
FT                   HTTMVNGLAVLGWGVGGIEAEAAMLGQPLSMLLPEVVGFKLKGALKEGVTATDLVLTVT
FT                   QMLRKQGVVGKFVEFFGPGLDHLSVADKSTIANMAPEYGATCGFFPVDSETLDYLKTSG
FT                   RASARVALVEKYAKAQGLFRTAKSPDPVFTVTLTLDLADVVPSLAGPKRPEGRVALPAV
FT                   AEGFTTAMDAEYKKALDGARYKVEGRNFDLGHGDVVIAAITSCTNTSNPSVLIGAGLLA
FT                   RNAAAKGLKAAPWVKTSLAPGSQVVAEYLANSGLQKDLDKVGFNLVGFGCTTCIGNSGP
FT                   LPEEISKSINDNGIVAAAVLSGNRNFEGRVSPDVQANYLASPPLVVAYALAGSVTKNLA
FT                   VDPIGTGRDGKPVYLKDIWPTTKEINAFVKKYVTSKVFKARYADVFKGDTNWRKIKTVE
FT                   SETYKWNMGSTYVQNPPYFEGMTKQPEPITDMVDARILALFGDKITTDHISPAGSIKLT
FT                   SPAGKYLTEHQVRPADFNQYGTRRGNHEVMMRGTFANIRIKNHMLKGADGNIPEGGLTK
FT                   HWPDGEQMSIYDAAMKYQEEKVPLVVFAGAEYGNGSSRDWAAKGTRLLGVRAVICQSFE
FT                   RIHRSNLVGMGVLPLTFEEGTSWASLGLKGNEKVTIRGLEGDLKPRQMLEAEITSAEGK
FT                   RKRVPLLCRIDTLDELDYYRNGGILHYVLRKLAA"
FT   gene            472314..473069
FT                   /locus_tag="Rpdx1_0437"
FT   CDS_pept        472314..473069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0437"
FT                   /product="protein of unknown function DUF1223"
FT                   /note="PFAM: protein of unknown function DUF1223; KEGG:
FT                   bja:bll0465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42078"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJS8"
FT                   /inference="protein motif:PFAM:PF06764"
FT                   /protein_id="ADU42078.1"
FT                   /translation="MDGVGGFSRWSGALGLCVTIATANLAAAEPRAVVELFTSQGCSSC
FT                   PPADKIIGELARDPSVIALSLPIDYWDYLGWKDTLADPRFSARQRAYSQVRGDRDVFTP
FT                   QVVVNGSAHLVGSNRAGIDAAIRTTDKVAGVMAVPVSLAVEGNEIKVSVAAAPRGETAK
FT                   SGEVWICAVSKAVPIEIGRGENRGRQITYHNVVRNLLKVGDWSGAAEHWAVPLENVVGD
FT                   GVDAAAVYIQNGTREKPGAMLGAAFTSLN"
FT   gene            473490..473858
FT                   /locus_tag="Rpdx1_0438"
FT   CDS_pept        473490..473858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42079"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJS9"
FT                   /inference="similar to AA sequence:KEGG:Nham_0406"
FT                   /protein_id="ADU42079.1"
FT                   /translation="MDLISGEADPSESRAAERSGAAPLQGRVTFNRLELNRILNLYGRM
FT                   VAAGEWRDYAIDFLKDHAVFSIFRRASEVPIYRIVKDPRLARKQGAYCVIGASGQILRR
FT                   GHELDRVLLVIDRKLALV"
FT   gene            complement(473969..474499)
FT                   /locus_tag="Rpdx1_0439"
FT   CDS_pept        complement(473969..474499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0439"
FT                   /product="Phosphinothricin acetyltransferase"
FT                   /note="KEGG: bja:blr0463 acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42080"
FT                   /db_xref="GOA:E6VJT0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJT0"
FT                   /inference="protein motif:PRIAM:2.3.1.183"
FT                   /protein_id="ADU42080.1"
FT                   /translation="MSNVLIRPATSADLPAVTAIYEQAVRFGTATFELTPPDLAEMTRR
FT                   FEALTGAGFPYLVASADGAIAGYAYAGPYRPRPAYRFTVENSIYLDPAAHRRGIGSALL
FT                   DDLVAICTSRGFRQMIAVIGDSANAASIALHRKAGFVPIGTHTDVGFKFGRWLDSVLMQ
FT                   RTLGDGGRTVPEA"
FT   gene            complement(474656..475447)
FT                   /locus_tag="Rpdx1_0440"
FT   CDS_pept        complement(474656..475447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0440"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   oca:OCAR_4575 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42081"
FT                   /db_xref="GOA:E6VJT1"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJT1"
FT                   /inference="protein motif:PFAM:PF01027"
FT                   /protein_id="ADU42081.1"
FT                   /translation="MSDLDRNYASPFGRAAGRVETATVDAGLRAYMLRIYNYMTIGLAI
FT                   TGLAALGVYMGAVTTDAGAAAARVGNTMLTSFGVAMFVSPLKWVFILAPLAMVFVISFG
FT                   INRLKPATAQLLFWAFSALMGISLSSIFLVYTHTSIVRVFFITAAAFGALSLYGYTTKR
FT                   DMTGMGSFLIMGLIGVVIASLVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYI
FT                   YGAGSMGGEVAERAAITGALSLYLNFINLFTLLLQLLGQKE"
FT   gene            complement(475795..478368)
FT                   /locus_tag="Rpdx1_0441"
FT   CDS_pept        complement(475795..478368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0441"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bja:blr0461 ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42082"
FT                   /db_xref="GOA:E6VJT2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJT2"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU42082.1"
FT                   /translation="MTTLATGRPARARSRMLPLRYALREMRGGLNGFYVFIACIALGVM
FT                   AIAGVGSVAASLGDGLAREGRTLLGGDAAFALIQREAAPNEVEFLRSRGEVSVAATMRG
FT                   MARTDDGRSALVELKAVDSAYPLLGELKLEPPLPLADVLARRGDTYGAAADAALLARLD
FT                   LKIGDTIQVGSVNLQIHSAVAAEPDKLSGNIGFGPRLLISEDGLRATQLLQPGSLVRWT
FT                   YRVRLPDNGTDDRAAQRLADDTRAALPQAGWEIRTRSNASPQLERSITRFTQFLTLVGL
FT                   AALVVGGVGVANAVKSHIDRRRDVIATLKAVGGTGGDVFAIYLTQVIVLAAIGAVIGLA
FT                   LGAAIPFAIVGLFGQMLPLPVVAALHPGELALSLMYGLLTALAFGLWPLAQVRDVPVAT
FT                   LFREASTAAGHWPRWTHMAWMGVVIAALLALVIGLAYDKRVAVAVVGATLAVFVLLRGV
FT                   AAALMAIARRLPRSRITMLRLAVANIHRPGALTPSVVLSLGLGLAVLVTVSQIDGNLRR
FT                   QFSAALPEKAPTFFFIDIPSGETEAFSAFLRQIAPSAALEDVPMLRGRIVAARGVRAEE
FT                   LKPAADAEWVLQSDRGLTYATEIPAGSKVVEGRWWPKDYGGPPLVSFDRKLAEGLGLTI
FT                   GDKVTVNVLGRDITATISNLRSIDWQSLGINFVLVFSPDTFRGAPHTHVATLTETGSTP
FT                   QSDAALIKQVADKFPMVTSVRVREALETVGGVVSNLALAVRGASAVTLISAILVLGGAL
FT                   AAGHRHRVYDAVILKTLGATRARLIGAFALEYALIGLATAGFAVIAGSAAAWLIVTRLM
FT                   TLSFVWQAGSAAGVVAAALVVTVGLGLIGTLLALNQKPASVLRNL"
FT   gene            complement(478372..479115)
FT                   /locus_tag="Rpdx1_0442"
FT   CDS_pept        complement(478372..479115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0442"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bja:blr0460 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42083"
FT                   /db_xref="GOA:E6VJT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJT3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU42083.1"
FT                   /translation="MDSLIEPSSSAGGAPDTIAISNVNLSLGSGAARVHILKDISLSVA
FT                   GGEAIGLIGPSGSGKSTLLMVMAGLERPDSGEVVVDGTAFNGLDEDALARFRGRQIGIV
FT                   FQSFHLIPTMTALENVAVPLELAGQTDAADRAARELASVGLGERLHHYPAQLSGGEQQR
FT                   VALARALAPDPAILVADEPTGNLDEATGKQIVDLLFAKHVERGMTLVLVTHDAALAQRC
FT                   DRVVRLRSGRIDTMQPGAAARARSA"
FT   gene            479195..479812
FT                   /locus_tag="Rpdx1_0443"
FT   CDS_pept        479195..479812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0443"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   bra:BRADO0400 multifunctional: acyl-CoA thioesterase I;
FT                   protease I; lysophospholipasel(I)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42084"
FT                   /db_xref="GOA:E6VJT4"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJT4"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADU42084.1"
FT                   /translation="MAALIPGQGAQAEATIKPLKVVVLGDSLTAGYGLPAADAFPAKLQ
FT                   KALKAKGIETEMVNAGVSGDTASGGLARLDWSVPPDADAVIVELGANDALRGTDPKVPR
FT                   KALDEILKRLQQRKMPVLLAGMLAPPNYGKDYAAQFNAIYPELAATYDVPLYPFFLDGV
FT                   AAVSNLNQPDGIHPTAAGVDVIVERILPMVEALLRPLLGQRS"
FT   gene            480019..480558
FT                   /locus_tag="Rpdx1_0444"
FT   CDS_pept        480019..480558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0444"
FT                   /product="2'-5' RNA ligase"
FT                   /note="KEGG: bra:BRADO0401 putative 2'-5' RNA ligase;
FT                   TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase HXTX"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42085"
FT                   /db_xref="GOA:E6VJT5"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJT5"
FT                   /inference="protein motif:TFAM:TIGR02258"
FT                   /protein_id="ADU42085.1"
FT                   /translation="MPRLFTGLEIPAEISQTLSSLRGGLPGARWVDPDDYHLTLRFIGD
FT                   IDGVTANEIASTLFRVNRKPFEVTLQGLSSFGGKKPRAVVASVVPSKPLIELQAELERL
FT                   MQRVGLDPEGRKFTPHVTLARLRGDVSSRDVADYLSIRGYFPSKVFRAERFVLYSARAS
FT                   TGGGPYIVEAPYELTP"
FT   gene            480645..481829
FT                   /locus_tag="Rpdx1_0445"
FT   CDS_pept        480645..481829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0445"
FT                   /product="AFG1-family ATPase"
FT                   /note="PFAM: AFG1-family ATPase; KEGG: bra:BRADO0402 AFG1
FT                   family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42086"
FT                   /db_xref="GOA:E6VJT6"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJT6"
FT                   /inference="protein motif:PFAM:PF03969"
FT                   /protein_id="ADU42086.1"
FT                   /translation="MSSPLSLRQQYQSLIASGSIEADPAQARAVQAFTLLNETLEGYKP
FT                   PKKQGFFGRLFGGGDAVQQPPQGLYIHGEVGRGKTMLMDLFFDASPIALKRRSHFHEFM
FT                   AETHDRINGFRQAIKRGDIPDSDVMELTAASILDDAWLLCFDEFHVTDIADAMILGRLF
FT                   TRLFELGTVVVATSNVAPDDLYKGGLNRSLFMPFIGQVKRHMRVLRLDARTDYRLEKFA
FT                   GMKVWLTPDDAEATATIDRAWQRITGTSRGEPRDISIKGRILHIPQADHHVARFSFADL
FT                   CQKPLGAGDYLRLAHEYHTLMIDHVPVMEYADRNAAKRFIALIDTLYDNSVKLMASAAA
FT                   EPARLYRATDGFEAMEFNRTVSRLTEMGSESYLALPHGRRDSTATGETTGLVET"
FT   gene            481974..482942
FT                   /locus_tag="Rpdx1_0446"
FT   CDS_pept        481974..482942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0446"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /note="KEGG: bbt:BBta_0392 malate dehydrogenase; TIGRFAM:
FT                   malate dehydrogenase, NAD-dependent; PFAM: Lactate/malate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42087"
FT                   /db_xref="GOA:E6VJT7"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJT7"
FT                   /inference="protein motif:TFAM:TIGR01763"
FT                   /protein_id="ADU42087.1"
FT                   /translation="MARDKIALIGSGQIGGTLAHMIGLKQLGDVVLFDIAEGVPQGKAL
FT                   DIAESSPVDGFDSKLTGANSYEAIEGARVVIVTAGVPRKPGMSRDDLLSINLKVMEQVG
FT                   AGIKKYAPDAFVICITNPLDAMVWALQKASGLPAKKVVGMAGVLDSARFRYFLADEFNV
FT                   SVEDVTAFVLGGHGDTMVPLVKYSTVAGIPLPDLIKMGWTSQARLDEIVDRTRNGGAEI
FT                   VNLLKTGSAFYAPAASAIAMAESYLKDKKRVVPVAAHLNGEYGVKDMYVGVPVVIGDKG
FT                   VERIVEIELAGKDKEAFDKSVAAVQGLVDACKKIAPDLLGR"
FT   gene            483038..484234
FT                   /locus_tag="Rpdx1_0447"
FT   CDS_pept        483038..484234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0447"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   KEGG: oca:OCAR_6554 succinyl-CoA synthetase beta chain
FT                   (SCS-alpha); PFAM: ATP-grasp domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42088"
FT                   /db_xref="GOA:E6VJT8"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJT8"
FT                   /inference="protein motif:TFAM:TIGR01016"
FT                   /protein_id="ADU42088.1"
FT                   /translation="MNIHEYQAKAVLREFGVAVGHGFPIFKASEAEAAAKQLGGPVWVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVKDYAKQMLGATLVTVQTGADGKQVN
FT                   RLYIEEGSDIDKEFYLSLLVDRATSRISFVVSTEGGMSIEDVAHETPEKIVSFTVDPAT
FT                   GIMGHHGRTVAKALNLKGDQAKQAEAMVAKLYAAFVAKDMDMLEINPLVLTKQGDLKCL
FT                   DAKISFDGNALYRHIDIQALRDETEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMA
FT                   TMDIIKLYGMAPANFLDVGGGASKEKVTAAFKIITADPNVKGILINIFGGIMKCDVIAE
FT                   GVVAAVKEVGLDVPLVVRLEGTNVEAGKKIIKHSGLNVLPADNLDDAAQKIVAAVKGA"
FT   gene            484299..485183
FT                   /locus_tag="Rpdx1_0448"
FT   CDS_pept        484299..485183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0448"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="KEGG: bbt:BBta_0394 succinyl-CoA synthetase
FT                   (ADP-forming) alpha subunit; TIGRFAM: succinyl-CoA
FT                   synthetase, alpha subunit; PFAM: ATP-citrate
FT                   lyase/succinyl-CoA ligase; CoA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42089"
FT                   /db_xref="GOA:E6VJT9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJT9"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ADU42089.1"
FT                   /translation="MSILIDSNTRVICQGFTGKNGTFHSEAAIAYGTKMVGGTSPGKGG
FT                   STHLGLPVFDTVREAREKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLD
FT                   MVRVKRSLNGSKSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVF
FT                   QTSAEGLGQTTAVGIGGDPVKGTEFIDVLEMFLADDKTESIIMIGEIGGSAEEDAAQFL
FT                   IDEAKRGRKKPTVGFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGITVSPSP
FT                   ARLGKTLAEKLKS"
FT   gene            485311..488268
FT                   /locus_tag="Rpdx1_0449"
FT   CDS_pept        485311..488268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0449"
FT                   /product="2-oxoglutarate dehydrogenase, E1 subunit"
FT                   /note="KEGG: bbt:BBta_0395 2-oxoglutarate dehydrogenase E1
FT                   component; TIGRFAM: 2-oxoglutarate dehydrogenase, E1
FT                   subunit; PFAM: Transketolase central region; dehydrogenase
FT                   E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42090"
FT                   /db_xref="GOA:E6VJU0"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJU0"
FT                   /inference="protein motif:TFAM:TIGR00239"
FT                   /protein_id="ADU42090.1"
FT                   /translation="MSRQDANAAFALSSFLQGANATYIDDLYSRYEADPSSVDADWQAF
FT                   FQSLKDTPGDIQKNAEGPSWEQANWPLTPQDELTSALDGNWNQVEKAVGQKLQAKAQSR
FT                   GVALSSADVHQATRDSVRALMLIRAYRMRGHFHAKLDPLGLSPAKDHEELDIRSYGFTE
FT                   ADLDRKIFLDHVLGLEYGSLREIVAICERTYCQTMGIEFLHISNGAQKAWIQERIEGPD
FT                   KEISFTREGRRAILMKLIETEGFEKFCDLKFTGTKRFGLDGGEALIPALEQIIKRGGNL
FT                   GVREIVLGMPHRGRLNVLTQVMAKAHRALFHEFKGGSANPDEVEGSGDVKYHLGASSDR
FT                   EFDHNKVHLSLTANPSHLEIVDPVVLGKVRAKQDQHGDLPEERVSVLPLLMHGDAAFAG
FT                   QGVVAECFALSDLKGYRTGGSIHFIVNNQIGFTTYPRYSRSSPYPSDVAKMIDAPIFHV
FT                   NGDDPEAVVFAAKIAVEYRQKFHKPVVIDMFCYRRHGHNEGDEPSFTQPLMYRKIAGHP
FT                   TTLEIYSKRLIADGVITEGEVEKARADWRARLDAEFEAASSYRPNKADWLDGKWAGFKS
FT                   ADQEEEPRRGITGVDLPSLKEIGRRITKVPEGFRLHRTVQRFLENRAKAIDSGNGIDWA
FT                   TGEALAFCTMLLEGHRIRLSGQDSERGTFSQRHSVLIDQEDETRYTPFNHLSPDQGHYE
FT                   VINSLLSEEAVLGFEYGYSLAEPNALTLWEAQFGDFANGAQVLFDQFISSGERKWLRMS
FT                   GLVCLLPHGYEGQGPEHSSARLERYLQMCAEDNMQVVYPTTPANYFHALRRQLKREIRK
FT                   PLILMTPKSLLRHKRAVSRLDELGPDTSFHRVLLDDAQTLPEEKIKLVPDAKIRRVVVC
FT                   SGKVYYDLYEEREKRGIDDVYLLRIEQLYPVPLKTLVHELSRFKDAELVWCQEEPRNMG
FT                   GWHFIEPYLEWVQNQIEAKHRRPRYVGRAASAATATGLMSKHLAQLKAFLDDALR"
FT   gene            488368..489609
FT                   /locus_tag="Rpdx1_0450"
FT   CDS_pept        488368..489609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0450"
FT                   /product="2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase"
FT                   /note="KEGG: bra:BRADO0407 dihydrolipoamide
FT                   succinyltransferase; TIGRFAM: 2-oxoglutarate dehydrogenase,
FT                   E2 subunit, dihydrolipoamide succinyltransferase; PFAM:
FT                   catalytic domain of components of various dehydrogenase
FT                   complexes; biotin/lipoyl attachment domain-containing
FT                   protein; E3 binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42091"
FT                   /db_xref="GOA:E6VJU1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJU1"
FT                   /inference="protein motif:TFAM:TIGR01347"
FT                   /protein_id="ADU42091.1"
FT                   /translation="MTEIRVPTLGESVTEATIGRWFKQPGEAVAVDEPLVELETDKVTI
FT                   EVPAPSAGTLGEIVAKDGETVAVGALLGQITDGAAPAKPAAAAPAKAAPAPAAQAPAPA
FT                   APAAKTPPSDAPLAPSVRRLSTESGVDASTVPGSGKDGRVTKGDMLAAIEKAASAPTPV
FT                   NQPAAAVQVRAPSPADDAAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTNVM
FT                   ALRAQYKDVFEKKHGAKLGFMGFFTKACVQALKDIPAVNAEIDGTDLIYKNYYHVGVAV
FT                   GTDKGLVVPVVRDCDTKSIAEIETSISDFGRRARDGQLKIEEMQGGTFTITNGGIYGSL
FT                   MSTPILNAPQSGILGMHKIQERPVVVGGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRV
FT                   KESLEDPARLVLDL"
FT   gene            489675..490067
FT                   /locus_tag="Rpdx1_0451"
FT   CDS_pept        489675..490067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmr:BMI_I1943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42092"
FT                   /db_xref="GOA:E6VJU2"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJU2"
FT                   /inference="similar to AA sequence:KEGG:BMI_I1943"
FT                   /protein_id="ADU42092.1"
FT                   /translation="MPVEITVLGWGVALLIVQMLLASIPTTMELGGDYQAGPRDEPRAP
FT                   KGRFAGRAGRAYRNLLETFPAYVAIALALAVTGKTGGYAATAAIVWLVARVLYVPLYIV
FT                   HIPFARSIAWLVALLALVAMLVRLLS"
FT   gene            490075..490821
FT                   /locus_tag="Rpdx1_0452"
FT   CDS_pept        490075..490821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0452"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bra:BRADO0408 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42093"
FT                   /db_xref="GOA:E6VJU3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJU3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU42093.1"
FT                   /translation="MNDRVVIITGGSRGIGRATALACARRGFKVVIGYASNAAAASEVV
FT                   AEIEAVGGKAIAVKCDVGLEAEILAMFAAADAFGPLGALVNNAGIVGPTARVDEMSAER
FT                   IQRIMAVNVTGSILCAREAVKRMSTRHGGQGGVIVNLSSVAAKLGSPNTYVDYAASKGA
FT                   VDSFTVGLGHELAGEGIRVAAIRPGLIDTEIHASGGDPERAHRLSVNVPMKRVGRAEEI
FT                   ANAVVWLLSDEASYVTSAILDVSGGR"
FT   gene            490853..492256
FT                   /locus_tag="Rpdx1_0453"
FT   CDS_pept        490853..492256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0453"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="KEGG: bbt:BBta_0398 dihydrolipoamide dehydrogenase;
FT                   TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42094"
FT                   /db_xref="GOA:E6VJU4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJU4"
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /protein_id="ADU42094.1"
FT                   /translation="MATYDLVVIGTGPGGYVCAIRAAQLGLKVAVVEKNATLGGTCLNV
FT                   GCMPSKALLHASELFEEAGHSFAKMGIGVPAPKLDLPAMMNFKQQGIDGNVKGVEYLMK
FT                   KNKIDVLAGRGKILGAGKVEVTGADGKAQTVDTKSIVIASGSAVAQLKGIEIDEKRVVS
FT                   STGALSLDKVPGKLIVVGAGVIGLELGSVWRRLGAEVTVVEFLDRILPGMDAEVVKQFQ
FT                   RILEKQGFAFKLGAKVTGVDSSGAKLAVKVEAAAGGNPETLEADVVLVAIGRVPYTEGL
FT                   GLKEAGIALDERGRVVIDDHFATSLKGVYAIGDVVRGPMLAHKAEDEGVAVAELIAGKA
FT                   GHVNYEVIPGVVYTTPEVSCVGKTEEDLKQAGVAYTVGKFPFTANGRSKVNQTTDGFVK
FT                   ILADAKTDRVLGVHIIGREAGEMIHEAAVLMEFGGSAEDLARTCHAHPTRSEAIKEAAL
FT                   TVGKRAIHM"
FT   gene            492283..492840
FT                   /locus_tag="Rpdx1_0454"
FT   CDS_pept        492283..492840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42095"
FT                   /db_xref="GOA:E6VJU5"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJU5"
FT                   /inference="similar to AA sequence:KEGG:bll0448"
FT                   /protein_id="ADU42095.1"
FT                   /translation="MDGGVMKRRPLQPLWVLLAVLFLIEAWFWDHVEPLVARIVALIPL
FT                   RELKERLARWVEHLSPAMTLPVFLVPVAPLYPLKLFALALLAQGHWIAGLCIFAAAQVF
FT                   GLGVAAFIFDVTKPKLLQLRWFAATYRWVIELRAKAHAIVAPIMARIRARLAELLKEDG
FT                   DGWGAKVLRRIGALRRRIRSAR"
FT   gene            492946..494388
FT                   /locus_tag="Rpdx1_0455"
FT   CDS_pept        492946..494388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0455"
FT                   /product="anion transporter"
FT                   /note="KEGG: rmr:Rmar_2078 anion transporter; TIGRFAM:
FT                   anion transporter; PFAM: sodium/sulphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42096"
FT                   /db_xref="GOA:E6VJU6"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJU6"
FT                   /inference="protein motif:TFAM:TIGR00785"
FT                   /protein_id="ADU42096.1"
FT                   /translation="MRWDAIDWRRLGAILFGFALLALTLVIPPPAGMKLEAWRVAGVAA
FT                   LMATWWISEAVPLPVTALLPLVAFPLLGVVPIREAAAPYADPIIFLFLGGFVLGVAMQR
FT                   WSLHKRIGLGVVALAGVSPARLCAGFLLSTALLSMWISNSATAIIMLPVATSVLALLDR
FT                   DTGNAPQARRHLGLSLMLSVAYGASVGGLGTLIGTPANAMLAAYLRREHQLDIGFAEWM
FT                   AIGVPLAAVLLLAAWLLLTRMFPVPVALTERAADTVAAELNRLGPISGPEARVAVVFGL
FT                   TAAAWMLRPLYAAWVPGIDDTSIAVIGALLLFLLPSGDADKGRLLGWADFRSLPFDVLI
FT                   LFGSGLSLATAISVSGLAQWIGEALGGLAAWPPLLLVVTATFAMLFLTELTSNTASAAT
FT                   FIPIGGAIAVGIGLDPVLLALPLALAASCAFMLPVATPPNAIVFASGHITVREMARVGL
FT                   WMNLISGVVIVALTYALAGMLR"
FT   gene            complement(494394..494984)
FT                   /locus_tag="Rpdx1_0456"
FT   CDS_pept        complement(494394..494984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oca:OCAR_4586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42097"
FT                   /db_xref="GOA:E6VJU7"
FT                   /db_xref="InterPro:IPR025570"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJU7"
FT                   /inference="similar to AA sequence:KEGG:OCAR_4586"
FT                   /protein_id="ADU42097.1"
FT                   /translation="MGAHESMEHAEHAEHASGSNKGIALLISVIALFLAFSETLGKGAQ
FT                   TEALAKNVEASNLWAFFQAKSIRRTTVQAVSEHAKLSLGTVPDEATKAALQKQIEDWQK
FT                   TAARYRSEPETGEGSEQLAARAKHAEHDRDLAMARYHHYEVASAAFQIGIVLASATIIT
FT                   GMIVLAWISGLLAVGGLGFMAIGLFAPHAVHLF"
FT   gene            complement(495125..496096)
FT                   /locus_tag="Rpdx1_0457"
FT   CDS_pept        complement(495125..496096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0457"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: bja:blr0446 site-specific
FT                   tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42098"
FT                   /db_xref="GOA:E6VJU8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJU8"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADU42098.1"
FT                   /translation="MVSSKPAPPPLELAGAAADLTAEMAKWLSHLRAERRLSGKTLEAY
FT                   ARDVRQFLQFLAGHWGGEVTLGRFARLEATDVRAFMAARRADDIAGRSLMRALAGLRSF
FT                   GRFLEREGKGRVGALASVRAPKIRKSLPKPLPIAAAKRLADADERAGEERETWVLIRDA
FT                   AVMALLYGSGLRISEALGLKRRDVPAPGKGDTLIVHGKGNKTRMVPVLQNVLEQIAEYA
FT                   AACPYNLPPDGPMFVGARGGPLSPRIIQLAMERLRGGLGLPDSATPHALRHSFATHLLS
FT                   RGGDLRAIQELLGHASLSTTQVYTGIDTERLLEVYNSAHPRA"
FT   gene            496293..498503
FT                   /locus_tag="Rpdx1_0458"
FT   CDS_pept        496293..498503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0458"
FT                   /product="primosomal protein N'"
FT                   /note="TIGRFAM: primosomal protein N'; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; KEGG:
FT                   nha:Nham_0535 primosome assembly protein PriA; SMART:
FT                   DEAD-like helicase; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42099"
FT                   /db_xref="GOA:E6VJU9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJU9"
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /protein_id="ADU42099.1"
FT                   /translation="MDEFPTSRPAANGPASVVDVLVPVAIDQAYSYRVPRGLSLKPGDV
FT                   VAVPLGAREVLGVVWAENPSPDPRLHNRLKDVAEKLDVPPLRDELRRMVDWVATYTLSA
FT                   RGMVLRMCLRMGEHLGPERQRMGVRLVGPPPQRMTPARRRLLEILSDGLLHGKSDVAKE
FT                   AGVSPGVIDGLVDEGTLSVEPMPRENPAPEPDPDFAPAAFSPEQARAAETIRGLVTAGG
FT                   FQAALIDGVTGSGKTEVYFEAVAEVIRQGRQSLILMPEIALTGQFLDRFAQRFGVRPLE
FT                   WHSELTPRTRARNWAAIAAGEARVVVGARSALFLPYADLGLIIVDEEHDQAYKQEDGAH
FT                   YHARDMAVVRASIAKIPIVLASATPSVETEVNARKGRYQRIPLPSRFGGQHMPQIEAID
FT                   LRREPPMRGRFISPRLAEQIGFAIERREQALLFLNRRGYAPLTLCRACGHRFACTICDA
FT                   WLVDHRFRQRLVCHHCGFSMPRPPACPHCGAEGSLVAVGPGVERLQEEAASLFPNARTM
FT                   VLSSDLITSIETMRSELNEIAEGRVDIIIGTQLVAKGHNFPRLNLVGVVDADLGLSNGD
FT                   PRAAERTFQLLNQVIGRAGREQGRGVGFLQTHQPEHPVMKALVACDREAFYASEIEIRE
FT                   RTLYPPFGRLASLIISAGDRPTAESFGRQLAGAAPFDERVQVLGPAEAPLAVIKGRYRF
FT                   RLLVKSVRGFDLSNYLRSWLARGPKTKGNLKLEVDVDPQSFL"
FT   gene            complement(498674..499150)
FT                   /locus_tag="Rpdx1_0459"
FT   CDS_pept        complement(498674..499150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0459"
FT                   /product="rare lipoprotein A"
FT                   /note="KEGG: bja:blr044 hypothetical protein; TIGRFAM: rare
FT                   lipoprotein A; PFAM: Rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42100"
FT                   /db_xref="GOA:E6VJV0"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJV0"
FT                   /inference="protein motif:TFAM:TIGR00413"
FT                   /protein_id="ADU42100.1"
FT                   /translation="MVRKKTPALLTTGPATAAAMIVASVFLGGSVGEASAKSRQQRHHH
FT                   HHHSHQSDWRSANASVDRSSGRSFSGMASFYGNESGSRTASGQRFNQHAMTAAHRSLPF
FT                   GTKLRVTHGSRSVVVTINDRGPFIRGRVLDLSRGAAQAIGLTSRGVGRVVAEVM"
FT   sig_peptide     complement(499040..499150)
FT                   /locus_tag="Rpdx1_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.264 at
FT                   residue 37"
FT   gene            499853..500413
FT                   /locus_tag="Rpdx1_0460"
FT   CDS_pept        499853..500413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0460"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="KEGG: nwi:Nwi_0429 F0F1 ATP synthase subunit delta;
FT                   TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42101"
FT                   /db_xref="GOA:E6VJV1"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJV1"
FT                   /inference="protein motif:TFAM:TIGR01145"
FT                   /protein_id="ADU42101.1"
FT                   /translation="MASEDPSVSGVSGRYATALFELARDEKSIDAVTADLDKFSAMLAG
FT                   SPDLVRLVRSPVFASEVQGKALAAVLDKAGITGISANFLKVLAANRRLFVVADVIRAYR
FT                   ALVARFRGEATADVTVAEQLSDKNLEALKAALKSVTGKDVALNINVDPAIIGGLVVKLG
FT                   SRMVDSSLRTKLNSIKHAMKEAG"
FT   gene            500413..501945
FT                   /locus_tag="Rpdx1_0461"
FT   CDS_pept        500413..501945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0461"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /note="KEGG: nha:Nham_0532 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42102"
FT                   /db_xref="GOA:E6VJV2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJV2"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ADU42102.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVSEVGQVLSVGDGIARVYGLD
FT                   NVLAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRSIVDAPVGKGLL
FT                   GRVVDALGNPIDGKGPIQAVERKRVDVKAPGIIPRKSVHEPMATGLKSIDALIPIGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNVEGAPESQKLYCVYVAVGQKRSTVAQFVKVLE
FT                   EQGALEYSVVVAATASDPAPMQYIAPFTGCTIGEYFRDNGMHAVIIYDDLSKQAVAYRQ
FT                   MSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDQGNGSLTALPVIETQANDVSAYIP
FT                   TNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYR
FT                   EMAAFAQFGSDLDAATQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGYLDALP
FT                   LNKVRPFEDGLLALLRGKESAILEAIRTSRDLSDDTAAKLKAVVESYAKTFA"
FT   gene            502089..502964
FT                   /locus_tag="Rpdx1_0462"
FT   CDS_pept        502089..502964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0462"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="KEGG: nha:Nham_0531 F0F1 ATP synthase subunit gamma;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42103"
FT                   /db_xref="GOA:E6VJV3"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJV3"
FT                   /inference="protein motif:TFAM:TIGR01146"
FT                   /protein_id="ADU42103.1"
FT                   /translation="MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQMAAEAARPY
FT                   AEKMDAVISNIAGAAAGSPGAPVLLAGNGKDQVHLLLVCTGERGLSGAFNSSIVRLARE
FT                   RAYELMGQGKTVKFFCVGRKGYEQLRRNFEKQIIDNVELRSVRQIGFVNAEDIAQKVIA
FT                   RFNAGEFDVCTLFYSRFKSVISQIPTAQQLIPLEVTAPAAGTVATSYEYEPEEDEILSG
FT                   LLPRNLAVQIFRALLENNASFYGAQMSAMDNATRNAGEMIRKQTLVYNRTRQAMITKEL
FT                   IEIISGAEAI"
FT   gene            503036..504466
FT                   /locus_tag="Rpdx1_0463"
FT   CDS_pept        503036..504466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0463"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; KEGG: nha:Nham_0529 F0F1 ATP synthase
FT                   subunit beta; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42104"
FT                   /db_xref="GOA:E6VJV4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJV4"
FT                   /inference="protein motif:TFAM:TIGR01039"
FT                   /protein_id="ADU42104.1"
FT                   /translation="MATPANQTGRITQVIGAVVDVQFEGHLPAILNAIETKNGDNRLVL
FT                   EVAQHLGESTVRTIAMDTTEGLVRGQEVTDTGAPISVPVGDGTLGRIMNVIGEPVDEQG
FT                   PIKSEGLRAIHQEAPAYTDQSTEAEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVL
FT                   IQELINNVARAHGGYSVFAGVGERTREGNDLYHEFIESGVNKKGGGEGSKCALVYGQMN
FT                   EPPGARARVGLTGLTVAEHFRDQGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQP
FT                   TLATDMGALQERITTTTKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLNRAISEK
FT                   GIYPAVDPLDSTSRMLSASIVGEEHYTTARMVQQILQKYKSLQDIIAILGMDELSEEDK
FT                   LTVARARKIERFLSQPFFVAEVFTGSPGKFVDLADTIKGFRAICEGKYDHLPEAAFYMV
FT                   GTIEEAVEKGKKLAAEAA"
FT   gene            504583..505002
FT                   /locus_tag="Rpdx1_0464"
FT   CDS_pept        504583..505002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0464"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="KEGG: nwi:Nwi_0434 F0F1 ATP synthase subunit
FT                   epsilon; TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   ATPase, F1 complex, delta/epsilon subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42105"
FT                   /db_xref="GOA:E6VJV5"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJV5"
FT                   /inference="protein motif:TFAM:TIGR01216"
FT                   /protein_id="ADU42105.1"
FT                   /translation="MRRDMSTFHFDLVSPEMVAFSGEVDQVDIPGAEGDFGVLAGHAPV
FT                   VALIRPGILTVTAGAATQKIVVLGGIAEVSEKGLTVLADVATPAPDVDLQDFAATIQTM
FT                   EQQLPGKVGDELDSAIERLDHFKSIQQQLNTTAMH"
FT   gene            complement(505204..505713)
FT                   /locus_tag="Rpdx1_0465"
FT   CDS_pept        complement(505204..505713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0465"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bja:blr0437
FT                   dinucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42106"
FT                   /db_xref="GOA:E6VJV6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJV6"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADU42106.1"
FT                   /translation="MTARPPLETLPYRRNVGIALFGGDGRILIGRRFRDDGPEIILPGL
FT                   EWQMPQGGIDEGEEPRIAVMRELWEETGVTRAEILGETDWVSYDFPPYDGPAHRLAVFR
FT                   GQRQKWFALRFTGSDAEIDPLAVRNGMPPEFDAWRWERLDRVADFVVPFRREVYREVAR
FT                   SFARFV"
FT   gene            complement(505710..506657)
FT                   /locus_tag="Rpdx1_0466"
FT   CDS_pept        complement(505710..506657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0466"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42107"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJV7"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADU42107.1"
FT                   /translation="MRLSRRILVSGGAGFIGSHLCDKLLAEGHEVLCVDNYFTGWRRNI
FT                   EHLVGTPRFEVMRHDVTFPLYVEVDDIYNLACPASPVHYQHDPVQTLKTSVHGAINMLG
FT                   LAKRTRAKIFQASTSEVYGDPNVHPQPESYWGHVNPLGIRACYDEGKRAAETLFFDYHR
FT                   QHKVKIKVARIFNTYGPRMHPNDGRVVSNFIVQALSGNDITIYGDGSQTRSFCYVTDLL
FT                   DGFARLMATGDEFIGPVNLGNPVEFTIRQLAEMVIEMTGSKSKLVMMPLPSDDPRQRQP
FT                   DISLARRELGWEPKVPLADGLKETIGYFRTLMAS"
FT   gene            506876..507946
FT                   /locus_tag="Rpdx1_0467"
FT   CDS_pept        506876..507946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mea:Mex_1p4746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42108"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJV8"
FT                   /inference="similar to AA sequence:KEGG:Mex_1p4746"
FT                   /protein_id="ADU42108.1"
FT                   /translation="MTAPVDTSKLRILEIGGGYFKLQYPERTTCLWTWTKLTGDFGKLD
FT                   GFSTPDRVLRELRAAGRGEYDVVVVNSLRYSPWHPRYWARGIFYTPANPWAALTRQFGP
FT                   SMFRWVKSPVPLVAVEMDDHFAISKSSVFLLDKAKAYFKRELPCDKWQALAGTVHPHLP
FT                   TLRYRRSEKWQRRIDRLQPISLPQFRFDARWRDAPFPEKTHDIFFIGSVDGNSTVRRDG
FT                   LPELERLRAAGVRIDQPTERLPYDAFMERMSHSWLAWSPEGMGWDCYRHYEAPIVQSVP
FT                   LMNNPTILRYAPLLSGEHGVYYDIEPGGLERAVTSALADKGKLRRMALAARDHVFAHHT
FT                   VKAHCDHILQAAIAAR"
FT   gene            complement(508022..508528)
FT                   /locus_tag="Rpdx1_0468"
FT   CDS_pept        complement(508022..508528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0468"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bja:blr0436
FT                   dinucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42109"
FT                   /db_xref="GOA:E6VJV9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJV9"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADU42109.1"
FT                   /translation="MARYEDLPYRTCVGVMLINREGLVFIGRRAGGIEHVDDTHVWQMP
FT                   QGGVDPGEDTWEAAKRELYEETSVHSVEKLAEVPDWLIYDIPRTVAGRAWKGRYRGQRQ
FT                   KWFAARFVGTDSEINVAHPGGGHKPEFTSWRWEPMHNLPELIVPFKRPVYERVVKEFSQ
FT                   LAAAV"
FT   gene            complement(508568..509806)
FT                   /locus_tag="Rpdx1_0469"
FT   CDS_pept        complement(508568..509806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0469"
FT                   /product="protein of unknown function DUF610 YibQ"
FT                   /note="PFAM: protein of unknown function DUF610 YibQ; KEGG:
FT                   nha:Nham_0526 protein of unknown function DUF610, YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42110"
FT                   /db_xref="GOA:E6VJW0"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJW0"
FT                   /inference="protein motif:PFAM:PF04748"
FT                   /protein_id="ADU42110.1"
FT                   /translation="MAADELSTPLGQKRSRWQRLRHYRLPFNATQAIATLLGVFVLAFL
FT                   GFAIFSHDPLGGEPVVRLEIPPAADAPKQAAAAPAKAPDGKAENAPAAGPDQHGGKQAA
FT                   PGQKTITIIDGSKGTRQDVVVGADTADKSEPPGGASAVAADGINPKLLEQSRYGMIPVM
FT                   AGGLKPFNAYAMATDAERAKAERMPTVTIVVGGLGIGAARTNDAVMKLPAPVTLAFTPY
FT                   GSDPGKLATEARAKRHEIILQIPMEPFDYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRI
FT                   QGYVGLSNFMGARFVATEPAMQAIIRDAAKRGLGYLDDGTAPRSVAGTLANSLAIPFAR
FT                   ADLTIDQVPAGADIDKALTRLESIAKERGSAIGMASALPVTIERIVNWSKSLESRGIVL
FT                   VPLTTAMLKSKSS"
FT   gene            complement(510158..511537)
FT                   /locus_tag="Rpdx1_0470"
FT   CDS_pept        complement(510158..511537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0470"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="SMART: peptidase S41; PDZ/DHR/GLGF domain protein;
FT                   TIGRFAM: carboxyl-terminal protease; KEGG: bja:blr0434
FT                   carboxy-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42111"
FT                   /db_xref="GOA:E6VJW1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJW1"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADU42111.1"
FT                   /translation="MMRKTSVILLSAVTGAALTLFVTQPRTMLMGASARAATSDTYRQL
FT                   NLFGDVFERVRSDYVEKPDDSKLIESAISGMLTGLDPHSSYMDAKSFRDMQVQTRGEFG
FT                   GLGIEVTMEDGLIKVVSPIDDTPASKAGILANDIITNLDDEAVQGLTLNQAVEKMRGPV
FT                   NTKIRLKIVRKGQDAPIEVTLVRDNIRVRSVRARVEDSDIGYIRITTFNEQTTEGLKKE
FT                   ITNLTNQIGADKLKGFILDLRNNPGGLLEEAVTVSDAFLDRGEIVSTRGRNAEETQRRS
FT                   AHAGDLTKGKPVIVLINGGSASASEIVAGALQDHKRATVVGTRSFGKGSVQTIIPLGSG
FT                   NGALRLTTARYYTPSGKSIQAKGITPDIEVMQDVPADIKARTDTKGEASLRGHLKGADG
FT                   DEKTGSQSYVPPEAKDDKALKAAADMLHGIKVNATAPVADKQTNGDKAAVDKPAGNKAA
FT                   N"
FT   sig_peptide     complement(511427..511537)
FT                   /locus_tag="Rpdx1_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.813 at
FT                   residue 37"
FT   gene            complement(511534..512934)
FT                   /locus_tag="Rpdx1_0471"
FT   CDS_pept        complement(511534..512934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0471"
FT                   /product="Peptidase M23"
FT                   /note="KEGG: nha:Nham_0524 peptidase M23B; manually
FT                   curated; PFAM: Peptidase M23"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42112"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJW2"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADU42112.1"
FT                   /translation="MHAPRHRAARDRSAAGPWGRAALLSAGLAAGGLLAHGLAPRQAAL
FT                   IAAAQAQTAPAATTASPSMADLIKQHEQELEAARAQQKSAAEQQDRLKADLAAIGADRT
FT                   KLNQELIDVAAKVRTIETRISDAEARLRPLDARENEIRSSLDQRRDEIGEVLAALQRAG
FT                   RRAPPALLVRPEDALESLRTAILLGAVVPELRTRAERLATDLGELIAVRQKIAAERDQL
FT                   AADRSRLGSDQTRLAALVEERQRQQSAVERDIDAERGRALTLSRQVDSLQGLIAKMEQD
FT                   LKSAAKAAAVAGQKGAPTSPGGKPDLAALKDPGRLSPAIAFASAKGMLPFPVNGAKIRD
FT                   FGRPDGVGGVERGISLSTRPGAQITTPCDGWVVYAGPFRSYGQLLILNAGGGYHVLIAG
FT                   MERISVNIGQFVLTGEPVATMGSTSRVASILAANASQPVLYVEFRKDGTPIDPGPWWAA
FT                   NEGEKVRG"
FT   gene            complement(512954..513427)
FT                   /locus_tag="Rpdx1_0472"
FT   CDS_pept        complement(512954..513427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0472"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   bra:BRADO0427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42113"
FT                   /db_xref="GOA:E6VJW3"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJW3"
FT                   /inference="protein motif:PFAM:PF02590"
FT                   /protein_id="ADU42113.1"
FT                   /translation="MILAVGKLKQGPERELAERYRARFDDLGRKLGFRGLDVHEIAESR
FT                   AREAPARMAEEASAITGHVPDGAVLVTLDERGQSLGSTAFATQLGRWRDEQVPGTIFVI
FT                   GGADGLSPELRRKAKLSLSFGAATWPHQLVRVLLLEQIYRAATILAGHPYHRA"
FT   gene            complement(513530..513826)
FT                   /locus_tag="Rpdx1_0473"
FT   CDS_pept        complement(513530..513826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0473"
FT                   /product="iojap-like protein"
FT                   /note="KEGG: bbt:BBta_0417 hypothetical protein; TIGRFAM:
FT                   iojap-like protein; PFAM: Iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42114"
FT                   /db_xref="GOA:E6VJW4"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJW4"
FT                   /inference="protein motif:TFAM:TIGR00090"
FT                   /protein_id="ADU42114.1"
FT                   /translation="MKAEETVTIDLRGKSAMFDYVVVSSGRANRHVGAIAENVVKALKQ
FT                   AGIAAPHVEGLPNCDWVLIDSGDVVLHVFRPEVREFYNLERLWTQGPAPAKTL"
FT   gene            complement(514195..514824)
FT                   /locus_tag="Rpdx1_0474"
FT   CDS_pept        complement(514195..514824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0474"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="TIGRFAM: nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase; KEGG: bja:blr0430 nicotinic acid
FT                   mononucleotide adenylyltransferase; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42115"
FT                   /db_xref="GOA:E6VJW5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJW5"
FT                   /inference="protein motif:TFAM:TIGR00482"
FT                   /protein_id="ADU42115.1"
FT                   /translation="MTPDLAAARRAIPPFTPGMRIGLLGGSFNPPHLAHRAISQFAIKR
FT                   LGLDRVWWLVSPGNPLKDVSGLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTL
FT                   RYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSLRALAAPAAQR
FT                   LMRMRLPADAATTLADHPPPAWVFLTGLKSPVSSTALRNPDGSWKA"
FT   gene            complement(514849..516141)
FT                   /locus_tag="Rpdx1_0475"
FT   CDS_pept        complement(514849..516141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0475"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="KEGG: bja:blr0429 gamma-glutamyl phosphate
FT                   reductase; TIGRFAM: gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42116"
FT                   /db_xref="GOA:E6VJW6"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJW6"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ADU42116.1"
FT                   /translation="MTASLKAIDGSAELTTLMTDLGRRARAAARILALAPPEQKNRALE
FT                   AMERTIRTHADKILAANAEDVADAKAAGTTSAFLDRLTLTPARVEAMAEGIAVVRGIPD
FT                   PIGAVTESWQRPNGMTIERVRVPLGVVAVIYESRPNVTADAGVLCLKSGNAVILRGGSE
FT                   SFRSGRAIHDCLVQGLREAGLPDAAISLVPTRDRAAVGLLLAGLDGAVDVIVPRGGKSL
FT                   VARVESEARVPVFAHLEGVNHVYVDRSADPAMAKAIVFNAKMRRTGVCGAAETLLIDRA
FT                   GAATHLAPLVTMLIDSGCEVRGDQAVQQVDPRVKPASDEDWDTEYLDAVIAAKLVDGVD
FT                   AAIAHIHDHGSHHTDAIVAEDTQAAAKFLSEVDSAIVLHNASTQFADGGEFGFGAEIGI
FT                   ATGKFHARGPVGAEQLTTFKYRIHGSGQTRP"
FT   gene            516265..516546
FT                   /locus_tag="Rpdx1_0476"
FT   CDS_pept        516265..516546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0476"
FT                   /product="addiction module antidote protein, CC2985 family"
FT                   /note="TIGRFAM: addiction module antidote protein, CC2985
FT                   family; KEGG: mpo:Mpop_0594 putative addiction module
FT                   antidote protein, CopG/Arc/MetJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42117"
FT                   /db_xref="GOA:E6VJW7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJW7"
FT                   /inference="protein motif:TFAM:TIGR02606"
FT                   /protein_id="ADU42117.1"
FT                   /translation="MAGSYTLDEHSAAFVDSLVESGRYETAGDVVRESLRQMQAREAKL
FT                   EALRAEIQKGLDSGPGEEFDAKTLAEDVKRRGRERLVAARAAASKSVS"
FT   gene            516548..516833
FT                   /pseudo
FT                   /locus_tag="Rpdx1_0477"
FT   gene            complement(516834..517964)
FT                   /locus_tag="Rpdx1_0478"
FT   CDS_pept        complement(516834..517964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0478"
FT                   /product="glutamate 5-kinase"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein; KEGG: bbt:BBta_0422 gamma-glutamyl kinase; SMART:
FT                   PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42118"
FT                   /db_xref="GOA:E6VJW8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJW8"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ADU42118.1"
FT                   /translation="MASPKLRDFRRIVVKVGSSLLIDSAAGEVRAGWLAALAADIAELH
FT                   RGGRDVMVVSSGSIALGRSRLKLPRGPLKLEESQAAAAVGQIELARTWSEVLGAHGIGA
FT                   GQILVTFQDTEERRRYLNARSTIGKLLEWHAVPVINENDTVATTEIRYGDNDRLAARVA
FT                   TMASADLLILLSDIDGLYTAPPGSDPDATLIPVVEAITAEIEGMAGAAGSELSRGGMRT
FT                   KIEAAKIATSAGTHMLIASGKIDHPLKAIAEGGKCTWFLTPANPVTARKRWIAGSLEPK
FT                   GTLTIDAGAVSALRAGKSLLPAGVIRVDGQFSRGDAVIVRGPDTHEIGRGLVAYDAEDA
FT                   EKIKGRSSPDVMMILGITGRAEMIHRDDLVVGTAPA"
FT   gene            complement(518122..519183)
FT                   /locus_tag="Rpdx1_0479"
FT   CDS_pept        complement(518122..519183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0479"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="KEGG: bra:BRADO0432 GTPase ObgE; TIGRFAM:
FT                   GTP-binding protein Obg/CgtA; small GTP-binding protein;
FT                   PFAM: GTP1/OBG sub domain protein; GTP-binding protein
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42119"
FT                   /db_xref="GOA:E6VJW9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJW9"
FT                   /inference="protein motif:TFAM:TIGR02729"
FT                   /protein_id="ADU42119.1"
FT                   /translation="MKFLDEAKVYIRSGDGGNGCVAFRREKFIEFGGPNGGNGGRGGDI
FT                   IVEAADGLNTLIDYRYQQHFKAPKGGNGMGSDRHGAGGKDVVMKVPVGTQIFDEDKETL
FT                   IYDFTKVGERFVLAKGGNGGFGNAHFKSSTNRAPRHANPGLPGEERWIWLRLKLIADAG
FT                   LVGLPNAGKSTFLSKVSAAKPKIADYPFTTLHPQLGVVNSDGREFVLADIPGLIEGAHE
FT                   GAGLGDRFLGHIERCRVLLHLIDATCEHAGKAYKTVRGELEAYADALTDKIEIVALNKI
FT                   DAVDPDELKKQKDRLKRAAKKTPLLLSGVTGRGVPEALRALVAVIGEAPVSDKAIGTAD
FT                   NPAEAKPWAPQDA"
FT   gene            519335..520234
FT                   /locus_tag="Rpdx1_0480"
FT   CDS_pept        519335..520234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0480"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bbt:BBta_0424 DMT family permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42120"
FT                   /db_xref="GOA:E6VJX0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJX0"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU42120.1"
FT                   /translation="MGLFAKITTASDPRTARIAGILLMLLAMLAFSFSDAAGKTVVATY
FT                   SVGQLLLLRALAGLLVLSPLIWRQRKTFARLERPGLQLARTLIAACEVAVFYLATVYLP
FT                   LADVITFYLASSLFVSVGAALFLGEPIDKPRAIAIVIGFVGVLIALQPSAQTVSWPALI
FT                   AILASVLFAGLLLLTRFLRQTPDMVLASQQFAGTLLLGLVLAPSGWMTPPPGDLVWFAI
FT                   SGAVSAVGLLCVNRSLRLAPASVVVPYQYTMIIFAAAFGWLLFGDVPSHALMVGAAIIV
FT                   GSGLYLGWRERAARPPAV"
FT   sig_peptide     519335..519445
FT                   /locus_tag="Rpdx1_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.785 at
FT                   residue 37"
FT   gene            complement(520235..520408)
FT                   /locus_tag="Rpdx1_0481"
FT   CDS_pept        complement(520235..520408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: der:Dere_GG10289 GG10289 gene product from
FT                   transcript GG10289-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42121"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJX1"
FT                   /inference="similar to AA sequence:KEGG:Dere_GG10289"
FT                   /protein_id="ADU42121.1"
FT                   /translation="MPVSPDQAAAVRDVRDEFRADLDAFEATERKLLIEERRERARVLS
FT                   ERFNGLTLRVSE"
FT   gene            complement(520539..520730)
FT                   /locus_tag="Rpdx1_0482"
FT   CDS_pept        complement(520539..520730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecb:100060039 hypothetical LOC100060039"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42122"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJX2"
FT                   /inference="similar to AA sequence:KEGG:100060039"
FT                   /protein_id="ADU42122.1"
FT                   /translation="MSAHRYIQAVLARDLAEDIKPLAPATIDQIERAADRAAEVDQHRE
FT                   RTEQLSFRFVDLDRRFGI"
FT   gene            complement(520934..521533)
FT                   /locus_tag="Rpdx1_0483"
FT   CDS_pept        complement(520934..521533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0483"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nha:Nham_0516 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42123"
FT                   /db_xref="GOA:E6VJX3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJX3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU42123.1"
FT                   /translation="MLQEIPTTTPSLREARPCVLETERLTLRKPVLADVQAIASLANDR
FT                   RVVEMTRRMPFPYTRDDAARFVTALPKGNDSVFLIEAEDLEPIGLVGVDWSDRDAPELG
FT                   YWLGVQHWGNGYATEAARAVIDFTFEVHGAWQMISGARVINPASRNVLEKCGFQWTGVE
FT                   LHRFDAIASSSPVDCFRLTRGVWSSLKKWGTTKRRC"
FT   gene            complement(521669..521941)
FT                   /locus_tag="Rpdx1_0484"
FT   CDS_pept        complement(521669..521941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0484"
FT                   /product="ribosomal protein L27"
FT                   /note="KEGG: nha:Nham_0515 50S ribosomal protein L27;
FT                   TIGRFAM: ribosomal protein L27; PFAM: ribosomal protein
FT                   L27"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42124"
FT                   /db_xref="GOA:E6VJX4"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJX4"
FT                   /inference="protein motif:TFAM:TIGR00062"
FT                   /protein_id="ADU42124.1"
FT                   /translation="MAHKKAGGSSRNGRDSAGKRLGIKAFGGERVIPGNIIARQRGTQW
FT                   HPGLNVGMGTDHTLFAKVEGHVEFRAKANGRTYVSVLPIAMQAAE"
FT   gene            complement(522029..522409)
FT                   /locus_tag="Rpdx1_0485"
FT   CDS_pept        complement(522029..522409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0485"
FT                   /product="ribosomal protein L21"
FT                   /note="KEGG: nha:Nham_0514 50S ribosomal protein L21;
FT                   TIGRFAM: ribosomal protein L21; PFAM: ribosomal protein
FT                   L21"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42125"
FT                   /db_xref="GOA:E6VJX5"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJX5"
FT                   /inference="protein motif:TFAM:TIGR00061"
FT                   /protein_id="ADU42125.1"
FT                   /translation="MFAVIKTGGRQYRVVPEDVLEVGKLDGDVGTIIQLGEVLVLGGDT
FT                   PVLGTPTVAGATVAAEVLDHKRGPKVIAFKKRRRKHSKRKRGYRDEITVLRITEILADG
FT                   KQPSVGPRPKRAKAAPAAEAAE"
FT   gene            522739..523890
FT                   /locus_tag="Rpdx1_0486"
FT   CDS_pept        522739..523890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0486"
FT                   /product="putative glucokinase"
FT                   /note="KEGG: bra:BRADO0437 putative glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42126"
FT                   /db_xref="GOA:E6VJX6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJX6"
FT                   /inference="similar to AA sequence:KEGG:BRADO0437"
FT                   /protein_id="ADU42126.1"
FT                   /translation="MAEDTATNAGIAGHGATRLPSVEIDSYNIEIKDDDGFLGDRACRG
FT                   AFQRLLDDWRKPLREAGDDPFGRRDTKKIAKGALDEALTSDDVAAAAVVHSAIEDFAQE
FT                   LAYVTKRFLRTKAWADTECIVVGGGFRQSRVGELAIARTDILLKAEGHAVDLVPIRFHP
FT                   DEAGLIGCLHLAPSWIFEAHDSILAVDIGGSNIRCGVVETAWKKAPDLSKASVWKSDLW
FT                   RHAEDEPTREGAVKRLTRMLKDLIAQAEDEGFKLAPFIGISCPGVINADGSIEKGAQNL
FT                   PGNWESSKFHLPRSLLEGIPMIGKHDTAILMHNDGVAQGLSEVPFMQDFERWGVLTIGT
FT                   GLGNARFTNRRDKDKAKKEREKDKDKEKDKDKGKKDKDSKEKA"
FT   gene            524046..524135
FT                   /locus_tag="Rpdx1_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            524046..524135
FT                   /locus_tag="Rpdx1_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(524318..525634)
FT                   /locus_tag="Rpdx1_0487"
FT   CDS_pept        complement(524318..525634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0487"
FT                   /product="HipA N-terminal domain protein"
FT                   /note="KEGG: bja:bll1985 HipA protein; TIGRFAM: HipA
FT                   N-terminal domain protein; PFAM: HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42127"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJX7"
FT                   /inference="protein motif:TFAM:TIGR03071"
FT                   /protein_id="ADU42127.1"
FT                   /translation="MARSRTHVPLNVFLNGRLVGILRRDSTGAIDFQYGREWLDWDNTF
FT                   PVSLSLPLREDRYIGAPAINVFDNLLPDSDAIRRRVAERVGVDGIDAYSLLAALGHDCV
FT                   GALQFLPDGVDPGSPGATNGTPVSDDEVATIINNLASSPLGMGEDEDFRISIAGAQEKT
FT                   ALLRVEGQWLKPHRAAATTHILKPQIGRLPNGVDLSNSVENEYLCLKLLAALDVPTAHA
FT                   EIADFGGRRTLVVERFDRRWTKDGRLLRLPQEDMCQALSVPPTRKYQSDGGPSMRDIIE
FT                   LLKGSDKPDEDIATFMRACILFWMFGATDGHAKNFSIAISPGGRFRLTPLYDVLSAQPS
FT                   LDAGQVQQKAFKLAMSVGKNRRYHVKEIVPRHFMQTAALAGVGARLMRGLFEQIAARAV
FT                   ATTDALLAKLPTGFPEQVAASVQSAVQTRVRLLLDAGVK"
FT   gene            complement(525636..525890)
FT                   /locus_tag="Rpdx1_0488"
FT   CDS_pept        complement(525636..525890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0488"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: bja:bsl1986 transcriptional regulator; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42128"
FT                   /db_xref="GOA:E6VJX8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6VJX8"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU42128.1"
FT                   /translation="MPDQIARNEKQLGAILRRARKQAGLTQGSLGEHIHLRQATVSRLE
FT                   AGEPAIQLRTLMAALSALDLELVVRPRSKAAAADIEDLF"
FT   gene            526109..527110
FT                   /locus_tag="Rpdx1_0489"
FT   CDS_pept        526109..527110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0489"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   KEGG: bja:bll6944 HupU protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42129"
FT                   /db_xref="GOA:E6VKK0"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKK0"
FT                   /inference="protein motif:PFAM:PF01058"
FT                   /protein_id="ADU42129.1"
FT                   /translation="MGTFDVLWLQAASCGGCTMAALEAGHAGWFAELARFGIDLIWHPS
FT                   ASEETGDQAVAILDRLVAGEQRLDALVIEGALLCGPNGTGRFNMLGGTGRPVLHWVEAL
FT                   ARRAGYVVAAGSCAAFGGVPMAGDNPTDATGLQFAGPARGGALGAEFRSAAGLPVINIA
FT                   GCAPHPGWIVETLASLALGGLGPDGLDRYGRPRFFADHLAHHGCARNEFYEYKASAEEL
FT                   SQQGCLMEHLGCKATQAVGDCNQRGWNGGGSCTSGGYACIACTSPGFETSQGFMETAKL
FT                   AGIPVGLPLDMPKAWFVALAALSKSAMPNRVRANAAADHIVVPPRSYPGRRP"
FT   gene            527107..528552
FT                   /locus_tag="Rpdx1_0490"
FT   CDS_pept        527107..528552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0490"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: bja:bll6943 HupV protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42130"
FT                   /db_xref="GOA:E6VKK1"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKK1"
FT                   /inference="protein motif:PFAM:PF00374"
FT                   /protein_id="ADU42130.1"
FT                   /translation="MTRRITVGPFNRVEGDLEVRLDIDGGVVVSAEVTAPLYRGFEQIL
FT                   RGRSAMDALTLVPRICGICSVSQSMAAAAALRAAGGVRPARNGVLAANLAHAAENAADH
FT                   LTHFYLFFMPDFARDAYAERPWHPEIAARFKAVQGSAAQAMLPARARLLQIMGLLAGKW
FT                   PHSLAFQPGGTTCAIDLGERVQLLSIIGDFRDFLERTVFGDSLDNVLEVDSARALETWR
FT                   DGRGGDFARFLAVADDLALHRLGRIALPLMSVGAYHGDDVPLFAAGVFDPSSAERAAFD
FT                   PAAITEDVAHAWMRDTALSPMEADTVPDADKPAGYSWCKAPRLGGGPAEVGALARQAVD
FT                   GDPLIRDCLGRFGPCVTTRVIARLRETARLALAMQQWARQLDLAEPFLERGERGRDGSG
FT                   IGLVEAARGSLGHWIELRGDSIRRYQIIAPTSWNFSPRDRGGFPGPLEQALVGTPVGDA
FT                   GARAVTIQHVVRSFDPCMVCTAH"
FT   gene            528788..529900
FT                   /locus_tag="Rpdx1_0491"
FT   CDS_pept        528788..529900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0491"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="TIGRFAM: hydrogenase (NiFe) small subunit HydA;
FT                   KEGG: bja:bll6942 uptake hydrogenase precursor; PFAM: NADH
FT                   ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42131"
FT                   /db_xref="GOA:E6VKK2"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKK2"
FT                   /inference="protein motif:TFAM:TIGR00391"
FT                   /protein_id="ADU42131.1"
FT                   /translation="MGAVTETFYEVIRRQGITRRSFVKFCSLTATSLGLGPIGGTQIAQ
FT                   ALETKPRVPVIWMHGLECTCCSESFIRSAHPLVKDAVLSMISLDYDDTIMAAAGHQADA
FT                   ILEETRKKYKGQYVLAVEGNPPLNEDGMFCIDGGRPFVEKLKEMAEDSLAVIAWGSCAS
FT                   WGCVQAAKPNPTNATPIDKVIRNKPVIKVPGCPPIAEVMTGVVTYIITFGRLPELDRQG
FT                   RPKMFYSQRIHDKCYRRSHFDAGQFVEEWDDDGARKGYCLYKMGCKGPTTYNACSTVRW
FT                   NGGVSFPIQSGHGCIGCSEDAFWDKGSFYDRLTTINQFGIEANADQIGATVAGVVGTAI
FT                   AAHAAVTTVRNLSRRKEVPNGNGTSNGKSA"
FT   gene            529919..531712
FT                   /locus_tag="Rpdx1_0492"
FT   CDS_pept        529919..531712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0492"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: bbt:BBta_1997 uptake hydrogenase large subunit
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42132"
FT                   /db_xref="GOA:E6VKK3"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKK3"
FT                   /inference="protein motif:PFAM:PF00374"
FT                   /protein_id="ADU42132.1"
FT                   /translation="MTNVTTPNGFKLDNAGRRVVVDPVTRIEGHLRVEVNVDSSNVIRN
FT                   AVSTGTMWRGIEVILKGRDPRDAWAFTQRICGVCTGTHALTSVRAVENALNISVPENAN
FT                   TIRNIMQLALYVHDHLVHFYHLHALDWVDVVSALKADPKATSALAQSISPWPMSSPGYF
FT                   KDLQIRLTKFVESGQLGPFKNGYWGHPAYKLPPEANLMAVAHYLEALDFQKEIVKIHTI
FT                   YGGKNPHPNWLVGGVPCSINVDGTGAVGAINIERLNLVSSIIDQTVAFVEQVYVPDLVA
FT                   IAGFYKDWLYGGGLSSKSVMSYGDLPEYANDYSDKSLMLPRGVIINGNLNEVLPVDLSA
FT                   PDQIQEFVTHSWYKYADEGKGLHPYDGVTEPNFVLGPNTKGTRTNIEALDESAKYSFLK
FT                   APRWKGHAVEVGPLARYIIGYAQGKPEFKEPTEKLLKTLDVPVTALFSTLGRTAARGLE
FT                   CQWAARKLRAAQDKLMASIKAGDLSTANTDKWHPSSWPKDVKGVGFTEAPRGALAHWVR
FT                   IKDTRIDNYQCVVPTTWNGSPRDPQGNIGAFEAALLDTPMADPNQPLEIIRTLHSFDPC
FT                   LACSTHVMSEDGQEMARVKVS"
FT   gene            531729..532457
FT                   /locus_tag="Rpdx1_0493"
FT   CDS_pept        531729..532457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0493"
FT                   /product="Ni/Fe-hydrogenase, b-type cytochrome subunit"
FT                   /note="TIGRFAM: Ni/Fe-hydrogenase, b-type cytochrome
FT                   subunit; KEGG: bja:blr6947 Ni/Fe-hydrogenase B-type
FT                   cytochrome subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42133"
FT                   /db_xref="GOA:E6VKK4"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKK4"
FT                   /inference="protein motif:TFAM:TIGR02125"
FT                   /protein_id="ADU42133.1"
FT                   /translation="MTTEIARVQGAIDSAGERARSLQTVYVYQAPVRLWHWVNALLIVA
FT                   LCVTGYLIGSPPPSVPGEAIASFQMGYIRFIHFAAGQTLLVFFLLRAYWAIVGNKYSKQ
FT                   LFYMPVTNRTWWWGMLYEFKWYAFLVKDPKKYIGHNPLAHVAMFTFMLFMIFMICSGMA
FT                   LYAEGQGIDSWQYKLFGFMFWIFPNSQDLHTVHHLGMWAIVVFVIVHIYAAVREDILSR
FT                   QSMISSIVSGERLFRDDLPD"
FT   gene            532585..533172
FT                   /locus_tag="Rpdx1_0494"
FT   CDS_pept        532585..533172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0494"
FT                   /product="hydrogenase expression/formation protein"
FT                   /note="KEGG: bja:bll6939 HupD protein; TIGRFAM: hydrogenase
FT                   expression/formation protein; hydrogenase maturation
FT                   protease; PFAM: peptidase M52 hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42134"
FT                   /db_xref="GOA:E6VKK5"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004419"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKK5"
FT                   /inference="protein motif:TFAM:TIGR00140"
FT                   /protein_id="ADU42134.1"
FT                   /translation="MTDAPRVLILGIGNILWADEGFGVRAVEAFHRAYDVPANVTVLDG
FT                   GTQGLYLVNFLQDHDHLLVFDAIDYGLEPGTLKLVRGDEVPKFTGAKKMSLHQTGFQEV
FT                   LSAADLLGAAPRELALIGCQPLDLENWGGALTEPVRARIAPSLAMACAILAEWGIAVAR
FT                   RAEPLPEGAALLANDLDHDHYERRDAAASPTI"
FT   gene            533186..533779
FT                   /locus_tag="Rpdx1_0495"
FT   CDS_pept        533186..533779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0495"
FT                   /product="HupE/UreJ protein"
FT                   /note="KEGG: xau:Xaut_2188 HupE/UreJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42135"
FT                   /db_xref="GOA:E6VKK6"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKK6"
FT                   /inference="similar to AA sequence:KEGG:Xaut_2188"
FT                   /protein_id="ADU42135.1"
FT                   /translation="MTHLLRAGAALIALLGLSGLAEAHTGVHPMAADGFAAGFVHPFSG
FT                   LDHLLAMVAVGLWAWSLGGAARWSVPASFVALLAIGATLGASGVSLPAVEPMIALSVIA
FT                   LGGLVALSVRVPTAAAAAMVALFGLFHGYAHGAEMPALAQPLAYGAGFVAATALLHGLG
FT                   LALGAALPRFAPARSLRFAGVALAAAGVALALPL"
FT   sig_peptide     533186..533257
FT                   /locus_tag="Rpdx1_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 24"
FT   gene            533801..534103
FT                   /locus_tag="Rpdx1_0496"
FT   CDS_pept        533801..534103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0496"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="KEGG: bja:bsl6938 hydrogenase expression/formation
FT                   protein; TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42136"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKK7"
FT                   /inference="protein motif:TFAM:TIGR00074"
FT                   /protein_id="ADU42136.1"
FT                   /translation="MCVGLPMTVISTEEGSALCVRRGEHRSVSTMLIGEVAPGDQLLVF
FT                   IDSAIRRLDPEEARLIDDALDGVAAALEGRPFEHLFADLIDREPELPAHLRRDPQ"
FT   gene            534324..534725
FT                   /locus_tag="Rpdx1_0497"
FT   CDS_pept        534324..534725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0497"
FT                   /product="hydrogenase-1 expression HyaE"
FT                   /note="PFAM: hydrogenase-1 expression HyaE; KEGG:
FT                   bra:BRADO1689 hydrogenase expression/formation protein
FT                   HupG"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42137"
FT                   /db_xref="InterPro:IPR010893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKK8"
FT                   /inference="protein motif:PFAM:PF07449"
FT                   /protein_id="ADU42137.1"
FT                   /translation="MSGSLAHAAARQNPPALVDEAGVDDFIARSGRIVVLFFRGDAARF
FT                   PEAADLAVVLPELINAFPGRLVAAEIAAEAERGLMARFGVAVCPSLAVVQPGRTLGVIA
FT                   KIQDWSSYLAQIGAMLAEVDRRGEAELRS"
FT   gene            534722..535588
FT                   /locus_tag="Rpdx1_0498"
FT   CDS_pept        534722..535588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0498"
FT                   /product="HupH hydrogenase expression protein"
FT                   /note="PFAM: HupH hydrogenase expression protein; KEGG:
FT                   bra:BRADO1690 hydrogenase expression/formation protein
FT                   HupH"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42138"
FT                   /db_xref="InterPro:IPR006894"
FT                   /db_xref="InterPro:IPR038527"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKK9"
FT                   /inference="protein motif:PFAM:PF04809"
FT                   /protein_id="ADU42138.1"
FT                   /translation="MRVGYWTKPDSDDIEMTLLPIGAGDAGRFGVTGAGAIAALATRGG
FT                   EELTRQCPLLAGTLTQLAEALAAQRVEGPTTLLSIDHLSQAERSLLDDILGEGEVSGIV
FT                   ALPDRRVAQIQESVLAGLWRVRIEGDADGPARDYLEIGSIPAIVSRAAQDFPAPHIAIT
FT                   APPAGAMNVQPVLVEIRDRMAAHRIGRPSHVINFTLLPMNAADMDHLAATLGNGAIQLW
FT                   SRGYGSCRVLATGARHVWSVQFLNAMDTPILDTIEIGDVPAAVRAADEDFHDSAERLGE
FT                   IIEAYFR"
FT   gene            535585..535797
FT                   /locus_tag="Rpdx1_0499"
FT   CDS_pept        535585..535797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0499"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   azo:azo3796 rubredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42139"
FT                   /db_xref="GOA:E6VKL0"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKL0"
FT                   /inference="protein motif:PFAM:PF00301"
FT                   /protein_id="ADU42139.1"
FT                   /translation="MTEFATSPDTETDPRSRMECGVCWTVYDPAEGDPLGRAAPGTPFA
FT                   ALPDDWCCPTCDAPPAKFLRLDDDH"
FT   gene            535787..536314
FT                   /locus_tag="Rpdx1_0500"
FT   CDS_pept        535787..536314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0500"
FT                   /product="hydrogenase expression/formation"
FT                   /note="KEGG: bbt:BBta_2004 hydrogenase
FT                   expression/formation"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42140"
FT                   /db_xref="InterPro:IPR023994"
FT                   /db_xref="InterPro:IPR038530"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKL1"
FT                   /inference="similar to AA sequence:KEGG:BBta_2004"
FT                   /protein_id="ADU42140.1"
FT                   /translation="MTTEPTEPRDAEARAAGEAVAAIYRAAVPAMRDLPVFNPALDVAA
FT                   IGFRARRDVAFGVIVTPWFMNLVRIPLDPGAAAKQGQGEAVTHVLPVGALEFTIGRLDG
FT                   FGGIESCSLFSPMFGFADQAAAEAAAAAALAAVLEPEQAADETSPPQAPGKMATTLDRR
FT                   GLLRGAWMEWRP"
FT   gene            536311..537420
FT                   /locus_tag="Rpdx1_0501"
FT   CDS_pept        536311..537420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0501"
FT                   /product="hydrogenase expression/formation"
FT                   /note="KEGG: bbt:BBta_2005 hydrogenase
FT                   expression/formation"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42141"
FT                   /db_xref="GOA:E6VKL2"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKL2"
FT                   /inference="similar to AA sequence:KEGG:BBta_2005"
FT                   /protein_id="ADU42141.1"
FT                   /translation="MTAAPGEDRIEVGIVRRGDRVVRLDITARRPIGIGRLAQGKSGET
FT                   VVALVPRLFALCASAQGVAAAQALAAARGISPSPAIVAAQASAVLAERMIELLRGTVLL
FT                   LGGGGSPSLTHHLRDLTIAARPRDPAAPLDDDAISRIAQGLEALGLAPRSFADVAACRR
FT                   WLGSDMLLAELHRPLVAEAEFGGAVIDPLTAADDAAIGERLIALGPSFAVRPDLAGRVP
FT                   ETGALARNADHPVIASFGGGLGGRLLARLIEIAATPELLRAVRRGNVDTGTVVQSAPLG
FT                   AGIGLAAVESARGRLHHLIALDAGGAIRQFEILAPTEWNFHPEGPLARALVGTNLRATE
FT                   PDRQRVAALVAAFDPCVGYDVRFREAADA"
FT   gene            537413..537754
FT                   /locus_tag="Rpdx1_0502"
FT   CDS_pept        537413..537754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0502"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /note="KEGG: bja:bll6932 HypA protein; TIGRFAM: hydrogenase
FT                   nickel insertion protein HypA; PFAM: hydrogenase
FT                   expression/synthesis HypA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42142"
FT                   /db_xref="GOA:E6VKL3"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKL3"
FT                   /inference="protein motif:TFAM:TIGR00100"
FT                   /protein_id="ADU42142.1"
FT                   /translation="MHEMALCESLIEIIEREARAQDFSLVRTVWVEIGALSHVEPEAMR
FT                   FCFSAVADAGIAAGARFEIVTVPGEAWCMDCAKTVPLAQRAEPCPDCGGYRLQVTAGDE
FT                   LRIKELEVE"
FT   gene            538042..538737
FT                   /locus_tag="Rpdx1_0503"
FT   CDS_pept        538042..538737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0503"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="KEGG: msl:Msil_2744 hydrogenase accessory protein
FT                   HypB; TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42143"
FT                   /db_xref="GOA:E6VKL4"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKL4"
FT                   /inference="protein motif:TFAM:TIGR00073"
FT                   /protein_id="ADU42143.1"
FT                   /translation="MPGLTQARVVQIERDILSKNDGYAAENRARFAAAGCFVLNFVSSP
FT                   GSGKTTLLVKTITDLKGQYPIAVVEGDQQTANDAERIRAAGAPAIQINTGKGCHLDAHM
FT                   VGHALDQLPPAQGGLLFIENVGNLVCPAAFDLGEAHKVAVLSITEGEDKPLKYPHMFAA
FT                   SDLLLLNKIDLLPHLDFDLAATIEYARRVNPKIEVLTVSARTGEGMPAFYAWIAKRAAA
FT                   ARASATAAE"
FT   gene            538742..540994
FT                   /locus_tag="Rpdx1_0504"
FT   CDS_pept        538742..540994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0504"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="KEGG: bja:bll6930 hydrogenase maturation protein;
FT                   TIGRFAM: [NiFe] hydrogenase maturation protein HypF; PFAM:
FT                   SUA5/yciO/yrdC domain; acylphosphatase; zinc finger HypF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42144"
FT                   /db_xref="GOA:E6VKL5"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKL5"
FT                   /inference="protein motif:TFAM:TIGR00143"
FT                   /protein_id="ADU42144.1"
FT                   /translation="MQPAVALVPDATRARVRVRGAVQGVGFRPFVYHLAQRYRLGGFVA
FT                   NDAEGVLIEVEGAALPEFIAALRSEAPPLARVDAIETEALHARGDRDFDIAETRGGVVT
FT                   TRIGADAATCEACLDDLFDPASRFHLYPFVNCTHCGPRYTLTQRLPYDRANTSMAKFAL
FT                   CADCARDYRDPANRRFHAEPVACPACGPRLDHSIAGIVACLRAGGIVALKSLGGYHLLC
FT                   DATNETAVAELRRRKGRDAKPFAVMVASEASLDRLAEASAAERALLSSVERPVVLMKSR
FT                   GVLAPSVAPGLGALGVMLPYTPLHHLIFHAAAGSPAGRDWQRAPVDLVLVATSANGGGD
FT                   PIVTDDAGRKLAGVADLIVGHDRAIVVRADDSVAAIIDGAPSFIRRARGHTPRPISLPR
FT                   AVPPVLAVGAYLKTTIALTRGREAFVSQHIGDLATAETVRFFEHTVAHLTDLVGVTAAA
FT                   IAHDLHADFASTRFAEGLGLPLIAVQHHHAHVASIAAEHGVAAPLLGLVLDGHGAGSDG
FT                   GNWGGELLRVDGARFARLGHLRPLPLPGGDAAAREPWRMAAAALHVLGQGRAIAARFAD
FT                   QPRAAALAAMLANHGCATTTSAGRLFDAAAGLLGVCATQSYEGQAAMQLEALVKCPRVL
FT                   GGGWEIGAGTLDLSPLLAHLAARPDAQDGAELFHGTLAAALADWAVQAAEQTGLTTIAL
FT                   GGGCFLNRVLSEDLAARLRANGLVPLLARQVPPNDGGLSLGQAWIAGQLMAERELR"
FT   gene            540994..541227
FT                   /locus_tag="Rpdx1_0505"
FT   CDS_pept        540994..541227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0505"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="KEGG: bja:bsl6929 hydrogenase expression/formation
FT                   protein; TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42145"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKL6"
FT                   /inference="protein motif:TFAM:TIGR00074"
FT                   /protein_id="ADU42145.1"
FT                   /translation="MCLAIPAEVIELLPDQMARVSLGGVGKVISVALVEGVAVGDYVVV
FT                   HVGFALTRIDPEEARQTLALLAEMGQLAEVAQ"
FT   gene            541224..542366
FT                   /locus_tag="Rpdx1_0506"
FT   CDS_pept        541224..542366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0506"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /note="KEGG: bja:bll6928 HypD' protein; TIGRFAM:
FT                   hydrogenase expression/formation protein HypD; PFAM:
FT                   hydrogenase formation HypD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42146"
FT                   /db_xref="GOA:E6VKL7"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKL7"
FT                   /inference="protein motif:TFAM:TIGR00075"
FT                   /protein_id="ADU42146.1"
FT                   /translation="MKYVDEYRDGAVARRIAAAIAQAADPARSYHFMEFCGGHTHAISR
FT                   YGLEDLLPANVRMVHGPGCPVCVLPVGRIDMAIQLALRPEVTLCTYGDLMRVPGSHGAS
FT                   LLRAKAAGADIRMVYSTLDALAIAAAEPEREVVFFAIGFETTTPPTALAIKLARARGLA
FT                   NFTVFCNHVLTPPAIRGILEHPDLDGVPGPQLDGFVGPAHVSAVIGSDAFAPFAREFEQ
FT                   PVVVAGFEPLDVMQAILMLIRQVNDGRHEVENQYIRAVTPEGNMIAKAEVADVFELRDS
FT                   FEWRGFGAVPLSGLRLREAYRGFDAEQRFTMAEISAADNPACECGTILRGIKRPTDCKL
FT                   FGTLCTPETPMGSCMVSSEGACAAHWTYGRFRDHARRNVA"
FT   gene            542363..543409
FT                   /locus_tag="Rpdx1_0507"
FT   CDS_pept        542363..543409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0507"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="KEGG: bbt:BBta_2011 hydrogenase maturation; TIGRFAM:
FT                   hydrogenase expression/formation protein HypE; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42147"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKL8"
FT                   /inference="protein motif:TFAM:TIGR02124"
FT                   /protein_id="ADU42147.1"
FT                   /translation="MSSETRRRKLDLKNGRVDLSHGAGGRAMAHLIGEIFHAAFDNPML
FT                   RAGNDQAAFEVGGGRMVMTTDGYVVSPLFFPGGDIGSLAVHGTINDVAMAGARPLYLSA
FT                   GFIIEEGFAFADLKRIADSMAAASRDAGVPIVTGDTKVVERGKADGVFITTTGIGVAPR
FT                   DLVLSSDQARPGDKVLLSGFIGDHGVAVMSQRQNLAFETTVQSDSAALHELVAAMVAAA
FT                   PQGLRVMRDPTRGGVAATLNELAQQSGVGFRLDEDAVPVRPQVAAACELLGLDPLYVAN
FT                   EGKLIAIVPPEAAGTVLAAMRAHPLGRDAALIGEVILDDHHFVQMTTSFGGGRIVDWLA
FT                   GEQLPRIC"
FT   gene            543449..544897
FT                   /locus_tag="Rpdx1_0508"
FT   CDS_pept        543449..544897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0508"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: bra:BRADO1701 two component sigma-54-dependent
FT                   hydrogenase fis family transcriptional regulator; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   response regulator receiver; helix-turn-helix Fis-type;
FT                   SMART: response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42148"
FT                   /db_xref="GOA:E6VKL9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKL9"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADU42148.1"
FT                   /translation="MSGQATVLVVDDEIRSLESLKRVLSDEFEVICARDPGEARRVLES
FT                   EIVHAILCDQRMQYETGVDFLKHVRETWPDPVRMIISGYSDSEDIIAGINEAGVYQYIA
FT                   KPWHPDKLLDTVRGAVELFRLQKETETANIDVKLTPERVQRVVTEKRGAARKLYDFDRI
FT                   VHAPDSPLAEVIELGKRAAEFDISVLITGESGTGKELLARAIHYGSARSGKAFVVENCG
FT                   ALPDELLESELFGCKKGAFTGAYQDRVGLFEVADGGTIFLDEIGETSPAFQVKLLRVLQ
FT                   ESEIRPLGAQRVRKVDVRIVAATNRDLEAEVRAGRFRRDLFYRLAAFPLHMPSLRERPM
FT                   DVPLIAAKVLADVAKSYGRAVNGFTPGVLARMRHYDWPGNVRELQNEIQRMVVLTRDGW
FT                   LQEADLSARIRQGNEPIRLQSSHHGSATLKTNIEALERHMIIEALDRHGGNISRVAGEL
FT                   GLSRVGLRNKLGRYDLRKGLDDDA"
FT   gene            544890..546239
FT                   /locus_tag="Rpdx1_0509"
FT   CDS_pept        544890..546239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0509"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein;
FT                   histidine kinase A domain protein; KEGG: bja:bll6924
FT                   two-component hybrid sensor and regulator; SMART:
FT                   ATP-binding region ATPase domain protein; PAS domain
FT                   containing protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42149"
FT                   /db_xref="GOA:E6VKM0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKM0"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADU42149.1"
FT                   /translation="MPDRIAPGERLIDRVGSHLLSPLEGDQEAAWIEVIRKMDEVYADL
FT                   LRYETDLEEKNTALEEAQAFISSVIESVSDILIVCDRNGIVLQINPAAVRLLATPAAAV
FT                   VERPLGELVDAADRARIEELLRAPSSSEIALEIRFVTAHGLSDLYAINGATRCDQAGHR
FT                   VGTVLTGRPIGELRRAYEALHTAHSELQRAQRQLVEQEKMASLGRLVAGVAHELNNPIS
FT                   FIYGNIHMLDRYRERMAAYLAAIHGGADPAEIDALRRRLKIDALLADYASLIEGTLEGA
FT                   MRVSDVVKNLRRLSFPRTGETQPIDVDRIVRTAARWAVRAKPGHVDLAFDIVPDLTVVG
FT                   NEGQFHQIMVNLVDNAIDAVRGRPEPRIEISARRQDGEVTITVADNGPGLPDGMIDKIF
FT                   EPFFTTKPVGEGTGLGLWISYGIVREHGGTLAAANRDEGGAAFTVTLPAS"
FT   gene            complement(546469..548178)
FT                   /locus_tag="Rpdx1_0510"
FT   CDS_pept        complement(546469..548178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr2350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42150"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKM1"
FT                   /inference="similar to AA sequence:KEGG:blr2350"
FT                   /protein_id="ADU42150.1"
FT                   /translation="MSSLKHPIADAVASIELVASRIEASFAQVGGQLGEGHGIFQGLNE
FT                   ALADLARELSSAQIEGASGALRDIAGRLNSLADALPAESALLDQLRRNVAEAGSLLKQL
FT                   LKHVEMITTIARSARIESASLEGDREGFIAFTREAYELGKAVQASIEACVRDQQLLAAA
FT                   VETTWGRQSEFERRNRPQLGASGTALMTAFADLGRQRNDSVGVAELAGSSARTISEVVG
FT                   RSIVSLQAGDSTRQRLEHVCEGLRRAAVPEPSLVPEIGEAGALPQLLVHLEAVQLRDAQ
FT                   QEFNSDIGDVVRALSTILAEVATLVEKGRSLHGGREGGSSSFLFQVRQTLAQASSLIGM
FT                   CEDGGRSIDEALSVVENTLERFRDAIANLSDSVVDISLIGMNAGLRAGHLGAKGRAFVV
FT                   IAHEMKVTADQMTGAASRLRPLLSEIGKVGDDLRKTRESSDPATLSGMEASILQTLQHV
FT                   EAGNDRLGGLIGRLIDEGAKFDAVMNGAREQMTSLESSASALPAVAKDLEQAGGDLGRT
FT                   AVGPHDEAVLDELYARYTMERERDVHRRFLQQFGLAAKQQAPVASDCDFELF"
FT   gene            complement(548186..549277)
FT                   /locus_tag="Rpdx1_0511"
FT   CDS_pept        complement(548186..549277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0511"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: bbt:BBta_6730 chemotaxis response regulator
FT                   protein CheB-glutamate methylesterase; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42151"
FT                   /db_xref="GOA:E6VKM2"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKM2"
FT                   /inference="protein motif:PRIAM:3.1.1.61"
FT                   /protein_id="ADU42151.1"
FT                   /translation="MAKQKVRVLIVDDSASVRQVLGTILGEDPEIEVIATASDPFVAAK
FT                   RLQNELPDVILLDIEMPRMDGITFLRKIMAQHPIPVVICSSLTPEGSDLMFEAFEAGAV
FT                   DIVPKPRVDTRQALMESSGRLREAIKSAARARVRPRAARKVIEQKLTADAIIPPPVAGR
FT                   SRPTTERIVCIGVSTGGTEALYDVLEVLPPTCPGILIVQHMPQGFTAAFAKRLNAGCRI
FT                   NVKEAEDGDPVLPGWAYIAPGARHMLLVRSGLRYQIAIKDGPPVSRHRPSADVLFRSAA
FT                   QYAGANALGIIMTGMGDDGARGLLEMRKLGAATCAQDEESCVVFGMPKEAIACGAVEKV
FT                   VSLTQIPREIMAWQQAKQPVAAD"
FT   gene            complement(549298..550155)
FT                   /locus_tag="Rpdx1_0512"
FT   CDS_pept        complement(549298..550155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0512"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   bja:blr2348 protein-glutamate O-methyltransferase; SMART:
FT                   MCP methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42152"
FT                   /db_xref="GOA:E6VKM3"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKM3"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ADU42152.1"
FT                   /translation="MVHANRQPSSRQLTDRQFRSIAELIEGQVGIKMPSAKRVMLEGRL
FT                   HKRVRALNFSGVTEYVDHLFDRQILDDELTHLIDVVTTNKTDFFREPQHFEFLRTVAVP
FT                   ELLKLPDRKSNDLKIWSAACSTGMEAYTTAMVLDDMVQSGSRFQFRILGTDISTAVLRL
FT                   AKSAIYNREAIAPVPAPFVGRYFLTSRDRSRGEVRVVPELRRLTNFTRMNLMDASYPVD
FT                   RDVDVIFCRNVLIYFDRDTQRKVVEQLCSHLRPGGYLLVGHSESMIHSALPKLRQVQPT
FT                   VFKL"
FT   gene            complement(550305..552113)
FT                   /locus_tag="Rpdx1_0513"
FT   CDS_pept        complement(550305..552113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0513"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bja:blr2347 putative sensory transducer
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42153"
FT                   /db_xref="GOA:E6VKM4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKM4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADU42153.1"
FT                   /translation="MRLTVKAKLAGAFGVVILLSAVAGALGYFKLNEMAATTSVLSQAA
FT                   ERMDKASHLKELLLQQVRAEKNAILSVSESEVDRYVAEIAGIRANLMRSRDEVHAVATE
FT                   NGKRILDKFQGVYLRVNASEDQALRLAKSDKAKATELSTTEVRKEVGEATAALDEYITY
FT                   VRKVMYDRSEQAKEDGARAQLMMISLVVASLVIALIAAIWIALNISRGLARAVGLADAV
FT                   AIGDLSQTIDIASDDEIGDLVKSLNAMTANLNATAAVANEIAKGNLTADAKRLSDKDTL
FT                   GIALEQMIHKLRQIVSEALTAAQNVSAGSQELSASAEQLSQGATEQASSAEEASSSMEE
FT                   MAANIKQNAENAGQTEKIAAQSAKDAEASGTAVGRAVQAMQTIAEKITIVQEIARQTDL
FT                   LALNAAVEAARAGEHGKGFAVVASEVRKLAERSQASATEIGELSGETVKVAQEAGEMLA
FT                   KLVPDIKRTAELVQEISSACREQDVGSSQVNQAIQQLDKVGQQNASASEQVSSTSEELA
FT                   SQAEQLQSTIAFFRIEQGASNPHAAPLDKAVGQLRAKASQMASVDRGAKRPAPAKPQRQ
FT                   LKAAGGGGFAFALGDGEDDRDADFQR"
FT   sig_peptide     complement(552042..552113)
FT                   /locus_tag="Rpdx1_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.612) with cleavage site probability 0.331 at
FT                   residue 24"
FT   gene            complement(552180..552662)
FT                   /locus_tag="Rpdx1_0514"
FT   CDS_pept        complement(552180..552662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0514"
FT                   /product="CheW protein"
FT                   /note="KEGG: bbt:BBta_7835 chemotaxis protein CheW; PFAM:
FT                   CheW domain protein; SMART: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42154"
FT                   /db_xref="GOA:E6VKM5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKM5"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADU42154.1"
FT                   /translation="MAETAQYLTLGLAGETFGMSIRNVREILDMRPISRLPHAPEFMLG
FT                   MIDVRGTGYPILDLRLKLDLPAVPATEATRIIILDVPVADRVVGVGFVADCVYEVTDIE
FT                   ESSLEQVPDVGGKWKSDYIAGIGRKGDRFVIIFDLARLMAGTEVSAGAAPSNELAA"
FT   gene            complement(552723..553190)
FT                   /locus_tag="Rpdx1_0515"
FT   CDS_pept        complement(552723..553190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0515"
FT                   /product="CheW protein"
FT                   /note="KEGG: bbt:BBta_6736 CheW protein; PFAM: CheW domain
FT                   protein; SMART: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42155"
FT                   /db_xref="GOA:E6VKM6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKM6"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADU42155.1"
FT                   /translation="MSSDRVQDTTDGGSAMQVVMIGLGEEKFALDAGLVREIIDPIPAT
FT                   KVAGAKAFVPSVINVRGNVIPYADLRIRFGMPAACETVDTRIVMVEVRIDGDPVLVGVS
FT                   ADKVYEVTEISRTDVQQTPRVGMHWKPEYIRFITKWRDEFVVVPNMERILN"
FT   gene            complement(553190..555211)
FT                   /locus_tag="Rpdx1_0516"
FT   CDS_pept        complement(553190..555211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0516"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="KEGG: bbt:BBta_6737 chemotaxis protein CheA; PFAM:
FT                   ATP-binding region ATPase domain protein; Signal
FT                   transducing histidine kinase homodimeric; Hpt domain
FT                   protein; CheW domain protein; SMART: CheW domain protein;
FT                   Hpt domain protein; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42156"
FT                   /db_xref="GOA:E6VKM7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKM7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU42156.1"
FT                   /translation="MTTIDPAAVFRQEAAELFEVLETALLDLGQNPDDRELVDSAFRAL
FT                   HTIKGSGAMFGFDKVASFTHEFETAFERVRKGEIKPTQDLVSVALAAKDFIRALIETPD
FT                   DTDAIIGEAILADLSRFVSTTETMEAASPERRRVGWHLRFEFDSQILRNGSNPLDLLDD
FT                   LAKLGSCFATPLTDGIPFLDELVPEDCYLKWDVSLHSDCDKTAIDDVFMFVVDEMQLVL
FT                   EPLFEGEAPQPVPMLDLPEVSILPPEPPPSMEETTPAPAAATAAASAERRSGEPRRAED
FT                   RGIATVRVQAERLDELMDRVGELVIAQARLSQLAASGTDISIKLIAEEIERLASSLRDT
FT                   TMGARMVPIGSLFGRFRRLVHDLSRDLGKPVEFITVGEDTELDKTMIECLADPLVHLIR
FT                   NAIDHGIEPPSARIAAGKPEQGRIELAAQHCGAQVLVTVKDNGGGLNTARIRAKAEEQG
FT                   LIAPGASASDQEIHQFLFHPGFSTAQTISALSGRGVGMDVVKRTIENMRGSIELSTVAG
FT                   EGATVTLRLPLTLAIIEGLLIRVGSGRYIIPLSAVEECVELTAEDERSRSRNFLNVRGN
FT                   LVPFLRLRDIFDADGEPDQHQKTIIISTGETRVGLVADQIIGNHQTVIKSLSKLHSNVT
FT                   TFSGATILGDGTAALILDVVQLVGLAQAQAEKQMSEAA"
FT   gene            complement(555208..555573)
FT                   /locus_tag="Rpdx1_0517"
FT   CDS_pept        complement(555208..555573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0517"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bja:blr2342 chemotaxis two-component response
FT                   regulator; PFAM: response regulator receiver; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42157"
FT                   /db_xref="GOA:E6VKM8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKM8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU42157.1"
FT                   /translation="MATILTVDDSPSIRQMIKVTLEPAGHSVLEAGDGAQGLSKAQATK
FT                   VDLVITDLNMPVMNGLELIKALRKQPNLVGLPIVFLTTESNDAVKQEAKSCGATGWITK
FT                   PFKPEQLLAVVSKLVRS"
FT   gene            complement(555573..555896)
FT                   /locus_tag="Rpdx1_0518"
FT   CDS_pept        complement(555573..555896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0518"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: bja:blr2341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42158"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKM9"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADU42158.1"
FT                   /translation="MTFDPTEAGAALRLPSDCSISSIRSIHETIQDALGRQGPLEIDCS
FT                   KVNRADLTSVQLLLSTAKTGEAQGRPVVLTELSDVLRDTLQRAGFAGDAMIDKHFPQKK
FT                   GGS"
FT   gene            556197..557315
FT                   /locus_tag="Rpdx1_0519"
FT   CDS_pept        556197..557315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0519"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="KEGG: bja:bll2340 two-component response regulator;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   response regulator receiver; SMART: response regulator
FT                   receiver; metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42159"
FT                   /db_xref="GOA:E6VKN0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKN0"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADU42159.1"
FT                   /translation="MLIQALVVDDSRSALDYLKRTIEADGQVQVIAFTEPVLALASARN
FT                   LDIDIVFADYEMPNMDGISLIRRLRSLPKFSDIPIVMITSVESDEVRLRALDAGATDFL
FT                   PKQPKSLETQVRLRNMIRLGLAVRKLNDRAALLASEVARATHELQEREEEIILRLALSV
FT                   EYRDNDTGDHTLRVAKYSRMIAEGLGLPDRLCRDIYLAAPLHDVGKVATPDDILLKPGR
FT                   LTPDEIAMMQTHTTVGGSILAGSRCELIQLAADIAIAHHERWDGTGYPNRLKGEAIPVA
FT                   ARIVAVADVFDALATKRPYKEAMPLPVARKHLEDGRGQHFDPACVDAFLARWDQVVAIA
FT                   TDRILGSRQDAAPLQPQLQSEAARSAVTAPSA"
FT   gene            complement(557337..557678)
FT                   /locus_tag="Rpdx1_0520"
FT   CDS_pept        complement(557337..557678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_0565 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42160"
FT                   /db_xref="GOA:E6VKN1"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKN1"
FT                   /inference="similar to AA sequence:KEGG:Plav_0565"
FT                   /protein_id="ADU42160.1"
FT                   /translation="MKPRLPLLLIPAGFVIWASAFTLLYAVLSLGCVAGWQSEVIAGMT
FT                   LVRLVLLAVWLVHLAALIGLLIYCVQLRHRSADRTFGFLRRAAIGSTVAALAATVWTGV
FT                   AIPAVTPCL"
FT   sig_peptide     complement(557574..557678)
FT                   /locus_tag="Rpdx1_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.452 at
FT                   residue 35"
FT   gene            complement(557675..560209)
FT                   /locus_tag="Rpdx1_0521"
FT   CDS_pept        complement(557675..560209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0521"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /note="KEGG: pla:Plav_0564 cytochrome c oxidase subunit I
FT                   type; TIGRFAM: cytochrome c oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42161"
FT                   /db_xref="GOA:E6VKN2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKN2"
FT                   /inference="protein motif:TFAM:TIGR02891"
FT                   /protein_id="ADU42161.1"
FT                   /translation="MTTDTQDTRHPPVSAIRLHKRLEAVWGTPPGWARLSAVNHNVVGR
FT                   RFILTAFVFFGIGGVLAMLIRAQLATPRSAFLGPEIYNQIFTMHGTVMMFLFAIPMFEG
FT                   FAIYLLPKLLGARDMAFPRLGAYGYWCYLFGGSILLIALAFGLAPDGGWFMYTPLTSKT
FT                   YSPGINADIWLIGVTFVEVSAISAAIEIIATVLKTRAPGMSIDKMPLLAWYLLVTAFMM
FT                   LFGFPPLILGSVLLELERAFSLPFFDPTRGGDSLLWQHLFWLFGHPEVYIIFLPAAGMV
FT                   STILPTLARREILGYGWIVVSVVALAFLSFGLWVHHMFTVGIPHLALAFFSSASTAVAV
FT                   PTAVQIFAWIGTLAAGRPQLKLPMLYLLGFFSVFVIGGLTGVMLAIVPFNWQAHDTHFV
FT                   VAHLHYVLVGGFVFPMLAAAYYWLPHFTGRVPRHSLGTAAFWLIMIGFNLTFLVMHWTG
FT                   LLGMPRRITGYGPETGWEWPNLLSSIGSFTMAIGFALFAIDVLMHWRHGKRCDRNRWGA
FT                   STLEWATATPPPSYNFASLPQIASRAPLADRPDLGNRLAAGDGYLGFVRHQWLETLGVE
FT                   AVTGRVEQIVRLPNRTFIPLVTAVITGLFFVAVLFKLYVLALIALVAVVAAALMWTPDS
FT                   GERQDRGALPIGNGESAVLHSEAASPPSLWAIWLALAADATAFASLGFGLLFLWVVAPN
FT                   WPPPEWLQWSPLGAALTAAGLAIALLAANVAAMRRVVARAPWREALLAIAASGHIVALT
FT                   GIGAIVLVTPAPTRHAYAAVVLVMLLYAGLHAAIGLVFAGFGIWRSRAGFVSPVRRIDL
FT                   RLGAIWTSYTAALGAAALLLVFGLPLVMGTVQ"
FT   gene            complement(560206..560907)
FT                   /locus_tag="Rpdx1_0522"
FT   CDS_pept        complement(560206..560907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0522"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="KEGG: nwi:Nwi_2313 cytochrome c oxidase, subunit II;
FT                   TIGRFAM: cytochrome c oxidase, subunit II; PFAM: cytochrome
FT                   c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42162"
FT                   /db_xref="GOA:E6VKN3"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKN3"
FT                   /inference="protein motif:TFAM:TIGR02866"
FT                   /protein_id="ADU42162.1"
FT                   /translation="MRRGRAGCIAAVATMPLAGCSGPLSTLDPAGPSAAAIAELWWAML
FT                   AGSIALFGLVMTLLLWTFLRANAHPSSPRPKLWLAGGGLVLPALVLTPLLAYGLLTGER
FT                   LLAHPRAAEVTRIEVEARQWQWNFRYPAAAGGPRMSVNELHLPAGRPVDLHVGSADVIH
FT                   GFWIPRLGGKIDAIPGHINVIRLSADRPGVYRGVCAEFCGGGHTAMDFRVEAHSDDSYE
FT                   DRLRELPRDRP"
FT   sig_peptide     complement(560827..560907)
FT                   /locus_tag="Rpdx1_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.564 at
FT                   residue 27"
FT   gene            560929..561411
FT                   /locus_tag="Rpdx1_0523"
FT   CDS_pept        560929..561411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0523"
FT                   /product="protein of unknown function DUF2231,
FT                   transmembrane"
FT                   /note="KEGG: protein of unknown function DUF2231,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42163"
FT                   /db_xref="GOA:E6VKN4"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKN4"
FT                   /inference="similar to AA sequence:KEGG:BC1002_4825"
FT                   /protein_id="ADU42163.1"
FT                   /translation="MPKTVIEEINEYDTSSVVAFAGHPVHAMLVSFPIALVISTLGCDV
FT                   FYWWSADPFWARAGLWASGFAFWFGVAASIAGTAELLLVEGIRQRTTSWTHAVAGVTLV
FT                   SIAGANWGWRLVQDDPVLPVGLMISALGTVFVGLAGWHGGKLVFDHGVGLMVSTKE"
FT   gene            complement(561375..561869)
FT                   /locus_tag="Rpdx1_0524"
FT   CDS_pept        complement(561375..561869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_0562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42164"
FT                   /db_xref="GOA:E6VKN5"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKN5"
FT                   /inference="similar to AA sequence:KEGG:Plav_0562"
FT                   /protein_id="ADU42164.1"
FT                   /translation="MIAWLKLVHILALMVWCAGLLALPGLFVHRSRLADAEAAELHRLT
FT                   RTLFIKITSPAAFVAVVAGTVLLFMRDVFTTWMMLKLVVVGVLVVIHVRGGHQILNLFG
FT                   PEGHYAAWRRWTMTAATLCTIAGILTLVLAKPVLAPLNLPDWMTRPGGLHSLVETIKPT
FT                   P"
FT   sig_peptide     complement(561765..561869)
FT                   /locus_tag="Rpdx1_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.711) with cleavage site probability 0.321 at
FT                   residue 35"
FT   gene            complement(561866..562600)
FT                   /locus_tag="Rpdx1_0525"
FT   CDS_pept        complement(561866..562600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0525"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /note="PFAM: Cytochrome c oxidase caa3-type, assembly
FT                   factor CtaG-related; KEGG: nwi:Nwi_2311 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42165"
FT                   /db_xref="GOA:E6VKN6"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKN6"
FT                   /inference="protein motif:PFAM:PF09678"
FT                   /protein_id="ADU42165.1"
FT                   /translation="MIEPYCGSAPLPADLFVRWNFDPALLVGLAVGGGVWVARRGACWA
FT                   AGLGWAILAVLFVSPLCALTSALFSVRVGHHVVMVAVAAPLLALSLRRTATASALTRAG
FT                   SAMFMVHTVLLWLWHAPAPYAAALADPAVFWAMELSLLGSAVALWLAVLAPAGAIGRSL
FT                   ALLLGSVVQMGMLGAVITFARAPLYDAHLGVTTAWGLSALQDQQLAGLVMWVPGALPYL
FT                   AVALVLLGRRLDRPIAANEPVR"
FT   gene            complement(562984..564120)
FT                   /locus_tag="Rpdx1_0526"
FT   CDS_pept        complement(562984..564120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42166"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKN7"
FT                   /inference="similar to AA sequence:KEGG:Nham_0500"
FT                   /protein_id="ADU42166.1"
FT                   /translation="MSALRGDAGQQSDHTVDACASPPDVGATTRRRLIAGGLSFGAAAA
FT                   LASFAPANALAQGRQPGADELTPPAPRSIEVRARLIEHFDLRDRARRQFGVLQFRSGLI
FT                   LTSSFRGFGGLSGLRLDPRGERFVAISDKATWFTGRIVYAGSVMTGLADVEAAPLLAAD
FT                   GAPFRARKWYDSESLAFDGGTAYVGFERVNQIVKFEFGHGGVRSRGQPIAIPPALRKLP
FT                   NNKGIEALVMVPRPHPLSGTLIAVSERGLDAARNTIGFLIGGRTPGQFAIHRTANYDIA
FT                   DAALLPDGDLLILERKFSWIEGVHIRIRRIALRAILPGATVDGPAIFEADLGHEIDNME
FT                   ALDVHLDEEGAIVLTMLSDDNFSMLQRTLLLQFSLIPD"
FT   gene            complement(564144..566045)
FT                   /locus_tag="Rpdx1_0527"
FT   CDS_pept        complement(564144..566045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0527"
FT                   /product="cobalt chelatase, pCobT subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="SMART: von Willebrand factor type A; TIGRFAM: cobalt
FT                   chelatase, pCobT subunit; KEGG: bbt:BBta_7564 aerobic
FT                   cobaltochelatase subunit CobT; PFAM: Cobalt chelatase CobT
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42167"
FT                   /db_xref="GOA:E6VKN8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKN8"
FT                   /inference="protein motif:TFAM:TIGR01651"
FT                   /protein_id="ADU42167.1"
FT                   /translation="MTTQNTKIRTGSKEAPTEPFKRAVTSCLRAIAKAPDLEVSFAAER
FT                   PGLAPGKARLPEPARKMSKRDAAIVRGHADSIALKLACHDPKVHRKLMPGNPQARGVFE
FT                   AVEQARVEALGARRMAGVAKNLTAMLDDHFHRGKFDEITDRADAPLSDALAMLVRERLT
FT                   GLAPPTAAKKLVDLWRPVLEDKLGPRLDQLERFADNQAKFGDVIHDMLDALELGDDRDT
FT                   ETDEEDNQDDKQEGENDQGGAEGQPEGESAQEMSTEQAEATTDDVSDSQMESAQASASD
FT                   AFDDSEMGEDETPGEATRPHNRGANEPRGPEYHAFAPKFDEIVAAEDLCDHDELERLRS
FT                   YLDKQLAHLQGIVARLANRLQRRLMAQQNRAWDFDLEEGILDPARLSRVVIDPFHPLSF
FT                   MSEKEATFRDTVVTLLLDNSGSMRGRPITVAATCADILARTLERCGVKVEILGFTTRAW
FT                   KGGQSREAWLAAGKPANPGRLNDLRHIIYKSADAPWRRARKNLGLMMREGLLKENIDGE
FT                   ALDWAHKRLLGRPEQRKILMMISDGAPVDDSTLSVNPGNYLERHLRHIIEEIETRSPVE
FT                   LIAIGIGHDVTRYYRRAVTIVDAEELGGAITEKLAELFSETAAPAAAPGPHRRRLHS"
FT   gene            complement(566051..566563)
FT                   /locus_tag="Rpdx1_0528"
FT   CDS_pept        complement(566051..566563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0528"
FT                   /product="protein of unknown function DUF29"
FT                   /note="PFAM: protein of unknown function DUF29; KEGG:
FT                   mrd:Mrad2831_3699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42168"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKN9"
FT                   /inference="protein motif:PFAM:PF01724"
FT                   /protein_id="ADU42168.1"
FT                   /translation="MTTTKSKLRSDPIEPATPKPSRRHREDLYGWVQDQVALLKAGRLS
FT                   EIDAVNIADELGDVGRTEYDKLQSAIRVVLLHLLKWDHQPERRSRSWVLSVREHRRRIG
FT                   RLLRDNPSLQPRISDGIAEAYEDAMDDAVKETGLTETAFPATCPYDWRAIVERVIEHDE
FT                   LQSPRRH"
FT   gene            complement(566610..567605)
FT                   /locus_tag="Rpdx1_0529"
FT   CDS_pept        complement(566610..567605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0529"
FT                   /product="cobalt chelatase, pCobS small subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="TIGRFAM: cobalt chelatase, pCobS small subunit;
FT                   KEGG: oca:OCAR_4070 cobaltochelatase, CobS subunit; PFAM:
FT                   ATPase associated with various cellular activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42169"
FT                   /db_xref="GOA:E6VKP0"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKP0"
FT                   /inference="protein motif:TFAM:TIGR01650"
FT                   /protein_id="ADU42169.1"
FT                   /translation="MTAATTTAPEIAGLPDMNVSVRQVFGIDSDLEVPAYSEVDPHVPD
FT                   VDPDYRFDRATTLAILAGFAKNRRVMVTGFHGTGKSTHIEQVAARLNWPCVRVNLDSHI
FT                   SRIDLVGKDAIVVRDGKQVTEFRDGILPWALQHNVALVFDEYDAGRPDVMFVIQRVLEI
FT                   SGRLTLLDQNKVIKPHPAFRLFATANTIGLGDTSGLYHGTQQINQGQMDRWSIVTTLNY
FT                   LPHDEEVEIVLAKAKHYRNAEGRDTVNKMVRLADLTRNAFANGDLSTVMSPRTVITWSE
FT                   NAEIFGDIGFAFRVTFLNKCDELERPLVAEFYQRCFNAELPESSVNIAMS"
FT   gene            567882..568505
FT                   /locus_tag="Rpdx1_0530"
FT   CDS_pept        567882..568505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0530"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   bja:blr0181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42170"
FT                   /db_xref="GOA:E6VKP1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKP1"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADU42170.1"
FT                   /translation="MSSFLDSLVAFAAAHAGWAYLVLFLAALLEAVPVLGSLVPGSTVI
FT                   LALSALIPGGELNPVGVLASAIAGALIGDGAAYWTGRRAQRRILSAWPLSTYPDLVARA
FT                   ESFFRRWGVWAVLFGRFVPPIRAFVPVTAGALQMTPQRFFAVDVPAILIWAPAHVLPGV
FT                   LAATVLERDHATLHHWLPVVAGVAGMAVLGVWAYRRRRSGTQAR"
FT   gene            complement(568625..569269)
FT                   /locus_tag="Rpdx1_0531"
FT   CDS_pept        complement(568625..569269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0531"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="KEGG: nha:Nham_0496 heat shock protein DnaJ-like;
FT                   PFAM: heat shock protein DnaJ domain protein; SMART: heat
FT                   shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42171"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKP2"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ADU42171.1"
FT                   /translation="MPIDSSKFFDKIRVKPRAAEVAREAAREQVRMCDAPGCTSRAAHR
FT                   APKGRGHEKDYWHFCLNHVREFNQGYNFFQGMNPDDVARYQKDALTGHRPTWKMGQNGA
FT                   RSRARSPEDLEGAADPFNVFNEFTGSRRRRRGPDPAEEVRAEPRKVFNAERKALQVMGL
FT                   DSDATLEVVKAKYKALVKQHHPDANGGDRSTEDRLIEIIKAYNYLKTVVRS"
FT   gene            569387..569656
FT                   /locus_tag="Rpdx1_0532"
FT   CDS_pept        569387..569656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0532"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: nha:Nham_0495
FT                   BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42172"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKP3"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ADU42172.1"
FT                   /translation="MGTQDTITQKLREAFTPESLDVVDESNLHEGHAGHAGRSETHFRV
FT                   NIVSAAFAGKSRLDRHRMINELLAAELTGGVHALAIKAKAPGEA"
FT   gene            complement(569751..571067)
FT                   /locus_tag="Rpdx1_0533"
FT   CDS_pept        complement(569751..571067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0533"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   bbt:BBta_7571 CBS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42173"
FT                   /db_xref="GOA:E6VKP4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKP4"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADU42173.1"
FT                   /translation="MEWVTFGIVIACLFGSAFFSASETALTAASRANMMRLAKQGSSNA
FT                   GIVGRLLGMRERMIGALLLGNNVFNIGASALATGLFTAWFGELGVLYATAVMTALVVIF
FT                   AEVMPKTIAISAPDRFALLVAKPMRLMVLVLGPVLVVIEALVRVLMRLLGIKLGANQSL
FT                   LSATERLRGAVELIHHEGGVAKHDRDMFGGLLDLNELQVSDVMVHRTEMVMVNADLPPD
FT                   ELVREVLATEYTRIPLWRDKPENIMGVLHAKDLLRALRAADGDASKIEVGKIALPPWFV
FT                   PEMRPVSEQLKAFRTRKTHFALVVDEYGEVEGMVTLEDILEEIVGDISDEHDVVVAGVR
FT                   TQPDGSVVVDGSVPIRDLNRAMDWNLPDEEATTVAGLVIHEARSIPERGQNFTFHGFRF
FT                   RVLRRERNRITALRISPVPREGEAELIETSNRKTRAGSA"
FT   gene            complement(571082..572230)
FT                   /locus_tag="Rpdx1_0534"
FT   CDS_pept        complement(571082..572230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0534"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="KEGG: bja:bll0187 3-dehydroquinate synthase;
FT                   TIGRFAM: 3-dehydroquinate synthase; PFAM: 3-dehydroquinate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42174"
FT                   /db_xref="GOA:E6VKP5"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKP5"
FT                   /inference="protein motif:TFAM:TIGR01357"
FT                   /protein_id="ADU42174.1"
FT                   /translation="MNAPQKHSAPITVEVALGDRAYDIVIGRDVIASLGERIAKLRPGA
FT                   RTAIVTDRTVAKTWLKRAEEVLDQAGIAHASVIVGEGESSKSYAGLQQVCEALIAAKIE
FT                   RNDLVIALGGGVIGDLAGFSASLLRRGVDFVQVPTSLLAQVDSSVGGKTGINSPQGKNL
FT                   IGTFHQPVLVLADTAILDTLSPRQFRAGYAEVAKYGALGDEAFFAWLEANHAELFSGGA
FT                   AREHAVATSCRAKAAIVARDERETGDRALLNLGHTFGHALEAATGFSDRLFHGEGVAIG
FT                   MVLAAEFSVERGMMPAADAQRLAKHLADVGLPTRLQDIAGFIQEGLADADQLMALMAQD
FT                   KKVKRGELTFILMEGIGRAVIANKVEPAPVRDFLASQLAHRS"
FT   gene            complement(572227..572844)
FT                   /locus_tag="Rpdx1_0535"
FT   CDS_pept        complement(572227..572844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0535"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="KEGG: nha:Nham_0490 shikimate kinase; PFAM:
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42175"
FT                   /db_xref="GOA:E6VKP6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKP6"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ADU42175.1"
FT                   /translation="MSETVPTAAAGRSPEEAAIVAALGDRPVVLIGMMGAGKSTVGRRL
FT                   ALRLGLPFLDADTEIETAAAMTIPEIFQTHGEPHFRDGEARVIARLLDGGTKVLATGGG
FT                   AFMREETRDRIRDKAISLWLEAEADVILRRVKRRADRPLLKPPDPAGTIARLIAERYPL
FT                   YREADITIASRDVPHEKIVDECVAALHHYLCGAPAPTMSETS"
FT   gene            572980..573126
FT                   /locus_tag="Rpdx1_0536"
FT   CDS_pept        572980..573126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bsr0189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42176"
FT                   /db_xref="GOA:E6VKP7"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKP7"
FT                   /inference="similar to AA sequence:KEGG:bsr0189"
FT                   /protein_id="ADU42176.1"
FT                   /translation="MPTLFRFLTVIAVVGGIIYGTIFVLAHFVSPNTREMTVTIQPDKF
FT                   LKK"
FT   gene            573176..574159
FT                   /locus_tag="Rpdx1_0537"
FT   CDS_pept        573176..574159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0537"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="KEGG: nha:Nham_0488 tyrosine recombinase XerD;
FT                   TIGRFAM: tyrosine recombinase XerD; PFAM: integrase family
FT                   protein; integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42177"
FT                   /db_xref="GOA:E6VKP8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKP8"
FT                   /inference="protein motif:TFAM:TIGR02225"
FT                   /protein_id="ADU42177.1"
FT                   /translation="MQPESEAQAAPLRPTSYSDAGLTELFLDMIAAEQGASANTLDAYR
FT                   RDLADLSHFLSRRRLSIGAADTAALRGYLADLDKRGFATSSVARRLSALRHLFRFLLSE
FT                   RIRADDPAAILAGPKRGRSLPKVLSIADVDRLLACARQEADAAEGAARLRAARLNCLLE
FT                   VLYATGLRVSELMALPLSAARRDARIIVVRGKGDKERLVPLNAGAKQAMARYLEEVAAV
FT                   AKDPKGASSKWLFPSFGDSGHLTRQHFARDLKDLAARAGLSPRLVSPHVLRHAFASHLL
FT                   HNGADLRIVQTLLGHSDISTTQIYTHVVEERLKSLVRDLHPLSNRS"
FT   gene            574272..574895
FT                   /locus_tag="Rpdx1_0538"
FT   CDS_pept        574272..574895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0538"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: acr:Acry_2218 PadR-like family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42178"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKP9"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADU42178.1"
FT                   /translation="MFGFHKEMQFPGRHGRSGRGHGHHAQAFHAGPRRGGGWEDEIGGV
FT                   GHPGHGRRGGGRRMFDGSELRLLLLKLIADKPRHGYDLIRAIEERTGGAYAPSPGIVYP
FT                   TLTMLSEMGLIEEQLTEGARKQFAATAEGAAHLAAHAAELAAIIARLDALGAMRERIDA
FT                   APARRAMQNLRSVLQNRLGEGLDKAKLHEAVALIDEVASRIERL"
FT   gene            574938..576074
FT                   /locus_tag="Rpdx1_0539"
FT   CDS_pept        574938..576074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0539"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; KEGG: nwi:Nwi_0392 acetyl-CoA
FT                   carboxylase carboxyltransferase subunit alpha; PFAM:
FT                   Acetyl-CoA carboxylase, alpha subunit, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42179"
FT                   /db_xref="GOA:E6VKQ0"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKQ0"
FT                   /inference="protein motif:TFAM:TIGR00513"
FT                   /protein_id="ADU42179.1"
FT                   /translation="MPAVGLMLVSPGDATHSHPSRRWMRSAACPIRLTWLPDGLKSRAA
FT                   PIGRSFPPHIALVMSGPMRSYLDFEKPVAELDSKIDELRTLAASGSDIHEEVEKIEEKA
FT                   QQALHDLYAALTPWQKTQVARHPQRPHCVDYIEALITEFTPLAGDRKFGDDEALVGGFG
FT                   RFRGESVCVIGQEKGSTTESRLRHNFGMARPEGYRKAVRLMEMADRFDLPVLSLVDTAG
FT                   AYPGIGAEERGQAEAIARSTEACLQLGVPNVAVVIGEGGSGGAIAIATANKVLMLEHAV
FT                   YSVISPEAASSILWRDGTKAQEAANSMKITAQDLLKFGVIDQILAEPKGGAHRDPAAMI
FT                   ATAGDAIAAAFAELKGQGRDAIRAHRRQKFLDIGRKLA"
FT   gene            576447..577880
FT                   /locus_tag="Rpdx1_0540"
FT   CDS_pept        576447..577880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0540"
FT                   /product="putative exported protein; putative
FT                   transcriptional regulatory protein at C-terminal"
FT                   /note="KEGG: bra:BRADO0605 putative exported protein;
FT                   putative transcriptional regulatory protein at C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42180"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKQ1"
FT                   /inference="similar to AA sequence:KEGG:BRADO0605"
FT                   /protein_id="ADU42180.1"
FT                   /translation="MTKSPLVRALLVTAALATMPLLAGCNSDQMALATNAKASQPVPPK
FT                   LVAAMQEKNMDLQSPILVRLFKQEAELEVWKQDRTGVFQLLKSYPICRWSGDLGPKIRE
FT                   GDRQAPEGFYSISPGQMNPQSSYYLSFNTGYPNAFDKSLGRTGSQLMVHGDCSSRGCYA
FT                   MTDEQIAEIYALGRESFFGGQRAFQLQAYPFKMTPANFAKHRNNPNMPFWKMLKQGYDH
FT                   FEVTRQEPKVDFCEQKYVFDAAPPPGSTRPLQFNASAKCPAYEVRPDIAQAVREKDRQD
FT                   SVKIAELIAKGTPVARLNTGIDGGMNHVFASKIPEASTGLSDTPESTTLASFDRAPGTI
FT                   PPTVNPPRPSDNLLIAAPAESSGGAAKARVASASKDDIGSLLAGSHKPGNESATSARPV
FT                   PSAPVSTATRHEPAPRPQGAAPKASETKQAAASRPPLRPSVDAAETTSSASARPSGMIS
FT                   GGAPVVSSNSFDSRFSAFR"
FT   sig_peptide     576447..576518
FT                   /locus_tag="Rpdx1_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.537 at
FT                   residue 24"
FT   gene            complement(578120..580960)
FT                   /locus_tag="Rpdx1_0541"
FT   CDS_pept        complement(578120..580960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0541"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: bja:bll0204 preprotein translocase subunit
FT                   SecA; TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SecA DEAD domain protein; SecA preprotein cross-linking
FT                   region; SecA Wing and Scaffold; SEC-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42181"
FT                   /db_xref="GOA:E6VKQ2"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKQ2"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADU42181.1"
FT                   /translation="MIGAFARKLFGSANDRRVKGYQSRVAAINALEPELSKLSDEALRA
FT                   RTAEFRAELAAGKTLDDLLVPAFATVREAAKRTLGQRHFDVQLIGGMVLHEGDIAEMKT
FT                   GEGKTLVATLAVYLNALPGKGVHVVTVNDYLATRDSGWMGQIYGFLGMTTGVIVHGLDD
FT                   SQRQAAYACDITYGTNNEYGFDYLRDNMKYRLEDMVQRGHHFAIVDEVDSILIDEARTP
FT                   LIISGPLDDRSDFYNTIDTFIPRLDKSDYDVDEKQRTVTLTEGGMEKIETLLRDAGQLR
FT                   GESLYDIENVSVVHHVNQALRAHALFHRDKDYIVRNDEVVIIDEFTGRMMQGRRYSEGL
FT                   HQALEAKEHVTVQPENQTLASITFQNYFRMYDKLGGMTGTAATEADEFFDIYKLEVVEI
FT                   PTNLPIARLDEDDEVYRTQGEKYAAILAEVERANKRMQPVLVGTGSIEKSEVLAEYLKK
FT                   NGYKQIDFTDPKGMDKLYAAARAGKPAKLFAVLNARFHEQEAYIVAEAGVPGAITIATN
FT                   MAGRGTDIKLGGSLEMRIQQEAAHITDEAEKAAKIAEIKADIERFRTMVLNAEDEIEIE
FT                   PAKGNKPAKTAKRPGGLYIIGSERHESRRIDNQLRGRSGRQGDPGRSKFFLSLEDDLMR
FT                   IFGSGKLDTMLTRLGLKEGEAIIHPWINKALEKAQQKVEARNFDIRKNLLKFDDVQNDQ
FT                   RKVIFDQRVELMKEDSVAETVTDMRHTYIEDLVSKYVPEHAYAEQWDVAGLKAELQRVV
FT                   GFDIPVDEWAKEEGIADEELMTRLERVFDEHMAAKVGQWGTDVMRYAEKSILLQTLDHL
FT                   WREHLVMLDHLRQVIGLRGYGQRDPLQEYKSEAFNLFQEMSSHLREAVTAQLMRVEIIP
FT                   PDQPQELPPMEVHKMDPDTGEDEMALASVSLAPAQAADKAARDPNKPETWGKVGRNEDC
FT                   PCGSGKKYKHCHGRYA"
FT   gene            581303..582220
FT                   /locus_tag="Rpdx1_0542"
FT   CDS_pept        581303..582220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0542"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: bja:blr0205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42182"
FT                   /db_xref="GOA:E6VKQ3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKQ3"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ADU42182.1"
FT                   /translation="MTPASNAVSSGLRAGLLSAAVTGCLAFALLAAPAVRAEDANPVLA
FT                   KVNGAEIRQSDVDLAEQELGPSLAQMDPASKKENVLAFLIDMKIVAKAAEDKKIQDSAD
FT                   FKKRLDFARNRLLMDDVLAAEGKAATTDEAMKKVYEEAAKQISGEQEVHARHILVETED
FT                   EAKAVAEELKKGADFAELAKKKSKDPGASDGGDLGFFTKDQMVPEFSAVAFALEPGKIS
FT                   DPVKSQFGWHIIKVEEKRNRKPPSFDQVKAQIEQYVARKAQSDYVSKLRQAAKVERMDQ
FT                   APAKPDAAKPADAAKPAAPAPAKK"
FT   sig_peptide     581303..581416
FT                   /locus_tag="Rpdx1_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.575 at
FT                   residue 38"
FT   gene            complement(582313..585036)
FT                   /locus_tag="Rpdx1_0543"
FT   CDS_pept        complement(582313..585036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0543"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS II domain
FT                   protein; MutS III domain protein; MutS IV domain protein;
FT                   KEGG: bja:bll0924 DNA mismatch repair protein MutS; SMART:
FT                   DNA mismatch repair protein MutS domain protein; MutS III
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42183"
FT                   /db_xref="GOA:E6VKQ4"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKQ4"
FT                   /inference="protein motif:TFAM:TIGR01070"
FT                   /protein_id="ADU42183.1"
FT                   /translation="MTIRPDIAPPPEPALPAEAPAKMSPMMEQYHEIKAANPGLLLFYR
FT                   MGDFYELFFEDAEIASRALGITLTKRGKHLGADIPMCGVPVERSDDYLHRLIALGHRVA
FT                   VCEQTEDPAAARARKSVVRRDVVRLITPGTLTEDTLLDARANNYLLAIARARGSSGADR
FT                   IGLAWIDISTGEFCVTECSTGELAATLARINPNEAIVPDALYGDAELAPTLRELAAVTP
FT                   LTRDVFDSATAERRLCDYFAVATMDGLAALSRLEATAAAACVTYVDRTQLGKRPPLSPP
FT                   AREASGTTMAIDPATRANLELTRTLAGERRGSLLDAIDCTVTAAGSRLLAQRLAAPLTD
FT                   AAAIARRLDAVEAFAADSGLREQIRSSLRAAPDMARALARLSLGRGGPRDLANLRDGIR
FT                   AADEVLTQLGQLATPPQEISAAIAALQRPSRELCAELGRALADDLPLLKRDGGFVRDGY
FT                   EPVLDETRKLRDASRLVVASMQARYADDTGIKTLKIRHNNVLGYFVEVSAQHGEKLMAA
FT                   PLNATFIHRQTLAGQVRFTTAELGEIEAKIANAGDRALGLELEIFDRLSALIDAAGDDL
FT                   RAAAHAFALLDVATALAKLASDDNYVRPEVDESLSFAIEGGRHPVVEQALKKAGEPFIA
FT                   NACDLSPGPAQKSGQIWLLTGPNMAGKSTFLRQNALIALLAQVGSFVPASRARIGIVDR
FT                   LFSRVGAADDLARGRSTFMVEMVETAAILNQASERALVILDEIGRGTATFDGLSIAWAA
FT                   IEHLHEQNRCRTLFATHYHELTALSAKLPRLFNATVRVKEWRGEVVFLHEVLPGSADRS
FT                   YGIQVAKLAGLPASVVARAKTVLAKLEANDRGQPKTLIDDLPLFAITALAPAEAAPPSE
FT                   AEPLIEALKALHPDEMTPREALDALYALKAKLPSAN"
FT   gene            585199..586407
FT                   /locus_tag="Rpdx1_0544"
FT   CDS_pept        585199..586407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0544"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.174"
FT                   /note="TIGRFAM: beta-ketoadipyl CoA thiolase; acetyl-CoA
FT                   acetyltransferase; KEGG: bja:blr0925 beta-ketoadipyl CoA
FT                   thiolase; PFAM: Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42184"
FT                   /db_xref="GOA:E6VKQ5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKQ5"
FT                   /inference="protein motif:TFAM:TIGR02430"
FT                   /protein_id="ADU42184.1"
FT                   /translation="MADVFICDAVRTPIGRYGGSLAKVRTDDLAAVPIKALMARHPDMD
FT                   WSAVDEVFFGCANQAGEDNRNVARMAALLAGLPDSVPGQTLNRLCASGLDAVGAAGRAI
FT                   RGGEIDLAIAGGVESMTRAPFVQGKATEAFARTADIFDTTIGWRFINPLMKQQYGVDSM
FT                   PETGENVAEEFQISRADQDAFAIRSQQRAGAAIAAGYFAEEIAPVTYAGGKAGPITVDK
FT                   DEHPRPETTLEGLAKLKPIVRNPGTVTAGNASGVNDGAAALLIASEAAVKKYGLTPRGK
FT                   ILGLASAAVPPRIMGIGPVPATGKLMERLGLKISDFDLIELNEAFASQGIACLRQLGVQ
FT                   DDADFVNPHGGAIALGHPLGMSGARLALTAVHGLEKRGGKLALATMCVGVGQGVAMAIE
FT                   KVN"
FT   gene            complement(586575..588137)
FT                   /locus_tag="Rpdx1_0545"
FT   CDS_pept        complement(586575..588137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0545"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: bbt:BBta_7638 EmrB/QacA family drug resistance
FT                   transporter; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42185"
FT                   /db_xref="GOA:E6VKQ6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKQ6"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADU42185.1"
FT                   /translation="MAGAAQSHAVPGFRRNMVTICAMTATIMQALDTTIANVALPYMQG
FT                   SLSASQDQINWVLTSYIVAAAIMTAPVGWIANRFGRKRIFIICAAGFTVASVMCGLAQD
FT                   ITQMVAFRLLQGVFGAALVPLSQAVMLDSYALHERAKAMSIWGMGVMMGPIMGPSLGAW
FT                   LTETYSWHWVFFVNLPFGAITVLGLAMFMEETDTNQELKFDWLGFAALAVGIGAMQLAL
FT                   DRGEQLDWFNSPEIIIESIVSVVGFYYFFAHSFTTERPFIQFAIFKDRNFIGGVIFMTV
FT                   MGLVLFSTMALSSPFLQNVEGYPIMTAGLLLASRGCGTLVAMMIVGRIMRHIEARTLIA
FT                   TGLALTCASLYVMTGWTDQTSVPSVVVTSIIQGFGFGLVFVPLSTVAFMTLPGHLRTDG
FT                   TSMLTLVRNVASSVGISVVIAKLSSGTTTAHAILSEHINPFNDALQMPNVTGMIDLSTT
FT                   TGKAMIDAIVTMQAQIIAFSHDYAMVMFLTAAAVPMAIIIGSTKAALRKQGEAAADHAA
FT                   VME"
FT   gene            complement(588141..589307)
FT                   /locus_tag="Rpdx1_0546"
FT   CDS_pept        complement(588141..589307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0546"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bra:BRADO0542 efflux pump protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42186"
FT                   /db_xref="GOA:E6VKQ7"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKQ7"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADU42186.1"
FT                   /translation="MAEPALKFPTEQKDASPGPALAAAGGPRGLGARLRRYRRPLLLVV
FT                   LPLLALIGGITFYLEGGRYVTTDDAYVGAQKVLITPDVAGKIVEVTVKEGQHVEPGDEL
FT                   FQIDPVPFRLAVAQAQAKLADAKTSHANLVANVKLYGHTVELVNAGIALKQRDVERKTS
FT                   LVQSRAGSQLDLDNSTAALVTAQAQLQLVKQQQSTALNQLLGDPELPLEKFPAYAQAKA
FT                   ALEDAERNLRLATVRAPMRGTATQVDNIQLGRFVAAGTPVFSVIDTSQPWVDANPKESD
FT                   FTYVAVGQTVTLDVDAFPDHPFKGRVTSLSPGTGAQFAVLPPQNATGNFVKVVQRVPLR
FT                   IAFNDNDPMIKKLKAGMSVNVAIDTRHRRSLAGLLGFGRAAAAQPEHN"
FT   gene            complement(589325..589786)
FT                   /locus_tag="Rpdx1_0547"
FT   CDS_pept        complement(589325..589786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0547"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: bja:bll0933 transcriptional regulatory
FT                   protein; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42187"
FT                   /db_xref="GOA:E6VKQ8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKQ8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU42187.1"
FT                   /translation="MTSGQPDQDFIFVFAEVQRLIRAYADRQAARHGITRAQWAVLAKV
FT                   ERAEGLKQSELAEMMELQPITLTRLIDKLCDRGWLERRNDDTDRRCKRLHLREAARPLL
FT                   AELAGLRAELTATALAGLAPDDAQRLVGQMQIIKENLRGAIQHNCHREQ"
FT   gene            589989..590477
FT                   /locus_tag="Rpdx1_0548"
FT   CDS_pept        589989..590477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0548"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: nha:Nham_0618
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42188"
FT                   /db_xref="GOA:E6VKQ9"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKQ9"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADU42188.1"
FT                   /translation="MTALKPTFPAPGHDHDRCTAEGIAHAERVCAGRSQNLTPIRRNVL
FT                   QALLSSHRPLGAYEVIEELARVMPRPAPITVYRALDFLMQNGLVHRIESRNAFLACGHD
FT                   HSDTATVAFLICECCGSVGEVSASEVTEILNEAARQTGFTPKMSVVEITGVCGHCQPA"
FT   gene            590643..591566
FT                   /locus_tag="Rpdx1_0549"
FT   CDS_pept        590643..591566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0549"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bja:blr0935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42189"
FT                   /db_xref="GOA:E6VKR0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKR0"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU42189.1"
FT                   /translation="MGRPLSAGAIALMLLCCLSWGFNQIAVKLVLPDIPPFLQAAIRSA
FT                   GALIVILIIARSRRVKLFQRDGTLWAGLSAGVLFGLEFVLIYRGLTLTTASRAVVFLYT
FT                   APFFVALGSYRLLGERLRRLQWAGLGLSFAGVALAIGVPQADVDTSVLVGDLMLVGGGA
FT                   LWAATTLIVKSTRLQRAPAEKGLAYQVAVSVPILAAAAALSGETITKMPSPLSLGLMAY
FT                   QTIWVVGLTFLLWFGLVKTYSASKLSAFTFITPLFGVAAGYLIMHDPLTPAFGAAAVLV
FT                   IAGLYLVNRPAPVPAPNDPLLNVTKT"
FT   sig_peptide     590643..590708
FT                   /locus_tag="Rpdx1_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.621 at
FT                   residue 22"
FT   gene            591580..592875
FT                   /locus_tag="Rpdx1_0550"
FT   CDS_pept        591580..592875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0550"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /note="KEGG: bja:blr0936 4-hydroxy-3-methylbut-2-en-1-yl
FT                   diphosphate synthase; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase;
FT                   PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42190"
FT                   /db_xref="GOA:E6VKR1"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKR1"
FT                   /inference="protein motif:TFAM:TIGR00612"
FT                   /protein_id="ADU42190.1"
FT                   /translation="MNKLENPLQDDVAGPAPRHQTTQVMVGDVAVGGGAPIVVQSMTNT
FT                   DTADVEGTIKQIAALARAGSEMVRITVDREEAAAAVPHIRDGIRKLGLTTPIIGDFHYI
FT                   GHKLLAEYPACAEALDKYRINPGNVGFKNKRDTQFADIVEIAIRNNKAVRIGANWGSLD
FT                   QELLTKLMDENAASAYPCDVRAVTREAMVQSALLSAARAEEIGLPKNKMILSAKVSAVQ
FT                   DLIAVYQDLASRSDYAIHLGLTEAGMGSKGIVASSAALGILLQQGIGDTIRISLTPEPG
FT                   GDRTREVQVAQELLQTMGFRTFVPLVAACPGCGRTTSTTFQELARSIQDFIRDEMPEWR
FT                   SRYPGVENLNVAVMGCIVNGPGESKHANIGISLPGTGESPAAPVFVDGQKFRTLRGDTI
FT                   ASDFKALVIDYIEQRYGATPKPGAAQMVPAAE"
FT   gene            complement(593219..593326)
FT                   /locus_tag="Rpdx1_0551"
FT   CDS_pept        complement(593219..593326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42191"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU42191.1"
FT                   /translation="MHNYHQTAAATVNRWLVEWQAFETKVERISTKHGA"
FT   gene            593407..595068
FT                   /locus_tag="Rpdx1_0552"
FT   CDS_pept        593407..595068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0552"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   met:M446_1827 diguanylate cyclase/phosphodiesterase; SMART:
FT                   EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42192"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKR3"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADU42192.1"
FT                   /translation="MSGSAPGGPVDHDPSQRTAQLTLSAFMAIDIGLALISPDGEIALT
FT                   NPMFDLAFGAIPREQLLLRFGFDPNREGGKASRPIIFPDERIYWIDITAFPGGWLISAA
FT                   DISERLRQGIVGAELVRTDRLTQLPNRLVFRERLGDLLAQPLDIRRDAAVLTVDLDRFK
FT                   AINDTLGRTIGDALLCLVAKRISSALTPSDVLARLEADEFGVIQTGRDQPEAAVMLAKR
FT                   LVDLLGRPYLLEGQLINVSAFVGIALLTDDDLDVDAVSKNADLALHRAKQERYAGYRVF
FT                   ESAMDESMRARRALETDLRRALALREFSLVYQPQVNLQSRRVSGFEALLRWRCPTRGPV
FT                   SPLDFIPIAEETGIIGPIGEWVLRTACRDAAAWPGDYMVAVNISAIQFANRSLVATVVS
FT                   ALADSGLDPRRLELEITESVMLDSRGNALAVLQQLRGLGVRVSLDDFGTGYSSLGYLRS
FT                   FPFDKIKIDQSFVRAASEDPGNRAIVRAIASLGASLGMATVAEGVETEDQLARVAADGC
FT                   TDVQGHLISRPIPPGDIEHFLAESRNVIDAATEVSL"
FT   gene            595086..595529
FT                   /locus_tag="Rpdx1_0553"
FT   CDS_pept        595086..595529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0553"
FT                   /product="BLUF domain protein"
FT                   /note="PFAM: BLUF domain protein; KEGG: mch:Mchl_4401 BLUF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42193"
FT                   /db_xref="GOA:E6VKR4"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKR4"
FT                   /inference="protein motif:PFAM:PF04940"
FT                   /protein_id="ADU42193.1"
FT                   /translation="MSSRLFRCVYYSKNLIAGGPVRIAEEVDSILAAARRNNPPLQITG
FT                   ALVFNRGLFAQVLEGPCPSVERLFEKILRDERHGDIQVLAFGAAEARLFSNWSMAFLGR
FT                   SREDENLFGHIGRQTGFSAERIEGDRLLDIVRNLAFEEEARAA"
FT   gene            complement(595540..596466)
FT                   /locus_tag="Rpdx1_0554"
FT   CDS_pept        complement(595540..596466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0554"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: bja:bll0946
FT                   geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42194"
FT                   /db_xref="GOA:E6VKR5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKR5"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADU42194.1"
FT                   /translation="MATATSTIDFAKRLDSTAEDTEALLGRLLSDELMTDEIARPRRLM
FT                   EAIRYSTLGGGKRLRPFLAVESAAVFGIDRDAALLVGAALECIHCYSLIHDDLPAMDDS
FT                   DLRRGRPTLHKAYDDATAILAGDALLTFAFDIVTRDEVHTDPTVRLMLTRVLARCAGLG
FT                   GMVGGQMLDLAGEGRFGDREPVDVAKLQQMKTGALLRYGCVAGAILGQANAEQYRALDD
FT                   YGRALGEAFQIADDLLDVESDAEALGKPAGADAALGKTTFVTQLGIDGAKQRLRDLIAR
FT                   ADQALAPFGERGDVLRAAARFVAERKN"
FT   gene            596567..597271
FT                   /locus_tag="Rpdx1_0555"
FT   CDS_pept        596567..597271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0555"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="KEGG: nha:Nham_0624 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase; TIGRFAM: monofunctional
FT                   biosynthetic peptidoglycan transglycosylase; PFAM: glycosyl
FT                   transferase family 51"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42195"
FT                   /db_xref="GOA:E6VKR6"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKR6"
FT                   /inference="protein motif:TFAM:TIGR02070"
FT                   /protein_id="ADU42195.1"
FT                   /translation="MSDPVASPLRAKRVVRMVVLAVLALLALPYLLTVLYAAGGQPGST
FT                   LMLGRWLTGAPVSRSWIDIETISPALPRSVVAAEDAKFCSHRGIDWDAVRDVLDDDSTS
FT                   RGGSTITQQVAKNLFLWPGRSVIRKALEAPLALWIDLVMSKRRILEIYLNIAEWGPDGQ
FT                   FGAMAGADYAFGRSAAQLSAKEAALLAAILPNPRIRSAKAPGRGVRRLAATYVARARSA
FT                   ELRQCWQQNRES"
FT   gene            597433..597615
FT                   /locus_tag="Rpdx1_0556"
FT   CDS_pept        597433..597615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0556"
FT                   /product="ribosomal protein L32"
FT                   /note="KEGG: bra:BRADO0557 50S ribosomal protein L32;
FT                   TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42196"
FT                   /db_xref="GOA:E6VKR7"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKR7"
FT                   /inference="protein motif:TFAM:TIGR01031"
FT                   /protein_id="ADU42196.1"
FT                   /translation="MAVPRRKTSPSRRGMRRSADALKRPTYAEDKDSGELRRPHHLDLK
FT                   TGMYKGRQVLKKKDS"
FT   gene            597866..598504
FT                   /locus_tag="Rpdx1_0557"
FT   CDS_pept        597866..598504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_7618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42197"
FT                   /db_xref="GOA:E6VKR8"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKR8"
FT                   /inference="similar to AA sequence:KEGG:BBta_7618"
FT                   /protein_id="ADU42197.1"
FT                   /translation="MSIIGFPLLLIPVAICNIIVFLMPGLGFDAALARVALPSGATWTI
FT                   ALGDVLVALGVLLLLPEVMKAARPGAKYLTDHLLSLLVLGGTVAEFVMLPQFANQTVFV
FT                   LAMLALVDFLSGVALRSRHQSAARAGQPAKRRGKAVQPIALPEDTTEAPAPALPASELS
FT                   PQTAEPTSAATTAASMAEAVLLDRPEPVKAAGSQAVAELAKAEEKSPAR"
FT   gene            complement(598525..598839)
FT                   /locus_tag="Rpdx1_0558"
FT   CDS_pept        complement(598525..598839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42198"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKR9"
FT                   /inference="similar to AA sequence:KEGG:Nham_0627"
FT                   /protein_id="ADU42198.1"
FT                   /translation="MTKVWIDDGSDLHGAAAERDCAEAELIEPLPVPVTPPPMRTRYTD
FT                   RQVRPSSNFVAQLMAIDGGYPQTRDCNRAEPGQANAAYRSTGGHAYAAPSSGLRTQRMS
FT                   "
FT   gene            599078..600148
FT                   /locus_tag="Rpdx1_0559"
FT   CDS_pept        599078..600148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0559"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="KEGG: bja:blr0951 hypothetical protein; PFAM: EAL
FT                   domain protein; SMART: EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42199"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKS0"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADU42199.1"
FT                   /translation="MSSAAPAPRPSTAQTATASDPSLLSLLGQATFVWDLASDALNWTG
FT                   RIAELFQDIPAETLATGASYAAMLEPSRAVRSEALLNAAAAAGPGCVPYRIEYGIRAST
FT                   SAPVCWIEETGVWFAGADGRPARVEGIVRINNERHARDEQLLKLSQHDPLTGELGLIRL
FT                   VDHRVLELVVAELAAAPGVTLSLNISPDTTIDADWWAGIESLMLAHPGIAERLIVEITE
FT                   TVAIPDLDEVRGFVNRLKTLGAKIAIDDFGAGYTSFRNLRALGVDIVKIDGAFVQNIVR
FT                   SADDRAFVQTLIDLARRLGIKTVAEWVQDEDSAQLLCDWGCDYIQGRLIGLASQQRPWP
FT                   LAAGAAAASALGQGAQ"
FT   gene            complement(600425..601015)
FT                   /locus_tag="Rpdx1_0560"
FT   CDS_pept        complement(600425..601015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0560"
FT                   /product="polyhydroxyalkonate synthesis repressor, PhaR"
FT                   /note="KEGG: bbt:BBta_7615 putative polyhydroxyalkanoate
FT                   synthesis repressor PhaR-like protein; TIGRFAM:
FT                   polyhydroxyalkanoate synthesis repressor PhaR; PFAM: PHA
FT                   accumulation regulator DNA-binding protein; PHB
FT                   accumulation regulatory domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42200"
FT                   /db_xref="GOA:E6VKS1"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKS1"
FT                   /inference="protein motif:TFAM:TIGR01848"
FT                   /protein_id="ADU42200.1"
FT                   /translation="MAKSDQPTTIKKYANRRLYNTGTSTYVTLEDLAAMVKNGEDFLVY
FT                   DAKTGDDITRSVLAQIIFEQENKAGQNLLPTTFLRQLIRFYGDSMQMVVPKYLEQSIDS
FT                   LTREQEKFRKQMASTFSMTPFAPLEETVRRNMELFQQTFSMFVPRNPGHESPDDAPAET
FT                   SGSADSIDDLRRQMKEMQDRLERMSLEQPKKDE"
FT   gene            601287..602465
FT                   /locus_tag="Rpdx1_0561"
FT   CDS_pept        601287..602465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0561"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   bja:bll0226 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42201"
FT                   /db_xref="GOA:E6VKS2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKS2"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADU42201.1"
FT                   /translation="MSDDVVIVSAARTAVGSFNGAFATTPAHELGAVAIKAALERGGID
FT                   PAQVSEVIMGQILTAGQGQNPARQASIAAGIPVESPAWGINQLCGSGLRSVALGYQALM
FT                   NGDSDIVVAGGQESMSMAPHAQYLRGGVKMGAVELVDTMLKDGLWDAFNGYHMGNTAEN
FT                   VARQWQITRAQQDEFAVASQQKAEAAQKAGKFKDEIAPVTIKTRKGDIVVDTDEYPRHG
FT                   ATIEAMAKLKPAFEKDGTVTAGSASGINDGAAAVVLMTAKQAEKLGKKPLARIVSWGQA
FT                   GVDPKIMGSGPIPASRAALKKAGWSVGDLDLIEANEAFAAQACAVNKDLGWDTSKVNVN
FT                   GGAIAIGHPIGASGARVLVTLLHEMQKRDSKKGLATLCIGGGMGIAMCLARD"
FT   gene            602647..603372
FT                   /locus_tag="Rpdx1_0562"
FT   CDS_pept        602647..603372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0562"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /note="KEGG: bja:bll0225 acetoacetyl CoA reductase;
FT                   TIGRFAM: acetoacetyl-CoA reductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42202"
FT                   /db_xref="GOA:E6VKS3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKS3"
FT                   /inference="protein motif:TFAM:TIGR01829"
FT                   /protein_id="ADU42202.1"
FT                   /translation="MARVALVTGGTRGIGAAISKALKAAGNEVAASYAGNDSAAEKFKN
FT                   ETGIPVFKWDVSSFDACAEGVKKVEAELGPVDILVNNAGITRDGAFHKMTLEQWNAVIN
FT                   TNLGSLFNMTRQVIEGMRARKFGRIVNISSINGQKGQFGQVNYSAAKAGDIGFTKALAL
FT                   ENARGGITVNAICPGYINTEMVQAVPKDVLEKAILPLIPCNRLGEAEEIARAVVFLAGD
FT                   EAGYITGSTLTINGGQYMV"
FT   gene            603449..604315
FT                   /locus_tag="Rpdx1_0563"
FT   CDS_pept        603449..604315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0563"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: nha:Nham_3690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42203"
FT                   /db_xref="GOA:E6VKS4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKS4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU42203.1"
FT                   /translation="MTPRVATLIGLSAILMWSLLAVMTVATGTIPPFQLAAMTFAIGAA
FT                   AAAVGWIARPQAVRALRQPPLVWAVGVGGLFGYHALYFVALRLAPPAEAGLLNYLWPLL
FT                   IVLFSSLLPGERLKPHHLAGALLGLAGTVLLFTGNGAALERAYLPGLAAAFVAAFVWAS
FT                   YSVLSRRLSAVPTDAVAGFCFVTALLAAAVHVLIEATAWPETALQWVAIVALGIGPVGA
FT                   AFYAWDIGMKRGDIRVLGAASYATPLLSTAFLIVAGYARPTATLAVAALLIAGGGLLAA
FT                   KDMLKRG"
FT   sig_peptide     603449..603592
FT                   /locus_tag="Rpdx1_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.328 at
FT                   residue 48"
FT   gene            complement(604353..604871)
FT                   /locus_tag="Rpdx1_0564"
FT   CDS_pept        complement(604353..604871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0564"
FT                   /product="putative protease"
FT                   /note="KEGG: bbt:BBta_7351 putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42204"
FT                   /db_xref="GOA:E6VKS5"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:E6VKS5"
FT                   /inference="similar to AA sequence:KEGG:BBta_7351"
FT                   /protein_id="ADU42204.1"
FT                   /translation="MRSILIFAAALVVLGTVMAQIADRIAPAPAQAHAASPGTIGMLAA
FT                   SDGGRRNLSIARDPRGHFRTDGRIDGQRLTFMVDTGASAVALNESSAARFGLRPSRGDY
FT                   TTQVSTANGQVKAARARIAMLDIGGLIVRDVDALVLPDEALSENLLGLSYLSRLKRFAY
FT                   ADGRMVLEQ"
FT   sig_peptide     complement(604812..604871)
FT                   /locus_tag="Rpdx1_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 20"
FT   gene            complement(605002..607698)
FT                   /locus_tag="Rpdx1_0565"
FT   CDS_pept        complement(605002..607698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0565"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="TIGRFAM: ATP-dependent helicase HrpB; PFAM: Helicase
FT                   ATP-dependent domain protein; helicase-associated domain
FT                   protein; helicase domain protein; KEGG: bbt:BBta_7352
FT                   ATP-dependent helicase; SMART: helicase domain protein;
FT                   DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42205"
FT                   /db_xref="GOA:E6VLF2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VLF2"
FT                   /inference="protein motif:TFAM:TIGR01970"
FT                   /protein_id="ADU42205.1"
FT                   /translation="MCRIFGIVSTGEPFCRWVWFLLTIRALHRSSRLLTRTFDIPLPID
FT                   DALDDLSGALATSTTAVLVAPPGAGKTTRVPLALLDAPWLKDQKIIVLEPRRIAARASA
FT                   ERMARTLGENAGETVGYRVRFGSKVSRTTRIEVVTEGIFTRQILDDPELTGIGAVLFDE
FT                   FHERSLDADLGLALARDAQQGLREDLRILVMSATIDGARVARLLGDAPVVESLGRAFPV
FT                   ETRYLGRKADAPLERQMAEAIAQALRGEPGSVLAFLPGAAEIRRTETMLAERVQDRSVE
FT                   IVPLFGALDAAVQDRAIQPAAKGKRKVVLATSIAETSLTIEGVRIVVDCGLSRVPRYEP
FT                   DLGLTRLETVRASRAAVDQRRGRAGRIEPGVCYRLWDEPQTASLPPYTQPEILSADLSS
FT                   LLLDLAQWGVADPSSLAFLDPPPQPALKEARELLGELGALDPDGRITDEGRSLRAMALP
FT                   PRLARMIVDAARHGCADDAAEIAAILTERGLGGDSADLDARRDNFRRDRSQRAMSARQM
FT                   AERWARQADNRGTPSPASPQNAAPSSPSPLAGEGRGGGATGTAAIRSTPTPDPSPQGGG
FT                   ELSTGVLLAFAFPDRVAKNRGNGSFTLANGRGAAIEQTSGLARAPYLAVGELTGTAAQG
FT                   RILLAAPITLSEIELHFGDQITDADEVSFDRSAMTLRARRRRALHAITLSEAPLALAPS
FT                   EGTARVLADGLIAAGLDRLPWSKQLQQWRGRVMFLRKAEGEPWPDLSDAALADSREDWL
FT                   VPALFDKTGLKDFSASDLSDALMNLLPWELRVRLEREAPTHFEAPTGSKLPIDYEAEQG
FT                   PTIAVRLQELFGLTIHPSVAGGAVPLVLELLSPAHRPVQVTRDLPGFWRGSYAGVRTDL
FT                   RGRYPRHPWPEDPASAPPTRRAKPKGT"
FT   gene            607772..608824
FT                   /locus_tag="Rpdx1_0566"
FT   CDS_pept        607772..608824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0566"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bbt:BBta_7354
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42206"
FT                   /db_xref="GOA:E6VLF3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E6VLF3"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADU42206.1"
FT                   /translation="MTANGTHVPRMHGGRVDWVDYAKGICIIMVVMMHSVLGVEAAAGQ
FT                   TSFMHYVVEFARPFRMPDFFLISGLFLAVVIDRDWRTYLDRKVVHFAYFYVLWVTIQFA
FT                   FKAPSFAAEIGWAGVAKLYALSFIDPFGTLWFIYLLPIFFVVTKLTRRVPSLLVWGIAA
FT                   VLESLHISTGWMVPDEFCSKFFYFYTGYLFARQVFALSDAARGRPVLALAGLASWAVIN
FT                   AAVVFLGWADLPLVSLLLGLAGACAIITAGTLLAEKRWLDGVRFCGEHSIVIYLAFFLP
FT                   MAISRTLLLKFAPFLDLGVIAILVNVAGVIGALIVWKLAMKTGATFLFERPDAFWIAPR
FT                   KKAARLQPAE"
FT   gene            608991..609229
FT                   /pseudo
FT                   /locus_tag="Rpdx1_0567"
FT   gene            609266..611254
FT                   /locus_tag="Rpdx1_0568"
FT   CDS_pept        609266..611254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0568"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: mes:Meso_0515
FT                   conjugal transfer coupling protein TraG"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42207"
FT                   /db_xref="GOA:E6VLF4"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VLF4"
FT                   /inference="protein motif:PFAM:PF02534"
FT                   /protein_id="ADU42207.1"
FT                   /translation="MSGTKILWGQVIVVGLIVLLAIWGATEWTAWRLAWQPELGRPWFE
FT                   LLGFKVYYPPVFFWWWFVYDAYAPRVFVEGAFIAASGTFVSIAVAIGMSVWRAREAKNV
FT                   ATYGSARWAGADEVRAAGLLGPDGVVLGKLDRDYLRHDGPEHVLCFAPTRSGKGVGLVV
FT                   PSLLAWPGSAIVHDIKGENWQLTAGFRSRHGRVLLFDPTNPKSSAYNPLLEVRRGEWEV
FT                   RDVQNVADVLVDPEGSLDKRNHWEKTSHSLLVGAILHVLYAEADKTLAGVAAFLSDPKQ
FT                   PIETTLRAMMTTPHLGEQGAHPVVASTARELLNKSENERSGVLSTAMSFLGLYRDPVVA
FT                   QVTCRCDWRIADLIADGRPTTLYLVVPPSDISRTKPLIRLVLNQIGRRLTEDLHARDRR
FT                   HRVLMMLDEFPALGRLDFFESALAFMAGYGIKSFLIAQSLNQIEKAYGPNNAILDNCHV
FT                   RVSFATNDERTAKRVSDALGTATEMRAMKNYAGHRLNPWLGHLMVSRQETARPLLTPGE
FT                   VMQLPPMDEIVMVAGTPPIRAKKVRYYEDRRFTERVLPPPNPASAGRSSRTDGWSALGP
FT                   LKPTAGPTDKAAEVEEDTANSGLRREPELPDHVAIAKETTEPTPAEEFAAVLDDDEDGV
FT                   RQSRLIRQQMRGVARQVAMDPNDGMEL"
FT   gene            611261..611686
FT                   /locus_tag="Rpdx1_0569"
FT   CDS_pept        611261..611686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0569"
FT                   /product="helix-turn-helix protein, CopG"
FT                   /note="KEGG: mes:Meso_0514 helix-turn-helix protein, CopG"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42208"
FT                   /db_xref="GOA:E6VLF5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E6VLF5"
FT                   /inference="similar to AA sequence:KEGG:Meso_0514"
FT                   /protein_id="ADU42208.1"
FT                   /translation="MRDRMNVYFPPELLKQISELADRKRLSRSAIVEAAVVSFLSPDGA
FT                   DRREAAFTRRLDRLSRQMQRLERDVGLTAESLALFIRFWLTITPPLPNDAQAAAQAKGR
FT                   DRFEGFVEALGRRLQKGQSFLREIPEDIGRQEPAEET"
FT   gene            611820..613148
FT                   /locus_tag="Rpdx1_0570"
FT   CDS_pept        611820..613148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0570"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bbt:BBta_3355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42209"
FT                   /db_xref="GOA:E6VLF6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6VLF6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU42209.1"
FT                   /translation="MQISGTWRLISRVFLPFAAGYYLSYLYRTINALIASHLSSDTALG
FT                   TADLGLLTSVYFLIFAAAQIPVGILLDRFGPRRVQSVLLLLAAAGAGLFAISTGFLSLL
FT                   IARAMIGLGVAAALTAGLKSIVLWFPRERVALLNGYMIMLGSLGAVTATVPVEYLLAWM
FT                   SWRQLFEILAAATGATAIFIYVVVPERGIVPSAACATLSSVFSDRRFWRMAPLSATCVG
FT                   SAWSLQGLWASPWLIDVERLDRTSLVRQLFTMSVVLSGGAWLFGMAVHYIKRKGIGAEA
FT                   ILVVVAVLFIAADSALILRAPLPSILPWSVVAIAGTATVVSFAVIADYFPPELAGRANG
FT                   VLNVLHFGWAFLAQYATGLILEQWHTIDGHRSVQAYQVAFGLNVALQIAALVWFALPWR
FT                   RVCASWMSLTSRSTPASVSNGVKSVGLYENSPILIPADDGAEW"
FT   gene            613317..614291
FT                   /locus_tag="Rpdx1_0571"
FT   CDS_pept        613317..614291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0571"
FT                   /product="P-type conjugative transfer ATPase TrbB"
FT                   /note="manually curated; TIGRFAM: P-type conjugative
FT                   transfer ATPase TrbB; KEGG: bbt:BBta_7741 conjugal transfer
FT                   protein TrbB; PFAM: type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42210"
FT                   /db_xref="GOA:E6VLF7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6VLF7"
FT                   /inference="protein motif:TFAM:TIGR02782"
FT                   /protein_id="ADU42210.1"
FT                   /translation="MGTTVPSHSIQSEANSRGARMLRSALGTAIAGYLEDEAIIEVMLN
FT                   PDGRLWIDRLSSGLIDTGKTLSAADGERIVRLVAHHVGAEVHAGAPRVSAELPGTGERF
FT                   EGLLPPVVAAPAFAIRKPAVAVFTLDDYVAKEIMTSEQAEILKSAVAARKNILVAGGTS
FT                   TGKTTLTNALLAEVAKTADRVVLIEDTRELQCTAPNLVALRTNDGVATLSDLVRSSLRL
FT                   RPDRIPVGEVRGAEALDLLKAWGTGHPGGIGTIHAGTALGALRRLEQLIQEAVITVPRA
FT                   LIAETINVIAVLAGRGADRRLVELALVRGLGAAGDYSLSTAGD"
FT   gene            614293..614616
FT                   /locus_tag="Rpdx1_0572"
FT   CDS_pept        614293..614616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpdx1_0572"
FT                   /product="Conjugal transfer protein TrbC"
FT                   /note="PFAM: Conjugal transfer protein TrbC; KEGG:
FT                   pzu:PHZ_c1513 conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpdx1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADU42211"
FT                   /db_xref="GOA:E