(data stored in ACNUC7421 zone)

EMBL: CP002450

ID   CP002450; SV 1; circular; genomic DNA; STD; PRO; 119718 BP.
XX
AC   CP002450; ADWA01000000-ADWA01000140;
XX
PR   Project:PRJNA41663;
XX
DT   28-JAN-2011 (Rel. 107, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Alicycliphilus denitrificans BC plasmid pALIDE01, complete sequence.
XX
KW   GSC:MIGS:2.1.
XX
OS   Alicycliphilus denitrificans BC
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Alicycliphilus.
OG   Plasmid pALIDE01
XX
RN   [1]
RP   1-119718
RX   DOI; 10.1128/JB.00365-11.
RX   PUBMED; 21742888.
RA   Oosterkamp M.J., Veuskens T., Plugge C.M., Langenhoff A.A., Gerritse J.,
RA   van Berkel W.J., Pieper D.H., Junca H., Goodwin L.A., Daligault H.E.,
RA   Bruce D.C., Detter J.C., Tapia R., Han C.S., Land M.L., Hauser L.J.,
RA   Smidt H., Stams A.J.;
RT   "Genome Sequences of Alicycliphilus denitrificans Strains BC and K601T";
RL   J. Bacteriol. 193(18):5028-5029(2011).
XX
RN   [2]
RP   1-119718
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Goodwin L., Pitluck S.,
RA   Daligault H., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Mikhailova N., Oosterkamp M.J., Veuskens T.,
RA   Weelink S.A., Plugge C.M., Stams A.J.M., Woyke T.;
RT   "Complete sequence of plasmid1 of Alicycliphilus denitrificans BC";
RL   Unpublished.
XX
RN   [3]
RP   1-119718
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Goodwin L., Pitluck S.,
RA   Daligault H., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Mikhailova N., Oosterkamp M.J., Veuskens T.,
RA   Weelink S.A., Plugge C.M., Stams A.J.M., Woyke T.;
RT   ;
RL   Submitted (03-JAN-2011) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 02cefab08145656b5a2914f56a5ac85f.
DR   BioSample; SAMN00015356.
DR   EuropePMC; PMC3165661; 21742888.
DR   EuropePMC; PMC3236047.
DR   EuropePMC; PMC3692508; 23825601.
DR   EuropePMC; PMC3735179; 23919996.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086861
CC   Source DNA and organism available from Alfons J.M. Stams
CC   (Fons.Stams@wur.nl)
CC   Contacts: Alfons J.M. Stams (Fons.Stams@wur.nl)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Alicycliphilus denitrificans BC
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Missing
CC   num_replicons       :: 3
CC   ref_biomaterial     :: JCM 14587
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Facultative
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.2 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi03280
CC   Greengenes ID       :: 39244
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: WGS
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..119718
FT                   /organism="Alicycliphilus denitrificans BC"
FT                   /plasmid="pALIDE01"
FT                   /strain="BC"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:596153"
FT   gene            complement(187..1257)
FT                   /locus_tag="Alide_4515"
FT   CDS_pept        complement(187..1257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4515"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02119"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2A8"
FT                   /inference="similar to AA sequence:KEGG:Bpro_5514"
FT                   /protein_id="ADV02119.1"
FT                   /translation="MAIRIKLDAKSALAKHTSTALAATQDRFAQAARIVEQKPTVFTQE
FT                   PPAEPAPKTIPSATASAGPAGFDLSRCVIGSVVAVPLHLIDPNPIGPRVIYKVEDIDKI
FT                   ARTLPASQDDAAHGFVREGRVVLIDGGTRYRAAKISGVGQLDVKFEQAPESEVELYLRA
FT                   RSYNEQRSQTSVIDHALSLQRLLDSGVVSSARELCEKIPDIGGSAQMSESQVSYYLRVA
FT                   RMPRQVIERMSSSAATSQLSILYAVSEIFPKNEAATAEQIELGLQIVDEIKTRELTHKQ
FT                   TVALVKSRLGEEPKQRRERSLQQQIAYGPYKGQIKCFGKRGQVDLSLRGVKEEDMPALQ
FT                   GEIDALVKRFVQERSG"
FT   gene            complement(1265..1969)
FT                   /locus_tag="Alide_4516"
FT   CDS_pept        complement(1265..1969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4516"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="KEGG: pol:Bpro_5515 cobyrinic acid a,c-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4516"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02120"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2A9"
FT                   /inference="similar to AA sequence:KEGG:Bpro_5515"
FT                   /protein_id="ADV02120.1"
FT                   /translation="MAQTASGKVITVFNQKGGAGKTTTACQLAGTFGHRGFDVLVADLD
FT                   RQGSASKWLARGSEDGRFPATLWSGHLYSGNVAAELGKLVDKYDLIFVDCAPAVDQPGT
FT                   WSSLLVSDLAIIPTKLTPADIDAVYDSFELAKRARKEIGVDFPVRVLATAYHRNRSDER
FT                   VALESLEENTAYPEFPLLRTTLGDRVAFTRSMLYGVTAHSIPKAGDAVTELDALADEIS
FT                   KILGIGSRKSKK"
FT   gene            3068..3346
FT                   /locus_tag="Alide_4517"
FT   CDS_pept        3068..3346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_3760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4517"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02121"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2B0"
FT                   /inference="similar to AA sequence:KEGG:Veis_3760"
FT                   /protein_id="ADV02121.1"
FT                   /translation="MNVYPVPDSFAGNYGVGYALAAIAGGQVLSLKYIAEHVDEKTQDE
FT                   LAEGGAPARNAAFKWIGSQSAGPVVRELQALGRVCAGMCSGWEFVEL"
FT   gene            3348..3851
FT                   /locus_tag="Alide_4518"
FT   CDS_pept        3348..3851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4518"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: gga:423125 similar to
FT                   scavenger receptor cysteine-rich type 1 protein
FT                   CD163c-alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4518"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02122"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2B1"
FT                   /inference="similar to AA sequence:KEGG:423125"
FT                   /protein_id="ADV02122.1"
FT                   /translation="MREIHTFDNADEADAFCESRDDATAVISNSPRPGQCSVSVGPAPR
FT                   DPRDMTLAELFEGVNREYRKREERCRARYETALHEAGVWRVAQAVAQELGLQGREAYQF
FT                   SAGFCGVPARAADPRAEGLEPVFRQGRKARSEKGVAERCRAAEASLRSTFTYTQFLATQ
FT                   FVPA"
FT   gene            3870..4051
FT                   /pseudo
FT                   /locus_tag="Alide_4519"
FT   gene            4303..4593
FT                   /locus_tag="Alide_4520"
FT   CDS_pept        4303..4593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4520"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="KEGG: dia:Dtpsy_1065 histone family protein
FT                   nucleoid-structuring protein H-NS; PFAM: histone family
FT                   protein nucleoid-structuring protein H-NS; SMART: histone
FT                   family protein nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4520"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02123"
FT                   /db_xref="GOA:E8U2B2"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2B2"
FT                   /inference="protein motif:PFAM:PF00816"
FT                   /protein_id="ADV02123.1"
FT                   /translation="MAKTYKELMEERNALDAQIAQARKEELGAAVAQARSIIAQFELTA
FT                   ADIFGGPRSSKTKVAPKYRDPQTGKVWTGRGREPGWIAGKDRAQFAIAQAS"
FT   gene            4606..4926
FT                   /locus_tag="Alide_4521"
FT   CDS_pept        4606..4926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4521"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="KEGG: vap:Vapar_1795 histone family protein
FT                   nucleoid-structuring protein H-NS; PFAM: histone family
FT                   protein nucleoid-structuring protein H-NS; SMART: histone
FT                   family protein nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4521"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02124"
FT                   /db_xref="GOA:E8U2B3"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2B3"
FT                   /inference="protein motif:PFAM:PF00816"
FT                   /protein_id="ADV02124.1"
FT                   /translation="MPSYAELKEQLDRLRNEAEQARREEMPRVIAGIKAQIEEYDLKPE
FT                   DLFPDLPSRRGGSEEGVRGKGGREPKYRGPNGQTWVGGAGRKPDWVRAALANGEDLEKF
FT                   AI"
FT   gene            5025..5441
FT                   /locus_tag="Alide_4522"
FT   CDS_pept        5025..5441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0558 Mg chelatase, subunit ChlI"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4522"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02125"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2B4"
FT                   /inference="similar to AA sequence:KEGG:Cpha266_0558"
FT                   /protein_id="ADV02125.1"
FT                   /translation="MSPKEDKTWIYDGPPDNIGLLIPDADPADGGYVLLTELDNGVVRM
FT                   FATRFPGRCVASWMAQIRRFGGAKPGRVLVSTPHLLYERIKRMVVEDVGVADAQSIEQY
FT                   KRKTNELFAIEPLNVKGASQRLATQAVELHAASV"
FT   gene            5438..7261
FT                   /locus_tag="Alide_4523"
FT   CDS_pept        5438..7261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4523"
FT                   /product="type IV conjugative transfer system protein TraD"
FT                   /note="KEGG: see:SNSL254_p_0066 type IV conjugative
FT                   transfer system protein TraD"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4523"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02126"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2B5"
FT                   /inference="similar to AA sequence:KEGG:SNSL254_p_0066"
FT                   /protein_id="ADV02126.1"
FT                   /translation="MSAELLDFDNPWRPIYEWRQALGWGCAAGGCIGAAAALPLPTTFA
FT                   SISAISCALVALSRAYVAWNRQDSKSKATNTEKRFITVKEVIEHGQRAGKNGQLWLGTG
FT                   FQWTDIEAGKMHALMGGGVAHQLGRKVSQADGAYWLHALGKETDNLIDMSLLDGHTLIT
FT                   GATRVGKTRLFDLLITQAIARGEPVVIIDPKGDHGLAENARQTCELMGKGNRFVYFHPA
FT                   HPDKSASIDPLRNWNRKTELASRVAALIPSETGADPFTAFGWKVLNDIVAGLLATGKNP
FT                   NLVELRRYIEGGPEDLLVKALRAHFRQNVQDWEVKSAPFIKRASKNPKCTNDVLDGYIS
FT                   YYKEVVIHEHPNVDLAGLISTHEHNRDHFQKMIASLIPILSMLTSDPLKDLLSPEFEGD
FT                   HNRVVTDMARIIRDDAVAYLGLDSLADSTVGSAIGSVFLADLTAVAGNLYNYGIKTKKT
FT                   VNIFVDEAAEVVNNPTIQLLNKAGGAGFRMFIATQTFADFAARLGDENKARQVLANTNN
FT                   KITLRVLDSETQQYISDGIPKIKARSMSVRYGHNVANTVREEYTASYQEQSTEEEADLI
FT                   PPGVLSELPPLHFFARLSGGRTIKGRLPIMQ"
FT   gene            7271..7879
FT                   /locus_tag="Alide_4524"
FT   CDS_pept        7271..7879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmr:PMI2473 plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4524"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02127"
FT                   /db_xref="GOA:E8U2B6"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2B6"
FT                   /inference="similar to AA sequence:KEGG:PMI2473"
FT                   /protein_id="ADV02127.1"
FT                   /translation="MATQRKPEGHSFASIVLVCVIFGALAILVFVPVNVFETVRAVEQN
FT                   SIRNWLGNEADQWVMLRIFDVLRITNQEATKSIGELALSGNHKIDSWLVQRVYATLVWV
FT                   HLVAYRSGVLLMWAAFGVPVLLAAIYDGYMRREISKTNFSSQSPMLHKSGIDVFRAAIA
FT                   LMVAWLLIPWHTSMLVAPTGFFIIGAAAWLWISNAPKRM"
FT   gene            7843..8619
FT                   /locus_tag="Alide_4525"
FT   CDS_pept        7843..8619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4525"
FT                   /product="EAL domain protein"
FT                   /note="KEGG: afo:Afer_1731 diguanylate phosphodiesterase;
FT                   PFAM: EAL domain protein; SMART: EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4525"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02128"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2B7"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADV02128.1"
FT                   /translation="MALDLERAEAHVSLKERRLRALSAARRISQRFRAQAIVRPSTLEV
FT                   TGIEILSRNRLLFCSYPTMLREDIAALKAAARMARTGFYREVHCNVEILSLLSPDWLEV
FT                   MGQTMTQGIVIEIVERNDMLMHGMWLERVIHVLSLIRIFGGKIAMDDVAYTDQSIHLIE
FT                   MMRPEIVKVEDARYAPVLRQHGDMEIIVERIETAQLAQEAVNLGVDYLQGYWCDVQVEK
FT                   CVPSSLTPPGIEARTKGDWNKPKQPWAEVKELLAVG"
FT   gene            complement(8616..9077)
FT                   /locus_tag="Alide_4526"
FT   CDS_pept        complement(8616..9077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cqu:CpipJ_CPIJ000220 conserved oligomeric
FT                   Golgi complex component 6"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4526"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02129"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2B8"
FT                   /inference="similar to AA sequence:KEGG:CpipJ_CPIJ000220"
FT                   /protein_id="ADV02129.1"
FT                   /translation="MSIKFIFALFSAVLLSACASAPTTLYKMSDKDTIKSAEGVITKFE
FT                   VKRVPIPITTTEAALTGVAANNLGNSTVQGATLLLGVIDDITTPKYQNNVELAFLDAAT
FT                   GEESALVMKNLARKPKIKIGDRFRIIYKSETDYQFINLTSYPQADAVTR"
FT   sig_peptide     complement(9018..9077)
FT                   /locus_tag="Alide_4526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.715 at
FT                   residue 20"
FT   gene            9315..9821
FT                   /locus_tag="Alide_4527"
FT   CDS_pept        9315..9821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4527"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   mpt:Mpe_B0379 invasion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4527"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02130"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2B9"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADV02130.1"
FT                   /translation="MMRWIMVFVALVPGFAAASCFEQAAARYKVPVELLQAISTVESGG
FT                   RANAYNANKNGSFDIGHMQINSSWLPTLAKYNIDVESLQDPCINTNIGAWVLAHNIARF
FT                   GLSWEAVGAYNAVSKSKREIYAKKVAAVLGELVRKKQAQAAQNVGPHSVGRENKVASMN
FT                   VAQRR"
FT   sig_peptide     9315..9389
FT                   /locus_tag="Alide_4527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.655 at
FT                   residue 25"
FT   gene            11454..13577
FT                   /locus_tag="Alide_4528"
FT   CDS_pept        11454..13577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: see:SNSL254_p_0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4528"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02131"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2C0"
FT                   /inference="similar to AA sequence:KEGG:SNSL254_p_0093"
FT                   /protein_id="ADV02131.1"
FT                   /translation="MRIDEPWEELPVTVESWYEKAPEYKTTENLTFVGIPLGPVVDLEK
FT                   SFVSHDKAPTIIHGSLGLVKGQTRVFDPNTMGTWKVVIRNDKTAEVMSAPVTVQPDGSF
FT                   AVNLGTLPAGTRYIVAEASMVTAGGAVATSSAKSKLRALITSPGQPITASLNVRTTSGR
FT                   APFMQTVAVNFTDPKMQPAVREVAWERQSEGGVWEPVYRKGTSTQYSGVNFIAQLDEPG
FT                   KANFRAVLTNKYSGAVYATDPVELEAFGMPEFKVVAPSIVLAKQPVTFVIEEEPGFEAE
FT                   YTWHLISSFGAVNIGPTNGKTFTFTPNEVKSYGVEVFGKQKGAPDNPAANVKKTVAVRA
FT                   VNPLASRATINGPKLLETNKPYQFTAKINDVVSDSKGKGYELKGYWILPDGTRVDGTEL
FT                   TFTPRANDKVLSFYTYVDGYPEDTSVSTYSFSTWTYTWPSDWAIRLQPLYLDVPASVKF
FT                   SVETNSVRLQDLHGEPLTYTWSLPEGVSQSYGTDSAGTLPINKFGKYQLAVQISDTRGN
FT                   VTNITSEEFTILPPATVETNVSLLSKYGDKFYSPGAYYLGVKINKLPRGDSFLRNEAWV
FT                   NDSKVGEFTGSGHYVAFSEPGAYDVTVRTITKSGNYGEQSISQQVQAPPAPVCEIKVSS
FT                   TTSGSLITPACTVEAGYIKSYTWNYVLGGQAQVATSKSFLVTKKWLSDNAIGTVSLTVE
FT                   SELGAKSTHQVTY"
FT   gene            13962..14285
FT                   /locus_tag="Alide_4529"
FT   CDS_pept        13962..14285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: transcription initiation factor E subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4529"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02132"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2C1"
FT                   /inference="similar to AA sequence:KEGG:MJ0777"
FT                   /protein_id="ADV02132.1"
FT                   /translation="MDAASVQSDSKKKRFVVERVFGLSNGSLSVEALFELDHFKAASTD
FT                   RFYVEMLTAGEMTEESVNQVMGVWKDLLKRLQAKGLNPKNVVMGGAKYQQTADAIVLVK
FT                   VGS"
FT   gene            14282..14560
FT                   /locus_tag="Alide_4530"
FT   CDS_pept        14282..14560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4530"
FT                   /product="type IV conjugative transfer system protein TraL"
FT                   /note="TIGRFAM: type IV conjugative transfer system protein
FT                   TraL; KEGG: bvi:Bcep1808_6760 pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4530"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02133"
FT                   /db_xref="GOA:E8U2C2"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2C2"
FT                   /inference="protein motif:TFAM:TIGR02762"
FT                   /protein_id="ADV02133.1"
FT                   /translation="MIKRPIPNYVDDQMQVFFWELDEFFPSLTIFVVMFMWDQLTVGIV
FT                   MTFAFVKFFGRFKSANMAGVLFHMAWWVGLMSMNKKFDNGAVREAVK"
FT   gene            14557..15333
FT                   /locus_tag="Alide_4531"
FT   CDS_pept        14557..15333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0365 sex pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4531"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02134"
FT                   /db_xref="GOA:E8U2C3"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2C3"
FT                   /inference="similar to AA sequence:KEGG:Mpe_B0365"
FT                   /protein_id="ADV02134.1"
FT                   /translation="MNLKSYLTSMSQLQTLTLTVILSNVILATGLVFALINITGQRERV
FT                   VLVPPSLDKKAEIAWESANKDYLKSFGLYVATMVGNIQPKSSSVVLDTASVFMDPEIYS
FT                   EFRKQLIAIIEDPVFKASGSVISFMPQSVQFEPETSRVFVIGSIVTSTSGSTKYQKNVV
FT                   YEVGLKIREGRPWVTHFTSYEGTAIRSVNWWAQKSSRDDSVIPDYALPEKWKKEEVKSA
FT                   PESDFSAMHFPPTPAASDAEKGSAEVLPAANEETIN"
FT   gene            15342..16475
FT                   /locus_tag="Alide_4532"
FT   CDS_pept        15342..16475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0366 sex pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4532"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02135"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2C4"
FT                   /inference="similar to AA sequence:KEGG:Mpe_B0366"
FT                   /protein_id="ADV02135.1"
FT                   /translation="MQLEFKKKALLTVLQAALVAGSFAAHAAEDAGTAPTPVTAPGQQK
FT                   SPTAPAASDEGSVGPKPEPQARFLVKKGSGGAKTVGTAPEVRLPEGPLGAAPGDIGALL
FT                   ADGQPKAPESLNQAIAEAQKAAGQPLDPVQREINMPGLKKDDPSLKPFVLHTRNGVNEI
FT                   VRMSSRLLNRVATPFKKPTVIDTSESTSKVIGSDVYFLPHGDQPIGLFIADSANTSQTV
FT                   SLTVIPDNTIPGQNLIVKLEDLRTIKSLANVTDSEAQVLHPQANDYTSMVRSLLASAAR
FT                   GTVPGFSPVPLEGGVAQMGDMAIEPELTFAGSVADIYRYRLVNTSDKQIDLVETAFFRE
FT                   GVKAVSFFPHTSLQPKQVSYVFILADKPESAAQGASQ"
FT   sig_peptide     15342..15425
FT                   /locus_tag="Alide_4532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            16472..17902
FT                   /locus_tag="Alide_4533"
FT   CDS_pept        16472..17902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4533"
FT                   /product="TraB pilus assembly family protein"
FT                   /note="KEGG: bvi:Bcep1808_6757 TraB pilus assembly family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4533"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02136"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2C5"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_6757"
FT                   /protein_id="ADV02136.1"
FT                   /translation="MSLASSFSNLSANQKRTTMVVAAIVAILGISTLLASVSERKVNRL
FT                   PHANKAEVTVVSPSRTTGVEAFAAQLANLEKAQQDLKSEMKSVLRNAGSAKPGGQGEDA
FT                   PKEVPQLEDVLPEISGQTSIFEAPTKKGPELPMTTPAVPVAPRVDAAPATVVPPPAPPT
FT                   IRMIGEEGELTDEKVSKLNTPAEAARTEKKVESAFVPAGSMFTGVLLSGLDAPTSAVAQ
FT                   KNPTPVVVRVKREAVLPNYASLDVRECFVMAAGYGQLSSERALMRAETLSCVRQDGNVI
FT                   ETSLDAYIVGTDGKVGIPGRLVSKQGQMIAQTLVAGTLGGMGQMLGRSRVPQLNINGQG
FT                   SLYEDESMSSIAQTGIAGGIGSATNMIAKFYLDMAKETFPVVEIPAGEVVTVVVTRGSS
FT                   LPLKGSSSLQRISAPNENQRNAQGTASRAEPPRRVTDARPANPGQIVAPAEAAIKSAVA
FT                   ATAGVKPPVQNFQNGLGW"
FT   sig_peptide     16472..16579
FT                   /locus_tag="Alide_4533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.795) with cleavage site probability 0.755 at
FT                   residue 36"
FT   gene            17902..18417
FT                   /locus_tag="Alide_4534"
FT   CDS_pept        17902..18417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4534"
FT                   /product="type IV conjugative transfer system protein TraV"
FT                   /note="KEGG: mpt:Mpe_B0369 sex pilus assembly protein;
FT                   TIGRFAM: type IV conjugative transfer system protein TraV;
FT                   PFAM: Type IV conjugative transfer system protein TraV"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4534"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02137"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2C6"
FT                   /inference="protein motif:TFAM:TIGR02747"
FT                   /protein_id="ADV02137.1"
FT                   /translation="MIMYPLQSRPALFAAAVAALFLSGCAGPLNTADNSEFACSDRDCP
FT                   TPFEVYNATNSAPPSVRNGRTPEKWNKGAKGNGAAEKQQEQTAMPALDLTQAVATTVRL
FT                   QDPAQKTAQPIREPSQVMRIWIAPWIDQGDNLNWSGYVYTEVTPKRWAFGERQIRYQSL
FT                   APQFVQPK"
FT   sig_peptide     17902..17997
FT                   /locus_tag="Alide_4534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.926 at
FT                   residue 32"
FT   gene            18453..18788
FT                   /locus_tag="Alide_4535"
FT   CDS_pept        18453..18788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4535"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02138"
FT                   /db_xref="GOA:E8U2C7"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2C7"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_6755"
FT                   /protein_id="ADV02138.1"
FT                   /translation="MKSKLQNNSKLVRNVQTALLLAVAVSLPMQAMAGAGGSEFTQVYD
FT                   QLTGWSNGILGKSLGVAALLVGLGVGVIKQSVIAAVVGVAMALTAGFGPGVIDGVITSG
FT                   VSIVNAI"
FT   sig_peptide     18453..18554
FT                   /locus_tag="Alide_4535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 34"
FT   gene            18799..21243
FT                   /locus_tag="Alide_4536"
FT   CDS_pept        18799..21243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4536"
FT                   /product="type-IV secretion system protein TraC"
FT                   /note="TIGRFAM: type-IV secretion system protein TraC;
FT                   KEGG: mpt:Mpe_B0371 F-pilin subunit assembly into extended
FT                   F pili"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4536"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02139"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2C8"
FT                   /inference="protein motif:TFAM:TIGR02746"
FT                   /protein_id="ADV02139.1"
FT                   /translation="MSALHRKFQRAAERISPDEYIPVVAYDEESGVLMTDDGHIGVCYW
FT                   GDPVNGADDTTADMLKGALSLALPEGSFVQLSIIGMPDIDNQIAQYQNRREQDIYRIRD
FT                   VSARDTLREYAKRRAEFMHGAAHVSNIPTIGTKIHDRRVVLSVKSPFKGRTPSTEEIDN
FT                   IAETGAKLAESMQTFGLFLRRMNATQYLELAHRLTHPFAPRKIDQVRTDQLLKHQVFLP
FT                   GESIEVHKDALLFNDDTHVQMLAVGRWPKSNDLSLMAFMIGDPLGANNQIKLPYHISLT
FT                   LHYPNQYGKTTSMKQKAAMINYQAFGPMLRFVPKLAFKKQGMDVLVNAMEQGASVVEAS
FT                   LTVSVYGQTREECSRQSSTLRTYLQSFDFAMGEERFVVLSSFWNSFPLFPSVESIKNTF
FT                   RFKTMAVEQAMTFAPILGEWKGTSVFAKPGQGYGMLLQSRRGQLMSLDLFDSPTNYNGV
FT                   VFASSGAGKSFLTQSMNMDYLSMGAKVWVIDVGRSYLKQAKMLNGSFIEFGPESGICLN
FT                   PFSRVVDIDEEVSLIQACIEKMAAPEDGLDDYRRSRIEEAIKAVWGRMGTGSTITDVAD
FT                   YLTHQEDQRTADIGNMLYRFTRYGSEGYWFDGKANVDMSNDFVVLELEELKGKRTLQQV
FT                   VLMQLISNIQREMYLSNDGRPKILVIDEAWDLLDDPMVGRFMEHAYRRFRKYGGAAIVV
FT                   TQSIADLYRSDSGRAIAANSAFKFILKQTAESIEQVKKEGHLALGDYGFYLLQTVHSIP
FT                   GKYSEVMFYTEQGMGVARLVVDRFSQVLFSTSGAERTEVIANIERGMNPVEAVETFIAN
FT                   HG"
FT   gene            21251..21745
FT                   /locus_tag="Alide_4537"
FT   CDS_pept        21251..21745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cli:Clim_1282 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4537"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02140"
FT                   /db_xref="GOA:E8U2C9"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2C9"
FT                   /inference="similar to AA sequence:KEGG:Clim_1282"
FT                   /protein_id="ADV02140.1"
FT                   /translation="MQERETEDQAQDDEATRQPKATAAAPKKSSGLLPFMVDALVVVVI
FT                   AVIASFAVVRYAPQTERPAEPQKFAYVDMERLSREHILGLTEQARSGEIDAEEITKRTR
FT                   EFAQALMTGISAVSEQGVIVFNANALASVPATTEDLTQTLQEQLQKSGKMAIRKSKQAS
FT                   P"
FT   gene            21856..22407
FT                   /locus_tag="Alide_4538"
FT   CDS_pept        21856..22407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4538"
FT                   /product="Peptidase S26, conserved region protein"
FT                   /note="KEGG: bvi:Bcep1808_6752 putative pilus assembly
FT                   protein,TrhF (pilin signal peptidase); manually curated;
FT                   PFAM: Peptidase S26, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4538"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02141"
FT                   /db_xref="GOA:E8U2D0"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2D0"
FT                   /inference="protein motif:PFAM:PF10502"
FT                   /protein_id="ADV02141.1"
FT                   /translation="MQSNSIHGDRVMHRALRALGEILVGVILALAAGVLLAMATGYRVG
FT                   LDAQRLAGEPACMPFLIYVWHKNRGEAPVRGDYVVARMPKTGLGVGGREGDRIVKLVMA
FT                   GPGDEVRIAGTELWINGKHTDRLWLAKSLPGKKVGDFDTHRVLGPREFFVMGTTKESFD
FT                   SRYWGPLNREAIIGTAIPVL"
FT   gene            22565..23554
FT                   /locus_tag="Alide_4539"
FT   CDS_pept        22565..23554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4539"
FT                   /product="Type-F conjugative transfer system pilin assembly
FT                   protein TrbC"
FT                   /note="PFAM: Type-F conjugative transfer system pilin
FT                   assembly protein TrbC; KEGG: afr:AFE_1095 pilus assembly
FT                   protein TraW, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4539"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02142"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2D1"
FT                   /inference="protein motif:PFAM:PF09673"
FT                   /protein_id="ADV02142.1"
FT                   /translation="MQDDMMRRLREAAPKVGQDTTAQDFDMQVFISAGMPEGVLRNLFA
FT                   QAMEFPVGRVRFVVRGFTPQKLGVLVSKLRGLFPDPQTDHITLEVDPNAFRAYAVDAVP
FT                   LYLVKDGEKWYETKGSQSLFAARENVRQRGKSAHGELYAIAEPDMLSVIEERTKNFDWK
FT                   PVMARAQERAAKNLRPGFDLPTATQDGTAYFVPTFRVPHDIKSPSKDGAGQVLLAKGGQ
FT                   TINLLDYTRLQVPVIVFDPSDKRQAQMVKRWIQQPEFANADLFVVGFNLQAIDAKTPVT
FT                   VEIAQSYKRPVYPFLSKLNDRFGVQAVPAIVQQEGPRLRISTFKPEDF"
FT   gene            23554..24708
FT                   /locus_tag="Alide_4540"
FT   CDS_pept        23554..24708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4540"
FT                   /product="TraU family protein"
FT                   /note="PFAM: TraU family protein; KEGG: afr:AFE_1096
FT                   conjugal transfer protein TraU, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4540"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02143"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2D2"
FT                   /inference="protein motif:PFAM:PF06834"
FT                   /protein_id="ADV02143.1"
FT                   /translation="MRPIVFVKRLICLLALLLSTSHGAFAQQAMSLGCNSYSPLETMFS
FT                   DVCWSGIFPIRLAGVTFMDGKSGVPSDASKRVVCTCGGDLLEGKLPRIGFTVGFWAPSK
FT                   IIDVTRRPYCMPSLGGLQLPLGNVEFLNSGANMGRGDNSQHFSNWVLYSFPIIWMLRLI
FT                   DEGACPADGLMDFDVITASPMFPNWNDVLGRYTAFINPEMLLFAGATSLYALPVDAASA
FT                   TAGQPINDLFWVAGAWGPGYPMTGFSNGGTVDHQIEPVRATSLSAFRGLSLMHRLGFLS
FT                   ETIGSDNLCERNQRFVIRKDAYRWQFLAPSPESDGPAEGAPPPVNSTNQVREVNPPSRY
FT                   STCTHPTGASTVGWGMWRDVPATGEDHSYLLFQWTDCCFGVYGD"
FT   sig_peptide     23554..23634
FT                   /locus_tag="Alide_4540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            24723..28715
FT                   /locus_tag="Alide_4541"
FT   CDS_pept        24723..28715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmr:PMI2456 mating pair stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4541"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02144"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2D3"
FT                   /inference="similar to AA sequence:KEGG:PMI2456"
FT                   /protein_id="ADV02144.1"
FT                   /translation="MQQHIRPWPVVLVGRLMLAIAVVVWPLTAHVAYAQAIEQLPITPS
FT                   QEAEASSWLVAQLTADELNEFNLINRRAARLLRGDGAPAPLRTPNVEEDATQRTRAPDL
FT                   STDPADEQRAKAQADRALQPLALPELIQGAQRGSDAGQEMMGRVNPPTLDMERVEPGQN
FT                   DTAERRLNVTEMLPGFNSKSIPALTSKGREAYNDPELLKGLSEQNRRNLRRDGCRKTDF
FT                   EALELQDISQAASSPKHRILKVEFFDIEKQAIPNTSPVEYLTVMKPTVYSRGHVDMMVA
FT                   TIGAGATVYWDRVDETYAIKYTYTPFSAAKNRNFFTYNHRFAVDGGAGVQVLSNAGIVS
FT                   YGSPGDGWKTVASQAVQFGAKALYLSADLYQAKATYTEETPGVPCPPDPPQVCEVPSYG
FT                   GEMLRWCPGAPGANIALMYDDQANPDERVVAKKYNDLAAATASRKTYSDDSLLRAGITR
FT                   GLNAGSSARAQELAGQCRRETISRIETQVGDPYRVPNMRLCSETLVNPYPQGCKNIQRS
FT                   FGLTYLAEQNYLTVRAFEKIKVPIIDPVTGKQVKDSEDYPLYTYRKEPANVAGPVRTDF
FT                   PIMGGAMCPGGEGCSTENLPDDPRGGSEGPYLEYMHTPVGGDPKTYAFDGVYVQAGGTS
FT                   NFSNYGKPSESWLPAGSASGDGTLHQLRLMAKTYSVPINTFAGCEKYMQYVADGFCKGG
FT                   KLTCVDTAPTRSIGGVTFGPGLPNSGIVELLKNWGTDASAVHDGIIDGAGDEPTPNGPP
FT                   IVMLEDKMCWAAEGESFTSCSTMEDEGSLAHFFKPDGSEWASDCDSVTNDDGLPISQAC
FT                   KPSLGNNSCDSRFEGVFTGICYNPTLAYDCGENKEPKIPIVVEEQGDTCSGVVRCMGTE
FT                   CHRPNLSGNHGEGFARAVSGMEALNFMISEMVCAETGEPPKSANESCTPMVFGGKPMYC
FT                   KQPIGRQIGITPDCCKEARKGAKSGPSWIMYLQATKALYKISRNETVQHFLGNFDVYNN
FT                   ASRTFGEISQPVTDLYDSASSWVTENVVEPFNAGFDNMFGDFGGGAGSTPLEIGVDAPA
FT                   KQGMIGSAIDQLKTNLMNSAYKILNSISPELANSVFVNGGLSTVAFTETAAQILETLNT
FT                   VFMIYSIARLIGHIIFACKQEEYEWGMNERWRLCTFVDSCCNKKFLFVCIEKRQLYCCY
FT                   KSIATRVISEQITKQNLSGSKPFGFRTGSKGSKLGGCKINCGGFTPLELASVDWSRVDL
FT                   TEWTDSLVESGIVNTADPGRSYGVTKSAVPISKAVGGPDAEGGDIDERSAAYKTVEGWR
FT                   QNQNKMTTFTETLRQDGIEHCYDPSNNKKMPFVYPGCKPSPEPTPP"
FT   gene            29224..30111
FT                   /locus_tag="Alide_4542"
FT   CDS_pept        29224..30111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pan:PODANSg9310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4542"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02145"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2D4"
FT                   /inference="similar to AA sequence:KEGG:PODANSg9310"
FT                   /protein_id="ADV02145.1"
FT                   /translation="MIRQTASSNSRLGVCVALQRANAAPTKGDDEKRRIEAIQLVAQKI
FT                   NNRDPHMLRARADAARLGLYGFKTDQNLALSLYKKAKIPDAGLNAALMLYRGTDYSNNA
FT                   KAAKEILNVLYSSGAATDRTRGPVGGQAHYIAGLIHEGGYAGQVDMKKAFIHFRSSARN
FT                   SYVPGIYHYLRLIVRNLPELTRAEQQVATQEIRLMTNRWRWQAAEIMMINGDMHAGGWF
FT                   PDDKDGYFAQYYWRVAQRMGDGSVIPNIQSLLQQRIRRMSNENEERLQNDVQVALRNVA
FT                   NTKHDLEFSDLCAE"
FT   gene            30099..31079
FT                   /locus_tag="Alide_4543"
FT   CDS_pept        30099..31079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4543"
FT                   /product="sex pilus assembly protein"
FT                   /note="KEGG: bvi:Bcep1808_6751 sex pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4543"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02146"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2D5"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_6751"
FT                   /protein_id="ADV02146.1"
FT                   /translation="MCRVEHWISRLLGAACALVLAISWAEPAFAIDQFILDKEDGWFWY
FT                   EREPEPETPVKPPEIKPEPKNPVEPAPPKKTQPQKVEPLSVEWFQKEYQQILNKAIDEP
FT                   SQENVRKYRYATRVMLDKASNFTHVFQRESLLDPLLDEANRMPFSSASRGSFMRLTIEE
FT                   QAKAIKAISEKAGLWVFLDESCAFCALQYPIVARMAQDRKLTVIYITPDGKRPPWMAKT
FT                   DDVRAESGQSKFLRIGVRPAVAVVVPPENVTVLTQGLLSQDMLEERLLFAGDQSGLLSK
FT                   EISDKAFPERRGLLTPDDIKEIGGSMSDDTKSFTNSVQDRLQKRY"
FT   sig_peptide     30099..30191
FT                   /locus_tag="Alide_4543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.745 at
FT                   residue 31"
FT   gene            31082..32590
FT                   /locus_tag="Alide_4544"
FT   CDS_pept        31082..32590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4544"
FT                   /product="TraH family protein"
FT                   /note="PFAM: TraH family protein; KEGG: bvi:Bcep1808_6750
FT                   TraH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4544"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02147"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2D6"
FT                   /inference="protein motif:PFAM:PF06122"
FT                   /protein_id="ADV02147.1"
FT                   /translation="MLWNFKRMATRTAAASLSIAVALGSLSLPAHAGLKEALNEMFIGT
FT                   STNPQAISTQRLKGMYGGSMTLRPISSGINVIQFAPPKIDAGCGGVDIFFGSFSFINGA
FT                   QFEQLIRSIAANAVGFAIKAAIESMCSPCAKLIAELEAAMRELNAMAKNTCAIGKAMLT
FT                   SAGRGKLMEQASDIGKRVSTALGNFADELKAENSRNYTNPNETAKGTGPGTSGTGAEVA
FT                   ANNPLDGNLVYLAARESLDNGGNTLRLFLSRNDAIGIVMGLYGVVIVNPETNTPSNCSG
FT                   TTPPERCVKDPETFEPTITRWDNLMYPARFDPDGVMVRSCGGSDCRSVPPARLPLATWG
FT                   GVTEIINRALFGTSVIPTSKADVSPDSVVGMFVHKSGEGALSASARSLISVAPLPIINL
FT                   MMETQDIEGASMTLGIQLAEVLPQYLAYKMAVEFQGIGANVFSGQTKKDMPALYERNLK
FT                   EKARQLDTLKPVDGTMAKILNETTKSMVNIRNLTRSQLSVAPKR"
FT   sig_peptide     31082..31180
FT                   /locus_tag="Alide_4544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            32599..38373
FT                   /locus_tag="Alide_4545"
FT   CDS_pept        32599..38373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbr:CBG02561 Hypothetical protein CBG02561"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4545"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02148"
FT                   /db_xref="GOA:E8U2D7"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2D7"
FT                   /inference="similar to AA sequence:KEGG:CBG02561"
FT                   /protein_id="ADV02148.1"
FT                   /translation="MSLTIYTVSDPATVGSVMTSMAMFFSQDSWVGGALKLALICSLLA
FT                   ILAKGVLAREGLRLDVMLIQLLVVMAAFIPKTTVVIEQFDNNAPVRVVDDVPYAIAFPG
FT                   AIAGAFALYMTQKIETVMSGVNGKYIAPSGELDPFMPARVLMQIATAPLDPARHVDPNL
FT                   TQTLYYASRYCGKPELMNIEFAQTANGFVKFADALNSDGTPTFIYSKNHPYRPGVPSGQ
FT                   VATCADVATYIRDIGLQLASQDTVMFKSTLDGIARTSDSKRYSENQTGTQTTKEWVDLL
FT                   PELNRVAPAHAALDNLAVANLMTYTILKQTARDSRNPIDEIVEIQRDTGLFQWAKEESS
FT                   QALMVTTTAPKFMDILFFIFIAATPIVMFVVAANPATGLKVAAGYVLFGLWTQSWIPML
FT                   AIINGWYQAEIQGFAAPGVEGLTPEYLSSLMRHVHTATIAASNMLQSAPYMMFAIMTGS
FT                   MFAMSNMIAKAAPSGGASAGGESGSGTGGSSGKGPMAIGGGALVGNQINPGAQLQGLQQ
FT                   AQALAGGQSGIRDLNSRGDANSVVMGQPTLGSGGDVSAGVAAATETSAALRSSLGKQFA
FT                   RAAKDSASLAKASSSYVRGDQLAQAMKAAGFDATYKSATDSVVGEGFNYSMKDGFQSQS
FT                   QAVFGGKGDLSLGGGVGGGGFNFKAAAALAAALNKIATDVQALEHGRKQEGGTKATSGE
FT                   GITGRTGKSASEGVGGGSGADFKEMAQKAKEMSDTFQAIAQQSQSLDQADKLTQTASNS
FT                   GNAGTSAQLKFGDIANLYGTKHNTASGNAEGARQKVIAAIGGELGMKLGEQIKQNQDKL
FT                   RSANTGATNALSEDQIAAVAALQALETMKNQSGNAGKLEALSGMARLAAAAGAHDASPA
FT                   ISQLAQAENVFKGVTDNLASMDKEVRPTADQAAAGAAAATSDGANEAHRQKVEAQQDSD
FT                   KGRAAATYGSAVGGVGRVDAEGRKAKQAQDGSGFIPQFMRAMDTSGMMLEAGQRQSMRP
FT                   TIPDMASSGARVMGSEAKFVKQGQAEGSDRTQRADQAPSRAAVKDIYGPLMDRKEKEID
FT                   AANERRAAQGLPLIDKHAALSKWANTELKNQQGDRDFESTYGQPVPKPASAGSAGAPAP
FT                   AHPSAPSPAPSPAPVQAVRGAAAGGAAAANIVTGAASAGLVAARAITGAPASFEQPKGG
FT                   PRSGSGSGGGSGGGGGGGGFGGNVAPQPAAAKTVAPAPAAVSSPSKPVQHSAAAPAVAA
FT                   AHAAVSAPSGAPPQPAAAPAVAPAPVAASAPSGASPQAAAAPAVAAAPAAVSAPPEAAP
FT                   QPAAAPAVAPAPAAMSAPSEASPQPAAAPAVAPAPVAPSVPTEASPQPAAAPAVAAAPA
FT                   AVSAAPEAAPQPAAAPAVAAAPAAVSAAPEAAPQPAAAPAVAPAPVAASAPSEASPQAA
FT                   AAPAVAAAPAAVSAPSDAAPQPAAAPAVAPAPAAMSAPSEASPQPAAAPAVAPAPVAAS
FT                   APPEAAPQPAAAPAVAPAPAAMSAPSEASPQPAAAPAVAPAPVAPSVPTEASPQPAAAP
FT                   AVAPAPVAASAPSEASPQAAAAPAVAAAPAAVSAPSDAAPQPAAAPAVAPAPAAMSAPS
FT                   EASPQPAAAPAVAPAPVAASAPSEASPQAAAAPAVAAAPAAVSAPSDAAPQPAAAPAVA
FT                   PAPVAASAPSEASPQPAAAPAVAAAPAAVSAPSDAAPQPAAAPAVAPAPAAMSAPSEAS
FT                   PQPAAAPAVAPAPVAPSVPTEASPQPAAAPAVAPAPVAASAPSEASPQAAAAPAVAAAP
FT                   AAVSAPSDAAPQPAAAPAVAPAPVAPSAPTEAAPQPAAAPAVAAAPAAVSAPSEASPQP
FT                   AAAPAVAAAPAATTAPSDAAPQQASAPAPQQPTAPSVETVPGSGGASSGASLPTLGGGG
FT                   GGLLAGGGAANGWGGGGATQPDSQPQQGNGRPQQIQGRQGSNSRTIPGRQ"
FT   gene            38484..39299
FT                   /locus_tag="Alide_4546"
FT   CDS_pept        38484..39299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4546"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="KEGG: dvl:Dvul_0954 Sel1 domain-containing protein;
FT                   PFAM: Sel1 domain protein repeat-containing protein; SMART:
FT                   Sel1 domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4546"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02149"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2D8"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADV02149.1"
FT                   /translation="MKPFRKKGATAISTKLLAFVLLTVGALQASAASSCSYPQDEISSL
FT                   RTDHAKTPYPSGYGKFDGPIRSWEKLDIPRDGKAGASRLFVQAKTLMSQGDEERGIRLA
FT                   NRSAECGDDDAIMFLAELSIARNNNNGAAKYLELGRKKNLPKAKYLLAEQYDQGALGFP
FT                   KDLKRAFILYYDAAKSGIPQAMSAVAYYFVRGQHGVKDELAALHWYHKAALAGHVESMT
FT                   AYGWMLMVGKGGPVDREEAAHYLHKAKALGDRQAGVFLSDLAITTKNVR"
FT   sig_peptide     38484..38579
FT                   /locus_tag="Alide_4546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.784 at
FT                   residue 32"
FT   gene            39372..40256
FT                   /locus_tag="Alide_4547"
FT   CDS_pept        39372..40256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4547"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gfo:GFO_2422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4547"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02150"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2D9"
FT                   /inference="similar to AA sequence:KEGG:GFO_2422"
FT                   /protein_id="ADV02150.1"
FT                   /translation="MKHLLKVCRVLVCLALAYLAPSLAFAQFAVTIQNQSQTLSTNYEM
FT                   KYGASVIYTGSLPPGQTITRTAVFDAVLIYNPSGGQACSGVYPECGTMYSARTFGVTSA
FT                   TTILFGDDRPECTAAPLSWGPGNYCSAVAQTTLNGQSIVISNSAAGAIGSATAVCNSAV
FT                   WEVSNPTCSASLSAPASVAATDGTVVGKITVTWGAVANATSYDIRHRKQGAPSWTTVTN
FT                   VTSGWQLTTADESVFEFQVVGKNVAGEGTWSGTETGNIAKGCTTQTLNWGPSNYCAASA
FT                   AAGAAGMLISTEF"
FT   sig_peptide     39372..39452
FT                   /locus_tag="Alide_4547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.877 at
FT                   residue 27"
FT   gene            complement(40306..41127)
FT                   /locus_tag="Alide_4548"
FT   CDS_pept        complement(40306..41127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4548"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="KEGG: mpt:Mpe_A2996 putative transposase; PFAM: IstB
FT                   domain protein ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4548"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02151"
FT                   /db_xref="GOA:E8TVS5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E8TVS5"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADV02151.1"
FT                   /translation="MSAEIISALKAMKLHGMAANYPEVAAQARHTDFTPEAFLNQLLKA
FT                   ETAERAVRSMAYQMGAARFPAHRDLAGFEFAQANVDEALVRSLHTAKFIEAAHNAVLIG
FT                   GPGTGKTHLATAVGIEAIQRHSKRVRFFSTVELVNALELEKAQGKAGQIAHRLMYTDLV
FT                   VLDELGYLPFSQAGGALLFHLLSKLYEHTSVMITTNLSFGEWSQVFGDAKMTTALLDRF
FT                   THHCHIVETGNDSWRFKNSSATTTSAAKTRGRKAPTKGEAIPSALDLSTTE"
FT   gene            complement(41124..42635)
FT                   /locus_tag="Alide_4549"
FT   CDS_pept        complement(41124..42635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4549"
FT                   /product="Integrase catalytic region protein"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bvi:Bcep1808_6160 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4549"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02152"
FT                   /db_xref="GOA:E8TVS6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:E8TVS6"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADV02152.1"
FT                   /translation="MGTLAKIRRLHLREGVPIKEIERRTGIARNTIKSWLRRGQMVEPK
FT                   YPARVMATKLDGFTEQLVIWLKADAHRGKRDRRTVKLMYEELAAQGYQGGYGRVAAFAR
FT                   RWRESQAANANKAAFVPLKFALGEAFQFDWSTEYAFVGGLRRRLEVAHTKLCASRAFWL
FT                   VAYPTQSHEMLFDAHARAFAAFGGVPQRGIYDNMKTAVDKVGLGKRRVINARFEAMTGH
FT                   YLFEPEFCNVASGWEKGIVEKNVRDRRTSIWHKAVKLRWDSMETLNTWLGEQCRAAWAE
FT                   LNHPEWPALKVADMLQDEQLRLMPNPKPFDGYVEVPARVSSTALVHLQRNRYSVPSEHA
FT                   HEVVSLRLYPDRLEIVAENVRVASHVRSFERSQTFYDWRHYVTLIERKPGALRNGAPFE
FT                   TLPEPLRKLQAILLRHEGGDRVMAQVLAAVPVHGLDAVLVAAQLALEAGKPSGEHVLNV
FT                   LARLKAPGDGACLEVASTPLKLAVEPLANVQRYDRLRGAAGETAR"
FT   gene            42692..43462
FT                   /pseudo
FT                   /locus_tag="Alide_4550"
FT   gene            43639..45165
FT                   /locus_tag="Alide_4551"
FT   CDS_pept        43639..45165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4551"
FT                   /product="Integrase catalytic region protein"
FT                   /note="PFAM: Integrase catalytic region; regulatory protein
FT                   MerR; KEGG: ctt:CtCNB1_2459 IstA"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4551"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02153"
FT                   /db_xref="GOA:E8TUK0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:E8TUK0"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADV02153.1"
FT                   /translation="MIDVATLSVIRRWALREQLSIREIARRTGLSRNTIRKYLRAGEAE
FT                   PHYAKRVSPSKLDPFALKLSGWLKTEAGRSRKQRRTVKQIYADLQALGYTGSYNRVAAF
FT                   VRLWQEQRLVAQQTTGRGTFVPLAFGPGEAFQFDWSEDWAVLAGVRTKLQVAHFKLSHS
FT                   RAFYLRAYLLQTHEMLFDAHNHAFVVLGGVPRRGIYDNMRTAIDRVRRGKERDVNARFA
FT                   AMVSHFLFEAEFCNPASGWEKGQVEKNVRDARHRLWQVVPPFPSLPDLNAWLEERCVAL
FT                   WHEIEHGKLAGTVADVWAEERAALMPVPRPFDGFVEHTKRVSPTCLVHFERNRYSVPAP
FT                   YANRPVSLRVYADRLVVAAEGQIICEHQRLIERNHHGAGQTVYDWRHYLAVLQRKPGAL
FT                   RNGAPFQELPVAFKRLQTALLMQPGGDREMVEVLALVLHHDEQAVLAAVELALESGAAS
FT                   KTHILNVLHRLLDGKPAPAPVTSPQALKLAMEPQANVLRYDQLREVRYAS"
FT   gene            45155..45958
FT                   /locus_tag="Alide_4552"
FT   CDS_pept        45155..45958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4552"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="KEGG: ctt:CtCNB1_3734 IstB-like ATP-binding protein;
FT                   PFAM: IstB domain protein ATP-binding protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4552"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02154"
FT                   /db_xref="GOA:E8TUJ9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E8TUJ9"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADV02154.1"
FT                   /translation="MRHDPAIASIVIMLRELKMHGMAQAVAELAEQGAPAFEAAQPILS
FT                   QLLKAETAEREVRSVAYQLKVARFPAYRDLAGFDFSHSEVNEALVRQLHRCEFLEDANN
FT                   VVLVGGPGTGKTHIATALGVQAIEHHHRRVRFFSTVELVNALEEEKAQGKTGQMAHRLA
FT                   YVDLVILDELGYLPFSASGGALLFHLLSKLYERTSVVITTNLSFSEWASVFGDAKMTTA
FT                   LLDRLTHHCHILETGNDSYRFKNSSAQQPPQTTKKEKATKNLSTT"
FT   gene            46273..47208
FT                   /locus_tag="Alide_4553"
FT   CDS_pept        46273..47208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pag:PLES_25131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4553"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02155"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2E4"
FT                   /inference="similar to AA sequence:KEGG:PLES_25131"
FT                   /protein_id="ADV02155.1"
FT                   /translation="MTEKIHGSFKAQAANSHETGVKKTDLYKVPPEKLVEEPGFNERDY
FT                   SDPDVQTQIEAFAQAFAAGRYVPPLVVRIDPITGDIIVVDGHQRRRGALLAIERGATIT
FT                   HLECLPFRGNDADRVICMLTSSEGLKLKPVGIARGYLRLLNMGSDVQEIARSVAKTPQH
FT                   VESMLVLAEANSDVQALVNKGAVSATMAIEVVRKHGDKAGAILGSKLQEANARGQTKVK
FT                   PSAIKDWAPPRALATKLYHSVGSALGQITQSSEVQQLLADLEANGSDAAAGKTVPVNAA
FT                   ALIELMRLFKETEEARTKKSEPKKDEQPED"
FT   gene            47275..47523
FT                   /locus_tag="Alide_4554"
FT   CDS_pept        47275..47523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4554"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02156"
FT                   /db_xref="GOA:E8U2E5"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2E5"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6231"
FT                   /protein_id="ADV02156.1"
FT                   /translation="MLRQRMRGALGDFKDALARPTLKQKEAYGRLAHTLCVACCVGAIT
FT                   VLFGAAFSFWTTLLYVCSLMIWGLVLFVAGAILSKGE"
FT   gene            47525..47635
FT                   /locus_tag="Alide_4555"
FT   CDS_pept        47525..47635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4555"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02157"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2E6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADV02157.1"
FT                   /translation="MTAAFLILGSLICAGFVYLATRETGPSKTEDKAHTA"
FT   sig_peptide     47525..47584
FT                   /locus_tag="Alide_4555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.779) with cleavage site probability 0.607 at
FT                   residue 20"
FT   gene            47767..48147
FT                   /locus_tag="Alide_4556"
FT   CDS_pept        47767..48147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4556"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4556"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02158"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2E7"
FT                   /inference="similar to AA sequence:KEGG:Rfer_4359"
FT                   /protein_id="ADV02158.1"
FT                   /translation="MSNLTLESVPAYERMLPEPLTRLRLAEEFYNELSDSVEVLSDIVE
FT                   QHGARTLSDLFHLHAAIMSNGFIDAWPDSAVLDVVSLLPSAERWLAYASVYDECGEIKR
FT                   SIFSKMQAQIPDEQNVESQYLS"
FT   gene            48419..49102
FT                   /locus_tag="Alide_4557"
FT   CDS_pept        48419..49102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scb:SCAB_16871 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4557"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02159"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2E8"
FT                   /inference="similar to AA sequence:KEGG:SCAB_16871"
FT                   /protein_id="ADV02159.1"
FT                   /translation="MNHHLDSIDQEMLRISIEMRDTLEGPRMGDFVLFPNGELERFSYD
FT                   WGNDIQTSPGGSFFLGKAGHASLSCGGLHPPVSKQSLEITSAALPGAFWFFHHGTAGAG
FT                   RGVECEAPCRVYKSSAAYQGYLGKDFRSAVNDRLKALLHAQFEPSESNQCVVNASAFHS
FT                   MLGHVADGTRVKFQSGDELTVRSAIRGWKLVDEKSGKCMGPFDGAMELTAAIVRHDAAS
FT                   ACVAA"
FT   gene            49184..50155
FT                   /locus_tag="Alide_4558"
FT   CDS_pept        49184..50155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4558"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02160"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2E9"
FT                   /inference="similar to AA sequence:KEGG:Rfer_4370"
FT                   /protein_id="ADV02160.1"
FT                   /translation="MSKVAIDRNILKVLLACAEHHVEDVETGIEEGLYIKSENTDLQSK
FT                   QAACAAAAQLVEPAEGAFVEDITAPCKQPPVPRVLVVVRGGIAEPVFDEGVEVAVFDWD
FT                   NYKSDPESTGGVSTKFAELAKPLGIPVAPDEEAIETSGQVRYVIRSLSEAGEPLGAPGA
FT                   FWSNADGWGCLETATHFSTRERMSLNFPLSARQDAEWMLVEEAKDLAAEASAKAATLPA
FT                   FSLVKIGADWLPDDVTVSAYSNGRHWNGWAMPRFTLEAGHSLLKHMPDLSYNGARDAFI
FT                   SKDAQDDQAEEEVFAAETLIVGGSPIKTYAIGAGSWCWYLAE"
FT   gene            50331..51050
FT                   /locus_tag="Alide_4559"
FT   CDS_pept        50331..51050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4559"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbr:CBG23756 C. briggsae CBR-SIR-2.1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4559"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02161"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2F0"
FT                   /inference="similar to AA sequence:KEGG:CBG23756"
FT                   /protein_id="ADV02161.1"
FT                   /translation="MTQTTPKAHPDLAKPVRTLTCTCCGQHTQGRQFHNQDTGFGLGDC
FT                   CHDYVKPRVEDMERTYGIHGVHYKLDPLALVREVGKSLTAPQTEWRISQNLTDRWGDIN
FT                   RHNEANKPLELLEGDPELLERLRAQMWDEITFVVRMDGQFGLLYEVEYSSRESEDRGDP
FT                   KDQASDWYKTLKPQAEVEQAVLKGMESLAQQFPRVKFGVPEVKWIVDDRPAAWAFVPDG
FT                   LLDEQQRETLGKALLAL"
FT   gene            51131..51385
FT                   /locus_tag="Alide_4560"
FT   CDS_pept        51131..51385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4560"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02162"
FT                   /db_xref="GOA:E8U2F1"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2F1"
FT                   /inference="similar to AA sequence:KEGG:Mpe_B0157"
FT                   /protein_id="ADV02162.1"
FT                   /translation="MANGHALVKEQLLHMLFGTITFVVLGAIAVGLDLAAAWIARLGVS
FT                   PFTHTAIEIAAHSLLTIDLLLFALYTAKSSFGLVKEMLK"
FT   gene            51382..51564
FT                   /locus_tag="Alide_4561"
FT   CDS_pept        51382..51564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4561"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02163"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2F2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADV02163.1"
FT                   /translation="MKTTTNSLQIRRIFRDSLKLYFAPLTGAYKGIKNEMLRVDREIVR
FT                   DRGAQAKRSNTAPHA"
FT   gene            51781..52095
FT                   /locus_tag="Alide_4562"
FT   CDS_pept        51781..52095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tkm:TK90_2628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4562"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02164"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2F3"
FT                   /inference="similar to AA sequence:KEGG:TK90_2628"
FT                   /protein_id="ADV02164.1"
FT                   /translation="MPAPLTTELHCKVTVTGDASSEEDRSIPGTYDFEVHLKRAVNPAA
FT                   LTDAEKSEIACQVFDCFHDHIGIDFLEDFFIGVSLASGAELVENDTPPVDLVAKVSYEA
FT                   "
FT   gene            52105..52425
FT                   /locus_tag="Alide_4563"
FT   CDS_pept        52105..52425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aba:Acid345_4350 2-oxoglutarate dehydrogenase
FT                   E2 component"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4563"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02165"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2F4"
FT                   /inference="similar to AA sequence:KEGG:Acid345_4350"
FT                   /protein_id="ADV02165.1"
FT                   /translation="MQAKAHKATGLTFEAILDVLADRTVLAANLSPAAPYPQRMLPDKP
FT                   YRLELGQSSFYVHRGPTMRPLTFNEEQADTAKLSGDRLTMEDAQAFVLDLDLAPAGSCE
FT                   QN"
FT   gene            52504..52965
FT                   /locus_tag="Alide_4564"
FT   CDS_pept        52504..52965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_0894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4564"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02166"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2F5"
FT                   /inference="similar to AA sequence:KEGG:Elen_0894"
FT                   /protein_id="ADV02166.1"
FT                   /translation="MSINPQQARALQALRKAMALATDSGLFEVMTDLSGPGVVPEFTAA
FT                   VAKSEAFLLKSIRIEGFNVRIVAKGERYGLNDCLVHDKDEPLVEFFDAAQDHTVFGPLG
FT                   QFVSRYYRSTLMESKNHDGLLLDTGAPHWHIGAEGMRAVKEFIGTVVAC"
FT   gene            53214..53597
FT                   /locus_tag="Alide_4565"
FT   CDS_pept        53214..53597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: svi:Svir_02820 acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4565"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02167"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2F6"
FT                   /inference="similar to AA sequence:KEGG:Svir_02820"
FT                   /protein_id="ADV02167.1"
FT                   /translation="MSNFNADDFPPIIVGRQYEFYAEMQQAEMPEHARMRNYTGQTVTV
FT                   TSGPLPKDDDEGSDLFRIRAADGREFEAFEEELCGWNKAHGQYFWPDGTYGPDRDKQYL
FT                   GNERNLRAQLNGGLYLDQVERVA"
FT   gene            53594..53842
FT                   /locus_tag="Alide_4566"
FT   CDS_pept        53594..53842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4566"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02168"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2F7"
FT                   /inference="similar to AA sequence:KEGG:Pnap_4210"
FT                   /protein_id="ADV02168.1"
FT                   /translation="MTPEINEIRAFVNRAPKTWMFRDGELLNFTPARHAWLNKMASGSL
FT                   DQRINRRAGICTQTPIWKYPTMSAIQRNQRRRIRRGY"
FT   gene            53915..54676
FT                   /locus_tag="Alide_4567"
FT   CDS_pept        53915..54676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4567"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02169"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2F8"
FT                   /inference="similar to AA sequence:KEGG:Rfer_4370"
FT                   /protein_id="ADV02169.1"
FT                   /translation="MTNYIEQANQQQISIETKITPELLSDVPVNWVGGSRWTFDRGAMP
FT                   GEPFAFLDGDNETSTAAMVEIQTPGRPVFFEVRKVDGILLSRSEFPDEAAREAERSIEN
FT                   ERSLSNYTRQQLARICELDAAIDSAADQGGDVFFAAVAAKDEYIDSQGIDRNRLEVTGR
FT                   EVSQIETGDPALNIVEQVCKDFDGNGIYSVGAIGALRAMAHHWKDHLFEGHSPRMISED
FT                   IDEMKQLLEVMRAEIMSRIAAQQVPAESPRG"
FT   gene            54843..55154
FT                   /locus_tag="Alide_4568"
FT   CDS_pept        54843..55154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4568"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: tin:Tint_1860 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4568"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02170"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2F9"
FT                   /inference="similar to AA sequence:KEGG:Tint_1860"
FT                   /protein_id="ADV02170.1"
FT                   /translation="MPNSSSHQHGISMAVTHLNAPYGAIVSPSDLIESLSQGELRAASP
FT                   KAAAILSYLFIEVEPRLVMRCAMESGSSLPKANQLYSDTIKGGAPRSALWESSIKALL"
FT   gene            55151..55882
FT                   /locus_tag="Alide_4569"
FT   CDS_pept        55151..55882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tin:Tint_1861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4569"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02171"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2G0"
FT                   /inference="similar to AA sequence:KEGG:Tint_1861"
FT                   /protein_id="ADV02171.1"
FT                   /translation="MTTIADIKNHKTNGPWRGLEKLAHEMVQDASTVAKSALLPVLGGG
FT                   TRLMLAMEHRISDDIDLFIRDPQWIGFLTPRLNDKFEHLINTYDEGATSLKLKFNDGEI
FT                   DFIVSMSLLGLDNKVSSECLFPLEPVAEVLAKKLFYRGWALTPRDLFDWHAIERHVPLL
FT                   DTHELMLAELIAARVDGIRMALDQMGTSKQSAIVWQEIRTHELPDLKQTIQWAQGRLGK
FT                   FQAMSEQAAKDKAAGRRPVER"
FT   gene            55886..56215
FT                   /locus_tag="Alide_4570"
FT   CDS_pept        55886..56215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4570"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: rpf:Rpic12D_2831
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4570"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02172"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2G1"
FT                   /inference="similar to AA sequence:KEGG:Rpic12D_2831"
FT                   /protein_id="ADV02172.1"
FT                   /translation="MTEQKNHSRQDRQSLLMHREAVRMIVADPSLAKKALAILARWDGH
FT                   ASLRSKPLRDQWVQIISELDWDRALEESERGNQLRQASPLAILLPNDVRLGIIRSIKNE
FT                   KAAHA"
FT   gene            56208..56780
FT                   /locus_tag="Alide_4571"
FT   CDS_pept        56208..56780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4571"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: reh:H16_B0351 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4571"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02173"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2G2"
FT                   /inference="similar to AA sequence:KEGG:H16_B0351"
FT                   /protein_id="ADV02173.1"
FT                   /translation="MHKSDLEHIIRAASAVTNQYEIVVVGSQSILGSVDAPPMECLVSM
FT                   EADIFVLGHEQLSDLIDGVLGEGSAFHDTFGYYAQGVDSTTSILPDGWRERLVRLQSPN
FT                   TDGKVGYCLDATDLFLAKCVANREKDREFNLALLVHGIVDATVALSRVESMPIDDDAKK
FT                   RIAHLIARLSAESEAAPQPARPSSPKP"
FT   gene            56800..57459
FT                   /locus_tag="Alide_4572"
FT   CDS_pept        56800..57459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4572"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bmj:BMULJ_05815 tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4572"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02174"
FT                   /db_xref="GOA:E8U2G3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2G3"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADV02174.1"
FT                   /translation="MAKPPVIEDKQVEHLLRATAAYSRVPLRDTALLLVLYGTALSVTE
FT                   LATITVGDYLDAKGNVRVTSAVRVDVAHNGEERPLFWSNKRVVAALDAYIAWRVEHKHG
FT                   VTAKKGAYRGLDPESALFLTEDGGAYALTKRMLPSGVWSYSCNTLGAYISRLHANAGIE
FT                   GGSAQSARRTFAVKQHRQGRDLVHIAAILGHKSVSTTKRLVEGDPVRLADIVARAV"
FT   gene            57459..57671
FT                   /locus_tag="Alide_4573"
FT   CDS_pept        57459..57671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mth:MTH700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4573"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02175"
FT                   /db_xref="GOA:E8U2G4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2G4"
FT                   /inference="similar to AA sequence:KEGG:MTH700"
FT                   /protein_id="ADV02175.1"
FT                   /translation="MTGQELETIRESLGYTQEQMADRLACDYVGYKRYATGARDVPRYI
FT                   ARSAFLVEFIQKNGLQKKLDKALDT"
FT   gene            57762..57953
FT                   /locus_tag="Alide_4574"
FT   CDS_pept        57762..57953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgr:MGG_03826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4574"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02176"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2G5"
FT                   /inference="similar to AA sequence:KEGG:MGG_03826"
FT                   /protein_id="ADV02176.1"
FT                   /translation="MLDGETRVFTRNSSYHIVSATEDALRRDVNRHGVDVLARAEFDAL
FT                   PVAGFRETKAGKSLLLAA"
FT   gene            58591..58983
FT                   /locus_tag="Alide_4575"
FT   CDS_pept        58591..58983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4575"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bid:Bind_3528 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4575"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02177"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2G6"
FT                   /inference="similar to AA sequence:KEGG:Bind_3528"
FT                   /protein_id="ADV02177.1"
FT                   /translation="MEQGAFIIHELKGDWPVYPGHPLVLATAIMRVFRTFAEANQPTEH
FT                   GWCAALGDSRIPGAGDHVGAAMRTLELGSRGEGVDSMVAYATRYWEAGQAGGHIKNVDA
FT                   GKAQAEKIEPHFRAISEKWFKTAATV"
FT   gene            58998..59384
FT                   /locus_tag="Alide_4576"
FT   CDS_pept        58998..59384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpf:Rpic12D_4799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4576"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02178"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2G7"
FT                   /inference="similar to AA sequence:KEGG:Rpic12D_4799"
FT                   /protein_id="ADV02178.1"
FT                   /translation="MPRTVEHIVACHQAATALRKAGKPIWNKRIDVKAITHEDRGNESP
FT                   EYISAISQRIAALIRSQAPASYFDIGHEDFDFDFVDAVEAMESCTIEDLAQDKANGCEA
FT                   VDMFNGWLETIYDWADVNRIWLGN"
FT   gene            59673..59894
FT                   /locus_tag="Alide_4577"
FT   CDS_pept        59673..59894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4577"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmt:Tmath_0092 PKD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4577"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02179"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2G8"
FT                   /inference="similar to AA sequence:KEGG:Tmath_0092"
FT                   /protein_id="ADV02179.1"
FT                   /translation="MPAHIVKPNVMRQVQPDVYLSANGFSARREEGFTPNGNPIGQRWV
FT                   LRDANGAWVDVNQYRHDLFEHHGLCTDY"
FT   gene            59911..60132
FT                   /locus_tag="Alide_4578"
FT   CDS_pept        59911..60132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4578"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpf:Rpic12D_4785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4578"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02180"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2G9"
FT                   /inference="similar to AA sequence:KEGG:Rpic12D_4785"
FT                   /protein_id="ADV02180.1"
FT                   /translation="MAHLSSKSVDRINGVIDKISRDSWTRGYYCAVAVLLREEGAVTPQ
FT                   VRSLFKQGGAPHEAAAGDLALFAEHGLI"
FT   gene            60423..61022
FT                   /locus_tag="Alide_4579"
FT   CDS_pept        60423..61022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4579"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02181"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H0"
FT                   /inference="similar to AA sequence:KEGG:Pnap_4409"
FT                   /protein_id="ADV02181.1"
FT                   /translation="MDMTASIAMLIKPHVDAAMAHQFRLELVHPHTQQRMTPVQREEFL
FT                   TLAFAEIAKGMGIDRFLQTPAERLDQFAVMSVMKNHDTAGLLRSLVNSFMIAYACPETS
FT                   ERAFQALVLIEGLRAEVADSKGQGQMTNKPELQVAAHELEVHLSAAAGPNHTPQSPLFK
FT                   VLIGADRVYVKSGYPLKDVPKVFKGFAVEPIVGQPM"
FT   gene            61034..61258
FT                   /locus_tag="Alide_4580"
FT   CDS_pept        61034..61258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpf:Rpic12D_4779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4580"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02182"
FT                   /db_xref="GOA:E8U2H1"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H1"
FT                   /inference="similar to AA sequence:KEGG:Rpic12D_4779"
FT                   /protein_id="ADV02182.1"
FT                   /translation="MTYNAKAKGLKQPTPVEIKEVRTRAGLTQQQAAALVHRADGARWR
FT                   EWEGGKYGIDLAVWELFLLKTGLRALEKT"
FT   gene            61314..61682
FT                   /locus_tag="Alide_4581"
FT   CDS_pept        61314..61682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03242 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4581"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02183"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H2"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro03242"
FT                   /protein_id="ADV02183.1"
FT                   /translation="MTRKFFTIVAAHPVGVQSHELPRVRVDSFLVEGDSLDAGFAEIAN
FT                   FEGIVEATEVFGVECRRVMLTPSTKMQREESLEQWEHWSRMARRGETEADWRLLAEGSE
FT                   TFRQRMDREFLERNPQFA"
FT   gene            61700..61897
FT                   /locus_tag="Alide_4582"
FT   CDS_pept        61700..61897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4582"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02184"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADV02184.1"
FT                   /translation="MAFKNWNVRVHLKTGSVNLGQVGEESEELARCAALSKFGIPEDED
FT                   TDPATRGIRADDEFDVSPAT"
FT   gene            62188..62394
FT                   /locus_tag="Alide_4583"
FT   CDS_pept        62188..62394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4583"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4583"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02185"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H4"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3093"
FT                   /protein_id="ADV02185.1"
FT                   /translation="MADEQLMAQQLVQQGAVHALSTLLKIGCTESNAVDMLASLRQNAQ
FT                   QIRKEADRRGKPNLFLSDQTAFN"
FT   gene            62409..62705
FT                   /locus_tag="Alide_4584"
FT   CDS_pept        62409..62705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_07640 ceramidase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4584"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02186"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H5"
FT                   /inference="similar to AA sequence:KEGG:RER_07640"
FT                   /protein_id="ADV02186.1"
FT                   /translation="MPRYKTPSFQKTYDAMLAAAQDTSSELYHDGMPHRGAAHRTAFWD
FT                   GYAGLATTANVVPGTLSAVCFAAGKEFAKSNPGIAVEDAVWTPGVTRQGGSKV"
FT   gene            63071..63235
FT                   /locus_tag="Alide_4585"
FT   CDS_pept        63071..63235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4585"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_1533 RNA polymerase RPB1 domain 5"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4585"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02187"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H6"
FT                   /inference="similar to AA sequence:KEGG:Metvu_1533"
FT                   /protein_id="ADV02187.1"
FT                   /translation="MKITVEVTQADLAEMGVSAKQLEDAVKQEIEGGLDVDGDTLYIND
FT                   ADVTVVVAE"
FT   gene            63248..63625
FT                   /locus_tag="Alide_4586"
FT   CDS_pept        63248..63625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:F49A5.6 THaumatiN family"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4586"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02188"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H7"
FT                   /inference="similar to AA sequence:KEGG:F49A5.6"
FT                   /protein_id="ADV02188.1"
FT                   /translation="MQMMELVMIADPAHPEARTKLTHPYNYDPFTMWRGPGEPDGSVYT
FT                   DRLFQWDHEKHDKLCIKHFGNSGQYWAQRDTDKIQAFLRDYLEAPELVLCEVQEHCNQA
FT                   TGYPCWFFAYRKMPNAAKAVN"
FT   gene            63637..63891
FT                   /locus_tag="Alide_4587"
FT   CDS_pept        63637..63891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4587"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_4457 Ham1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4587"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02189"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H8"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_4457"
FT                   /protein_id="ADV02189.1"
FT                   /translation="MSQQHTVEGLLDAIRNAASLEELQCLAGPSDAEKQVADNRLAQME
FT                   AIALKCEFESLTPSHQAMQARARYDEVAEVQAGYERRYC"
FT   gene            64281..64520
FT                   /locus_tag="Alide_4588"
FT   CDS_pept        64281..64520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4588"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_04829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4588"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02190"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H9"
FT                   /inference="similar to AA sequence:KEGG:HCH_04829"
FT                   /protein_id="ADV02190.1"
FT                   /translation="MAQAFAEYKTYPVKPGWYCLGFDRLDDQVQADIGPTMEDIYRFDG
FT                   QDWYDEHGEKKEGTFDPELGIEVGMTGADYYVPN"
FT   gene            64600..64806
FT                   /locus_tag="Alide_4589"
FT   CDS_pept        64600..64806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4589"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4589"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02191"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H4"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3093"
FT                   /protein_id="ADV02191.1"
FT                   /translation="MADEQLMAQQLVQQGAVHALSTLLKIGCTESNAVDMLASLRQNAQ
FT                   QIRKEADRRGKPNLFLSDQTAFN"
FT   gene            64822..65058
FT                   /locus_tag="Alide_4590"
FT   CDS_pept        64822..65058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bge:BC1002_4953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4590"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02192"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2I1"
FT                   /inference="similar to AA sequence:KEGG:BC1002_4953"
FT                   /protein_id="ADV02192.1"
FT                   /translation="MSKLLSINERPSDGLASLTVSDSGEVYSGQLWSKCKARKSGVCDA
FT                   SGERYLLGAEIYRPVGNSRNRSMRILAALIDQT"
FT   gene            65154..65318
FT                   /locus_tag="Alide_4591"
FT   CDS_pept        65154..65318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_1533 RNA polymerase RPB1 domain 5"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4591"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02193"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2H6"
FT                   /inference="similar to AA sequence:KEGG:Metvu_1533"
FT                   /protein_id="ADV02193.1"
FT                   /translation="MKITVEVTQADLAEMGVSAKQLEDAVKQEIEGGLDVDGDTLYIND
FT                   ADVTVVVAE"
FT   gene            complement(66153..67667)
FT                   /locus_tag="Alide_4592"
FT   CDS_pept        complement(66153..67667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4592"
FT                   /product="transposase IS66"
FT                   /note="KEGG: dia:Dtpsy_2523 transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4592"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02194"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:E8TS08"
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_2523"
FT                   /protein_id="ADV02194.1"
FT                   /translation="MVIDEQALSELDAEQLREVTQRLLAELRHQRALNEKLTYECALLK
FT                   RLKFAAQSERHSADQKSLLEDEIDADLAAVAVEIEQLQPPAAAPEAKQQPKRQPLPAHL
FT                   PRREIRHEPESTTCACGCRMQRIGEDVAEKLDYVPGVFTVERYIRGKWACTQCETITQA
FT                   PVEAHVIDKGIPTAGLLAQVLVAKYQDHQPLYRQENIFGRAGLAIPRSTLAQWVGTCGA
FT                   RLQPLVDALKAEVLGHRVLHGDETPVAMLKPGSGKTHRAYLWAYAPGAFEATRAVVYDF
FT                   CESRAGEHARAFLGDWRGSLICDDYAGYKASFSQGVTEAGCLAHARRKFFDLHAAGKSQ
FT                   IAELALMQFARVYEIERQVQPLAAPERLQVRQQHSRPILDALHQWMVLQRQQVAGNSAT
FT                   AKALDYSLKRWAALTRFVDDPQLPPDNNWIENQIRPVALGRSNWLFAGSLRAGQRAAAV
FT                   MSLIQSARMNGHDPYAYLKDVLTRLPTHKASRIEELLPHRWQPIDI"
FT   gene            complement(67750..68082)
FT                   /locus_tag="Alide_4593"
FT   CDS_pept        complement(67750..68082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4593"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: rfr:Rfer_2710
FT                   IS66 Orf2 like"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4593"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02195"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:E8TS09"
FT                   /inference="protein motif:PFAM:PF05717"
FT                   /protein_id="ADV02195.1"
FT                   /translation="MIRIDEAWLATTPLDMRAGTDTALARVIATFGAAHPHHAYVFANQ
FT                   RANRLKVLVHDGVGLWLAARRLHQGKFVWAPAGSPNVALEHAQLNALVLGLPWQRVGSQ
FT                   GAISVV"
FT   gene            complement(68079..68507)
FT                   /locus_tag="Alide_4594"
FT   CDS_pept        complement(68079..68507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4594"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rfr:Rfer_2709 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4594"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02196"
FT                   /db_xref="GOA:E8TS10"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:E8TS10"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADV02196.1"
FT                   /translation="MLKDPQTPRYAQRRTHRTYTPQFKAELVAACRQPGASVAAVALQH
FT                   GMNANVLHRWLKEWAQGFHRLEAGVSTAVVASPPPAFIPIDLSAVPPASAGELPSASLP
FT                   TPADGIRIECQRPGMSVTVHWPLSGAAECAQMLRELLR"
FT   gene            68567..69163
FT                   /locus_tag="Alide_4595"
FT   CDS_pept        68567..69163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4595"
FT                   /product="phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase like enzyme"
FT                   /note="KEGG: ajs:Ajs_4213
FT                   phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases like enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4595"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02197"
FT                   /db_xref="GOA:E8U2I6"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2I6"
FT                   /inference="similar to AA sequence:KEGG:Ajs_4213"
FT                   /protein_id="ADV02197.1"
FT                   /translation="MGSPAAYLATGLLVGAPAPAWVKEATVAARQALSTSQIQKAPATG
FT                   TIEVGFSPNKGAEELVLKVLRSAQSEIKLMAYAFTSARVTKSLLEATHRGVRVSVLVDS
FT                   KSASASKQTQAALSALSTAGAQVRTIDVFPIHHDKVIIIDNQHVQLGSYNYSTAAATKN
FT                   SENVLVNWSNPSLAKIYEGHFVNNWALAQQFTGNY"
FT   sig_peptide     68567..68635
FT                   /locus_tag="Alide_4595"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.966 at
FT                   residue 23"
FT   gene            69216..69581
FT                   /locus_tag="Alide_4596"
FT   CDS_pept        69216..69581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4596"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbz:LbrM34_V2.1910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4596"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02198"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2I7"
FT                   /inference="similar to AA sequence:KEGG:LbrM34_V2.1910"
FT                   /protein_id="ADV02198.1"
FT                   /translation="MGFISAIQKLFGRSGREDSAEEINARIEALEAKYFRFSQGNELIG
FT                   PAYGNGAADYVGEAIRAGLSKVKGSDMDFRRDEMFFYGDPMTDNFYMNPAVAEANSLSS
FT                   SDEPSFWINSLGPSWDD"
FT   gene            69620..70567
FT                   /locus_tag="Alide_4597"
FT   CDS_pept        69620..70567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4597"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: eba:p1B184 periplasmic
FT                   serine protease (ClpP class)"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4597"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02199"
FT                   /db_xref="GOA:E8U2I8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2I8"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ADV02199.1"
FT                   /translation="MWKKKPNATPLSNEDLLRVQIASEKSDLRWKRAKRALVAVMAAWG
FT                   LAGVWLASDLGPGKSKAHVPVIRIEGGIAGDSTKINADSVNKLLAKAFDDDSASAVVLY
FT                   IDSPGGSPAEADRIGSFIARKKQETGKPLYSVCANMCASAGYMIAMHGDEIYASKYSLI
FT                   GSIGAILSSWNFSQAIGKVGVQHNAYASGKLKAMLNPYAPVKAGDVEKAQELVDGMGKV
FT                   FAEQVRFYRKGKLTSKVDLFTGEVWSGEEAKTYGLVDVIGTLDDVVHDKFPDGSQILDM
FT                   DKSGGGFRLLRSASQAISQGIQSGMLAHVPLMMQ"
FT   gene            70582..70860
FT                   /locus_tag="Alide_4598"
FT   CDS_pept        70582..70860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4598"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_1551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4598"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02200"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2I9"
FT                   /inference="similar to AA sequence:KEGG:Mlg_1551"
FT                   /protein_id="ADV02200.1"
FT                   /translation="MRYRLNIPNGLDFSALALMCSSDSEVFTYNSGPLEDVCAASGLAF
FT                   AELDADPEESLRVIAAWYELHLANGGARHDAGDTAINAMSRCSLSTE"
FT   gene            complement(70956..71171)
FT                   /locus_tag="Alide_4599"
FT   CDS_pept        complement(70956..71171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4599"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_1032 xanthine/uracil/vitamin C
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4599"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02201"
FT                   /db_xref="GOA:E8U2J0"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J0"
FT                   /inference="similar to AA sequence:KEGG:Glov_1032"
FT                   /protein_id="ADV02201.1"
FT                   /translation="MDSNKLKYIAYFAHVCGGLAVLLGVLRLNGYIPDSLVSELEAVFG
FT                   VGIGTWTVWMGARALKVLGKNEGGGR"
FT   gene            complement(71289..71621)
FT                   /locus_tag="Alide_4600"
FT   CDS_pept        complement(71289..71621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4600"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: clu:CLUG_01384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4600"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02202"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J1"
FT                   /inference="similar to AA sequence:KEGG:CLUG_01384"
FT                   /protein_id="ADV02202.1"
FT                   /translation="MKPCSPAAHIGRAVAGDDSPSNSGPTARSSQGGREGGRGPVRYDA
FT                   AAIAKELEVTASGKRHFGNALRVAKDMAEVDSEERALLDRWATARQSAADNDALRELAR
FT                   KLRALE"
FT   gene            complement(71767..72948)
FT                   /locus_tag="Alide_4601"
FT   CDS_pept        complement(71767..72948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4601"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   aau:AAur_pTC10224 IS1071, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4601"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02203"
FT                   /db_xref="GOA:E8U2J2"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J2"
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /protein_id="ADV02203.1"
FT                   /translation="MLGREPRSTDELLMVYAGIMAHGTSLTAVECARMIPQLSATSIRQ
FT                   AMRWARDERRLSQACQAVLEFMQRHPIAATWGRSDLASSDMMSMETTKRVWQARLDPRR
FT                   NTPSIGIYSHVKDRWGIFHAQPFVLNERQAGVAIEGVIRQEKLETSQLAVDTHGYTDFA
FT                   MSHARLLGFDLCPRLKELKQRHLFVPRGTKVPAEIAAVCEANVDVALIEKHWDSLVHLA
FT                   ASVMSGHASAVAALARFGSAAQGDPIYEAGVQLGRLLRTAFLADYFVKDAFRNELRRVL
FT                   NRGEAVNALKRAIYTGRISPAQAKRVDEMQAVADALSLMANIVMAWNTSQMQAVLDRWS
FT                   NRRQVIPPELIGKIAPTRLESINLRGVFRFPVDRYADQILPSRPNASITGTNG"
FT   gene            complement(72984..76013)
FT                   /locus_tag="Alide_4602"
FT   CDS_pept        complement(72984..76013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4602"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   rpf:Rpic12D_4478 transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4602"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02204"
FT                   /db_xref="GOA:E8U2J3"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J3"
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /protein_id="ADV02204.1"
FT                   /translation="MTTKSERLTVLSDAEQEALYGLPDFDDAQRLEYLALTETELALAS
FT                   SRPGLHAQVYCILQIGYFKAKHAFFRFDWSEVEHDCAFVLSRYFHGESFEHKPISKHEH
FT                   YTQREWIADLFGYRPWAAEFLAQLAQQAAQTVRRDVMPGFIAAELIVWLNEHKIIRPGY
FT                   TTLQELVSEALSAERRRLAGLLSEVLDESAKAALGRLLVRDDTLSQLAALKQDAKDFGW
FT                   RQMAREREKRATLEPLHRIAKALLPKLGVSQQNLLYYASLANFYTVHDLRNLKADQTYL
FT                   YLLCYAWVRYRQLSDNLVDAMAYHMKQLEDESSAGAKQSFVAEQVRRQQDTPQVGRLLS
FT                   LYIDDSVPDPTPFGDVRQRAYKIMPRDTLQTTAQRMSVKPVSKLALHWQAVDGLAERIR
FT                   RHLRPLYVALDLAGTDPGSPWLVALAWAKDVFAKQQRLSQRPLAECPAATLPKRLRPYL
FT                   LTFDADGKPTDLHADRYEFWLYRQVRKRFQSGELYLDDSLQHRHFSDELVSLDEKAAVL
FT                   AQIDIPFLRQPLDAQLDALATELRAQWLAFNRELKQGKLTHLEYDKDTQKLTWRKPKGE
FT                   NQKAREKAFYEQLPFCDVADVFRFVNGQCQFLSALTPLQPRYAKKVADADSLMAVIIAQ
FT                   AMNHGNQVMARTSDIPYHVLESAYQQYLRHATLHAANDCISNAIAALPIFPYYSFDLDA
FT                   LYGAVDGQKFGVERPTVKARHSRKYFGRGKGVVAYTLLCNHVPLNGYLIGAHDYEAHHV
FT                   FDIWYRNTSDIVPTAITGDMHSVNKANFAILHWFGLRFEPRFTDLGDQLKELYSADDPA
FT                   LYDQCLIRPAGRIDRDLIVSEKPNLDQIVATLGLKEMTQGTLIRKLCTYTAPNPTRRAV
FT                   FEFDKLIRSIYTLRYLRDPQLERNVHRSQNRIESYHQLRSTIAQVGGKKELTGRTDIEI
FT                   EISNQCARLIANAVIFYNSAILSRLLMKYEASGNAKAHALLTQISPAAWRHILLNGHYT
FT                   FQSDGKMIDLDALVAGLELG"
FT   gene            complement(76010..76587)
FT                   /pseudo
FT                   /locus_tag="Alide_4603"
FT   gene            76841..77119
FT                   /locus_tag="Alide_4604"
FT   CDS_pept        76841..77119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4604"
FT                   /product="antitoxin of a toxin/antitoxin system"
FT                   /note="KEGG: rme:Rmet_6342 antitoxin of a toxin/antitoxin
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4604"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02205"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J4"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6342"
FT                   /protein_id="ADV02205.1"
FT                   /translation="MSKQAVFTMKLEPELRAEFMAEAEAAHRPASQVLRELMREFVQRQ
FT                   RESREYDEFLRRKVEAGRASMRAGLGRSNDEVEAEFAARRASVASQA"
FT   gene            77116..77400
FT                   /locus_tag="Alide_4605"
FT   CDS_pept        77116..77400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4605"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="KEGG: tin:Tint_3241 addiction module toxin,
FT                   RelE/StbE family; TIGRFAM: addiction module toxin,
FT                   RelE/StbE family; PFAM: plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4605"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02206"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J5"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ADV02206.1"
FT                   /translation="MRVVWTPEAQQDRADVWDYIAADNPRAAARMDEIFSDAAARLIQH
FT                   PMLGKPGKIPGTRELIPHESYRLVYQIDGETVWILTLVHTARLWPPVRD"
FT   gene            77807..78367
FT                   /locus_tag="Alide_4606"
FT   CDS_pept        77807..78367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4606"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: rme:Rmet_6340 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4606"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02207"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J6"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6340"
FT                   /protein_id="ADV02207.1"
FT                   /translation="MDTRLFAFVGADIGPWRIVRAETRVGEPLPEAKRLNVVSASELQS
FT                   ETNAPWILRGITSNERYVMRAEKNEIVAKQQGLARPEATCGALIPIRKNAAWWELTQDE
FT                   RRSVFEQSKHVQIGLQYLPAVARKLHHCRDLSENEPFDFLNWFEYAPIHEVEFNRLLSE
FT                   LRASEEWKYVDREVDIRLTQAQV"
FT   gene            78375..78857
FT                   /locus_tag="Alide_4607"
FT   CDS_pept        78375..78857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4607"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="KEGG: rme:Rmet_6339 cupin 2 conserved barrel
FT                   domain-containing protein; manually curated; PFAM: Cupin 2
FT                   conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4607"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02208"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J7"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADV02208.1"
FT                   /translation="MNTDPQQRRVAPPFRAGYRQRRTLGYSCSVITSQAKLIFGVDMEM
FT                   ESRIFSVTEYIRPSDGEPIRSVVLETKDSAVVVWHAHPGQEITAHVHPDGQDTWTVISG
FT                   EAEYYQGGGKVAHLKAGDIAIAKPGQVHGALNTSPVPFVFVSVVASGNAGFALAEK"
FT   gene            79354..80313
FT                   /locus_tag="Alide_4608"
FT   CDS_pept        79354..80313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4608"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgl:bglu_2p1110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4608"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02209"
FT                   /db_xref="GOA:E8U2J8"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J8"
FT                   /inference="similar to AA sequence:KEGG:bglu_2p1110"
FT                   /protein_id="ADV02209.1"
FT                   /translation="MKLFGIPRSQPLEILGELLTALYMGAIAWIAAATQVHFILFPELG
FT                   ALGHDVIKRPHGTWAKSPGMLVLTPPLTGLVGTILVRNMGGGIVPILLATVAAILIIRG
FT                   LRSPIAPAISAGVLPISLNITSWYYPASLLVGLVLLAAISLIWRGFIAPPQVRSAADVA
FT                   DDTTEEAPHSYSWFPFFAVFLIGTAVLAEVTGWRLILFPPLIVIGFEMFSHSDVCPWAK
FT                   KPLLLPVACTLSALVGVALVTSFGDAPLAVIASMASGILILRVFDLHVPPALAVGLLPF
FT                   VVPAVDYKLPASVGIGTLSLTVLFLIWRRLREMRLIPF"
FT   gene            complement(80638..81177)
FT                   /locus_tag="Alide_4609"
FT   CDS_pept        complement(80638..81177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4609"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="KEGG: rfr:Rfer_3089 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein B; manually curated;
FT                   TIGRFAM: molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4609"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02210"
FT                   /db_xref="GOA:E8U2J9"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J9"
FT                   /inference="protein motif:TFAM:TIGR00176"
FT                   /protein_id="ADV02210.1"
FT                   /translation="MKIFGIAGHSGMGKTTLLERLVPAISARGMVISLLKHSHKNIDVD
FT                   RPGKDSYRLRESGCKEVLLLGNDRWALMHELRGTPEPSLDYLLGRMQHCDLVLIEGFKS
FT                   GTFPKLEVWRASLEKPPLASVWPGIVAIASDTRFVASEQLLAVPNLVKLDLADTASIAE
FT                   FILLHAINPELSDLSI"
FT   gene            complement(81247..81564)
FT                   /locus_tag="Alide_4610"
FT   CDS_pept        complement(81247..81564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4610"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: rme:Rmet_3424
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4610"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02211"
FT                   /db_xref="GOA:E8U2K0"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2K0"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADV02211.1"
FT                   /translation="MKKILVLAAFATLSVSSFAIDKGVAMAMAQKSGCLACHALDKKLV
FT                   GPAWNEVGKKYAGNAAAAAQLAVKIKKGSNGIWGPIPMPPNATVKDADIKTMVEFVLTL
FT                   K"
FT   sig_peptide     complement(81505..81564)
FT                   /locus_tag="Alide_4610"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.800 at
FT                   residue 20"
FT   gene            complement(81691..82410)
FT                   /locus_tag="Alide_4611"
FT   CDS_pept        complement(81691..82410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4611"
FT                   /product="DMSO reductase family type II enzyme, heme b
FT                   subunit"
FT                   /EC_number="1.97.1.9"
FT                   /note="TIGRFAM: DMSO reductase family type II enzyme, heme
FT                   b subunit; KEGG: hla:Hlac_1337 DMSO reductase family type
FT                   II enzyme, heme B subunit; PFAM: Cytochrome c-552/DMSO
FT                   reductase-like, haem-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4611"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02212"
FT                   /db_xref="GOA:E8U2K1"
FT                   /db_xref="InterPro:IPR017838"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2K1"
FT                   /inference="protein motif:TFAM:TIGR03477"
FT                   /protein_id="ADV02212.1"
FT                   /translation="MKTNILVKRMAVIGLAVAAACTGAAAAAQGAVPQAQRIIRVLSVA
FT                   GGDAASPQAAVWKKAPTTQVTLLTAFPGHISIVGTAATQKLAAQAVRASGRLFVKLAWS
FT                   DRTANTVMKDTDQFLDGAAVQFPVNGKVATLHFMGDPVNVVNVWHWRADGRTLNLLAKG
FT                   FGTSTPVPTEDLRSASVRTGDGWEVVLSRPLRVKAEEGANLQGRRTMPIGFAAWDGENQ
FT                   ERDGLKAVTMEWWQLRF"
FT   sig_peptide     complement(82327..82410)
FT                   /locus_tag="Alide_4611"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.619 at
FT                   residue 28"
FT   gene            complement(82407..82988)
FT                   /locus_tag="Alide_4612"
FT   CDS_pept        complement(82407..82988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4612"
FT                   /product="DMSO reductase family type II enzyme chaperone"
FT                   /note="KEGG: dol:Dole_0197 delta-subunit of ethylbenzene
FT                   dehydrogenase; TIGRFAM: DMSO reductase family type II
FT                   enzyme chaperone; PFAM: TorD-like chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4612"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02213"
FT                   /db_xref="InterPro:IPR017843"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2K2"
FT                   /inference="protein motif:TFAM:TIGR03482"
FT                   /protein_id="ADV02213.1"
FT                   /translation="MNTLIDNPKAMASGYLAMAQMFSYPDADAWRRLTENGLVDPALGR
FT                   ETLEAEYLGLFEMGGGTSTMSLYEGQNRPERGRDGILQELLRFYEFFDVHLNQDEREYP
FT                   DHLVTELEFLAWLCLQEHAALRDGRDAEPFQNAARDFLVRHLAAWLPDFRQRLEATETT
FT                   YAQYGPTLGELVETHRSRLGDQPQKSREMQ"
FT   gene            complement(82985..83971)
FT                   /locus_tag="Alide_4613"
FT   CDS_pept        complement(82985..83971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4613"
FT                   /product="DMSO reductase family type II enzyme, iron-sulfur
FT                   subunit"
FT                   /note="TIGRFAM: DMSO reductase family type II enzyme,
FT                   iron-sulfur subunit; KEGG: pmx:PERMA_0658 respiratory
FT                   nitrate reductase 1 beta chain (nitrate reductase A subunit
FT                   beta) (quinol-nitrate oxidoreductase subunitbeta)"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4613"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02214"
FT                   /db_xref="GOA:E8U2K3"
FT                   /db_xref="InterPro:IPR017839"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2K3"
FT                   /inference="protein motif:TFAM:TIGR03478"
FT                   /protein_id="ADV02214.1"
FT                   /translation="MSQRQVAYVFDLNKCIGCHTCTMACKQLWTNRDGREYMYWNNVET
FT                   RPGKGYPKNWEGKGGGFDQEGKLKTNGIIPIMADYGGRIGDFNLNEVLLEGKADQVVPH
FT                   EKATWGPNWDEDEGKGEFPNNHSFYLPRICNHCSNPACLAACPTKAIYKRPEDGIVVVD
FT                   QTRCRGYRYCVKACPYGKMYFNLQKGKSEKCIGCYPRVEKGEAPACVKQCSGRIRFWGY
FT                   RDDKNGPIYKLVEQWKVALPLHAEYGTEPNVFYVPPMNTTPPPFEEDGRLGDKPRIPIE
FT                   DLEALFGPGVKQALATLGGEMAKRRKAQASELTDILIGFTNKDRYGV"
FT   gene            complement(83982..86726)
FT                   /locus_tag="Alide_4614"
FT   CDS_pept        complement(83982..86726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4614"
FT                   /product="DMSO reductase family type II enzyme,
FT                   molybdopterin subunit"
FT                   /note="KEGG: pmx:PERMA_0657 dimethylsulfide dehydrogenase
FT                   subunit alpha (dimethylsulfide dehydrogenase molybdenum
FT                   subunit) (DMS DH alphasubunit) (DMS DH molybdenum subunit);
FT                   TIGRFAM: DMSO reductase family type II enzyme,
FT                   molybdopterin subunit; PFAM: molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4614"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02215"
FT                   /db_xref="GOA:E8U2K4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017840"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2K4"
FT                   /inference="protein motif:TFAM:TIGR03479"
FT                   /protein_id="ADV02215.1"
FT                   /translation="MNSPDEHNGRRRFLQFSAAALASAAASPSLWAFSKIQPIEDPLKD
FT                   YPYRDWEDLYRKEWTWDSVGVMTHSNGCVAGCAWNVFVKNGIPMREEQISKYPQLPGIP
FT                   DMNPRGCQKGAVYCSWSKQPDHIKWPLKRVGERGERKWKRISWDEALTEIADKIIDTTV
FT                   KRGPGNIYIPKRPFAVITNTAYTRMTKLLGAINPDVTSMAGDLYPGIQTVRVPASTVST
FT                   FDDWFTSDLILMWHKNPIVTRIPDAHFLMEARYNGARLVNISADYNPSSIHSDLFVPVT
FT                   SGTDSHLAAALVNVLIAGKHYKADYLKEQTDLPFLVRTDNGKFLREKDFKADGSDQVFY
FT                   VWDTKAGKAVLAPGSMGSKDKTLKLGTIDPALEGNFETHGIKVTTVFERLKAEITPYTP
FT                   EATQATTGVHPSVVRQLAGWIAECKALRILDGYNNQKHFDGFQCGRLKILILTLIGHHG
FT                   TTGSIDTTFEGWRLEGDSELGTVKGKPGRSVSAVLAQWVWGEQYQRSKDYFNDAQLREE
FT                   LGFGVDEMESMRKESEANGWMPNWQSIKEPVVSITGGINMFATSNGYQHLRDNFLKRCE
FT                   LNVVVDFRLNSGAMYADIVLPAAGNTEKLDIRETSVTRFIHAFGQPVKPMYERKTDWQI
FT                   MVALAAKIQERAKARGIARVDDPEIKSGIDFDKIYDEFTMNGKVVTDEQAVRFVMDNSK
FT                   ALGPGTYEEVMKNGFVAVGPSAGKTGPVPKDKPYRPFTVNVTDKKPYGTLTGRLQFYVD
FT                   HDWFQRLGATVPKPQYRGGVLGPKKYPFVRNSPHTRWGVHSFARTEQWMLRHQRGEPDV
FT                   RMSPKAMAAKGIKDGDMVRIFNDSGEFFAVVKAMPALPDNMLFTEHGWEQYQYKNMTHY
FT                   NMVSSELINPLELVGGYGHIKYTSGAFNPNRIFYETTVDVEKA"
FT   gene            87047..87904
FT                   /locus_tag="Alide_4615"
FT   CDS_pept        87047..87904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4615"
FT                   /product="Chlorite dismutase"
FT                   /note="KEGG: dar:Daro_2580 chlorite dismutase; manually
FT                   curated; PFAM: Chlorite dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4615"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02216"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2K5"
FT                   /inference="protein motif:PFAM:PF06778"
FT                   /protein_id="ADV02216.1"
FT                   /translation="MKVRCVSLVAAGLLTIAGSAIGQPAPAPMPAMAPAAKPAMNTPVD
FT                   RAKILSAPGVFAAFSTYKIRPDYFKVALAERKGAADEVMAVLEKHKEKVIVDAYLTRGY
FT                   EAKSDYFLRVHAYDAVAAQAFLVDFRATRFGMYSDVTESLVGITKALNYISKDKSPDLN
FT                   KGLSGATYAGDAPRFAFMIPVKKNADWWNLTDEQRLKEMETHTLPTLAFLVNVKRKLYH
FT                   STGLDDTDFITYFETNDLGAFNNLMLSLAKVPENKYHVRWGNPTVLGTIQPIENLVKTL
FT                   SMGN"
FT   sig_peptide     87047..87115
FT                   /locus_tag="Alide_4615"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            88041..88328
FT                   /locus_tag="Alide_4616"
FT   CDS_pept        88041..88328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4616"
FT                   /product="pentapeptide MXKDX repeat protein"
FT                   /note="TIGRFAM: pentapeptide MXKDX repeat protein; KEGG:
FT                   pol:Bpro_2731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4616"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02217"
FT                   /db_xref="InterPro:IPR014299"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2K6"
FT                   /inference="protein motif:TFAM:TIGR02953"
FT                   /protein_id="ADV02217.1"
FT                   /translation="MNKIAAILLSIGFLSIADGALAQDGMKKDTMAKESMAKEAMTKDD
FT                   MKKPTMGKDAMAKDGMMKKDGMKKGAMPKDAMAKEGMEKGAMMGKGEMKK"
FT   sig_peptide     88041..88109
FT                   /locus_tag="Alide_4616"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.899 at
FT                   residue 23"
FT   gene            88334..88576
FT                   /pseudo
FT                   /locus_tag="Alide_4617"
FT   gene            88673..89044
FT                   /locus_tag="Alide_4618"
FT   CDS_pept        88673..89044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4618"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="KEGG: kpn:KPN_pKPN5p08243 hypothetical protein;
FT                   manually curated; PFAM: Cupin 2 conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4618"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02218"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2K7"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADV02218.1"
FT                   /translation="MLEMRMKAEGRIFSVADYVRPSDSEPIRSVVLETEDSAIVVWHAH
FT                   PGQEIAAHVHPHGQDTWTVISGAADYYLGSGMTTHLVAGDIAIAKPGQVHGALNIGSVP
FT                   FIFVSVVASGNAGFALAEK"
FT   gene            89415..90386
FT                   /locus_tag="Alide_4619"
FT   CDS_pept        89415..90386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4619"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: eba:p2A217
FT                   putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4619"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02219"
FT                   /db_xref="GOA:E8U2K8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2K8"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADV02219.1"
FT                   /translation="MNTTTTHRDGPSARPSASFTNHVAEELLRYDEHLCNVRGLAARSR
FT                   QNNLRIVGWLLQQKFAECPVEIAKLRPEDVRRFLASQLDAHRTTSNASHLASSLRSYFR
FT                   YRTTCGDRVDALTAVISSPVNWRLATIPRALKPDEVERLLNYFTANLRLPKRDYAIVRC
FT                   ALDMGLRAGEIAHLMISDIDWRAGTVMLRGTKSLRQDIMPLPMKTGQALADYLQHERPA
FT                   TRNPAIFVRQKEGRDCPITSMAIQKVIKHACCRVGLPHSSAHALRHTLACRLVENGSSL
FT                   KEVADLLRHRSLNTTLIYAKLDTLRIPRKLDSQSTANWTVGA"
FT   gene            complement(90406..91161)
FT                   /locus_tag="Alide_4620"
FT   CDS_pept        complement(90406..91161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4620"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="KEGG: bge:BC1002_7025 IstB domain protein
FT                   ATP-binding protein; PFAM: IstB domain protein ATP-binding
FT                   protein; IstB ATP binding domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4620"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02220"
FT                   /db_xref="GOA:E8U2K9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2K9"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADV02220.1"
FT                   /translation="MLNHPTHDQLQQLRLFGMARALAEQQAIPDITHLAFEERLGLLVE
FT                   REVTERDSRLTSGRLRRAKLKQAAVAEDVDYRAARSLDRTLFNRLLTGSWVAEHQNVLI
FT                   TGPTGVGKTWLACALANQACRQGKSVLYLRVPRLFEDVAIAHGDGRYGKLMMQLAKTDV
FT                   LLLDDWGLALLTDSARRDLLEIFDDRHGHRSTIVTSQLPVANWHESIGDPTLADAILDR
FT                   LVHNAHQLILTGESMRKHKNSLTQKQVSE"
FT   gene            complement(91181..92719)
FT                   /locus_tag="Alide_4621"
FT   CDS_pept        complement(91181..92719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4621"
FT                   /product="Integrase catalytic region protein"
FT                   /note="PFAM: Integrase catalytic region; Sigma-70 region 4
FT                   type 2; KEGG: bxe:Bxe_A3740 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4621"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02221"
FT                   /db_xref="GOA:E8U2L0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2L0"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADV02221.1"
FT                   /translation="MANNRLSMRKITEALRLHFEHDRTNREIALVIGTSPTTVGEYLRR
FT                   ARVAGIGYPLPDGLDDAAIESRLFPPAVSAEVIRLEPDWAWVHREMRKKSVTLDLLWQE
FT                   YKADHPDGYLYSWFCEHYRQWAGKLSVSMRQTHTPGEKLFVDYVGQTLSIIDGATGEIR
FT                   QAQLFVAVLGASNYTYAEATWTQKLPDWIGSHVRTFEFLGGVTAILVPDNLKSGVKHAS
FT                   YYDPELNPTYQDFARHYGVAVLPARPYKPKDKAKVEGGVLIVERWILARLRNQRFFSLA
FT                   EANRAIAQLLESLNQRPFKKLPGCRHSAFLEMDLPALNPLPQCRYEYAEWKKVRVGVDY
FT                   HVEGDEHYYSVPYRLSRLQLELRMTVTTVEVFHRGQRIAAHVRSPIKNHHTTLDAHMPP
FT                   EHQAVAGWNGPRLLDWAQKIGSSTESAVRVMLGARKHPQQSYRACLGVLRLAKGFGNDR
FT                   LNAACARALKLNAAGYRSIHSILKNGLDRQQPAIAIQAYLPLDHANVRGPNYYH"
FT   gene            complement(93023..93919)
FT                   /locus_tag="Alide_4622"
FT   CDS_pept        complement(93023..93919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4622"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   aau:AAur_pTC10224 IS1071, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4622"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02222"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2L1"
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /protein_id="ADV02222.1"
FT                   /translation="MQGWHTTFLGMRGLPRDISDFEMKAFFTFDGAERDAINARRGDSH
FT                   KLGLALHIGFLRMSGRLLGAFRVIPVALWRHLGNELGIAAPEVASLRAMYERGLTLFDH
FT                   QQVACTVLGFQWMSEHQRRSLVRELRDEVARCADRDQLLVRARQWLYKNKLVIVHERAI
FT                   RTLIAAALAQLEVETGTAIAASVDPATLDRWRASVSELLPDGQTQQSWLWAAPAKHSTR
FT                   QISEVLERIDLLYTLDVHKHLADIPDLILRRYARRLVSRPPSAGAKIKEPARTVEVACF
FT                   LRYSGTADIRVKIGLSG"
FT   gene            complement(94890..96803)
FT                   /locus_tag="Alide_4623"
FT   CDS_pept        complement(94890..96803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4623"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   rpf:Rpic12D_5076 integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4623"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02223"
FT                   /db_xref="GOA:E8U2L2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022169"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2L2"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADV02223.1"
FT                   /translation="MSPADRKIDLSHLAFYRAWLQGMDLRHAADRYFGEGMDLREAKST
FT                   IKWMREALIRAARRHGRMSYVRLLRIQIPNQARDEAPPPALPTLEDFRVERDPDYFYSE
FT                   ADLLEIYLAEYPEAQEAAKSPREQRIERLIVRQIEAINWAESHVATAPLPTDNVIEWFD
FT                   RPMAERLITNGLPNLQALIEHINAHGQRWYNDIRQLGTIQAGRLVAWIKSHGESLPAID
FT                   ETALLGARGLASQDNVRPARTDIMPLESFLVPALLDGVQGENRYLGRSRIEAVNDYQAI
FT                   NAWLVAVSRNAHTRRSYRREAERLLLWAVLERGKALSSLSVEDASAHQEWLYALGRTPE
FT                   GYWRWKIPQEKWLGPRNTARWSPDWRPYEGALSLRSQQQSYVILKSLCEWLTKMRYLDS
FT                   NPFDGVAKPNIEVAGASPDIELTHALSRGQWDFITEFKDRQPDEERTQRLRFILALAYA
FT                   TGLRLSELVDAKAGRLYAKERKSGMGLRWMLKTLGKGQKWRVVPVPSPVMQEMAKYFAA
FT                   RGLPNPLTHLNEIDAETPLIASLGGDGHALSSSMLYKTLKRFFADVATEMRKQEHFEDA
FT                   HKVAQASTHWLRHTRGSHSAEAMPLHMLQRLLGHASLSTTTIYTNADEDDLYEAMEKEL
FT                   AG"
FT   gene            complement(97121..97504)
FT                   /locus_tag="Alide_4624"
FT   CDS_pept        complement(97121..97504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4624"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4624"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02224"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2L3"
FT                   /inference="similar to AA sequence:KEGG:Pnap_4414"
FT                   /protein_id="ADV02224.1"
FT                   /translation="MPNPLNVVMHFWNIQADEHNQWDSLGEDEKIDWAVKMANQGVVRS
FT                   ATPPEPSEYQHFLGKAKDALRGGRDAWAVQSTGEKVAVALVLNKPEWLQEMGYTLAEAI
FT                   DRAGSQWVAMMAQIERDLRELSD"
FT   gene            complement(97530..100289)
FT                   /locus_tag="Alide_4625"
FT   CDS_pept        complement(97530..100289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4625"
FT                   /product="type III restriction protein res subunit"
FT                   /note="KEGG: maq:Maqu_4078 type III restriction enzyme, res
FT                   subunit; PFAM: type III restriction protein res subunit;
FT                   SMART: DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4625"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02225"
FT                   /db_xref="GOA:E8U2L4"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2L4"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ADV02225.1"
FT                   /translation="MTTTTNTHAMLQGALDLAVTAHSLQPEEFQGKLVKNISAKLLRSP
FT                   SPPCLLRAPTGSGKTFVMAKVLERVSDERPVLWFWFVPFVTLVSQTLDSLLQHAQGLAP
FT                   TTLAQGRNQNLGSGAVLISTAQAVSRAQWRTQGYDADADDDVRTLAAVVARARAKELQI
FT                   GLVVDEAHIGLDHSTEFGKFARWLNPDYMLMATATPKDQRLTDFLASAGRIGQEHFSVS
FT                   RDDVVKARLNKQYIEAVIYSIGENMQQVTDLRRTVLRQAWMRNALIGYRLREAGVPCVP
FT                   LLLVQVANGANSVEEAAQELTRLCKVPPEAIGTHTADKPDPVLMAQIANDPTKHVLVFK
FT                   QSAGTGFDAPRAFVLASLKPVNDEDFAMQFIGRVMRVSRQIREKFPKPIPIPEDLDTAY
FT                   VYLGNAQAQAGFEAAVQSTSAVRTQLEGQSEKLIAARTMNGAVKLTNRPTPETPLSYTM
FT                   GLPASDEDDSPAGPAPTLSGSGWHPPVPTDPLQQDLLGDAGWTLDTVDTSSLPKTPPAP
FT                   LQRPRTRDQVLQCLAENGLKAFPLRRGLPALKGSLKSEEKPFIVNLSGISLQIARALPI
FT                   SDLLAQAAVEAALNRTQQKEKHKELTQGKSYTQDIHVVTDRAALAREAQNALQSLPHAE
FT                   EEDYRIIVNTLSERLRPTVDATLAESPDDAASPSMRVRLARDAAHWVIRQSAPELKEAI
FT                   FKAIVDQAKLIDAQPLPDVMIFPNELPLIGSSKNIYGVLPPSKESTADVESVLFMDQRR
FT                   WWEEQRFELDDGAVMSIGRYDGATRLNTLEQSFASCLDEAEFVHWWHRNPDKKPYSVRV
FT                   VRAEHEHYFYPDFVVCVTHESGEPPMQRLIETKQDTKDAVNKAQHYPPFYGKVLFLTPD
FT                   KERLRWVKDDGSLGDVVRPSEFQVVHDMLRLTKPASVPLIPSNTQGIM"
FT   gene            complement(100286..102214)
FT                   /locus_tag="Alide_4626"
FT   CDS_pept        complement(100286..102214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4626"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   maq:Maqu_4077 DNA methylase N-4/N-6 domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4626"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02226"
FT                   /db_xref="GOA:E8U2L5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2L5"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ADV02226.1"
FT                   /translation="MPNDNKGLLQSLDGLSEVELRRLLVEHLTKQKLGLYWERNAIDHD
FT                   RALNADVVLPRLVPQWSHKPNGCNEHRNLVIEGDNFDALRLLRATHAGKIRVIYIDPPY
FT                   NTGNKDWVYNDQFVGKNDRWRHSLWLEFLYQRLTLARDLMTSDGVILVSINDENRARLE
FT                   LLMDEVFPGRRLGSLVWRTKDTGNDLTQRFSHVHEHVLVYANSGFAFNGRPTNRSKFRN
FT                   PDRDERGDWSPQPLTANKSLIERPNTYYPIQDPETGYWYPCDPDSTWRFASETVIRRLY
FT                   GDETAVRAALASLRSDTIETLIAKRKIYFPPCKHEDVLFFSSMQELLAAIKAGKGPVLP
FT                   KKKTPLLRADLPNLDFWIGKPIAPGRPSRKEHWTDKPESERLAPLSSWIAGVNEDVGED
FT                   DDDLMMLRSPRGGIATDEVKQILGSKAFQHPKPVSLIKGLLEQASRPDDIVLDFFAGSG
FT                   TTGQVVLELNAQDRGKRRFILCSSTEANDKEPDKNLCRDVCAERLRRVIEGYGNNDGVP
FT                   IERGGEFAYLQLDKLDPADLALDAKPDHASTMLAMRHASAVQVTQQKQEMRIVAKGNDW
FT                   LLVLCSMVNEDTLEQLTALPSLHGVSRLVVYAPRPKSLSAYLSERGIQAQVYSLRNAIE
FT                   HRAGEHA"
FT   gene            complement(102214..102537)
FT                   /locus_tag="Alide_4627"
FT   CDS_pept        complement(102214..102537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4627"
FT                   /product="PemK family protein"
FT                   /note="PFAM: PemK family protein; KEGG: xcv:XCVc0002
FT                   putative PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4627"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02227"
FT                   /db_xref="GOA:E8U2L6"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2L6"
FT                   /inference="protein motif:PFAM:PF02452"
FT                   /protein_id="ADV02227.1"
FT                   /translation="MTQRGDIVAVSIQGDYGKPRPALVIQSDLLEGLQSVVLCPITSEL
FT                   RDATFRVTVEPNPANGLRVLSQVMADKISTLPRNKLSEPFGRLDDDRMKAVERALLLVI
FT                   GMI"
FT   gene            complement(102534..102755)
FT                   /locus_tag="Alide_4628"
FT   CDS_pept        complement(102534..102755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4628"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCVc0003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4628"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02228"
FT                   /db_xref="InterPro:IPR021558"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2L7"
FT                   /inference="similar to AA sequence:KEGG:XCVc0003"
FT                   /protein_id="ADV02228.1"
FT                   /translation="MATSASSIDKVARYRERMRASGLRLVQFWVPDTRSAEFMARVREQ
FT                   CQRLAEDPQEEQALRFTQSAAELIEGWE"
FT   gene            102831..103667
FT                   /locus_tag="Alide_4629"
FT   CDS_pept        102831..103667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4629"
FT                   /product="restriction endonuclease"
FT                   /note="PFAM: restriction endonuclease; DNA topoisomerase
FT                   type IA zn finger domain protein; KEGG: eba:ebA67
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4629"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02229"
FT                   /db_xref="GOA:E8U2L8"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2L8"
FT                   /inference="protein motif:PFAM:PF04471"
FT                   /protein_id="ADV02229.1"
FT                   /translation="MPRKRKSSGLDDLLALAAMLPWWLAVALAVLAYAVLHHYAGGQAV
FT                   ATPAQPGQLALDHLLKMLATIGQYLVPAVFLLGALVSVLGRRHRQRLVAQVWRSDDGEA
FT                   LRAMGWRDFERLVGEAFRLRGYDVIETGGGGADGGIDLKLKRASETFLVQCKHWQADKV
FT                   PVNVVRELYGVMSAQGASGGFVVTSGVFTADAREFARGCNVELIDGPALKKMIDAAQGA
FT                   ADEGASAAVVATTIEPSCPRCGSAMIRRVAKSGAHAGREFWGCVSYPKCRGVRPLD"
FT   sig_peptide     102831..102929
FT                   /locus_tag="Alide_4629"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.743 at
FT                   residue 33"
FT   gene            complement(103685..104056)
FT                   /locus_tag="Alide_4630"
FT   CDS_pept        complement(103685..104056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4630"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="KEGG: ajs:Ajs_1589 histone family protein
FT                   DNA-binding protein; PFAM: histone family protein
FT                   DNA-binding protein; SMART: histone family protein
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4630"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02230"
FT                   /db_xref="GOA:E8U2L9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2L9"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ADV02230.1"
FT                   /translation="MATSKKPAKTAAPKAAPSIKPIKDVLTKTSLTALLAERTGVDAKS
FT                   VKAVLAALEGAMLGSVNKKGAQAFTLPGLLKIEVQKIPAKPKRKGINPFTKEEQVFAAK
FT                   PASVRIKARALKKLKDAAL"
FT   gene            104214..104666
FT                   /locus_tag="Alide_4631"
FT   CDS_pept        104214..104666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4631"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: vap:Vapar_5860 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4631"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02231"
FT                   /db_xref="GOA:E8U2M0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2M0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_5860"
FT                   /protein_id="ADV02231.1"
FT                   /translation="MANIASVLKAEISRIARKEARAEVESLKKANALHRSAIAGLRREL
FT                   ASLQKQLKQAQRERTPRAAKEQTTDRQYRFSATRLAAHRAKLGVSAADYGRLIGMSGAT
FT                   VYLWEQSKARPRPEQVQQLGMLKEMSRKVILERLEQTKVAKAPKAE"
FT   gene            complement(104677..105234)
FT                   /locus_tag="Alide_4632"
FT   CDS_pept        complement(104677..105234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4632"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_A2370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4632"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02232"
FT                   /db_xref="InterPro:IPR021686"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2M1"
FT                   /inference="similar to AA sequence:KEGG:Reut_A2370"
FT                   /protein_id="ADV02232.1"
FT                   /translation="MRQKPNARTGWQTATGPPDELRTQRRKMPEIQNSVTHAAARQPSR
FT                   FMGLPINAPEAIARVKDFLEPPERCHYCGRAVELVSNEVIYGRVFGWPLTYRCKGCRAR
FT                   VGCHPGTDLPLGTLADDATMRARRAAHDAFDPLWQGKGGKARSRAYQALAKAMGQTKAH
FT                   ISWMDAPACAKVVQICKAGLAI"
FT   gene            105502..107247
FT                   /locus_tag="Alide_4633"
FT   CDS_pept        105502..107247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4633"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   aau:AAur_pTC10224 IS1071, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4633"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02233"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2M2"
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /protein_id="ADV02233.1"
FT                   /translation="MQGWHTTFLGMRGLPRDISDFEMKAFFTFDGAERDAINARRGDSH
FT                   KLGLALHIGFLRMSGRLLGAFRVIPVALWRHLGNELGIAAPEVASLRAMYERGRTLFDH
FT                   QQVACTVLGFQWMSEHQRRSLVRELRDEVARCADRDQLLVRARQWLYKNKLVIVHERAI
FT                   RTLIAAALAQLEVETGTAIAASVDPATLDRWRASVSELRPDGQTQQSWLWAAPAKHSTR
FT                   QISEVLERIDLLYTLDVHKHLADIPDLILRRYARRLVSRPPSAGAKIKEPARTVEVACF
FT                   LRYCLFTTTDQLILMVQRRIADLWRQAAADVPATVNWAAMYKTLLGELVALSAQGAVPD
FT                   AELRARLEALITETQKRKPPSRASLVREGLIDGIRPVRSLLVAIAKLPWQATGEHPAIE
FT                   YLAKLQALYLKGSRKLPVEVVAPSLGMIWQVSISSPDRERAFQALEVATLFALRRAVRN
FT                   GSVWIEHSLSFRGRARLFFTDERWQAESKKHYARLSLPSKAATFLKPLLARVTAGVDAV
FT                   AAAARSGVLRVDDELHLSPLPAEDEDPEVTKLRAALDHRIGEVQLPEVILAVDAQVRFS
FT                   WIMGF"
FT   gene            complement(107675..108031)
FT                   /locus_tag="Alide_4634"
FT   CDS_pept        complement(107675..108031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4634"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="KEGG: rme:Rmet_6339 cupin 2 conserved barrel
FT                   domain-containing protein; manually curated; PFAM: Cupin 2
FT                   conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4634"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02234"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2M3"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADV02234.1"
FT                   /translation="MEMESRIFSVTEYIRPSDGEPIRSVVLETKDSAVVVWHAHPGQEI
FT                   TAHVHPDGQDTWTVISGEAEYYQGGGKVAHLKAGDIAIAKPGQVHGALNTSPVPFVFVS
FT                   VVASGNAGFALAEK"
FT   gene            complement(108154..108726)
FT                   /locus_tag="Alide_4635"
FT   CDS_pept        complement(108154..108726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4635"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4635"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02235"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2M4"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6340"
FT                   /protein_id="ADV02235.1"
FT                   /translation="MDTRLFAFVGADIGPWRIVRAETRVGEPLPEAKRLNVVSASELQS
FT                   ETNAPWILRGITSNERYVMRAEKNEVVAKQQGLARPEATCGALIPIRKNAAWWELTQDE
FT                   RRSVFEQSKHVQIGLQYLPAVARKLHHCRDLSENEPFDFLNWFEYAPIHEVEFNRLLSE
FT                   LRASEEWKIRRPRSRYSSYASTGLTRR"
FT   gene            complement(109133..109417)
FT                   /locus_tag="Alide_4636"
FT   CDS_pept        complement(109133..109417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4636"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="KEGG: tin:Tint_3241 addiction module toxin,
FT                   RelE/StbE family; TIGRFAM: addiction module toxin,
FT                   RelE/StbE family; PFAM: plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4636"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02236"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J5"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ADV02236.1"
FT                   /translation="MRVVWTPEAQQDRADVWDYIAADNPRAAARMDEIFSDAAARLIQH
FT                   PMLGKPGKIPGTRELIPHESYRLVYQIDGETVWILTLVHTARLWPPVRD"
FT   gene            complement(109414..109692)
FT                   /locus_tag="Alide_4637"
FT   CDS_pept        complement(109414..109692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4637"
FT                   /product="antitoxin of a toxin/antitoxin system"
FT                   /note="KEGG: rme:Rmet_6342 antitoxin of a toxin/antitoxin
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4637"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02237"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2J4"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6342"
FT                   /protein_id="ADV02237.1"
FT                   /translation="MSKQAVFTMKLEPELRAEFMAEAEAAHRPASQVLRELMREFVQRQ
FT                   RESREYDEFLRRKVEAGRASMRAGLGRSNDEVEAEFAARRASVASQA"
FT   gene            109946..110524
FT                   /locus_tag="Alide_4638"
FT   CDS_pept        109946..110524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4638"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; KEGG: rpf:Rpic12D_4479
FT                   resolvase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4638"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02238"
FT                   /db_xref="GOA:E8U2M7"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2M7"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ADV02238.1"
FT                   /translation="MRVSSDSDRQSTNLQRDALLAVGVDARHLFEDHASGAKDDRAGLA
FT                   RALEFVRPGDVLVVWKLDRLGRSLSHLLAIVTSLKKKQVAFRSLTENLDTTTPSGEFLF
FT                   QVFGALAQYERALIQERVVAGLAAARKRGRIGGRPQAITGEKLEAIVAALDGGMSKAAV
FT                   CRNFGVKRTTLIETLARVGWTGSRGASSR"
FT   gene            110521..113551
FT                   /pseudo
FT                   /locus_tag="Alide_4639"
FT   gene            113579..114016
FT                   /pseudo
FT                   /locus_tag="Alide_4640"
FT   gene            complement(114221..114895)
FT                   /locus_tag="Alide_4641"
FT   CDS_pept        complement(114221..114895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4641"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   aau:AAur_pTC10224 IS1071, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4641"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02239"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2M8"
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /protein_id="ADV02239.1"
FT                   /translation="MQGWHTTFLGMRGLPRDISDFEMKAFFTFDGAERDAINARRGDSH
FT                   KLGLALHIGFLRMSGRLLGAFRVIPVALWRHLGNELGIAAPEVASLRAMYERGLTLFDH
FT                   QQVACTVLGFQWMSEHQRRSLVRELRDEVARCADRDQLLVRARQWLYKNKLVIVHERAI
FT                   RTLIAAALAQLEVETGTAIAASVDPATLDRWRASVSELLPDGQTQQSWLWGVSQDKARN
FT                   ST"
FT   gene            complement(115162..115413)
FT                   /locus_tag="Alide_4642"
FT   CDS_pept        complement(115162..115413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4642"
FT                   /product="Wgr family protein"
FT                   /note="manually curated; KEGG: alv:Alvin_3256 Wgr"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4642"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02240"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2M9"
FT                   /inference="similar to AA sequence:KEGG:Alvin_3256"
FT                   /protein_id="ADV02240.1"
FT                   /translation="MFQSEIVRWVSKDRWYHAYIVCDLLGDWTVVRRWGGLHNRRGGQK
FT                   IDHVSCFDEANAHMKMIERRRRYSHSGYQQVIKPELVL"
FT   gene            116308..116775
FT                   /locus_tag="Alide_4643"
FT   CDS_pept        116308..116775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4643"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xca:xccb100_0185 cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4643"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02241"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2N0"
FT                   /inference="similar to AA sequence:KEGG:xccb100_0185"
FT                   /protein_id="ADV02241.1"
FT                   /translation="MEMQEAHESAKEGLVGYLDAIHGQMEALVTAHLAACDQLETQKTD
FT                   WKDRSILRLGMHKSGNHLQVKWFTIKWYGKGTARKSVKGSIRKSPNEDTYSMAQLREKA
FT                   QEWEWPLVESTEIRLGILRRQASFVAKALTSLRYGQMALDKYAAWEPKAQD"
FT   gene            117039..117539
FT                   /locus_tag="Alide_4644"
FT   CDS_pept        117039..117539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4644"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oan:Oant_2921 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4644"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02242"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2N1"
FT                   /inference="similar to AA sequence:KEGG:Oant_2921"
FT                   /protein_id="ADV02242.1"
FT                   /translation="MTNAKNDILYVYIHDNPSGRTWRAQIDRAGFLDAATEIKLSGDAE
FT                   KLKIAALLANRIEDLALCELGSEREHELMEGDIEADIPGVFHLGALHSGSSETAFAQVL
FT                   NGQPGGHYIVVRYLAERHVHLRTAHLPQETGFIRGPLSSETLQGALRGMEEADRDYLKS
FT                   MDA"
FT   gene            complement(117756..118919)
FT                   /locus_tag="Alide_4645"
FT   CDS_pept        complement(117756..118919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alide_4645"
FT                   /product="initiator RepB protein"
FT                   /note="PFAM: initiator RepB protein; KEGG: bmj:BMULJ_05362
FT                   replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alide_4645"
FT                   /db_xref="EnsemblGenomes-Tr:ADV02243"
FT                   /db_xref="GOA:E8U2N2"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8U2N2"
FT                   /inference="protein motif:PFAM:PF01051"
FT                   /protein_id="ADV02243.1"
FT                   /translation="MKITLLMRKFFNILLHTVQEQGDQETYRAPMSDIFSTAAMDPRNM
FT                   EIAKETLRSMAKTTVEWDRIRGEEDDVLSWGISALLADAEFLTVGGRLYLEWSYSPKVR
FT                   QRLLDPYRYVQLPLAIFNNFRSGSAAALYEICMKYLSNYNGLTNKAPWEWWKPRISGIN
FT                   DSKSTGEYRFFKRDTLMPAINEVNAVSGLQVSLLEFKTGRKITHLQFSVQRKPQSMLPL
FT                   ESSEDLIDVDILRRMEALGLAKSIIDVIYTENEPEVLVATLDFVESRVAKGGIKSPAAL
FT                   FRDALKKGYGAAEVSKPSKDETSKAPRKKLKSDFVPSEDVPPSKLAAIEEYIKGLSPKE
FT                   LKPLQTRFEAQATGLIKEQFVKSGMKAKIVRVAFAQFIADNGLDQAT"
XX
SQ   Sequence 119718 BP; 25582 A; 34311 C; 35485 G; 24340 T; 0 other;
     gttgttgcct gttttttaag caaataccat gaagatggtc cggagaagcc cgttctgtgc        60
     cacgcgaact gtgaggagat ttatgaagca gaacaaaaaa ggatgcctct cgacccaaaa       120
     aaaggcgtcg catctgctag gagacgcgac gctaaccgtt ggatcacacg ctgaaaaaag       180
     gaaagatcag cccgatcgct cctgcacaaa gcgcttcaca agagcatcaa tctcaccctg       240
     cagcgccggc atgtcctctt ccttcacgcc gcgaagcgac aaatccacct ggccacgctt       300
     gccgaagcac ttgatctggc ctttatacgg gccatacgcg atttgctgct gaagactgcg       360
     ttcacgacgc tgcttgggtt cttctcccag ccgcgactta accagagcaa ccgtctgctt       420
     gtgggtcagc tcgcgcgtct tgatctcatc gacgatctgc aggcccagct cgatttgttc       480
     ggcagtggcg gcttcgtttt tgggaaagat ttcgctcacg gcatacaaga tcgaaagctg       540
     gcttgtagcg gcggacgaag acatgcgctc aataacttgc cgaggcatgc gtgcgacgcg       600
     caagtagtag ctcacctgcg attcggacat ctgggccgag ccgccgatgt cggggatctt       660
     ctcgcaaagc tcacgcgcag agctcacgac accagaatcg agcaagcgct gcagactcaa       720
     ggcgtggtca atcacggaag tctgggaccg ctgctcgttg tacgagcgcg cgcgcaaata       780
     gagttccact tctgactcag gggcctgctc gaatttgaca tccagttggc cgacaccgga       840
     gatctttgca gcccggtagc gcgtgccgcc gtcaatcagg accaccctcc cctcgcggac       900
     gaaaccgtgg gccgcatcgt cctgggaggc cgggagcgtg cgcgcaatct tgtcgatgtc       960
     ctcgaccttg tagatcaccc gaggaccaat gggattgggg tcaatcaggt gaagaggaac      1020
     agccacgacg cttccgatga cgcaccgcga gaggtcgaac cccgctgggc ccgcggaggc      1080
     agtagccgaa gggatggtct ttggcgctgg ttcggcagga ggttcttgag tgaaaaccgt      1140
     aggcttctgc tccacgatcc gagcggcctg cgcgaaacga tcctgcgtcg cagcgagggc      1200
     cgtactcgtg tgcttggcga gagcagattt cgcgtcgagc ttgattctga tggccatggg      1260
     aacctcactt cttggacttg cgggaaccga ttcccaggat cttggaaatc tcgtcggcca      1320
     gggcatcgag ctcagtcacg gcgtcccctg ctttcggaat cgagtgcgcg gtgacaccgt      1380
     aaagcatcga gcgcgtaaac gccacccgat cacccaacgt ggtgcgtagc agcgggaatt      1440
     cagggtacgc cgtgttctct tccagggatt ccagagcgac ccgctcgtca ctgcgattgc      1500
     ggtgatacgc cgtggcgagc acccgcaccg ggaagtcaac accgatctcc ttgcgagcgc      1560
     gcttggccag ctcgaaggag tcgtacacgg catcgatgtc cgcaggcgtg agcttcgtcg      1620
     ggatgatggc taggtcgctc acgagcaaag aagaccatgt tcccggctga tccacggccg      1680
     gtgcgcagtc cacaaagatc aggtcgtact tgtccaccag ctttcccagc tcggccgcga      1740
     cgttgccgct gtagagatgt cccgaccaga gagtggccgg gaagcgaccg tcttcgctac      1800
     cccgagcgag ccactttgat gccgagccct ggcggtcgag gtcggccacc agcacatcaa      1860
     aaccacggtg cccgaaggtg ccagcgagct gacaggccgt ggtcgttttg cccgccccgc      1920
     ccttctggtt gaacactgtt atgactttac cagacgctgt ttgtgccata tgaactccta      1980
     tagatcatga ataatacata aggagggcaa acagtcaatc aaaacccaca accgcaccgt      2040
     taaaaaatca aaataacaac aggatcgcga attggctcat acgcgcccta ccctgcccgt      2100
     tcccgtcgcg actttgggcg tccaaagttt tcgtgcagaa ggcgggttgc gttggatgaa      2160
     ctttgggcgt ccaaagtgtt tgcgatgaat gggtgcctcg cgggctactc cagaggactt      2220
     tggacgttca aagtccgctt cctcgggcgc cgccttgggg agctttggat gtccaaagtt      2280
     catgggctct ttgtgtgcag gcggtggcac atagcaatgc tcgcgccgcg agtgttgtcc      2340
     atttgaggcg gctagtcctt agagtgcaaa cagaaagttc cttaaggcga ggtctggtcc      2400
     gatgggcttc atgggttctt tgggcatcca aagtcgggcg cgttggaccg ggagaaagaa      2460
     gagcgtgggc gcctgaggtc ggagcgatgt cgtgatgtga atgtgagaaa actttagacg      2520
     tgcaaagttg gagcgctctg gggaggtggg tggaggagac tttgggcgtc caaagttcca      2580
     attggcgtct gtcatgcggt ttatgttgag cgaaagacgt gtgcccatcc aaatcattta      2640
     atagatcgac acgtagcgcc cagcgacggc ctggtgcgtg ttcctctgca cgaggggttg      2700
     ctcagactcc gtttgtgcgt ggccagaatg tctggctctt gcgcgcctga gtgctactga      2760
     aatgcagcac gacacgggct gtttgccatc gaacgagtag tgcaacagcg tctggccgct      2820
     gctctatggg ctgaattgag tgttaaaaca attcagtgaa cttcaggacg tttggttgat      2880
     agaaaaattg cgttgttgtg atgaattaac atcggatctg ttctataatt aactattgtt      2940
     aatagctact atgaaaaaat gaggcgcatg ggcactctgt aatcgcgagg caccttggag      3000
     aaagcacggt cgcacgcgtg agctgaggct ccagggcggg atcactgcaa agcaggagtt      3060
     ccacggaatg aatgtctatc cagttccaga ttcatttgct ggcaattacg gcgttgggta      3120
     cgcgctcgcg gcgatcgctg ggggccaggt gctttccctt aaatacatcg cagagcacgt      3180
     ggatgaaaag acgcaggacg agcttgcgga gggtggcgca ccggcacgaa acgcggcatt      3240
     caagtggatt ggcagccagt ccgctggacc ggtagtgcgc gagctgcagg cactcgggag      3300
     agtctgcgcc ggcatgtgca gtggatggga attcgtggag ctttgagatg cgagaaatac      3360
     acaccttcga taacgccgac gaagccgacg cattctgtga atcacgcgat gacgcaacgg      3420
     cagtgatcag caacagccct cggcctggtc agtgcagcgt ctccgttgga ccagcgccca      3480
     gggatccgcg cgacatgacg ctcgctgagc tatttgaggg tgtgaatcga gagtacagaa      3540
     agcgggaaga acgctgccgc gctcgctacg agaccgcact ccatgaggct ggcgtgtgga      3600
     gagttgcaca agcggttgct caggagctcg ggttgcaggg ccgcgaggcc tatcagttca      3660
     gtgcagggtt ttgtggggtg cctgcacgtg ccgccgaccc acgggcggaa ggacttgagc      3720
     cggtctttcg gcagggccgc aaagccagat ctgagaaagg cgtggctgag agatgccgtg      3780
     cagcagaagc aagcctgcgc tcaacgttta cctataccca attcctggca acacagtttg      3840
     tgccggcgta aggccattag gagaggtgag tgatccaaat cagcaacgat ggatcggaaa      3900
     tcctctcaat cacatactgg gcacggagca cgctgccgct ggactgtgct ttctcagcgg      3960
     gaatgcgggc gcattgcgcc tgcttgtgcc cgagccctca aaaatgatgc tgttggagat      4020
     gcgtactggg aagcgggtgc atcgcggtcc gccctgcaca cgtaggggcc gaagggacaa      4080
     atctcctgat aggctgtaac caaaaaggtc cgccctatga acgcaggggt tgaggtattg      4140
     cgaatgggcg caggtttaat tgggcgacga gctatcaatt ccccaacaac tgcgggacgg      4200
     actccccgtg catacctgat aaagcgaaat aaataccgtt gcaatcaata ggcaatcgtg      4260
     tcacaattga ttggtcttta attgccaaac aaggaagcca cgatggccaa gacctacaag      4320
     gaattgatgg aagaacgcaa tgcactggat gcgcaaatcg cccaggcgcg caaagaggag      4380
     ctcggcgctg cggttgctca agcgcggagc attattgccc agtttgaact cacggcagcc      4440
     gacatttttg gtggcccgcg ttcttcaaag accaaggtgg cccctaagta tcgcgatccg      4500
     caaaccggta aggtttggac cggccgtggt cgggagccgg gttggattgc gggcaaagac      4560
     cgcgcgcagt tcgcgatcgc acaggcctcg taaagaggag tccgtatgcc cagctacgcg      4620
     gagctgaagg aacaattgga cagattgcgc aatgaagccg agcaagcgcg gcgtgaagaa      4680
     atgcccaggg tcatcgctgg aatcaaggcg cagatcgagg aatatgacct gaagcccgaa      4740
     gatctctttc ctgatctgcc cagccgaagg ggcgggagcg aggagggagt acgcggcaag      4800
     gggggcaggg agcccaaata ccgcggcccc aacgggcaga cgtgggttgg tggggcaggg      4860
     cgcaagcccg attgggtgcg agctgcgctg gccaacggcg aagatctgga gaagttcgcg      4920
     atctagcgcg gccgaccacc catcgttctc ggcaaacgag acgcaacaaa tgagggcgct      4980
     tttggcgccc ttttttcttt ctgggctcca tattctcgat gcccatgagt cctaaagaag      5040
     acaaaacctg gatctacgat ggcccaccgg acaacattgg cctcctgatt ccggatgcgg      5100
     accccgctga cggcgggtat gtgttgctga ccgaactcga taacggcgtg gtgcgcatgt      5160
     tcgccactcg cttcccaggg cggtgcgtag cgagctggat ggcgcaaatt cgtcgctttg      5220
     gcggagccaa gcctggacgt gtcctggtat cgaccccaca cctgctctat gagcggatca      5280
     agcggatggt cgtcgaagac gtgggtgttg ccgatgcgca gagcatcgag caatacaagc      5340
     gcaagacgaa tgagcttttt gcgattgagc ctctgaacgt caaaggtgca tcgcaacgac      5400
     tcgcgaccca ggcggtggag ctgcacgcgg cgagcgtatg agcgccgaat tattggattt      5460
     tgacaatcca tggcggccca tctacgagtg gcgccaggcc ctgggctggg gttgcgcggc      5520
     cggtggttgc attggtgcag cggcggcgct tcctctaccc actaccttcg caagcatatc      5580
     ggccattagc tgcgccctcg tggcgctctc acgggcctat gtcgcatgga atcggcagga      5640
     ttccaaaagc aaggccacaa acactgaaaa acggtttatc accgtaaaag aagtgattga      5700
     gcatggccag agagcgggga aaaacgggca attgtggctg ggcactggtt tccagtggac      5760
     ggacatcgaa gcggggaaga tgcacgcgtt gatgggtggg ggtgttgccc atcagctcgg      5820
     ccgaaaggtg tctcaggcgg acggcgccta ttggctgcat gccctcggca aagaaacgga      5880
     caacctcatc gacatgagct tgctcgatgg gcacaccttg atcacggggg caacccgcgt      5940
     tggcaagacc cgcttgtttg accttctgat tacgcaagcg attgcccgcg gcgaacccgt      6000
     tgtgattatt gatcccaagg gcgaccatgg ccttgcggag aacgccaggc aaacgtgcga      6060
     actcatgggc aagggcaatc gctttgtgta ctttcacccg gcacacccgg acaaatccgc      6120
     gagcatcgac cccttgcgca actggaatcg caagaccgag ctcgcttccc gcgtagcagc      6180
     gctaatcccc tcggaaaccg gagccgatcc atttactgca ttcggatgga aagttctgaa      6240
     tgacatcgtg gccgggttgt tggccacggg gaaaaatccc aatcttgtgg agctgcgccg      6300
     ctacatagag ggcgggcccg aggatctctt ggtcaaagcg ctgcgcgcgc actttcggca      6360
     gaacgtgcag gactgggaag tcaagtccgc tccattcatc aaacgggcca gcaaaaatcc      6420
     caaatgcaca aacgacgttc ttgacggcta tatcagctac tacaaggaag ttgtgattca      6480
     cgagcatccc aatgtggatc tcgcgggcct tatctccacg cacgagcaca accgcgatca      6540
     cttccaaaag atgatcgcat cgctcatccc gattctgtcg atgctgactt cagacccgtt      6600
     gaaggatttg ttgtcaccgg aattcgaggg cgaccacaac cgcgtcgtca cggacatggc      6660
     gcgcatcatc cgcgacgatg ctgtggccta cctcggcctg gacagcctcg cggattcgac      6720
     cgtgggcagt gccatcggat ccgtgtttct tgcggacctc acggcggtgg ccggcaatct      6780
     ctacaactac ggcatcaaga caaagaaaac cgtcaacatc tttgtcgatg aggccgccga      6840
     ggtggtcaac aaccccacta tccagctact gaacaaggcc ggtggcgcgg gttttcggat      6900
     gttcattgcc acgcagacct tcgccgactt cgcagcgcgc ctgggcgacg aaaacaaggc      6960
     ccgccaggtc ctggccaaca ccaacaacaa gatcacgttg cgggtgctgg actccgagac      7020
     ccagcaatac atctcggacg gcataccgaa gatcaaggcg cggtccatga gcgtgcgcta      7080
     cgggcacaac gtcgccaaca cggtgcgcga ggaatacacc gcgtcctatc aagagcagtc      7140
     cacggaagaa gaggccgacc tgataccacc tggggtgctg agtgagctgc ccccgctgca      7200
     tttttttgcc cgcctgtccg ggggcagaac catcaagggc agattgccca tcatgcagta      7260
     gagacggccg atggcgacgc aaaggaagcc cgaggggcac tcgttcgcat caatcgtgct      7320
     ggtgtgcgtg atatttggcg ccctcgccat attggttttt gtccccgtga acgtcttcga      7380
     gacagttcgc gcagtggaac aaaacagcat ccgcaactgg ctcggcaacg aggcagacca      7440
     atgggtgatg ttgcggatat tcgatgtcct gaggatcacc aaccaggagg ccaccaaatc      7500
     gattggtgag ctggccctct cggggaacca caagatcgat agctggctgg tgcagcgcgt      7560
     ttacgcaacc ctggtatggg tccatctcgt cgcctaccgt tcgggtgtcc ttttgatgtg      7620
     ggccgcgttc ggcgttccgg tgcttctcgc tgcgatctat gacggctaca tgcgccgcga      7680
     gatcagcaag acaaatttct catcccagag ccccatgctg cacaaaagcg gaatcgacgt      7740
     attccgtgca gccatcgcac tgatggtggc ctggctcttg atcccatggc acacctcaat      7800
     gctggtcgcg cctacggggt tcttcatcat aggagcagca gcatggcttt ggatctcgaa      7860
     cgcgccgaag cgcatgtgag tcttaaagaa cggcgcctac gggcactgtc ggccgcacgg      7920
     cgtatttccc aacgattcag ggcgcaggcc attgtgcggc cttccaccct ggaggtcacc      7980
     gggattgaga ttctgtctcg aaacaggctg ctgttctgca gctacccaac catgttgcgc      8040
     gaggacattg cggcactgaa agccgccgcc aggatggcca ggacaggctt ctatcgagag      8100
     gtgcactgca acgtagaaat tctgtcgcta ctgtccccgg actggctgga agtcatgggc      8160
     caaaccatga cacaagggat cgtgatcgag attgttgagc gcaacgacat gttgatgcac      8220
     ggcatgtggc tggagcgtgt catccacgtg ctatcgctca ttcggatatt cgggggcaag      8280
     attgccatgg acgatgttgc ctacaccgac caaagcatcc atctgattga aatgatgcga      8340
     cccgagatcg tgaaggtcga agacgccagg tatgccccgg tattgcgcca acatggcgac      8400
     atggaaatta ttgttgagcg gattgagaca gcgcagctcg cacaagaagc cgtgaatctg      8460
     ggcgtggact atctgcaagg gtactggtgc gacgtgcagg tcgaaaagtg cgtcccaagc      8520
     tctctcacgc cccctggcat cgaggctcgg accaaggggg actggaacaa accgaagcag      8580
     ccctgggcgg aagtcaagga actgctggct gtgggctaac gcgttaccgc atcggcttgg      8640
     gggtacgagg ttagattaat gaattggtaa tctgtttcgc ttttataaat aattctgaag      8700
     cgatcgccga ttttaatctt tggcttccgg gcaaggttct tcatcacgag agcactctcc      8760
     tccccggtgg cggcgtcaag aaacgccagc tcgacattgt tttggtattt gggcgttgta      8820
     atatcatcaa taacgccgag cagcagagtt gccccctgca ccgtggaatt tccaagatta      8880
     tttgccgcaa ccccggtcaa cgccgcctcg gtcgtggtaa ttgggatcgg gactcgcttc      8940
     acttcgaact tggtaataac cccctcagca gatttgatgg tgtccttgtc gctcatttta      9000
     tagagcgtcg tcggcgcact cgcgcaggcg gacagaagaa cagcagagaa gagggcaaaa      9060
     atgaatttga tggacatgac gtaaaggtat ggattgggtc gggatgagag cgtaaacctt      9120
     tgctctgaaa ttggaatcag aagtctattg aatcaattat aattcaatcg acggccgaat      9180
     caattgtaat tggcgcgaaa gcaacaagag ccccaatgat tccacagggg ccgagggagg      9240
     ggcgttcgag acgcgacgtt taagggcgtt tttacgaatc ggttctccgc agcgccctcg      9300
     taggatgtga cgccatgatg agatggatca tggtgtttgt cgcgcttgtt cccggcttcg      9360
     ccgcggcctc ttgctttgag caggccgctg ccaggtacaa ggtgccagtg gagttgctcc      9420
     aggcgatttc aaccgtggaa tctggcgggc gagcgaacgc ctacaacgcc aacaagaacg      9480
     gttccttcga cattggccac atgcaaatca acagcagttg gctgccaacc ctggcgaaat      9540
     acaacatcga tgttgagagc ctgcaggacc cttgcataaa taccaatatt ggggcctggg      9600
     tgcttgccca caacatagcc cgatttggcc tgtcttggga agctgttggg gcatataacg      9660
     ccgtctcaaa atccaaacgc gaaatttacg caaaaaaagt tgcggcggtg ctcggggagt      9720
     tggtccgaaa gaagcaggcc caggcagctc aaaatgtcgg cccgcactcg gttggtcgag      9780
     aaaacaaagt tgcttcaatg aatgtggcac agcggagata gaacatgaaa atggctttga      9840
     aatcatttcc gattgctttt ctgctttgcg cgggcggcat gtacagcgtc caggcaaatg      9900
     ctgctcctgt gcaacgagta tgcgatgtga atggggtaaa tgcgtgtctc gaaaccgggg      9960
     ccgtcgcccc gaccggagcc gttttatcga tccagggtta tgcatatgat ctcgcaacgg     10020
     gagacaagcc tattggcatc tcgggcgcct acatcacggt gcaaaacgaa gagtcgttcc     10080
     agcggtacaa gctaccgatg acggctcttg aggctcgtcc tgacgccatt ggggcgtcta     10140
     tcggtgacgg gtcgcttaaa ccggaagatt atggaattgt gaacgccggg ttcgttgccc     10200
     aggtgttcat ggcttctttg ccgcccggaa gctactcggt gcaggaagcc aggatcgtca     10260
     tgaaaaactc cggtttggtg aggctagatc tttcaagcgc cgatcaaaga gcttcctttc     10320
     gcgtcgaagg tgcggaaagc ggttttgaat tggtgaaaac cgatggctca aaaattccct     10380
     taaccttggg gaaactgagt aatggcagca tccctgtgac gggctatcca ccgctgcgca     10440
     atgacaatta ccaaatcaac gcgcgttttg ccggagcagc ggggccaatc gtcaaaaaca     10500
     tctctttcaa atatcgacgc ccagaaatca gcatccccat ctccttgccg ttggttgagg     10560
     ggttcccagg gataatctcg cgattgactg cggccaatcc tttaaataat aggccattgg     10620
     accttcaaag tcttccagtc gttgtggatc aggtccagaa ctccactacc tctattaatg     10680
     gtacaggtat taatgttggc aaaagtattc aatttgacac ctttggcggt agtggttcct     10740
     atcaattcaa tttgtctgac gccgactcta ctgaagggca gaacctcatt aatttatggc     10800
     tgaatactcc tgacgctccg aacgtaaaga ttactgctac ccgatgggac ccggataaaa     10860
     aggttgttgt tcaaaagagc gccgagcagg ctccgattaa ggtagttgat gttaatttgc     10920
     aggcctcatt ggtagggccg tcagcagaaa cctgccaggt gcttcgttcc atcaagactg     10980
     aaaatattat tggccagtat atcggtactg actgcgccat tcgttttgat gaaatgcccg     11040
     aggggattaa gcataaccaa tatatttcga actctgtcgc cggggcgctt cccacagttg     11100
     gcgtaaacga tttcaaatac agcgtggggg ttatctatac agatccagcc acaaaaaaaa     11160
     cgcatttcta tccgtccagg tcgggggtgt cggtcttgca tatgactggg ttggctcttg     11220
     acccgattgc tctctcgttc cgaagcgaca agctcttgca gcccttctac gacgataacc     11280
     aagccgtgtt tccaggcaaa aagtttggct tcgttgatag cctgcagcca cgggcgcttg     11340
     gtatggtgga tgtttcgagc gcacatcgcg gtgtgcgtac ccgcgtgaca tatcctgatg     11400
     gcagctccaa ggaagcctat tccacagtgt ttacctcagc ggtgccgctt gccatgagaa     11460
     tcgacgagcc atgggaagaa ttgccggtta cggtcgagtc ctggtacgag aaggctcccg     11520
     aatacaagac cactgagaac ctgaccttcg tcggcattcc cttgggccct gtcgtcgatt     11580
     tggagaaatc cttcgtctcg cacgacaagg cccccaccat cattcatggc tctcttgggc     11640
     tggtcaaagg ccaaacgcgc gtgtttgacc ccaacaccat gggcacgtgg aaagtggtca     11700
     tccgcaacga caaaacagcc gaggtgatga gcgcgccggt gacggtccaa ccggatgggt     11760
     cttttgcagt aaatcttgga acccttcccg caggcacccg ctacatcgtg gccgaagcct     11820
     cgatggtcac cgccggtggc gcggtggcca ccagctcggc caagtccaaa ctgcgcgcgc     11880
     tgatcacctc tccgggccag ccgatcacgg ccagcctgaa cgtgcgaacc acgagcggca     11940
     gggcgccgtt tatgcagacg gttgctgtca atttcactga tccgaagatg cagcccgcgg     12000
     tgcgtgaagt cgcctgggag cggcaaagcg aaggtggggt ctgggaaccc gtctatcgca     12060
     agggcacgag cacccaatac agtggcgtca acttcattgc gcaactggat gaacccggta     12120
     aggcgaattt ccgcgctgtg ttgacaaaca aatactcggg cgcagtgtat gcgacagatc     12180
     cagtcgagct agaagctttt gggatgccag aattcaaggt tgtggctccg tcaatcgtcc     12240
     tggcaaagca gcccgtaacc tttgtaattg aagaagagcc cggatttgag gccgagtaca     12300
     cctggcacct catctcgtcc tttggcgctg tgaatattgg tccgacaaac gggaagacgt     12360
     ttactttcac gccgaatgaa gtcaaaagct atggtgtaga ggtgtttggg aagcaaaagg     12420
     gtgctcccga caatcctgcc gcaaatgtaa agaagacggt agcggttcgc gcggtgaatc     12480
     ctctggcctc aagggcaacg atcaatggcc cgaaattgct ggagaccaac aagccctacc     12540
     aattcaccgc caagatcaac gatgttgttt ccgacagcaa aggcaagggt tacgagctca     12600
     aaggctactg gattcttccg gatggcaccc gagtggacgg caccgagctg acattcacgc     12660
     cgcgagcgaa cgataaggtt ctcagtttct atacctacgt ggatggttat cctgaagaca     12720
     cctccgtttc tacttattcg ttcagcacat ggacatatac atggccatcg gactgggcga     12780
     ttcgtctgca acccctgtac cttgacgtac ccgcctccgt gaaattcagt gtggaaacaa     12840
     attcagtgcg cctgcaggat ctgcacggcg aaccattgac ctacacctgg tctctgcccg     12900
     aaggcgtaag ccagagctat ggcacggata gtgccggcac gctgccaatc aacaagtttg     12960
     ggaaatatca gttggcggtg caaatctctg ataccagggg caatgtcacc aacatcacta     13020
     gtgaggaatt cacgatattg cctccagcta cggtggaaac aaacgtctcc ctgctttcca     13080
     aatatgggga taagttctat tctcctggcg cctattacct cggggtaaaa attaacaaac     13140
     tcccccgcgg ggactctttc ctgcgcaacg aggcgtgggt gaacgatagc aaggtagggg     13200
     agttcaccgg atctgggcac tacgtcgcgt tttccgaacc aggtgcatat gacgtaaccg     13260
     tccgaaccat tacgaagagc ggcaactatg gggagcagtc gatctcgcag caggtccagg     13320
     ccccacctgc gccggtatgc gagatcaaag tctccagcac gaccagtggt tccttgatca     13380
     caccggcttg caccgttgaa gcgggatata tcaagtcgta cacgtggaac tacgtccttg     13440
     ggggacaggc ccaggtggcg acctcaaaat cattcctcgt caccaagaag tggctttctg     13500
     acaatgccat tggcacggtc agcctcactg tagagagcga gctgggcgcg aagtccacgc     13560
     accaagttac ctactagagg cagcacaaac aggacgcaaa caggcgcttt tcgcgcctgt     13620
     ttttttttgg ccgctctcta cagttcaagc caatgaaagc gtcttgcgat gaggcgcaaa     13680
     cagcgaccca tatggacaca ccctggaaat tagctctgat tttgttgccc gccagcctgc     13740
     ttgcggggtg cgcaacgcaa tcgccgatct cgcaggtgga acttgaaaag cattgggtgc     13800
     agagaaatgt agaaatttcc tcgcaggaat cagtttttgt gagcaatgag tttgtcggtg     13860
     tttcggcgga ccagtacagg cccatctcgc ttgcagatcg cgtggtttgg gtgtctggag     13920
     ttaatcccaa gacctcgaag ctgcaaagag gaaatacgcc ggtggacgcg gccagcgtcc     13980
     aatcggactc caagaagaag cgatttgtcg ttgagcgtgt gtttggcctc tccaatggat     14040
     cgctgagtgt cgaggcgctc tttgagctgg atcacttcaa ggcggcatcc acggacaggt     14100
     tttatgtgga aatgctgacc gcgggcgaaa tgaccgaaga gagtgtcaac caggtaatgg     14160
     gagtctggaa agaccttctc aaacgcctgc aggccaaagg tttgaatcct aagaacgtgg     14220
     tgatgggcgg ggctaaatat cagcaaaccg cagatgcaat tgtgcttgta aaggtaggtt     14280
     catgattaag cgcccgattc ccaattatgt ggatgaccaa atgcaagtgt ttttttggga     14340
     gctcgacgaa tttttcccgt cgctcaccat tttcgtggtc atgttcatgt gggatcaatt     14400
     gactgtcggc attgtcatga catttgcctt tgtcaagttc ttcggacgtt tcaagagtgc     14460
     aaatatggcc ggggttctgt tccatatggc ctggtgggtg ggcctgatga gcatgaacaa     14520
     gaaattcgac aacggcgcag tccgcgaggc tgttaaatga atttgaagtc ctatctgacg     14580
     agcatgagtc agcttcaaac gctgacgctc accgtcatct tgtccaacgt gatcctggct     14640
     accgggttgg tattcgcctt gatcaatatt accgggcagc gcgagcgggt cgttttggtc     14700
     cctccatctt tggataaaaa ggccgagata gcctgggaaa gtgctaacaa ggattatctc     14760
     aagagcttcg ggctctatgt tgcgaccatg gtcgggaaca tacagccgaa atcctcttcg     14820
     gtggtgctcg atacggcctc tgttttcatg gatcccgaga tctattcgga atttcgcaag     14880
     caactgattg cgattatcga agacccggtt ttcaaggcgt cgggctccgt tatttcattc     14940
     atgccccagt ctgttcaatt cgaacccgag accagtcgag tctttgtcat cggttcgatt     15000
     gtgaccagca cgtccggatc taccaaatat caaaagaacg tggtctatga agttggcctc     15060
     aagattcgtg agggtcggcc atgggtaacc catttcacca gctatgaggg tacggccatt     15120
     cgctcggtga attggtgggc acaaaagagc tctcgcgacg attcggtaat tcctgactat     15180
     gcgttgcccg aaaaatggaa aaaggaagag gtcaagagcg cgcctgaatc ggatttctcc     15240
     gcgatgcatt ttcctccgac gccggccgct agcgatgctg aaaagggctc ggctgaagtt     15300
     cttccagcag caaatgaaga aaccatcaat taggcagcag tatgcaattg gaatttaaaa     15360
     agaaggcgct gctgaccgtg ttgcaggccg ccctggtcgc gggatcgttc gccgcccacg     15420
     ctgccgaaga cgccggcact gcaccgactc cggtcactgc ccctggtcaa cagaagtccc     15480
     caaccgcccc ggccgcgagc gatgagggtt ccgttggtcc aaagcctgag ccgcaggcgc     15540
     gtttcctggt caagaagggg agcggtggtg caaagacagt gggcacagcg ccggaggtgc     15600
     gacttcccga aggccctctg ggcgccgctc ccggtgacat cggggctctt cttgccgatg     15660
     gccagccgaa agcgcccgag agcctgaacc aggcaattgc cgaagcgcaa aaggctgcgg     15720
     gtcagcccct cgatcccgtg caacgcgaaa tcaatatgcc ggggctgaaa aaggacgacc     15780
     cctcgctcaa gcccttcgtg ttgcacacgc gcaatggggt caatgaaatt gtccggatgt     15840
     cctcgcgtct tctcaatcgc gtcgccaccc cattcaagaa acctacggtt atcgatacct     15900
     ccgagtccac cagcaaggtg attggcagcg atgtgtactt cttgccgcac ggggatcagc     15960
     cgatcggtct cttcatcgcg gactcggcca atacgtctca gacagtcagc ctgacggtga     16020
     tccccgacaa cacgattcct ggccaaaacc tgatcgtcaa gctcgaagac ctccgaacga     16080
     tcaagagcct cgcgaatgtg accgattcgg aagcccaggt cctgcatccg caggccaatg     16140
     actacacgag catggtgcgc tccttgctgg ccagcgcagc gcgcggaacg gtgcctggct     16200
     tttcacctgt gccccttgaa ggcggcgtgg cgcagatggg cgacatggcg attgagcccg     16260
     agttgacctt tgcgggctcg gtggcagaca tctaccgcta tcgactcgtc aacaccagcg     16320
     acaaacagat tgacctggtg gagaccgcgt tcttccgcga gggcgtgaag gctgtgagct     16380
     tcttccctca caccagcctc cagcccaagc aggtgagcta tgtgttcatc ctcgctgata     16440
     agcctgaaag cgcggcacag ggagcgtcgc aatgagcctt gcatcgagct tcagcaacct     16500
     ctctgccaac cagaagcgga ccaccatggt ggtcgccgcg atcgttgcga ttctgggcat     16560
     cagcaccctt ctcgcatcgg tttccgagcg caaggtcaat cggctgcccc acgcaaacaa     16620
     ggcagaagtt accgttgtat cgccttctcg aacaacgggc gtggaagcgt ttgctgcgca     16680
     attggccaat ctggaaaagg cgcagcagga tctgaaaagc gagatgaagt ccgtcttgcg     16740
     caacgccggg tcggccaagc caggcggtca aggtgaggac gcacccaaag aggtgcctca     16800
     acttgaagat gtcctgcctg agatttcggg ccagaccagc atctttgaag ctcccacgaa     16860
     aaaggggccg gagctgccca tgacgactcc agcggttcca gtggcaccga gggtggatgc     16920
     tgccccggcc acagttgtcc cgccgcctgc tcctccaact atccgaatga tcggcgaaga     16980
     gggcgagctc accgacgaga aagtctcgaa gctcaacacg cccgccgaag cggccaggac     17040
     agagaagaag gtcgagtcgg cctttgtgcc ggccgggtcc atgttcactg gtgtgctgct     17100
     ctccggactt gatgcgccca catcggccgt cgctcagaag aacccgacgc ctgtcgtggt     17160
     gcgcgtcaaa cgcgaggcgg ttttgcccaa ctacgcatca ctcgatgtgc gggagtgctt     17220
     cgtgatggcg gcgggatatg gccagctctc cagcgagcgc gccctgatgc gggcggaaac     17280
     gctctcctgt gtacgccagg acggcaacgt gattgaaacc agtctggacg cctacatcgt     17340
     gggtacggac ggcaaggtcg gtatccccgg acgtttggtg tccaaacagg gccagatgat     17400
     cgctcagacc cttgtcgcgg gaaccctggg aggcatgggg caaatgctgg gccgctcgcg     17460
     cgttccgcag ctcaatatca acgggcaagg ttcgctgtac gaggacgagt cgatgtcctc     17520
     aatcgcccaa accggtatcg ccggaggtat cggatccgcg acaaacatga tcgcgaagtt     17580
     ctatctggac atggccaaag agaccttccc ggttgtcgag atccctgctg gtgaggtggt     17640
     gacggtggtg gtgacccgcg gctcatcgct gccactcaaa gggtcgtcaa gccttcaacg     17700
     catctctgcg cccaacgaga accagcggaa cgctcagggc acggcctcgc gcgcagaacc     17760
     tccacgccgc gtaacggacg ctcggccggc gaacccaggg cagatcgtgg cgcccgctga     17820
     agcggccatc aagtccgccg tcgcggcgac tgcgggcgtg aagccccccg tccaaaactt     17880
     ccaaaacggc ctcggctggt aatgatcatg taccccctcc aatcgcgccc tgcattattc     17940
     gctgctgctg tcgcggcatt gttcctcagc ggctgcgctg gcccgctcaa taccgcagac     18000
     aactcggaat tcgcgtgcag cgaccgcgac tgcccgactc cgtttgaggt ttacaacgca     18060
     acgaactcgg cgccgccatc tgtccgcaac ggacgcacgc cagagaagtg gaacaagggc     18120
     gcgaaaggca atggggccgc ggaaaagcag caagagcaaa ccgctatgcc ggccttggac     18180
     ctcacccagg cggtagcaac aaccgtgcgc ctgcaagacc ctgcgcaaaa gactgcgcaa     18240
     cccatccgcg aaccgagcca agtgatgcgc atctggatcg ctccttggat tgaccagggc     18300
     gacaacctga actggtcggg ctatgtctat accgaagtga cgcccaagcg ctgggccttt     18360
     ggtgagcgtc agatccgcta ccaaagtctc gcgcctcaat tcgtgcaacc gaaataacga     18420
     tttccctcaa ccgcctcaag aaaggtacta ccgtgaaaag caagctccaa aacaattcca     18480
     agctggtccg caacgtgcaa accgcactgc tgctggcagt cgccgtctcg ctccccatgc     18540
     aagccatggc aggggcgggc ggcagtgagt tcacccaggt ctatgaccag ttgaccggtt     18600
     ggtccaacgg cattttgggc aagtcgctcg gcgtggccgc gttgcttgtc ggcctgggtg     18660
     tgggcgtgat caagcagtcg gtgattgccg ctgttgtggg cgtcgccatg gcgctgaccg     18720
     cgggtttcgg cccaggcgtg atcgacggcg tgatcacctc gggagtgtcc atcgtcaacg     18780
     ccatctaaaa cgccaaacat gtccgccctg caccgcaagt ttcaacgcgc cgctgagcgc     18840
     atatcgcccg acgagtacat cccagtggtg gcctacgacg aagagagcgg tgtgctcatg     18900
     accgatgatg gtcatatcgg tgtttgctat tggggcgacc cggtgaacgg ggcggacgac     18960
     acaactgccg acatgctcaa gggggcgctc tccctggcgc tacctgaagg cagctttgtc     19020
     caactgtcga ttatcgggat gcccgacatc gataaccaaa ttgctcaata ccaaaatcgg     19080
     cgagagcaag acatctatcg gatccgtgac gtttctgccc gcgacaccct tcgtgagtac     19140
     gcaaagcgcc gcgcggagtt catgcatggc gcggcccacg tctccaacat ccccaccata     19200
     ggcacaaaga tccatgatcg gcgcgtcgta ctgtcggtga agtcaccctt caaaggcaga     19260
     acgccaagca ccgaagagat cgacaacatc gctgaaactg gcgccaagct cgcagagtcc     19320
     atgcaaacct tcggtttgtt tctgcgtcgc atgaatgcca cccaatatct ggagctggcc     19380
     caccggctca cgcacccgtt tgcaccgcgc aagattgacc aggtgcgaac cgatcagctc     19440
     ctcaagcacc aagtgttcct gccaggcgag agcatcgagg tgcacaagga cgcattgttg     19500
     ttcaacgacg atacgcacgt gcagatgctc gcggtagggc gctggcccaa gagcaacgac     19560
     ttgtccctga tggccttcat gatcggggac ccgctcgggg cgaacaatca gatcaagctg     19620
     ccctatcaca tcagcttgac gctgcactat ccgaatcagt acggcaaaac cacgagcatg     19680
     aagcagaagg ccgccatgat caactatcag gccttcggcc cgatgttgcg cttcgtgccg     19740
     aagctggcgt tcaaaaagca aggcatggat gtccttgtga atgcgatgga gcagggcgcc     19800
     tcggtcgtgg aagcatcgct cacagtgagc gtgtacgggc agacccgcga agagtgctcg     19860
     cgccaatcat cgacgctgcg cacctacctg caatcattcg acttcgcgat gggggaagag     19920
     cgctttgtgg tgctctcctc attctggaat tcgttcccgc tctttccttc tgtcgagagc     19980
     atcaagaaca cctttcgctt caagaccatg gcggtggagc aagccatgac ctttgctccg     20040
     atcctcggag agtggaaagg aacgtccgtg tttgccaagc ctggccaggg ctatgggatg     20100
     ctcctgcaga gtcgtcgcgg tcagttgatg agcctcgacc tgttcgacag tcccacgaac     20160
     tacaacggcg tggtcttcgc atcttctggg gcgggcaagt cgttcctcac ccagtcgatg     20220
     aacatggatt acttgtcgat gggggccaag gtgtgggtga tcgacgtggg gcggtcgtac     20280
     ctgaagcaag ccaagatgct caacggctca ttcattgagt ttgggccgga gtcagggatc     20340
     tgcttgaacc cgttttctcg ggtcgtggac atcgacgaag aagtgtcctt gatccaggcc     20400
     tgcatcgaga aaatggcagc tcctgaggac gggctcgacg actaccgtcg ctcgcgcatt     20460
     gaggaagcga taaaggccgt atgggggcgc atgggtacgg gttcgacaat cacggacgtg     20520
     gccgactacc tcacgcacca agaggaccag cgcacagccg acatcggcaa catgctgtac     20580
     cgctttacgc gctacggctc cgaaggctat tggttcgacg gcaaggcgaa cgtggacatg     20640
     tccaatgatt tcgtggtgct cgaactcgaa gagctcaaag gaaagcgcac gctgcagcag     20700
     gtggtgttga tgcaactcat cagcaacatc cagcgcgaga tgtacctctc caatgacggg     20760
     cggccaaaga tcctggtgat cgatgaagcg tgggatcttc tcgatgaccc gatggtcggg     20820
     cgtttcatgg agcatgccta caggcggttc cggaaatacg gcggcgcggc cattgtggtt     20880
     acgcagtcaa tcgccgacct gtaccgctct gattctgggc gtgcaatcgc cgccaacagc     20940
     gctttcaaat tcattctcaa gcagacggcc gagtcaatcg agcaggtgaa gaaggaaggc     21000
     catctggcgc tgggcgacta cggcttttat ttgctccaga cggtgcattc aatacccggc     21060
     aagtattcgg aggtgatgtt ctacaccgag caggggatgg gtgtcgcccg actggttgtg     21120
     gaccgctttt cacaagtcct gttctcgacc tccggtgctg agcgaacgga agtcattgca     21180
     aacatcgagc ggggcatgaa cccggttgag gccgtcgaaa cgtttatcgc caaccatgga     21240
     taagagaaaa atgcaggaac gagagaccga ggaccaagcc caagacgacg aagcaacacg     21300
     gcaacccaag gccactgcgg ctgcgcccaa gaagagctct ggcctcttgc cattcatggt     21360
     ggacgcgctg gtggtagtgg tcatcgcagt gatcgcttcc tttgccgtgg tgcgctatgc     21420
     accccaaacc gaaaggcctg ccgaaccgca gaagttcgct tacgtggata tggagcgcct     21480
     atcaagggag cacattcttg ggctcaccga acaggcgcgc agtggggaaa ttgatgcgga     21540
     ggagatcacg aagaggactc gcgaattcgc tcaagcactc atgaccggaa tatccgcggt     21600
     gtccgagcag ggcgtcatcg tcttcaatgc caacgccctc gcttcggttc ccgcgaccac     21660
     ggaagatttg acccaaacac tgcaggaaca gttgcagaaa tctgggaaga tggcaatacg     21720
     gaaatccaag caagcatcgc cctaaacaag gcgaaacctg gtgcgtttcg tcgcaattta     21780
     cggcggacgc atacctagta tttgaagcac ctgcaggcca ccgcttgtcg gtgctttttc     21840
     tattgggaat ccaccttgca atcgaattca attcatggcg atcgcgtgat gcaccgcgcg     21900
     ttgcgagcgc ttggagagat ccttgtcggc gtgatcctcg ctctcgctgc tggcgtgctc     21960
     cttgcgatgg ccacgggtta ccgagtcggc ctggatgcgc agcgcctcgc cggtgagccc     22020
     gcctgcatgc cattccttat ctatgtctgg cacaagaacc ggggcgaggc gccggtgcgc     22080
     ggcgactacg ttgtcgcgcg catgcccaag accgggctgg gtgtcggcgg ccgagaaggg     22140
     gaccggatcg tgaagctcgt catggccggc cctggcgatg aagtccgaat cgcagggacc     22200
     gaactctgga tcaacggcaa acacaccgac cggctttggc tcgcaaagag tctgcccgga     22260
     aaaaaggtgg gcgactttga cacgcatcgg gtgcttggac cgcgtgaatt ctttgtcatg     22320
     ggcacgacga aggaaagttt tgactctcgc tactggggac cattaaatcg tgaagcaatc     22380
     attggcacgg caattcctgt gctgtagttt tttcgtgatg gccggggctt cccacgcagg     22440
     aattgaaacg accgctccat ggcttgtccg cgacgacatc acgcagaaac cccagcccct     22500
     ccaagtcgct cccacgcgca ccctctctga cttcactcgg cagcagccgc agcagcagca     22560
     gtggatgcaa gacgacatga tgcgacgctt gcgcgaggcg gcgcccaagg tcgggcaaga     22620
     cacgacagcg caagactttg acatgcaggt gttcatctcg gcgggcatgc ccgaaggggt     22680
     cttgcgcaac ctgtttgcgc aggccatgga atttcctgtc gggcgcgtcc ggtttgttgt     22740
     ccgcggcttt actccgcaaa agctcggcgt gctggtgagc aagctcagag gcctgttccc     22800
     cgacccccaa accgatcaca tcaccctgga ggtggacccc aacgcgtttc gcgcctacgc     22860
     cgttgatgcc gtccccctgt acctcgtcaa ggatggcgag aaatggtacg agaccaaggg     22920
     ctcgcaaagc ctgtttgcag cacgcgagaa cgtgcggcaa cgcggaaaaa gcgcgcacgg     22980
     ggagctctat gccattgccg agcccgacat gctcagcgtg attgaagagc gcacaaagaa     23040
     cttcgactgg aagccggtga tggcgcgcgc gcaagaacgg gcggccaaga accttcgccc     23100
     tgggtttgat ctgccgactg caacgcagga cggtacggct tacttcgtgc cgaccttccg     23160
     cgtgccacac gacatcaaat cgccctctaa agacggcgct ggccaagtgc tgttggccaa     23220
     aggtgggcag accatcaacc tgttggacta cacccggctg caggtgcccg tcatcgtgtt     23280
     tgacccatct gacaaacgcc aggcgcaaat ggtcaagcgc tggattcagc agcccgaatt     23340
     tgcaaatgca gatctgttcg ttgtggggtt caaccttcag gcgatcgacg ctaagacgcc     23400
     ggtcacggtc gagattgcgc agagctacaa gcggcccgtc tatccgttcc tctcaaagct     23460
     caatgaccgc ttcggcgtgc aggccgtgcc tgcgatcgtg cagcaggaag ggccgcgcct     23520
     gcgcatcagc accttcaaac cggaggactt ttgatgcgcc ccatcgtctt tgttaagcga     23580
     ctcatttgcc tgctcgctct gctgctctcg acttctcacg gcgcgtttgc acagcaagcc     23640
     atgtcccttg ggtgcaacag ctacagcccg ctcgaaacga tgttcagtga cgtttgctgg     23700
     tccgggatct ttccaatccg gctggccggg gtcaccttca tggacggcaa gtccggtgtg     23760
     cccagcgacg catccaaacg tgtggtttgc acgtgtgggg gggatctgct ggaaggcaag     23820
     ctgcctcgca tcggatttac cgtgggtttc tgggcgccgt caaagatcat cgatgtcacg     23880
     cggcggccct actgcatgcc gtcgctaggg ggcttgcaat tgcctcttgg gaatgtcgag     23940
     ttcctcaatt cgggggcgaa catggggcgt ggcgataaca gccagcattt ctcgaactgg     24000
     gtgctctaca gttttccgat catctggatg ctgcgcctga ttgatgaggg ggcctgccca     24060
     gccgatgggc tcatggattt cgacgtgatc accgccagcc caatgtttcc caactggaat     24120
     gatgttctgg ggcgctatac ggccttcatc aacccggaga tgctgttgtt tgccggcgcc     24180
     acgtcgcttt acgcgctgcc tgttgatgcc gcctcagcca cggcagggca gccgatcaac     24240
     gaccttttct gggttgcggg agcatggggg cccggatacc ccatgaccgg cttctccaat     24300
     ggtggcactg tggaccatca gatcgagcca gtcagagcca caagcctatc ggcatttcgt     24360
     gggctctccc tgatgcaccg actgggcttt ttgtcggaga ccatcggctc ggacaacctg     24420
     tgtgagcgca accagcgctt cgtgattcgc aaggacgcct accgatggca attcctggcg     24480
     ccatcaccag agagcgatgg gccagcagag ggagcgccgc caccggtgaa ctccaccaac     24540
     caggtgcgcg aggtcaaccc gccttcacgc tacagcacct gcacccatcc aacaggcgcg     24600
     tccaccgtgg gctgggggat gtggcgagac gttccggcaa caggcgaaga ccactcctat     24660
     ctgctgtttc agtggacgga ttgctgcttc ggcgtgtacg gcgattgaga gaagcgctca     24720
     agatgcaaca gcacattcgt ccctggcctg tcgtcttggt cggccggctc atgctggcaa     24780
     ttgcagtggt cgtgtggcca ctcaccgcac atgtcgcgta cgcccaagca atcgagcagt     24840
     tgcccatcac cccgtcacaa gaggcagagg cgtcttcgtg gctcgttgcg cagttgacgg     24900
     cggatgagct caacgaattc aacctcatca accggcgcgc cgcgcgactg ctgcgtggag     24960
     acggggcccc cgcgccgctg cgcacgccca acgtagagga agacgcgact cagcgaacgc     25020
     gcgcgcccga tctgagcacc gatccggccg acgagcaacg cgctaaggcc caggcggacc     25080
     gagccctgca gccccttgcg ctgcctgaat tgattcaagg cgcgcagcgt ggaagcgatg     25140
     ctggccagga gatgatgggg cgagtcaacc caccgacgct ggacatggaa cgggttgagc     25200
     ctggacagaa cgatacggcc gagaggcgcc tgaacgttac agagatgctt ccagggttca     25260
     attcgaagtc gataccggca ttgacctcca aaggacgcga ggcttacaac gacccggagc     25320
     tgctcaaagg cctctctgaa caaaaccgca gaaacctgcg ccgagacgga tgcagaaaaa     25380
     ccgactttga agcgctagaa ctgcaggaca tctcgcaggc cgcatcgtcc ccaaagcacc     25440
     gcattctgaa agtcgaattc ttcgacatcg agaaacaggc cattccaaac accagcccgg     25500
     tagagtacct aacggtgatg aagcccaccg tgtacagccg gggccatgtg gacatgatgg     25560
     tcgcaaccat cggcgccggt gcaacggtgt actgggatcg cgtggacgag acctacgcca     25620
     tcaagtacac ctacacgccc ttttcggccg cgaagaatcg aaacttcttc acctacaacc     25680
     atcgtttcgc cgtggatggt ggggcagggg tacaggtgtt gagcaacgcg ggcattgtca     25740
     gctatggcag ccccggcgat gggtggaaga cggtggcgtc tcaggccgtc caattcggcg     25800
     ccaaggcctt gtacttgtcc gccgatctct accaggcgaa agcaacctac acagaggaga     25860
     cccctggggt tccgtgcccg cctgacccgc ctcaggtctg cgaagtccca tcgtatgggg     25920
     gagagatgtt gcggtggtgc cctggggcgc caggagccaa cattgccctc atgtacgacg     25980
     accaggcgaa tccagatgaa cgcgtggtcg cgaagaagta caacgatttg gctgccgcga     26040
     cggcctcgcg gaaaacctat tccgatgact ccttgcttcg cgccggcatc acgcgcggct     26100
     tgaacgccgg aagcagcgca agagcacaag aacttgctgg gcagtgtcgc cgcgaaacga     26160
     tttcgcgcat cgagacacaa gtgggtgatc cctaccgcgt gccgaatatg cgcttgtgct     26220
     cagagaccct tgtgaatccg tatccacaag gctgcaagaa catacagcgg tcgttcggcc     26280
     tcacatacct ggccgagcag aattacctca cggtccgcgc gttcgaaaaa atcaaggtgc     26340
     cgatcattga tccggtcacc ggaaagcagg tgaaggactc ggaggattac ccgctctaca     26400
     cgtaccgcaa agaaccggcc aatgttgcgg gcccggttcg gacggatttt ccgatcatgg     26460
     gtggggccat gtgtccaggc ggggaggggt gctcgactga aaatctgcct gatgacccac     26520
     gaggtgggag cgaggggccc tatctggagt acatgcacac cccagtggga ggagacccaa     26580
     agacctatgc ctttgatggc gtgtacgtcc aggcaggggg tacaagcaac ttcagcaatt     26640
     acggcaagcc cagcgagtcc tggctgcccg cagggtcggc aagcggtgac ggcaccctgc     26700
     accagttgcg tctgatggcc aagacgtact cggtgcccat caacaccttc gcgggctgcg     26760
     aaaagtacat gcagtacgtg gcagatggct tctgcaaagg gggcaagttg acgtgtgtgg     26820
     ataccgcccc aaccagatca attggcggag tgacgttcgg ccctggcttg cccaacagtg     26880
     gcatcgttga actgctcaag aattggggaa cggacgcttc tgcggtccac gacggaatca     26940
     tcgatggagc gggagacgaa cccacaccca atggcccacc catagtcatg cttgaagaca     27000
     agatgtgctg ggcggccgaa ggcgagagct tcacgagctg ctccacgatg gaagatgaag     27060
     ggtcgcttgc gcatttcttc aaacccgatg gcagcgaatg ggcctcggac tgcgacagcg     27120
     taaccaacga cgacggccta ccaatctcac aagcctgtaa gccatcactc ggtaataact     27180
     cgtgcgattc gcgatttgag ggtgttttta ccggcatttg ctacaacccc acactggctt     27240
     acgattgcgg agaaaacaaa gagcccaaga ttccaatcgt cgttgaagaa caaggcgaca     27300
     cgtgctctgg agtggtgcgt tgtatgggga cagagtgtca ccgcccgaat ctgagcggca     27360
     atcacggaga gggctttgcc agagcggtat cggggatgga agcgctgaac ttcatgatca     27420
     gcgaaatggt gtgcgcagaa accggcgaac cacctaaatc agcaaatgaa tcgtgcaccc     27480
     cgatggtctt tggcggtaag ccgatgtact gcaagcagcc aattggccgc caaattggca     27540
     ttactcctga ttgctgtaaa gaagcgcgaa aaggggctaa aagcggccca tcgtggatca     27600
     tgtatctgca ggcgacaaaa gcattatata aaatttcccg caatgagact gtccagcatt     27660
     ttctcgggaa ttttgatgtg tacaacaacg cttcacgtac gtttggggaa atatcccaac     27720
     ccgttacaga tctttatgac tctgcgtcaa gctgggtgac ggaaaatgtc gtggaaccat     27780
     ttaatgctgg tttcgataac atgtttggag atttcggagg aggagccgga agcactccgc     27840
     tcgaaatagg tgttgacgcg cctgccaagc aaggcatgat tggcagtgca attgaccagc     27900
     taaagacgaa tttaatgaat tcagcctata aaatcctgaa ttcaatcagc ccagagctgg     27960
     ctaatagtgt ttttgtgaat ggaggcctct ccacggtcgc attcacggaa accgcggcgc     28020
     aaatcctcga aacgctcaat accgtattca tgatttactc aatcgcgaga ttgattggcc     28080
     acattatatt tgcatgcaaa caagaggaat atgagtgggg tatgaacgaa cgatggcggc     28140
     tgtgtacctt tgtggattca tgttgcaaca agaaattcct gttcgtttgc atcgaaaaac     28200
     ggcagttgta ttgttgctat aaatcaatag cgacgagagt aatttctgag caaataacca     28260
     aacaaaacct ctctgggagc aagccattcg gctttcgtac tggttcaaaa gggagcaagc     28320
     ttggcggttg caaaattaat tgcggcggat tcaccccctt ggagctggcc tctgtggatt     28380
     ggtcccgggt tgacttgacg gaatggaccg attcccttgt cgagtcaggg atcgtaaata     28440
     cggccgatcc cggacgttct tatggagtta ccaagagtgc agtgccaatt agtaaagcgg     28500
     ttgggggacc cgatgccgaa gggggcgata tcgatgagcg ctctgccgcg tacaagaccg     28560
     tcgagggctg gaggcaaaac caaaacaaga tgacaacgtt taccgaaaca ttgcgccagg     28620
     acggcatcga gcactgctac gacccgagca acaacaagaa aatgccattc gtgtatccag     28680
     gctgcaaacc aagccccgag ccaacaccgc cttaaacagg gcgaaacctg gtgcgtttcg     28740
     tcatggattg agacgagtgc aaccctagta tccaaacacc tgcgcgctga agcctgcagg     28800
     tgcttttttt gttttggatc acgagagttg cacagtgggc gccttcctta tcgcaatcat     28860
     ccttttggca gcaggactgg ctctcgtaac cctgggggtg ggggcatcca agagaaatga     28920
     tcgccccaaa acggtcaaga aattggggac caccaagagc cctgcagggc aagggggcac     28980
     cagggtcgcc agccacttgg ctgcggaaga gggggaagac cccgccgaaa tcatcctgag     29040
     cactctgcgg attcctcccc cagacgagaa gcgcatagaa gcggtggccc ccaagaacga     29100
     tcgaccggca ccgaccgggg ggcgcttgtg aagtctctgt tccccaccct gatcgcctgg     29160
     gcctgtgccg cggggtttag cgcccccgct gtcgcagcag gagagccaaa cccggttgtg     29220
     cagatgattc gccagaccgc cagcagcaac tcgcgccttg gggtctgcgt agcccttcag     29280
     cgggcaaacg cagccccgac aaagggggat gacgaaaaga ggcgcatcga agcaattcaa     29340
     ctggtcgcgc agaagatcaa caaccgagat cctcacatgc tgcgagctcg ggccgacgca     29400
     gctcggctgg gcttgtacgg tttcaagacc gaccagaacc tcgcgctctc tctttacaaa     29460
     aaagccaaga tacccgatgc cggattaaat gcggccttaa tgctgtatcg cggcaccgat     29520
     tacagcaata acgctaaggc cgcaaaggaa atcctgaatg tgctttattc gtccggggca     29580
     gccaccgacc ggactcgggg gccggtaggc ggccaggcgc attacattgc cggccttatt     29640
     catgaaggcg gctatgcggg gcaggtggac atgaaaaaag catttatcca cttcagatcg     29700
     tccgcaagaa attcgtacgt ccccggtata tatcactatc tccgtctgat agttcgtaac     29760
     ctacccgaat tgacgcgcgc tgagcagcag gtagcaacgc aagagatccg cctgatgaca     29820
     aacaggtggc gttggcaggc tgccgaaatc atgatgatca atggtgatat gcatgcggga     29880
     ggttggttcc ctgatgataa agacggctat ttcgcacagt attactggcg agttgctcaa     29940
     agaatggggg acgggtcggt gatacctaat atccaatcgc tcctacagca gcggatcagg     30000
     cgaatgtcca atgaaaatga agagcggctg cagaacgatg ttcaagtagc cctgcgaaat     30060
     gtcgcaaaca ccaaacacga tctggagttt tccgacctat gtgccgagta gagcattgga     30120
     tttcacggct actgggcgcg gcctgcgcat tggtgcttgc aatttcatgg gcggagccgg     30180
     ccttcgccat tgaccaattc attttggaca aggaggacgg atggttctgg tacgagaggg     30240
     agcccgagcc agaaacgccc gtcaagccac cggaaataaa acccgaaccg aaaaacccag     30300
     ttgagcccgc cccgcccaag aagactcagc ctcaaaaggt ggagccgcta tcggttgaat     30360
     ggtttcagaa agagtatcag cagatactca acaaggctat tgatgaacct tcgcaagaga     30420
     acgtccgtaa gtaccgctat gccacccgcg tgatgctcga taaggccagt aattttacgc     30480
     atgtgtttca gcgtgaatct ctgctggatc cacttctcga cgaggccaac cgcatgccgt     30540
     tttcttcggc ttcgcgcgga agcttcatgc gtttgaccat cgaggagcag gcgaaggcaa     30600
     tcaaggcaat atccgagaag gcggggctgt gggttttctt ggatgaatcc tgcgcatttt     30660
     gcgcattgca ataccccatc gtggcgcgaa tggcccagga cagaaaactc acggtgatct     30720
     acatcacacc agatgggaag cgtcctccct ggatggccaa gaccgatgac gtgcgtgcgg     30780
     agtcggggca atccaaattt ctgcgcattg gtgtacgtcc tgccgtggcc gtggtggtac     30840
     cgcccgagaa cgtgacggta ctcacccagg gattgctctc ccaggacatg ctggaagagc     30900
     gactgctctt tgccggagat cagtctgggc ttctcagcaa ggaaatcagt gacaaggcgt     30960
     tcccagagcg tcgcggcttg cttacgcccg acgacatcaa ggaaatcggc ggctcgatga     31020
     gcgacgacac caaatcattt accaattcgg tgcaagaccg actgcaaaaa aggtattgaa     31080
     catgttgtgg aatttcaaac gcatggcaac gcgaacggca gcggcaagcc tgtccatagc     31140
     ggtagcactg ggctcgcttt cgctaccggc ccatgctggc ctgaaagaag cgctcaatga     31200
     aatgttcatc gggacatcga ccaatcctca ggcgatcagc actcagcgcc tcaaggggat     31260
     gtacggcggt tccatgaccc tgcgccccat cagcagtggg atcaacgtaa ttcaatttgc     31320
     accgccaaaa attgatgctg gctgcggggg cgtcgatata ttcttcggct cgttctcgtt     31380
     tatcaatggg gctcaattcg aacaattgat acgctcgatt gcggccaatg ctgtgggttt     31440
     tgctatcaaa gcagccattg agtccatgtg ttctccatgc gccaaactga ttgcggagtt     31500
     ggaggcggca atgagagagc ttaatgcaat ggccaagaac acctgcgcca ttggtaaggc     31560
     tatgcttacc tcagcgggca gaggaaagct aatggagcag gcttccgata tagggaagcg     31620
     cgtttctaca gctctgggaa acttcgctga tgaattgaag gcagagaata gccgcaacta     31680
     taccaatcca aacgaaacag cgaaggggac cgggcctggc acaagtggta caggagctga     31740
     agtggcggcc aataacccat tggacgggaa tttggtttat cttgcagcaa gggaatcatt     31800
     ggataacggc ggaaatacac tgcgtttatt tctcagcaga aatgacgcaa tcggcatagt     31860
     gatgggcctg tatggcgtcg tcatcgtcaa tccagagacc aatacgccca gtaattgctc     31920
     tggcactacc ccgcctgagc gctgcgtcaa agacccagaa accttcgagc ccaccattac     31980
     gagatgggac aacctgatgt acccggcgcg gtttgatccc gatggcgtga tggtgcgctc     32040
     atgcgggggc tctgattgcc gtagcgttcc accggcaaga ctcccgctgg ctacctgggg     32100
     tggtgtcacg gaaattatca atagggccct gtttggtacc tcagttatcc caacatctaa     32160
     agccgatgtt tcacctgatt cggttgtcgg catgtttgtg cacaagtcgg gagagggggc     32220
     gttgagcgca tccgcgcgat ctttgatcag cgttgccccg cttccaatta tcaacttgat     32280
     gatggaaacg caggatattg aaggggcgtc catgaccttg gggattcagc ttgccgaagt     32340
     gctccctcaa tacttggcct acaaaatggc agttgagttt caggggatcg gtgcaaacgt     32400
     gttttctggc caaaccaaga aggatatgcc ggctctctat gagcggaacc tgaaagagaa     32460
     agcgcgccaa ctggatacgc tcaaacccgt ggatggcacc atggcaaaaa tcttgaatga     32520
     aaccacgaaa tctatggtga atattcgaaa tctcacgcgt tctcaattga gcgtggcccc     32580
     taaacgctag gagtcgagat gtctttaacc atttataccg tttcggatcc ggctaccgtt     32640
     gggtccgtga tgacctccat ggctatgttc tttagccagg actcatgggt agggggagcc     32700
     ctcaagctcg ctttgatttg cagtctcctg gctattcttg ccaagggtgt cctggccagg     32760
     gaggggctgc gcctggatgt catgctgatc cagctcttgg tcgtaatggc ggcattcatc     32820
     ccgaagacca ctgtcgtcat cgagcagttt gacaataacg cccctgtgcg tgtggtggat     32880
     gatgtcccat atgcgatcgc atttccaggc gccattgcgg gggcattcgc cctttacatg     32940
     acacagaaaa tagaaaccgt catgtcagga gttaacggca aatacattgc cccaagcggg     33000
     gagctcgatc catttatgcc ggcacgcgtg ctcatgcaaa tcgcgacggc acctctcgat     33060
     cctgcgagac acgttgaccc caatctgacg cagacactgt attacgcatc gcgctattgc     33120
     ggaaaaccag aattgatgaa tatcgaattt gcgcaaacag ccaatggttt tgttaagttt     33180
     gccgatgctt tgaattcgga cgggacgccg acatttatct attcgaagaa tcatccctat     33240
     cgacctggtg taccatccgg gcaagttgcc acctgcgcgg atgtggccac ttatatcagg     33300
     gatataggac tgcaattagc ctcgcaagac actgttatgt tcaaaagcac gctcgacgga     33360
     attgcgcgaa cgagcgacag caaacgttat agcgaaaatc aaacggggac acaaacaaca     33420
     aaggaatggg ttgacctctt gcctgaatta aatcgtgtcg ccccggctca tgcggcgctt     33480
     gacaacctgg cagtggccaa cttgatgacc tacacgatcc tcaaacaaac agcacgagat     33540
     tcgcgcaacc ccatagacga gattgtagag atccagcggg acaccggttt gttccagtgg     33600
     gcgaaagaag aatcatccca ggcgttgatg gtgacaacca cagcgcccaa atttatggat     33660
     attcttttct ttattttcat agctgccaca cccatcgtca tgttcgttgt ggctgctaat     33720
     cctgccaccg gactcaaggt ggctgcaggc tatgtgcttt ttggattgtg gacccaaagc     33780
     tggattccca tgctggccat tatcaatggt tggtaccagg ccgaaattca gggatttgca     33840
     gcgccagggg tagaggggct tactcctgaa tatttgtcat cccttatgcg ccacgtgcat     33900
     acagccacca ttgctgcctc gaacatgttg cagtctgcac cctacatgat gtttgcaatc     33960
     atgactggca gtatgtttgc catgtccaac atgattgcta aagccgcgcc atctggcggt     34020
     gccagcgcgg gaggcgaaag cggatctgga acgggaggtt cgtctggaaa gggaccaatg     34080
     gcaattggtg ggggcgctct tgtgggcaat caaatcaatc caggggcgca gttgcagggt     34140
     ctgcagcagg cccaggcctt ggcaggcggt caatcgggga taagggattt gaattcacgt     34200
     ggagacgcca attctgtagt aatgggtcaa ccaacattgg gttcaggcgg agatgtttct     34260
     gctggcgtcg ctgctgcaac cgagacatct gcggcactca ggtcgtcctt aggcaagcag     34320
     tttgctcggg cagctaaaga tagcgcgagt ttggccaaag cgtcttcatc ttatgtacgc     34380
     ggtgaccagc ttgcccaggc aatgaaggcg gcagggttcg acgcaaccta taaatcagct     34440
     actgattcgg tagttgggga ggggtttaat tattcgatga aggatggatt tcagagtcag     34500
     tcacaagccg tctttggtgg gaaaggtgat ttgtctcttg gaggtggagt tggaggtgga     34560
     ggtttcaatt ttaaagccgc agcggcatta gcggcggccc ttaataaaat tgcaactgat     34620
     gttcaggcat tggagcacgg ccgtaagcaa gaagggggaa cgaaagcgac ttccggtgag     34680
     ggaatcaccg ggaggacggg taagtcggca agcgagggag tgggcggagg atcgggcgca     34740
     gatttcaaag agatggcgca aaaggccaaa gagatgtctg acactttcca ggcaattgca     34800
     cagcaaagcc agtcgctcga tcaagccgac aaacttaccc agaccgcgag taacagtgga     34860
     aatgccggca caagcgctca gttgaaattt ggcgacattg cgaacctcta tgggaccaaa     34920
     cacaatacgg cgagcggcaa cgcagaaggg gcgcggcaaa aagtgatcgc ggctattggc     34980
     ggcgaattgg gaatgaagct tggcgaacag atcaaacaaa accaagacaa attgagaagt     35040
     gccaatactg gcgccaccaa tgctctttct gaagaccaga ttgccgcggt agctgccttg     35100
     caagcgcttg agacaatgaa gaatcagagc gggaacgcgg ggaaactgga agcactatct     35160
     gggatggccc gtctcgctgc tgcggcaggg gctcatgatg cttctccggc catttcccaa     35220
     cttgcgcagg ctgagaacgt attcaagggt gttacagaca acctggcgag catggataaa     35280
     gaggtgcggc caactgctga tcaagctgcg gcaggggcgg cggctgctac gagtgatggc     35340
     gcaaacgaag cacatcgtca aaaggtcgag gctcagcaag actccgataa aggacgggca     35400
     gcagctacat atgggagcgc agtcggagga gtcggacgcg ttgatgccga ggggcggaaa     35460
     gctaagcagg cgcaagatgg cagcggattt attccccagt ttatgcgcgc aatggatacg     35520
     agcgggatga tgttggaggc agggcagagg caatcaatgc gcccaacgat ccccgacatg     35580
     gcctcatcag gtgcccgtgt catggggagt gaggccaaat tcgtgaagca agggcaagct     35640
     gaaggttccg atagaacgca aagagccgac caagccccgt cgcgtgctgc cgtcaaggat     35700
     atttatgggc cgctcatgga taggaaagaa aaggaaattg atgccgctaa tgaacgtaga     35760
     gcagcgcaag gccttccatt aattgataag catgccgcat tgagtaaatg ggccaatacg     35820
     gagctgaaaa atcagcaagg cgatagggat tttgagagca cgtacggaca accggtaccg     35880
     aagcccgcga gcgctggatc tgcgggcgca cctgcgccgg cgcatccatc ggcaccatct     35940
     ccggcacctt ctccggcacc tgtgcaggca gttaggggtg ctgcagcagg aggcgcagca     36000
     gcggccaata tcgtgactgg ggcagcttcg gccggcctcg tggcagccag ggcgattaca     36060
     ggggcgcctg cttcgtttga gcagccgaag ggcggccccc gtagcggtag cggtagcgga     36120
     ggtggtagcg gtggtggggg tggtggtggt ggtttcggtg ggaatgtggc acctcaaccc     36180
     gcagcggcaa agaccgttgc gcctgccccg gctgccgtga gttcgccgag caaaccagtg     36240
     cagcattcgg ccgccgctcc ggctgttgca gcggcgcacg ccgccgtgag cgcacccagc     36300
     ggggcaccgc cccagcctgc ggcagctccc gctgtcgcac ctgcaccggt agcggccagc     36360
     gcgccgagcg gggcctcgcc gcaggctgca gccgctccgg ctgtcgcagc agctccggcc     36420
     gccgtgagcg cgccgcccga ggccgcgcct cagcccgcgg cggctcccgc tgttgcaccg     36480
     gcaccggccg ccatgagcgc gccgagcgag gcatcgcctc aaccagcagc cgctcctgcc     36540
     gtcgcaccag ctccggtagc gcccagcgtg ccgaccgagg catcgcccca gcctgcggcg     36600
     gctcccgctg ttgcagcggc accggccgca gtgagcgcag cgcccgaggc cgcgccccag     36660
     cccgcggcgg ctcccgctgt tgcagcggct ccggccgcag tgagcgcagc gcccgaggca     36720
     gcaccccagc ctgcggcggc acctgcagtc gcacctgcgc cggtggcggc cagtgcgccg     36780
     agcgaggcat cgccccaggc tgcggcggct cccgctgttg cagcggctcc ggccgcagtg     36840
     agcgcgccga gtgatgcggc accgcagccc gcggcggctc ccgctgttgc accggcaccg     36900
     gccgccatga gcgcgccgag cgaggcatcg cctcaaccag cagccgcccc tgccgtcgca     36960
     cctgcgccgg tggcggccag cgcgccgccc gaggccgcgc ctcagcccgc ggcggctccc     37020
     gctgttgcac cggcaccggc cgccatgagc gcgccgagcg aggcatcgcc tcaaccagca     37080
     gccgctcctg ccgtcgcacc agctccggta gcgcccagcg tgccgaccga ggcatcgccc     37140
     cagcctgcgg cagctcctgc cgtcgcacct gcgccggtgg cggccagtgc gccgagcgag     37200
     gcatcgcccc aggctgcggc ggctcccgct gttgcagcgg ctccggccgc agtgagcgcg     37260
     ccgagtgatg cggcaccgca gcccgcggcg gctcccgctg ttgcaccggc accggccgcc     37320
     atgagcgcgc cgagcgaggc atcgccccag cctgcggcag ctcctgccgt cgcacctgcg     37380
     ccggtggcgg ccagtgcgcc gagcgaggca tcgccccagg ctgcggcggc tcccgctgtt     37440
     gcagcggctc cggccgcagt gagcgcgccg agtgatgcgg caccgcagcc cgcggcagct     37500
     cccgctgtcg cacctgcacc ggtagcggcc agtgccccga gcgaggcatc acctcaaccc     37560
     gcagcggctc cggctgtcgc agcggcaccg gccgcagtga gcgcgccgag tgatgcggca     37620
     ccgcagcccg cggcggctcc cgctgttgca ccggcaccgg ccgccatgag cgcgccgagc     37680
     gaggcatcgc ctcaaccagc agccgctcct gccgtcgcac cagctccggt agcgcccagc     37740
     gtgccgaccg aggcatcgcc ccagcctgcg gcagctcctg ccgtcgcacc tgcgccggtg     37800
     gcggccagtg cgccgagcga ggcatcgccc caggctgcgg cggctcccgc tgttgcagcg     37860
     gctccggccg cagtgagcgc gccgagtgat gcggcacccc agcccgcggc agcccctgcc     37920
     gtcgcacctg cgccggtggc gcccagcgcg ccgaccgagg ccgcgcctca acccgcagcg     37980
     gctcccgctg tcgcagcggc accggccgcc gtgagcgcgc cgagcgaggc atcgccccag     38040
     cctgcggcag cacctgccgt cgcagcggct ccggccgcca ccaccgcgcc gagcgatgca     38100
     gcaccccaac aggcatcggc tccggctccg caacagccaa cagcaccttc cgttgaaacc     38160
     gtgcccggat ctgggggcgc ttctagcggc gcgtctctcc ccactctcgg aggcgggggc     38220
     ggggggctgc tggctggcgg aggggcagca aacggctggg gcggtggcgg agcaacgcag     38280
     cctgacagcc aacctcagca gggaaatgga cggcctcagc aaatccaagg aaggcagggt     38340
     tccaattcgc gaacgatccc aggtaggcaa taggttctat tgagatcgag acgcgacggt     38400
     tgcaagcgcg tcttgagtca aagttgaagg cgcttctttc taggattgct caatccataa     38460
     gcgccttcaa cgaacgctct cctatgaaac ccttccgaaa aaaaggcgct actgcgatca     38520
     gcacaaagct cctggccttc gtgcttttga ccgttggcgc gctgcaggca tcggctgcga     38580
     gttcttgtag ctacccacaa gacgaaatca gctcgttgcg gaccgaccat gccaagacgc     38640
     cttatccatc gggctatggg aagtttgatg gcccgatcag aagctgggaa aagctggata     38700
     taccgcggga cgggaaagct ggagcctcgc gcctttttgt tcaggccaag actttgatga     38760
     gtcaaggcga tgaagagcgc ggcataaggc ttgcaaatcg ttcggccgag tgtggggatg     38820
     atgatgccat tatgttcctc gcagagctga gcattgcccg caataataat aatggcgcag     38880
     ccaaatacct tgaattaggc cgcaaaaaga acttgccaaa ggcgaagtac cttctggccg     38940
     aacaatacga tcaaggcgcg cttggattcc ctaaggatct gaagcgcgct ttcattttgt     39000
     attacgacgc agccaaaagc ggaatacctc aggccatgtc ggcagttgct tactactttg     39060
     ttcgtgggca gcatggggtg aaagacgagt tggcagcgct gcattggtat cacaaggcag     39120
     ccttggccgg ccatgtggaa tcaatgacgg cttatggctg gatgctcatg gtcggtaaag     39180
     gtggcccggt ggaccgtgaa gaggccgccc attacttgca caaagcgaag gcattgggtg     39240
     acaggcaggc cggagttttt ctaagcgacc tcgcaatcac cacaaagaat gttcggtgaa     39300
     agtaacccta actgggcagt gaacagtgaa cagccacgat gcatatggca gatttttgag     39360
     gggataaagt aatgaaacat cttctgaagg tgtgccgagt tcttgtgtgt ttggcgcttg     39420
     cgtatctcgc gccaagtctt gcttttgctc agttcgcggt aactatccaa aaccaatctc     39480
     agacgctctc tactaattac gaaatgaagt acggtgcgtc cgttatatat accggatcac     39540
     tgccgcctgg tcagaccata acgagaaccg ccgtgtttga cgcggtatta atctacaatc     39600
     caagcggtgg gcaggcttgt tcgggggtgt atccggaatg cggaacaatg tattcggcac     39660
     gtacattcgg ggtcacttcc gccacgacca ttctttttgg cgatgatcgt cccgaatgca     39720
     cggcagcccc attaagttgg gggccaggta attactgttc tgcggttgca caaacaacat     39780
     taaatggaca atcgatcgtc atttcaaact ccgcggccgg tgcaattggg agcgcaactg     39840
     ctgtttgcaa tagcgccgtt tgggaagtca gcaatccaac ctgttctgca tccctgagcg     39900
     ctccggcgtc ggtggctgcg acggacggca cggttgttgg caagatcact gtgacatggg     39960
     gagcggtcgc aaacgccacc agctacgaca tacgccaccg caagcagggc gccccttcat     40020
     ggaccaccgt gacgaacgtg actagcggct ggcagctcac gactgcggac gagtcggttt     40080
     tcgagttcca agttgttggc aagaacgtcg cgggcgaagg gacgtggagt gggaccgaga     40140
     cggggaacat cgccaaaggc tgcacgacgc aaaccctgaa ttggggacca agcaactact     40200
     gcgcagcttc ggctgcagca ggagccgcgg gcatgttgat ttccactgaa ttctgacccc     40260
     ggtttttcat tcaatattga ccccaccctt ggtggagtag ccgggctact cggttgtgga     40320
     taagtctaac gccgaaggta tcgcttcccc tttcgttggt gcctttctgc ccctggtctt     40380
     ggccgcagag gttgtggtgg ccgatgagtt cttgaaccgc cagctgtcat tgcccgtctc     40440
     cacgatgtgg cagtgatggg tgaaccggtc cagcaaggcc gtggtcatct tggcgtcgcc     40500
     aaacacctgg ctccactccc cgaaactcag attggtggtg atcatcacgc tggtgtgttc     40560
     gtacagcttg gacagcaggt gaaacagcaa ggctccgccg gcctggctga acggcaggta     40620
     gcccagctcg tccagcacca ccaggtccgt gtacatcagc cggtgcgcga tctggccggc     40680
     cttgccttgc gccttctcca actccagcgc gttgaccagt tccaccgtcg agaagaaccg     40740
     cacccgcttg ctgtgccgct ggatcgcctc gatgccgacg gccgtggcca gatgcgtctt     40800
     gcccgtgccc ggcccaccaa tgagtactgc gttgtgcgca gcctcgatga acttggccgt     40860
     gtgcaaagag cgaaccaatg cttcatccac attggcctgg gcgaactcga accccgccag     40920
     atcccgatgc gcggggaagc gtgccgcacc catctggtac gccatggagc gcaccgcccg     40980
     ttcggccgtc tcggccttga gcagttggtt caggaacgcc tcgggcgtga agtcggtgtg     41040
     cctggcctgc gctgccacct ccgggtagtt ggctgccatg ccgtgcagct tcatggcctt     41100
     gagggccgag atgatttcgg cgctcatcgt gccgtctccc cggccgcgcc gcgaaggcgg     41160
     tcgtaacgct gcacgttggc cagcggctcc accgccagtt tgagcggcgt gctggccacc     41220
     tccaggcacg caccatcgcc cggcgccttc agccgcgcca gcacgttcag cacatgctcg     41280
     ccgctgggct tgcccgcctc cagcgccaat tgcgctgcta ccaacaccgc gtccagcccg     41340
     tgcaccggca cggccgccag tacctgtgcc atgacccggt cgccgccttc atggcgcagc     41400
     aagatggcct gcagcttcct cagcggctcg ggcagggtct cgaacggcgc cccgttgcgc     41460
     agcgccccgg gcttgcgctc gatcagggtc acgtagtggc gccagtcgta gaaggtctgg     41520
     ctgcgctcga agctgcgcac atggctggcc acgcggacat tctcggcgac gatctcgaga     41580
     cggtctgggt acaggcgcag gctcaccacc tcgtgggcat gttcgctggg cacgctgtaa     41640
     cggttgcgct gcaggtgcac cagggcggtg ctggacacgc gcgcgggcac ttccacgtag     41700
     ccatcaaacg gcttgggatt gggcatcagg cgaagctgct cgtcttgcag catgtcagcc     41760
     actttcaggg caggccactc tgggtggttc agctcggccc aggcagcacg gcattgctcg     41820
     cccagccagg tgttcagggt ttccatgctg tcccagcgca gcttcacggc tttgtgccag     41880
     atgctcgtcc tgcggtcgcg cacgttcttc tccacgatgc ctttctccca gccgctggcc     41940
     acgttgcaga actcgggctc gaacaggtag tggccggtca tcgcctcaaa gcgcgcgttg     42000
     atgacgcgcc gcttgccaag gccgactttg tcgactgcgg ttttcatgtt gtcgtagatg     42060
     ccgcgctggg gcacaccgcc gaaggcggcg aacgccctgg catgggcatc gaacagcatt     42120
     tcgtggcttt gcgtggggta ggccaccagc cagaacgcgc ggctagcgca cagtttggtg     42180
     tgcgccactt ccaggcgccg acgcaggccg cccacgaagg cgtactcggt gctccagtcg     42240
     aattgaaagg cttcgcccag ggcgaacttc agtggcacga aggcggcctt gttggcgttg     42300
     gcggcctggc tctcgcgcca gcgtcgggca aatgccgcta cgcgcccgta gccgccttgg     42360
     tagccttgcg cggcaagttc ttcgtacatc agcttgacgg tgcgccggtc gcgcttgccg     42420
     cggtgtgcgt cggctttgag ccagatgacc agttgctcgg tgaacccgtc cagttttgtt     42480
     gccatcacgc gcgccgggta cttgggctcg accatctggc cacggcgcag ccagctcttg     42540
     atggtgtttc gcgcaatccc cgtgcgccgc tcgatttcct tgatcggcac gccttctcgc     42600
     aggtgcagtc gccggatctt tgccagtgtt cccactttga tcactccttg attccccctg     42660
     cctaaaagtt aagcagagga ctgtattcaa ggggtcaaat ttcgatgaaa aaactaaggc     42720
     caaaggggtc aaatttgctc ggaaatcaac agtggggcat ctggtggtgg cgtttctcgc     42780
     catcatcgcc aaggtgcaac cggccgtggt gcttctggaa aacgtcaagc cgtacatggc     42840
     cacggcgtcc atgagcattc tgcggaacca actgcgtgat ctcggatacc gggtccatga     42900
     ggaagtcttg caggcttccg actggaatgc gctggagcac cgggagcgca tgtgcatggt     42960
     ggcagtcaca gaaggcatgt cgttcgactt ttcagcgctg caaaggcctg agaagcatga     43020
     acggagaatc gccggagtgc tcgatgccgt gcccgaggac gcggattgct ggagcgaaat     43080
     gcaaggcctc aaaaccaagc aggagcgcga ccaggaggcc ggcaagggct ttgccatgca     43140
     gatcatcacc ggcagcgaca ttcgttgccc gacgatcacc aaaggctaca gcaaggttcg     43200
     ctctacggat ccgaagcttc gccatcccac gaatcccaat ttgcttcgcc agttcacacc     43260
     tggggagcat gcaaggatca agggggtgcc ggagcaactg gttcagggcc tctcggccac     43320
     attggcgcac gagctgctgg gccagtcgat ttgttacgag cctttccggg ccgtggcaat     43380
     ggtgctcggc aagatgctca aagccaccca cgcggcgcag tcggtgcaaa ccgaatcacc     43440
     gctacttcaa cttgtcggct gaagccggca aatttcacca cccatgcggg gcctttcccg     43500
     caaggggcgg gctccgcgtt ttttcatgga tgttgatttc cacgcagaag tgacccacta     43560
     acccccagga tttccatcta aatctgaccc acgtactaac cctaacctgc tgctttgttg     43620
     agcagcagga gaccaggagt gatagacgtg gcaacactga gtgtcatcag gcgctgggcc     43680
     ctgcgagagc agctgtccat ccgagagatc gcccgccgca cgggcctctc gcgcaacacc     43740
     atccgcaagt acctgcgcgc aggcgaggcc gagccgcact atgccaagcg ggtcagccct     43800
     tccaagctcg atccctttgc cttgaagctc tcgggctggc tcaagacgga agctggccga     43860
     tcccgtaagc agcggcgtac cgtcaagcag atatacgccg atctgcaggc gctgggctat     43920
     accggctcct acaaccgggt cgcggccttt gtccgcctct ggcaagaaca acgcctggtg     43980
     gcccagcaga ccaccggccg cggcaccttt gtgcctttgg ccttcggccc cggcgaggcg     44040
     ttccaattcg attggagcga ggactgggca gtgctcgcag gtgtgcgcac caagctgcag     44100
     gtggctcact tcaaactcag tcacagccgg gcgttctacc tgcgtgccta tcttctgcag     44160
     acgcacgaga tgctgttcga tgcccacaac catgcgttcg tcgtgctggg cggtgtgccc     44220
     cgccgaggca tctacgacaa catgcgcacc gccatagacc gcgtgcgccg gggcaaggag     44280
     agagatgtca acgcacgctt tgctgccatg gtcagccact tcctgttcga ggcagagttc     44340
     tgcaacccgg cctctggctg ggagaagggc caggtggaga agaacgtgcg cgatgcccgc     44400
     caccgcctgt ggcaggtggt gccgccattc ccgagcctgc ccgatctgaa tgcctggctt     44460
     gaggagcgct gtgtggccct gtggcacgag atcgagcatg gcaagctggc tggcaccgtc     44520
     gcggacgtct gggccgagga gcgggcagcc ttgatgcctg tgccccggcc cttcgatggc     44580
     tttgtggagc acaccaagcg cgtctcaccc acctgcttgg tccacttcga gcgcaatcgc     44640
     tacagcgtgc cagcgccgta tgccaaccgg cctgtgagcc tgcgggtcta cgcggaccgc     44700
     ctggtggtcg ctgccgaagg ccagatcatc tgtgaacacc agcgcctgat cgagcgcaac     44760
     caccatggcg ctgggcagac cgtctatgac tggcgccact acctggcggt gctgcagcgc     44820
     aagcccgggg cattgcgcaa tggcgctccc ttccaggaac tgccagtggc cttcaaacgg     44880
     ctgcagaccg ccctcttgat gcagccaggc ggcgacagag agatggtgga ggtgctggca     44940
     ctggtgctgc atcacgacga gcaggccgtg ctcgccgcag tggaactggc cctggagtct     45000
     ggggctgcca gcaagaccca tatcctgaac gtgctgcacc ggctgctgga cggcaagccc     45060
     gctccagcac cggtcacctc cccccaggcc ctcaagctgg cgatggaacc ccaggccaac     45120
     gtgctgcgct atgaccaatt gagggaggtg cgctatgcgt catgaccccg ccatcgcttc     45180
     catcgtgatc atgctgcgcg agctcaagat gcacggcatg gcccaggcag ttgcggaact     45240
     ggctgagcaa ggtgcgccag ccttcgaggc agcacagccc atcctgtccc aactgctcaa     45300
     ggctgagacc gccgagcggg aggtgcgctc ggtggcttac caattgaagg tggccaggtt     45360
     ccccgcgtac cgggacctgg caggcttcga cttcagccac agcgaggtga acgaagccct     45420
     ggtgcgccag ttgcaccggt gtgagttctt ggaggatgcc aacaacgtgg tgctggtggg     45480
     cgggccgggc acaggcaaga cccacatcgc cacagccctc ggagtgcaag ccattgaaca     45540
     ccatcaccga agggtgcggt tcttctccac ggtagagttg gtcaatgcgc tggaagaaga     45600
     gaaggcccaa ggcaagacag ggcagatggc ccaccggctt gcatatgtgg atctggtgat     45660
     tctggacgag ttgggctacc tgccgttcag tgcatcagga ggcgccttgc tgttccacct     45720
     gctgtccaaa ctctacgagc gcaccagcgt cgtgatcacc accaacctga gcttcagcga     45780
     gtgggccagt gtgttcgggg atgccaagat gaccacggca ttgctcgacc ggctcacgca     45840
     tcactgccat attcttgaga ccggcaatga cagctaccgg ttcaagaata gctccgcaca     45900
     gcaaccacca cagaccacca agaaggagaa ggcgaccaag aacttatcca caacgtgagc     45960
     gtgaagttca cgaatcaggg tgggtcaaga ttcgatggaa atggtgggtc agctttgcat     46020
     ggaaatcaac acaccggcta actaaaccac gattgaatcc accccccgcc tgacggctgg     46080
     ggtggtttcc cagagcgcct gaagacgggc gctgcgggaa accagtattt gatgcggacg     46140
     gggtaacccc ttctgttcaa tgttcctggc tcggggaact caaacaaccg gcaacaaagc     46200
     tcgcagaaat cacttcaaca actgctcggg tcagcggtat cgctgtcccg tgcacattcc     46260
     aaagggaaaa tcatgaccga aaaaattcac ggatctttca aggcccaagc cgccaactcg     46320
     cacgagactg gcgtcaagaa aaccgacctc tacaaggtcc caccggaaaa gctggtggag     46380
     gaacctggct tcaatgaacg ggactacagc gatcccgatg tacaaaccca gattgaagcg     46440
     tttgcccagg cattcgctgc tggccggtac gtgccgcctc tggtggtgcg catcgacccc     46500
     atcacgggag acatcatcgt ggtggacggg catcaacgcc gtcgcggcgc gctgttggcc     46560
     atcgagcgcg gggccacgat cacgcatctc gaatgtcttc ccttccgtgg gaacgacgcc     46620
     gatcgcgtga tctgcatgct caccagctcg gaaggcctga aactcaagcc cgttggcatt     46680
     gcccgcggct atctcaggct tctgaacatg ggatctgacg tgcaagaaat cgctcgcagc     46740
     gtcgccaaga cgccgcagca cgtggagtcc atgttggtgt tggctgaagc caattctgac     46800
     gtgcaggccc tcgtgaataa aggggctgtt tcggcgacca tggccattga agttgtgcgc     46860
     aagcacggcg acaaggccgg ggccatcctg ggcagcaagc tccaggaagc caatgcacgg     46920
     gggcagacca aggtcaagcc ttcggcgatc aaggactggg cccctccgcg ggcgctggcc     46980
     acgaagctct accactcggt cggatccgct ctcgggcaga tcacgcaatc cagcgaagtg     47040
     cagcaattgc tcgccgatct ggaggccaac ggtagtgacg cggcggcggg gaagaccgta     47100
     cccgtgaacg ccgccgctct catcgagctg atgcgtctct tcaaagaaac cgaggaggct     47160
     cggaccaaga agagcgaacc caagaaagac gagcagccgg aagattgaac catcaaccct     47220
     tagagggcgc atgccctctt gggttggcgc ctttcttcat tgaaaggaac aggaatgctc     47280
     agacagcgca tgcgcggtgc tctcggcgat ttcaaagatg cgttggcgcg gccgacactg     47340
     aagcagaagg aggcctacgg gcgtctggct cataccctct gtgtggcctg ctgcgtggga     47400
     gcgatcactg tcctctttgg ggcagcgttc tcattctgga ccaccctctt gtacgtatgc     47460
     tccctgatga tttggggtct ggtactattc gtcgcagggg caatcctcag caaaggagaa     47520
     tgagatgact gcagcctttc tcatcctggg aagcctgatt tgtgcaggct tcgtgtattt     47580
     ggctacgcgg gaaaccgggc cttccaaaac tgaagacaag gcacacaccg cctgaaaagc     47640
     gcccatctcg gaacgctcac atcatcccgt gaatcgactg cgctcgatcg cgggattttt     47700
     tattcaccct gacgggcacc tgttgccctc cgggccagtg tccgtctctt tcgcaggaga     47760
     acggaaatgt cgaatctcac cctggaatcg gtgcccgctt acgagcgcat gctgcccgag     47820
     cccctgacac gactgaggct ggccgaggag ttctacaacg agctatcgga cagcgttgaa     47880
     gtgctctcag atattgttga gcagcatggc gcgcgcacgc tctcagacct attccacttg     47940
     cacgcagcca tcatgagcaa tggcttcatt gatgcctggc cggattccgc tgtgcttgat     48000
     gttgtctcgc tgttgccctc ggccgagcgc tggcttgcct atgccagtgt ttacgatgaa     48060
     tgcggagaga taaaaagatc catttttagc aagatgcagg ctcaaatacc ggacgaacag     48120
     aacgtggagt cgcagtatct aagctgaaac cacgctgccg atgagccccg aaggctcgtt     48180
     gtcggtgaca aagcgaacgc cctgctcccc tcggggttgc agggctttcc aaagcccctg     48240
     gaaaaccggg cgcttcggaa agcattcacg cccatcagcc tagtgcagat ggtttgaaac     48300
     ggtagcttgg ccgtgccctt cgaggcaaat cagcatttct gctcccgcga gcattccacc     48360
     accctgacgg gctcttgtcc gtttgggcga ggcctgtcat ttttcaaaaa ggcagaccat     48420
     gaaccatcat ttggattcca ttgaccaaga gatgctccgc atctcaattg agatgcgcga     48480
     cacactggaa ggcccccgca tgggggactt cgttctgttc cccaatgggg agcttgagcg     48540
     cttcagctac gactggggaa acgacatcca gacctcgcct ggtggttcgt tcttcctggg     48600
     caaagcgggt cacgcgtcct tgagttgcgg cggcctccac ccgcccgtgt ccaaacaatc     48660
     gctcgaaatc acctcggcgg cactgcccgg agccttctgg tttttccatc atggaactgc     48720
     cggggcaggg cggggcgtcg agtgcgaagc accctgccgg gtgtacaagt ccagtgcggc     48780
     ctaccaaggc tacctgggca aggacttccg ctccgccgtg aacgatcgcc tcaaggcgtt     48840
     gctgcatgcg caattcgagc catccgagag caaccagtgc gtggtgaacg cgtcagcgtt     48900
     ccactccatg ctcggccacg ttgctgatgg cactcgcgtc aaattccaat ctggtgatga     48960
     actcaccgtg cgaagcgcaa ttcgcggttg gaagctggtg gacgagaaaa gcgggaagtg     49020
     catgggcccc tttgatgggg ccatggagct gactgctgcg attgttcgtc acgacgcagc     49080
     aagcgcgtgc gtagccgctt gatctgattc gcgcaacctt ttaaccaccc ctgatgggcc     49140
     tcgccctgaa gggtgagccc atcttctttc attggagaag aacatgagca aagtagcaat     49200
     cgatcggaac atcctcaagg tccttctggc ctgcgcagag catcatgtgg aggatgtcga     49260
     gaccggcatc gaagagggct tgtacatcaa gtccgaaaac actgatttgc agtcgaagca     49320
     ggcggcatgt gcagccgccg cccaattggt agaacctgct gaaggcgcgt tcgtagaaga     49380
     catcaccgcc ccctgcaaac aacctccggt gcctcgtgta ctggtcgttg tccgcggagg     49440
     gatcgctgaa cctgttttcg atgaaggcgt tgaagtagcg gtcttcgatt gggacaacta     49500
     caagagcgac ccggagagca ctggcggcgt ctccacaaaa tttgccgaat tggcgaagcc     49560
     ccttggaatt ccagtggcgc cggatgagga ggcaatcgaa acgagcggcc aagtgcgata     49620
     cgtcatccgc tctttgagtg aggccggcga acccttgggc gctcctggcg ccttttggtc     49680
     caacgctgat ggttggggat gcttggagac agccacccat ttctcgaccc gagaaaggat     49740
     gtctttgaat tttcccctgt ccgcaaggca ggacgctgag tggatgcttg tggaagaggc     49800
     caaagacctg gcagccgaag caagcgcaaa ggccgcaact ttgccagcct tttcgctggt     49860
     gaaaattggc gccgattggc tgcccgatga cgtgacggtc tcggcctatt ccaacggccg     49920
     gcattggaac ggttgggcca tgccccgctt cactctcgaa gcgggtcata gccttctcaa     49980
     gcacatgcct gacttgagct acaacggtgc gcgagacgca ttcatctcga aggatgctca     50040
     agacgaccag gcggaggaag aagtgttcgc tgctgagacg ctgatcgtcg gcggaagtcc     50100
     catcaagacc tacgccattg gcgctggtag ttggtgctgg tacctcgccg aataggctgt     50160
     tcaaagatcc cagcgggctt gcccgctagc tactccccca acgcaggacg gcaacagccc     50220
     ctgcaaaaac ccaggcgcct gctcacccca gagcgccgcc ccatttttta acccctgcgg     50280
     gaacacacct cccgcatggg ggtgtgcctc gcttcttttc ggagaatgcc atgacacaaa     50340
     ccacccccaa agcccacccc gacctggcca agcctgttcg taccctgacc tgcacctgct     50400
     gcggccagca cacccaaggc cgccagttcc acaaccagga caccggcttt ggcctcggcg     50460
     actgctgcca cgactacgtg aagccccgcg tcgaagatat ggaacgcacc tacggcatcc     50520
     atggcgtcca ctacaagctg gaccccttgg ccctcgtgcg cgaagtcggg aaaagcctca     50580
     ctgcccccca gaccgaatgg cggatctcgc aaaacctcac cgaccggtgg ggcgacatca     50640
     accgccacaa tgaggccaac aagccgctgg agctgctcga aggcgatccc gaactgctgg     50700
     aacgcctgcg cgcccagatg tgggatgaaa tcaccttcgt ggtgcgcatg gacggccagt     50760
     ttggtctgct ctacgaggtg gaatactcct cccgcgaaag cgaagacaga ggcgacccca     50820
     aagaccaagc ctccgactgg tacaagaccc tcaagcccca agcagaggtc gaacaggccg     50880
     tgctcaaagg aatggagtct cttgctcagc aattcccccg cgtgaaattc ggcgtacccg     50940
     aagtgaagtg gatcgtcgat gaccgcccag cagcctgggc attcgtcccc gatggcctgc     51000
     tcgatgaaca gcaacgcgaa acgctcggca aagcccttct ggcgctctga cgacacccct     51060
     caacagtccg cgaaagcggc tcgggtgggt ggagcaaccc cgccgcccat ccccttcagg     51120
     agacccgtac atggccaatg gtcacgcact ggtcaaggaa caactgctgc acatgctctt     51180
     cggcacgatc acattcgtcg tcctgggagc catcgcagtc ggccttgacc tggctgccgc     51240
     atggatcgca agactcggcg tcagtccctt cacccacacg gcaatcgaaa tcgcagccca     51300
     tagcctgttg accatcgatt tgctactatt cgctctatac accgccaaat cgagcttcgg     51360
     gctcgtcaag gagatgttga agtgaaaacc acaaccaact ccctccagat ccgccgcatc     51420
     ttccgcgaca gcctcaagct gtacttcgcg ccgctgacgg gtgcctacaa aggcatcaag     51480
     aacgagatgc tgcgcgttga ccgcgaaatc gtgcgtgacc gaggagcaca agccaagcgc     51540
     agcaatactg ctccgcacgc ataatccaac ctaagcctcc atcttcggat ggggctttcc     51600
     aaagcgtcca accatggcgc ttcggaaagt cttctgtcct ggcgcgtaac gcaccagacg     51660
     ttggaacggt agctaggccg tgccccaggg cgaaaacagc aaaaacgctc aaaagagcaa     51720
     actcaacccg cacgggcttc atgccctcgg gcctggggct cgcgcatttt ggagaatcca     51780
     atgcccgcac ccctcacaac agaactgcac tgcaaagtca ccgtcactgg ggacgccagc     51840
     agcgaagaag accgcagcat ccccggcaca tacgacttcg aggtccacct caagcgcgcc     51900
     gtgaaccccg ccgccctgac cgatgcggag aaatccgaaa tcgcctgcca ggtgttcgac     51960
     tgcttccatg accacattgg catcgacttc cttgaagact tcttcatcgg agtctcgcta     52020
     gccagcggtg cggaactcgt tgaaaacgac acgccgcccg tcgatctggt ggccaaagtg     52080
     agctacgaag cctgaatgcc aaaaatgcaa gccaaagctc acaaagccac gggcctgacg     52140
     tttgaagcca tcttggatgt gctggccgac aggaccgtgc tcgctgcaaa cctctctcct     52200
     gcggcgccct acccgcaacg catgttgccc gacaagcctt atcggttgga actcggccaa     52260
     tcctcgttct acgtccaccg agggccaaca atgcgccccc tgacgttcaa tgaagagcaa     52320
     gccgacacag ccaagctgtc aggcgaccgc ttgaccatgg aagacgccca agcattcgtt     52380
     ctcgacctcg acctggctcc tgccggatcc tgcgagcaga actgacaaac ctttcccccc     52440
     tctgcgggca cttgatgccc gctggggcca gtgcccgcct tttttcacaa aggagaagca     52500
     ctgatgtcca tcaaccccca acaagcccgc gccctgcagg ccctgcgcaa agccatggcc     52560
     ctggccaccg acagcggcct cttcgaagtc atgacggacc tctcggggcc cggcgtggtt     52620
     ccggagttca ccgccgccgt ggccaagagc gaagccttcc tcctgaaatc catccggatc     52680
     gagggcttca acgtccgcat cgtggccaag ggcgagcgct acggcctcaa tgactgcctg     52740
     gtgcacgaca aggacgaacc gctggtcgaa ttcttcgatg cggcgcagga ccatacggtc     52800
     ttcgggccgc tgggccagtt cgtcagccgg tactaccgca gcaccctgat ggaaagcaag     52860
     aaccacgatg gactcttgct cgacaccgga gcgccgcact ggcacatcgg agctgaaggc     52920
     atgcgcgccg tgaaggaatt cattggcacc gtggtcgcct gctgatgagt cccgaggcct     52980
     gaaccgcccc cacgaacccc tcgtgccctc gggcacgggg ctttcccaag catccgccac     53040
     gggtgttttg gaaagcgaat tcatccccat ggcttagtgc cctggactga tgcggtagct     53100
     ggccgcgccc caaaggcgaa tcagcattca accggcgaaa gccaacttaa ccaccctgac     53160
     gggccctgcg cccaccaggg ccggtgtccg tctctttttt aggagaacgg aaaatgtcaa     53220
     atttcaatgc cgatgatttc ccgccaatca tcgttggtcg gcagtatgag ttctatgcag     53280
     aaatgcagca ggcagaaatg ccagagcacg ctcgcatgcg gaactacacg ggccagacgg     53340
     tcactgtgac atctgggccg ctgccgaagg acgatgatga gggctcagac cttttcagga     53400
     tccgtgcggc agacggtcga gagtttgagg ccttcgagga agagctgtgc ggctggaaca     53460
     aagctcatgg gcaatacttc tggcctgacg gcacctatgg gcctgatagg gacaagcagt     53520
     acctcggcaa cgagaggaat ctgcgagcgc aactcaatgg tggactctac cttgaccagg     53580
     tggagcgagt agcatgacgc ctgagatcaa cgagatcaga gccttcgtga accgtgctcc     53640
     caagacatgg atgttccgcg acggcgaatt gctgaatttc acacctgcaa ggcatgcatg     53700
     gctgaacaag atggcctccg ggtcacttga tcaacgcatc aaccgcagag cggggatctg     53760
     tacgcagaca ccgatctgga agtacccaac catgagtgca atccagcgca accagcgcag     53820
     gcgcatcagg cgagggtact gaaaatttca accaccctga cgggcatctg ttgccctcgg     53880
     gccggtgtcc gtctcttttt taggagaacg gaaaatgacg aattacattg agcaggccaa     53940
     ccaacagcag atcagcatcg aaaccaagat aacgccggaa cttctgagtg atgtaccggt     54000
     gaactgggtc ggtggaagtc gctggacgtt tgatcgtgga gccatgccag gagaaccatt     54060
     tgcgtttctc gatggcgaca acgaaacttc aacggctgct atggtcgaaa tccaaacgcc     54120
     ggggaggccc gttttttttg aagttcgcaa agttgacggc atcctgttgt ctcggtctga     54180
     attcccagat gaagcagcga gggaggcaga gcggagtatc gaaaatgagc ggagtctgtc     54240
     gaattacaca cgtcaacaac tcgctcgcat ctgtgaactc gatgcggcta tcgattcggc     54300
     tgccgaccaa ggcggtgatg ttttcttcgc tgcggtggct gcaaaagatg agtacatcga     54360
     ctcgcaagga atcgaccgta accggctgga agtgactggc cgggaagtga gccagattga     54420
     aacgggagat ccagcactga atatcgttga acaggtctgc aaagactttg atggaaacgg     54480
     tatctacagc gtcggagcta tcggcgcact gcgcgcaatg gcgcaccatt ggaaagacca     54540
     tctttttgaa ggtcattcac ctcgaatgat ctctgaagac attgatgaga tgaagcagtt     54600
     acttgaagtg atgcgtgctg agatcatgtc tcgaatcgct gcacagcaag tgccggcaga     54660
     aagcccacga ggctaatttt caaaacccac aaggcccagt tcacttcggt gtgctgggcc     54720
     tttttctttg cccgtcgttt tatccaactt tccttgatgt ggcgtggtcc ctggtgcccc     54780
     ggcttgttcg gggcctgctt cgcgtgtaga ctcaatgtaa ttgcacgatt caaggcaaat     54840
     gcatgccaaa ttcaagctca catcaacacg gcatctcgat ggctgtgacg cacttaaacg     54900
     cgccatacgg agcgattgtt tctcccagcg acctcatcga atcactgagc cagggggagc     54960
     ttcgtgctgc ttcacccaaa gccgctgcga ttctgagcta cctctttatt gaagtggagc     55020
     cgcggttggt gatgcggtgc gcgatggagt cgggttcgtc gctgccgaag gccaaccaac     55080
     tctattcgga cactatcaag ggcggtgcgc cccgcagcgc cctttgggaa tcatcaatca     55140
     aggctctcct atgaccacta ttgcggacat caagaatcac aaaaccaatg gtccatggag     55200
     agggcttgag aagcttgcac atgagatggt ccaagacgca tccacggtgg ccaaaagcgc     55260
     tctgcttcct gtattgggcg gtggaacaag gcttatgttg gcaatggagc atcggatcag     55320
     tgacgacatt gatttgttca tccgtgatcc tcaatggatc ggctttctca ccccgcgcct     55380
     gaatgacaaa tttgagcacc tcatcaacac ctacgacgag ggggccacct ccctaaagct     55440
     caaatttaat gatggcgaaa ttgacttcat tgtcagcatg tccctgcttg gactcgacaa     55500
     caaggtttcc agcgagtgtc tcttcccact tgagccggtg gcggaagtgc tcgcaaagaa     55560
     gcttttttat cgtgggtggg ctctcacgcc gcgtgacctg tttgactggc atgcaattga     55620
     acgccatgtg ccgcttttgg atacccatga gctgatgctg gctgaattga tcgcggccag     55680
     agtggatggc attcgcatgg cgctagacca gatgggtaca tcgaaacaat cggcgatagt     55740
     ctggcaggaa attcgcacac atgagctgcc cgatctcaag caaaccattc agtgggctca     55800
     agggcgatta gggaaatttc aggcaatgag tgagcaggcg gcgaaagaca aggcggcggg     55860
     gcgtcgtcct gtggagcgat agttcatgac ggaacaaaaa aaccactctc gccaagaccg     55920
     tcagagtctg ctgatgcacc gtgaggccgt gcgaatgatc gtggccgatc catccttggc     55980
     caagaaggct cttgcaattt tggctcgttg ggacgggcat gcatccctcc gctcaaagcc     56040
     tttgcgggat cagtgggtgc agatcatttc tgagttggat tgggatcgcg cactggaaga     56100
     atctgagcga ggcaatcagc tccgccaagc ctctccgctg gcaatacttt tgccgaatga     56160
     tgtgcggctg ggcatcatcc gttcgatcaa aaacgaaaag gctgctcatg cataaaagcg     56220
     atctggaaca catcattcga gccgcatcgg cagtcacgaa ccagtatgaa atcgttgtgg     56280
     ttggaagcca gtcgatcctg ggctctgtcg atgccccgcc tatggagtgt ctggtatcca     56340
     tggaggccga tattttcgtg cttgggcatg agcagctctc cgacctcatc gatggcgtct     56400
     tgggcgaagg atccgcattc cacgacacct ttggctacta cgcccagggg gttgactcga     56460
     cgacatcaat ccttcctgac gggtggcgtg aacgcctcgt gcgactgcaa tcgccgaata     56520
     cggatgggaa ggtcggctac tgccttgacg ccaccgactt gttcttggcg aaatgcgtcg     56580
     cgaaccggga gaaggaccgg gaattcaatc tggcgctact ggtccatgga attgttgatg     56640
     ccacggttgc gctctcgcgg gtcgaatcca tgcctattga cgatgacgcg aagaagcgca     56700
     tcgcgcatct gatcgcccgg ctttcggcag agtcagaggc tgcgccgcag ccggcgcgac     56760
     cttcctcacc aaagccataa cccataacca agtcaccgaa tggcaaaacc gccggtaata     56820
     gaagacaaac aggtcgagca tctgcttcgc gcgacagcag cctacagccg cgttccgttg     56880
     cgcgacaccg cattgctcct ggtcctgtac ggcacagcgc tgtcggtcac agagctggcc     56940
     accatcacgg tgggcgacta cctggatgcc aagggcaacg tgcgcgtcac gagtgcggtg     57000
     cgcgtcgatg ttgcgcacaa cggcgaagag cgtccgctgt tctggtctaa caagcgagtc     57060
     gtcgcggcac tggacgccta catcgcctgg cgcgtggaac acaagcacgg cgtcacggca     57120
     aagaagggcg cttaccgtgg gctcgacccc gaaagtgcgt tgttcctgac cgaagacggt     57180
     ggggcctatg cgctgaccaa gcgaatgctc ccttcaggcg tctggagcta ttcctgcaac     57240
     acgctggggg cttacatctc gcgcctgcac gcgaacgccg ggatcgaggg tggcagcgcg     57300
     cagtctgctc gacggacgtt cgctgtaaag cagcatcgcc aagggcgtga tcttgtgcac     57360
     atcgccgcga tcttgggaca caagagcgtg agcaccacca agcggctggt tgagggcgat     57420
     cccgtgcgcc tggcagacat tgtggcgagg gctgtgtgat gacgggacag gaactggaaa     57480
     ccatccgcga aagcctgggc tatacgcagg agcaaatggc ggatcgtctc gcatgcgact     57540
     acgtgggtta caagcgctat gccacgggcg ccagggatgt gccgcgttac atcgcgcgaa     57600
     gcgcctttct cgttgaattt attcagaaaa atgggctgca aaagaagttg gataaagccc     57660
     ttgacacgta gccaatggct actataattg agccatcaac aactggagca aagacatggc     57720
     gacactcacg acccgcattg agcaagacga gcgcaatcag catgcttgac ggagagaccc     57780
     gcgtgttcac ccgcaatagc agctaccaca tcgtctcggc aaccgaggat gccttgcgcc     57840
     gcgatgtgaa tcgccatgga gtcgatgtgc ttgcacgcgc ggagttcgat gccctgcctg     57900
     tggccgggtt ccgcgaaaca aaggcgggga agtctttgct gctggcggct tgaaaggaaa     57960
     actgatggct atctcaatga acaccacggc acacctggcg gatatttaca agcaaatagg     58020
     caccggcctc agcttgtatc gcagtcctcg tgaaagagaa gccaacaggc atcttcacca     58080
     tttggccatg ggcgccgaat gggctgagag gtacgtgcct gatggcgctt ggccagagga     58140
     ccggtggatg tgggacgact tgcgtgccgc gatccgttct gaaggtggtg ctgtgcgtcg     58200
     gcgcaacgcc gggggcgggt tcactgaaag ctacctcgat ggcgatgtcg ttcgcacccg     58260
     acaaattcca gcccaatagc ccaaggaata agcgccatgt cttggaagct caaaaatgtt     58320
     cgcaacgtgg acggtcgaac aggcgtgatt tctgttgacg cgccggggtt tgcgcaccga     58380
     ggcctgcaca tcaagtgcga ggatgggtct acgggatatg tgcagctcaa cgcggatggc     58440
     caggattcgg gtgatcgtgg ctgggagtgg ttctgtgaag gctttgatag ggctcttggt     58500
     ggtccgtgct ggatcgcact tggtgaccac aacggacccg aaatgaccgc gcatcctcgt     58560
     catatgaacg cctgaaccga aggaaaaaac atggagcaag gcgcattcat catccatgag     58620
     ttgaaaggag actggccggt ctatcctggt catccgctgg tccttgccac cgcgatcatg     58680
     cgtgtgttcc gaaccttcgc tgaagcgaat caaccgactg agcatggctg gtgcgccgca     58740
     ctcggcgact cgcgcattcc tggcgctggc gaccatgttg gggctgccat gcgcaccctg     58800
     gagctgggct cgcgtgggga gggcgttgat tcgatggtcg cctacgccac acggtactgg     58860
     gaggctggac aagccggtgg acacatcaag aacgtggacg cagggaaagc gcaggccgag     58920
     aagatcgagc ctcatttccg cgctatatcc gaaaagtggt tcaagaccgc agcgacggtc     58980
     tgaaaggaaa gcagaacatg ccacgcaccg tagaacacat cgttgcttgc caccaggcgg     59040
     cgacggcctt gcgtaaggcc gggaagccca tctggaacaa gcgcattgat gtcaaggcga     59100
     tcactcacga agaccggggc aatgagtctc cagagtacat cagcgcaatc agccagcgga     59160
     ttgctgcgct cattcgtagc caggcacctg cgtcgtactt tgacattgga cacgaagact     59220
     ttgattttga cttcgtggat gccgttgaag cgatggagag ctgcactatc gaggatctgg     59280
     ctcaagacaa ggcaaacggg tgcgaggccg tggacatgtt caatggctgg ctggaaacga     59340
     tttacgactg ggcggatgtc aatcgcatct ggctcggcaa ctgaaggaaa tcagatggac     59400
     gatcgtttca gctctctttt caaagatcgc gctcctgatg ctgcagctca gcaactggcg     59460
     atcgtcctgg cttggttgac ggagtgccag ttggcaaccc tggaaggact tgaatcggtc     59520
     aagcgcacgg cgaagtcgga gttgtctcgt caccgtgaaa tttgcgatcg ggcggtgagc     59580
     caatgcaaag accttggagt gcctccggtg ggccttcgcg gggatcaatg ccagcgcctg     59640
     gctgaacggc tcaagacctg aaggaaagca gcgtgcccgc acacatcgtc aagcccaacg     59700
     tgatgcgtca ggtccagccc gatgtgtacc tgtccgcaaa cgggttcagc gcccgacgag     59760
     aggaaggatt cacgcccaac ggcaacccta ttggccagcg ctgggtactt cgtgacgcaa     59820
     acggggcgtg ggtcgatgtg aaccagtacc ggcatgacct gttcgagcac cacggtcttt     59880
     gtaccgatta ctgatcaagg aaagaggagc atggcacacc tgagcagcaa gtctgttgat     59940
     cggatcaacg gtgtgatcga caagatttca cgggactcgt ggacgcgcgg ctactactgt     60000
     gcagtggctg tactgctccg cgaagagggc gccgtaacgc cgcaggttcg cagcctgttc     60060
     aagcaaggtg gagcgccaca tgaggctgct gcaggcgacc tcgccctgtt cgcagaacac     60120
     ggacttatct aggaaagcac catgacagac agaagcatca tcaggatcaa gctggagcga     60180
     gctggctttg atggactcta tgtgcccggt gaatgcgcct gtctgaaaga ggacttggct     60240
     ccatgtggtt cgtgtgagcc tgacgaagcg ggctggatca atggctgcaa gccaggttcg     60300
     cgccacgacg atccccgacc tgggcatgaa gggggatggg caataagcaa ctccaaaaca     60360
     cccatgactg ccgaaggttt tgacgccctg ggcgtctgaa ataaccaagc caggaatcca     60420
     agatggacat gaccgcctca atcgcaatgc tgatcaagcc ccatgtggat gcagcaatgg     60480
     cccatcagtt tcgtctggag ttagtgcatc cgcacaccca gcagcggatg acgcctgtgc     60540
     aacgcgaaga gttcctgact cttgcatttg cggaaatcgc caaaggcatg ggcattgacc     60600
     gatttctgca aacgccagcc gagcggctgg atcagttcgc ggtcatgtcg gtgatgaaaa     60660
     accatgacac ggcgggactg cttcgcagtc tggtcaactc gttcatgatc gcctatgcgt     60720
     gtccagaaac cagtgaacgg gcatttcaag cattggtact gatcgagggt cttcgcgccg     60780
     aggtggcaga ttccaagggc caaggtcaaa tgacaaacaa gccggaactg caggtagcgg     60840
     cacatgagtt ggaagtgcat ctgagcgcag cagcaggtcc aaaccacaca cctcagtcgc     60900
     cgttgttcaa ggtgcttatc ggggcggaca gggtttacgt gaagtctggc taccccctca     60960
     aggatgttcc caaggtgttc aaggggttcg cggtagagcc aattgttggc cagccgatgt     61020
     aaaggaaacc tgcgtgacct acaacgccaa ggccaagggg ctgaagcaac ccacccccgt     61080
     tgagatcaaa gaggtgcgca caagggcggg cctgacgcag cagcaagcag ccgcgctggt     61140
     ccaccgggcc gatggcgcgc gatggcgcga atgggagggc ggcaagtacg gcatcgacct     61200
     ggctgtctgg gaactgttcc tgctcaagac cggtctacgc gccctcgaaa agacttgaca     61260
     cacagacgca ttgcgtctat tattgcgtta agttaatcaa tagaggaaag accatgaccc     61320
     gaaagttttt cacgatcgtc gcggctcatc ctgtcggcgt acagagccac gaattgccgc     61380
     gtgtgcgcgt tgacagcttt ttggtcgagg gagatagcct cgatgcagga ttcgcagaaa     61440
     ttgcaaactt cgaaggcatc gtggaagcaa cagaagtgtt cggcgttgaa tgccggcgcg     61500
     tcatgctcac cccgtctacc aagatgcagc gcgaagagtc gctggaacag tgggagcact     61560
     ggagtcgcat ggcgcggcgc ggcgaaactg aggctgattg gcggctgttg gccgaggggt     61620
     cggaaacgtt ccgtcaacgg atggaccgcg agttcctcga acgcaacccg cagttcgcat     61680
     aattgaggaa ggaatcacca tggcattcaa aaattggaat gtgcgcgtgc acctcaagac     61740
     tggctcggtg aatcttggtc aggtcggcga agagagtgaa gagcttgcgc gctgcgcagc     61800
     actgtcgaag ttcggtatcc ccgaggatga ggacaccgat ccggctactc gcggtatccg     61860
     agccgatgat gaattcgacg tgagcccggc aacatgagcg gcttcacgat tccactggcc     61920
     cgccgtagtc gctgcgaagc gagcggcaaa gagtacaccc gctacttgcg tcgtggccaa     61980
     ccaaatgagc atgacatgct gaattgcccc gtatgcggga agggcgtcac attgcgcccg     62040
     atgaatacgg ggggcagtgc ggttgtcatc cctcgtcacc ttgagcgaat tgtcggcctt     62100
     tgaggccaaa ggaaatagac caccatggca accattgaag aaatcagcgg gcagggtacg     62160
     ccagcgtttg gcaaggaact tcgggcgatg gcggatgagc agttgatggc gcaacaactt     62220
     gtgcaacaag gggcagtcca tgcgctcagc acgttgctca agatcggctg cacagaatcg     62280
     aacgccgtgg acatgctcgc cagcttgcga cagaacgccc agcagattcg caaagaggcg     62340
     gatcgtcgcg gcaagccaaa tctgtttttg tccgatcaga cggcatttaa ctgaaaggaa     62400
     agcatcccgt gccacgctac aagacgcctt cgtttcagaa gacctacgac gcaatgcttg     62460
     cggcggcgca ggacacttcg agcgagctgt accacgatgg catgccgcac cgtggcgctg     62520
     ctcatcgtac ggcgttctgg gatggctacg cggggctggc cacaacagcc aatgtggtgc     62580
     caggcacgct cagtgctgtg tgcttcgctg cggggaaaga gttcgccaag tcgaaccctg     62640
     gaatcgcggt cgaggatgcc gtgtggacgc ccggtgtgac tcgccagggc ggatcaaaag     62700
     tctgagagga attcatgaaa gtcgagcgaa atttcaataa gcgggcagcg caactgattg     62760
     atgttcagca accccatgtt gcccacggaa agggtgatcc gctcggcatc ggcgtgacac     62820
     tcttcaccgc ccctgctcaa gacaaccgag atgaagtcgg aagtctgcgg atgcacttga     62880
     cgccagaaga ggctttgacc tttggatcgg atttgatcgc tgcagcgcgc gaccgcctaa     62940
     aagctcaagg gaagctcgcc ccagtcaacg caaattaatc aaggaacctg ccggccccac     63000
     ggggctggcc aaggctccag cgcaaagtcc aatgcggatt cgcagtgcgg ctaaaaaagc     63060
     aagggatcac atgaaaatca cagttgaagt cactcaggcg gaccttgctg aaatgggcgt     63120
     atccgccaag cagcttgagg acgctgtgaa gcaagagatt gagggcggtt tggatgttga     63180
     cggggacacg ctctacatca acgatgcgga cgtgaccgtt gtagtcgccg aatgatcgga     63240
     aatcaacatg caaatgatgg agttggtgat gattgcggac ccggctcacc cggaagcgcg     63300
     cacaaagctt acgcacccgt acaactacga tccgttcacg atgtggcgcg gtccgggtga     63360
     gccggacggg tcggtttaca cagaccgtct ttttcagtgg gaccatgaga agcacgacaa     63420
     gctctgcatt aagcactttg gcaacagtgg tcagtattgg gctcaacgtg acacggacaa     63480
     gatccaagca ttcttgcgag actacctgga agcgccagag ctggttttgt gcgaagtgca     63540
     ggaacactgc aaccaagcaa caggctaccc ctgctggttc ttcgcgtacc gaaaaatgcc     63600
     taatgcagcg aaagctgtga attgaaggaa acgcgcatgt ctcagcaaca cacggttgaa     63660
     ggtctgctgg atgcgattcg caacgcggcg agcttggagg aactgcaatg ccttgcaggt     63720
     ccgagcgacg ccgaaaagca ggttgccgat aatcggcttg cgcagatgga agccatcgct     63780
     ttgaaatgtg aattcgaatc tcttacgccg agccaccagg ccatgcaagc tcgtgcgcgc     63840
     tatgacgagg ttgccgaagt gcaagctggc tacgaacgcc gctattgctg agaggaaaac     63900
     aaacgtggca atcacgattc atcatgacgg cgacacgtgg caccttctgt ccgagggcgc     63960
     aaccagcgat ggcaaaacgt actgtcatct tgcgagcact actcgatttc tcccgcagaa     64020
     aaacggatcg gtgccggtgc agataagcga ttggatcagc aatgccgtga ttctctcggc     64080
     cgccatccag ggcgaagaaa cgcagcgctc cgttacggca aagaagcacc ttggcgcatg     64140
     tgtcccgtgg cgcggacgcg gtggcgatct cggcgcctgc atttactgtg gcgagaagcc     64200
     cgacagtatc accgcctatt acgctgatcg tgcagcaagc ggccaggctg tgcttaccgc     64260
     gcaccgataa aggaaacacc atggctcaag cattcgcaga gtacaagacc tacccagtca     64320
     agccaggctg gtactgcctc ggttttgatc gtcttgacga ccaagtgcag gccgacattg     64380
     gcccaaccat ggaggacatc tatcgcttcg acggccagga ttggtacgac gagcacggtg     64440
     aaaagaaaga gggcacgttt gaccctgagt tgggcattga agtgggcatg accggtgctg     64500
     attactacgt gcctaactga tcggaaagag accaccatgg caaccattga agaaatcagc     64560
     gggcagggta cgccagcgtt tgccaaggaa cttcgggcga tggcggatga gcagttgatg     64620
     gcgcaacaac ttgtgcaaca aggggcagtc catgcgctca gcacgttgct caagatcggc     64680
     tgcacagaat cgaacgccgt ggacatgctc gccagcttgc gacagaacgc ccagcagatt     64740
     cgcaaagagg cggatcgtcg cggcaagcca aatctgtttt tgtccgatca gacggcattt     64800
     aactgaaagg aaagaggcgc tatgagcaag ctgctttcga tcaacgagcg cccaagcgat     64860
     ggtttggcgt cgttgaccgt gagcgactca ggagaggtgt actccgggca gctttggtcg     64920
     aagtgcaaag ctcgaaaatc tggcgtgtgc gacgccagcg gtgagcgcta cctgctagga     64980
     gctgagattt accgcccagt gggcaactct cgaaatcgca gcatgcgcat cttggctgcg     65040
     ctaatcgatc aaacctgaca caaaggaaat ctgccggccc cacggggctg gccaaggctc     65100
     cagcgcaaag tccaatgcgg attcgcagtg cggctaaaaa agcaagggat cacatgaaaa     65160
     tcacagttga agtcactcag gcggaccttg ctgaaatggg cgtatccgcc aagcagcttg     65220
     aggacgctgt gaagcaagag attgagggcg gtttggatgt tgacggggac acgctctaca     65280
     tcaacgatgc ggacgtgacc gttgtagtcg ccgaatgatc ggaaatcagt atggaaacgc     65340
     ctggcctaag ccctattcag gatcttctgc acaaagcggc agggagcgct cccacccgag     65400
     tgcggcacaa agacttcaat gggtcgccga atgatgcgca gggaatgctc aatgtctggt     65460
     tagcgcggaa ccaggatgca cgcgtcatca atgttgagac gctgatgatg tactcctctg     65520
     cgtcgatgat tagcggagcc agccgcagag agatgggcct cagggtgtgg tacgagttgg     65580
     gtggtgatgg tgaaatagcc ccttgattcc ccggccccgt cctatcggga tcgcggcttg     65640
     gaagtcgaaa acaggacgtt gtatctctct ggcttcaacg tcgatatacg gggcacggag     65700
     ggaccgcggc agccgctgcg ctgaactaat cacatagcaa ctcgccaaca acagttaccc     65760
     caatctgtgg gatgtaccga gatccctgct gggtgttgcc gagaagccgt ccccagctct     65820
     tgactggcga accgaaccct cccgagtcaa agcgggccgc gcacagcaac gccgggagcg     65880
     ggctcaggcg gttcccggcg tcaacaagag ggctgcgacg agggcccgca atggcaaagg     65940
     gagcgatgcc agggcagcgg cgggcagagc gcaaacagcg ccgaaagggg cgtatttccg     66000
     ttgcggatac gagggggcag gaactatgct gaagcccctt tctgattcca ggcgcatcca     66060
     tgctgctacg cactgcaaca acaatctgtg ttcttgccac gtaagcgcac ggcaaaccca     66120
     tgttgaccgc cgctggcggc catggctgat gatcagatat cgatgggttg ccagcgatgc     66180
     ggcagcagtt cttcaatccg gctggccttg tgcgtgggca gccgggtcag cacatccttg     66240
     agataggcat atgggtcgtg cccgttcatg cgcgctgact ggatcaggct catcacggcg     66300
     gccgcccgct ggcccgcgcg caagctgccg gcgaacaacc agttcgagcg ccccagggcc     66360
     acaggcctga tctggttttc gatccaattg ttgtccggcg gcagctgcgg gtcatcgacg     66420
     aagcgcgtga gcgctgccca gcgcttgagg ctgtagtcca gcgccttggc cgtcgccgag     66480
     ttgcccgcca cctgctggcg ttgcagcacc atccactggt gcaacgcgtc cagaatgggc     66540
     cgactgtgct gctggcgcac ctgcaaccgc tctggtgccg ccaggggctg aacttgccgt     66600
     tcgatctcat agacccgggc gaactgcatc agggccaatt cggcgatctg gctcttgccc     66660
     gctgcgtgca ggtcgaagaa cttgcgccgg gcgtgtgcca ggcaaccggc ttcggtcacg     66720
     ccctggctaa agctggcctt gtagccggca tagtcgtcac agatcaggct gccgcgccag     66780
     tcccccagaa aggcgcgggc gtgttctccg gcgcgggact cgcagaagtc atagaccacg     66840
     gcccgcgtgg cttcaaacgc tcccggggca taggcccaca ggtaggcccg gtgcgtttta     66900
     ccgctgcccg gcttgagcat ggccaccggg gtctcatcac cgtgcaacac ccggtggccg     66960
     agcacctcgg ccttcagggc atcgaccagc ggttgcagcc gcgcaccgca ggtgcctacc     67020
     cactgcgcca gggtggatct tggaatcgcc aggccggcgc gaccaaagat gttctcctgc     67080
     cggtacaagg gctggtgatc ctggtacttg gccaccagca cttgggccag caggccggca     67140
     gtcgggatgc ctttatcgat cacatgggcc tcgaccggcg cctgggtgat agtttcgcac     67200
     tgggtgcacg cccacttgcc acggatgtag cgctccacgg taaacacgcc gggcacgtag     67260
     tccagcttct cggccacgtc ttcgccgatg cgctgcatcc ggcagccaca ggcgcaggtg     67320
     gtcgactcag gctcgtggcg gatttcgcgg cgcggcaggt gggccggcag cggctggcgt     67380
     ttgggctgtt gcttggcttc gggcgcagcc gcaggcggct ggagttgctc aatctcgaca     67440
     gcgaccgccg ccaggtcggc atcgatctcg tcttccagca ggctcttctg atcggcgctg     67500
     tgccgctcgg attgggcggc gaacttcagc cgcttgagca gcgcgcactc ataggtgagc     67560
     ttctcgttga gcgcgcgctg gtgacgcagt tcggccagca ggcgctgggt cacttcgcgc     67620
     agttgctctg cgtccagttc gctcagggct tgctcgtcga tcaccatggc tggcagtgtg     67680
     cccgctcacc ctgggtccag ccattgacgc atctcccgat tgccacggcc acgcccttgc     67740
     gccgacgatt cagaccacgc tgatggcacc ttgcgagccc acacgctgcc agggcaggcc     67800
     cagcaccagg gcgttgagct gggcgtgttc caacgccacg ttcggactgc ccgcaggtgc     67860
     ccagacaaac ttgccctggt gcagccggcg cgcggccagc cacagcccca caccgtcatg     67920
     taccaggacc ttcaggcgat tggctctctg gttggcgaag acgtaggcat ggtgcgggtg     67980
     ggccgcgccg aaggtggcga tcacccgcgc cagggccgtg tccgtgcccg cgcgcatgtc     68040
     cagcggggtg gtggccagcc aggcctcatc gatacggatc accgcaacaa ctcccgcagc     68100
     atctgggcgc actcggcggc gccagacaag ggccagtgca cggtcacgga catgccgggg     68160
     cgctggcatt cgatgcggat gccgtccgct ggcgttggca aggacgcgga tggcagctca     68220
     ccagcagacg ccggcggtac tgcgctcagg tcgatgggga taaaggccgg gggtggggaa     68280
     gcaacgactg cagtgctgac gccagcttca agacggtgaa atccctgcgc ccattccttg     68340
     agccagcggt gtagcacgtt ggcgttcatg ccatgttgca gggccaccgc cgcgaccgat     68400
     gcgcctggct gtcggcaggc agccaccagc tcggccttga attgcggggt gtaggtgcgg     68460
     tgcgtgcgcc gctgcgcata gcgcggggtc tgagggtctt tgagcatcgt gtccacgcca     68520
     atgttgcgtg cacacgatct tgctcagcct taccacctca ttcaagatgg gttcgccagc     68580
     cgcatacctt gccaccggcc tcctggtagg cgccccggct ccagcctggg tcaaagaggc     68640
     taccgtcgcc gctcgccagg cgctctcgac ctcccaaata caaaaagctc ctgcaaccgg     68700
     caccattgag gttgggtttt cgcccaacaa aggggccgaa gagctggtgt tgaaggtgct     68760
     tcgctcggcc caatccgaaa tcaagttgat ggcctacgca tttacgagcg cacgcgtcac     68820
     aaaatcactt ttggaggcaa ctcaccgggg cgtgcgggtg agtgttcttg tcgatagcaa     68880
     gagcgcaagc gcctcgaaac aaacgcaggc ggctctatct gcattatcta ccgcaggcgc     68940
     ccaagtgcga accatcgacg tttttccgat tcaccacgac aaagtgatca ttatcgacaa     69000
     ccagcacgtt cagttgggca gctacaacta ttcgacagca gccgccacca aaaacagtga     69060
     aaacgttctt gtcaactggt caaatccctc gctcgccaaa atttacgagg gtcatttcgt     69120
     aaacaattgg gctttggcgc aacaattcac agggaactat tgaattggaa ttgattgatt     69180
     gatataattc aattgcaatc agtaagaggt tcatcatggg attcatcagc gccattcaga     69240
     aattgttcgg tcgcagcggc agggaagatt cggccgaaga aatcaatgcg cgaattgaag     69300
     cgcttgaagc aaaatatttc cggttctctc aaggcaatga gctgatcggc cctgcttatg     69360
     gcaacggggc tgctgattac gttggcgaag cgattcgtgc tgggctttcg aaagtaaagg     69420
     gcagcgacat ggacttcaga agggatgaaa tgttcttcta tggggacccc atgaccgaca     69480
     acttttacat gaaccccgca gttgcagagg ccaattcgct ttcatcttct gatgagccgt     69540
     cattttggat caactcgctc ggcccaagtt gggacgatta atctgctgag acgcgtccgc     69600
     acaagaaagt catagttgaa tgtggaaaaa gaaacctaac gccaccccac tgagcaatga     69660
     ggatttgctt cgcgtgcaga tcgcctcaga aaaatccgac ctccgatgga agagggctaa     69720
     acgtgcgcta gttgccgtga tggccgcatg gggtctcgcg ggcgtctggt tggcaagcga     69780
     tctggggcca ggaaagagca aggcacacgt cccggtcatt cgcatcgaag gcggcatcgc     69840
     aggcgacagc accaagatca atgcggactc agtaaataaa ttacttgcaa aagcgttcga     69900
     tgacgattcc gccagcgccg tggtgcttta tatcgactcc ccaggcggct cccccgctga     69960
     ggccgaccgg atcggcagtt ttattgcgcg caagaaacag gaaactggca agcccttgta     70020
     ctccgtgtgc gccaatatgt gtgcgtcggc cgggtacatg atcgctatgc atggtgatga     70080
     gatctatgca agcaaataca gcctcatcgg ctctattggg gccattctta gttcatggaa     70140
     tttttcacag gccatcggca aagtgggcgt gcagcacaac gcctacgcca gtggcaagct     70200
     caaggccatg ctaaatccct atgcgcccgt caaggcgggg gatgtggaaa aggcccagga     70260
     gctggttgac ggcatgggta aagtctttgc agagcaggtg cgcttttatc gcaagggaaa     70320
     actcacgagc aaggtggatc tgttcaccgg ggaagtctgg agtggcgaag aggccaagac     70380
     ctacggcctt gtggacgtga ttggcacgct cgatgacgtg gttcatgaca aattccccga     70440
     tggctcgcag attttagaca tggacaaatc tggcggcggt ttccgcctcc tgcgcagcgc     70500
     ttcccaagcc atcagccaag gcatccaaag cgggatgttg gcccacgttc ccttaatgat     70560
     gcaatagtgg aaagggtgat catgcggtat cgtctcaaca tcccaaacgg gctcgatttc     70620
     agtgccctag ccctcatgtg ctcgtcagac tcggaagtgt tcacctacaa ctccggccca     70680
     ctggaagacg tgtgcgctgc gtcggggctc gcatttgcgg aactcgatgc agatccggaa     70740
     gagagtttgc gggtgatcgc agcttggtac gaattgcacc tggccaatgg cggcgctcgg     70800
     catgatgctg gcgatacggc gatcaacgcc atgtcgcgct gcagcctgag caccgagtaa     70860
     cccggcgttc cacacacccc gctttgggcg tgggcttctg ctggcagccg ccgcccattg     70920
     acgccgaaac cccgcagcaa gtggcgacct ccctattacc ggccgccacc ctcgttcttg     70980
     cccaggactt tgagggcgcg agcccccatc cagactgtcc atgtgcctat gccgacgcca     71040
     aagacggcct ctaattcgct gactagggag tccgggatat agccgttcag gcgcagaacc     71100
     ccaagcagga cggcgaggcc accgcagaca tgtgcgaagt acgcgatgta cttgagtttg     71160
     ttgctatcca ttttctctcc tcgtccctgg tttctgtagc tgcggccaat gccgccctgg     71220
     tttgctgatt gagccgccgt ccactcgcac ggcgaaatga ctggagcgca aaacttgcgt     71280
     tgccgctgtc actccagcgc cctgagtttc ctggccaact cccgcagagc atcgttatcc     71340
     gcggcactct ggcgcgcagt ggcccagcgg tcgagtaggg ctcgttcttc actgtccacc     71400
     tcggccatgt ccttggccac ccgcaaggca ttgccgaagt gcctcttgcc cgaggcggtg     71460
     acttcaagct ccttggcgat cgcagccgcg tcgtagcgca cggggccccg gccgccttcg     71520
     cgtccgcctt ggctgctgcg cgcggttggc ccgctgttcg acggtgagtc gtcgccagcc     71580
     acagcgcggc caatgtgggc tgctggtgag cagggcttca tttggggtct cctcgttttc     71640
     agtgcaataa gtgacggtac gaaaagctag cactggcgcg gaggtggtgt tggtagatcg     71700
     ttgatttcat tgactttcct gttcactttc aaatctgcga ttcgtggcgt caaaccgtgg     71760
     tcggtttcat ccattggtgc cagttatcga tgcatttggc cgcgaaggca ggatttggtc     71820
     agcatagcgg tcaaccggga agcgaaacac accccgcaag ttgatgctct ccagcctggt     71880
     gggcgcaatc ttcccgatca gttccggtgg aatgacctgg cggcggttcg accagcgatc     71940
     caggaccgcc tgcatctgtg aggtattcca cgccatcacg atgttggcca tcaggctcaa     72000
     cgcatcggcc acagcctgca tttcatcgac acgtttggcc tgcgccgggc tgatccggcc     72060
     ggtataaatg gcgcgcttga gggcgttaac agcctcgccc cgattgagca cccggcgcaa     72120
     ctcgttcctg aaagcgtcct tgacaaagta gtcagccaaa aacgccgtac gcagcaaccg     72180
     ccccaattgc acgccagcct catagattgg atcgccctgg gcggcagaac cgaaccgcgc     72240
     aagagctgcc accgcactgg catgtccgct catgaccgag gctgccaggt gcaccagact     72300
     atcccaatgc ttttcgatca aagcgacgtc gacattggct tcgcacaccg cagcgatttc     72360
     tgcgggcact ttggtgccgc gtggcacaaa gaggtggcgc tgtttgagtt ccttcaaccg     72420
     cgggcaaaga tcaaaaccaa gcaaacgggc atgtgacatg gcaaagtcgg tgtagccatg     72480
     ggtatccaca gcaagctggc tggtctccag cttttcttgg cggatgacac cttcaatggc     72540
     cacgcccgcc tggcgctcat tgagcacaaa gggctgcgca tggaagatgc cccaccggtc     72600
     ttttacatgg gagtagattc caatggaagg tgtgttgcgc cgaggatcaa gccgggcttg     72660
     ccacacccgt ttggtggtct ccatgctcat catgtcagaa gatgccaaat cggaccgccc     72720
     ccaggtggcg gcaatcgggt gtcgctgcat gaattccagc acagcctggc aggcctggct     72780
     cagacgccgt tcgtcccgcg cccagcgcat ggcctggcga atgctggtgg cagacaattg     72840
     cggaatcatg cgcgcgcatt cgaccgcagt cagactggtg ccgtgggcca tgatgccggc     72900
     atagaccatc agcagctcgt cggtagagcg cggctcacgt ccgagcatga tggggttcta     72960
     agccagaacc gccgaaattt ccgtcatccc agctccagcc ccgccacgag cgcatccagg     73020
     tcgatcatct tgccgtcgct ctggaaggtg taatgcccgt tcagcaggat gtgccgccag     73080
     gccgccggcg atatctgggt caggagagcg tgcgccttgg cgttgccgct cgcctcgtac     73140
     ttcatcagca gccgcgagag gatggccgag ttgtagaaga tgaccgcgtt ggcgatcagc     73200
     ctggcgcact ggttgctgat ctcaatttcg atgtcggtgc gcccggtcaa ttccttcttg     73260
     ccgccgacct gggcgatggt tgagcgtagc tggtgatagg actcgatgcg gttctgtgag     73320
     cggtgaacgt tgcgctccag ttgcggatcg cgcaggtagc gcagcgtgta gatgctgcgg     73380
     atgagcttgt cgaactcgaa caccgcgcgc cgcgtggggt tcggcgcggt gtaggtgcat     73440
     agcttgcgga tcagcgtgcc ctgcgtcatc tccttcagtc cgagcgtggc gacaatctgg     73500
     tcgaggttcg gcttctcgct gactatgaga tcgcggtcga ttctcccggc cggccggatc     73560
     aggcactgat cgtacagcgc cggatcgtcg gcactgtaga gttccttcaa ctgatcgcca     73620
     aggtcggtga agcgcggctc gaaacgcagg ccgaaccagt gcaggatagc gaagttggcc     73680
     ttgttgacgc tgtgcatgtc gccggtgatc gcggtcggca cgatgtccga cgtgttgcga     73740
     taccagatgt cgaacacgtg atgggcctcg taatcgtgcg cgccgatcag gtagccgttg     73800
     agcggcacgt ggttgcacag cagcgtgtag gcgaccacgc ccttgccgcg cccaaagtat     73860
     ttgcgcgagt ggcgcgcttt cacggtcggc cgctcgacgc cgaatttctg accatcgacg     73920
     gcaccgtaca gtgcatcgag gtcgaacgag tagtacggga agatcggcag cgcggcgatg     73980
     gcgttgctga tgcagtcgtt ggccgcgtgc agcgttgcgt ggcgcaggta ctgttggtag     74040
     gcgctctcca gcacgtggta cgggatgtcg ctggtgcgtg ccatgacctg gttgccgtgg     74100
     ttcatcgcct gcgcgatgat gaccgccatc aggctgtcgg cgtcggcgac cttcttcgca     74160
     tagcgcggct gcaaaggcgt cagcgccgac aggaactggc actggccgtt gacgaagcgg     74220
     aacacgtcgg ccacgtcgca gaacggcagt tgctcgtaga acgccttctc gcgcgccttc     74280
     tggttctcgc ccttgggctt gcgccatgtc agcttctgcg tgtccttgtc gtattctagg     74340
     tgcgtcagct tgccctgctt cagctcgcgg ttgaaggcca gccactgagc gcgcagctcg     74400
     gtcgcgagcg catcgagctg ggcatcgagt ggctgccgca ggaacgggat gtcgatctgc     74460
     gccagcacgg cggccttctc atccagcgaa accagctcgt cggaaaaatg ccggtgctgc     74520
     aagctgtcgt cgaggtagag ttcacccgac tggaagcgct tcctgacctg gcggtacagc     74580
     cagaactcgt agcggtcggc atgcaggtcc gtcggcttgc catcggcatc gaaggtcagc     74640
     aggtacggtc gcaagcgttt cggcagcgtg gccgctggac attcggcgag cggccgttgc     74700
     gataggcgct gctgtttggc gaacacgtcc ttggcccagg ccagcgccac gagccacggg     74760
     ctgcccggat cagtgccagc gaggtcgagc gcgacataca gcggccgaag atggcggcgg     74820
     atgcgctcag ccaggccgtc caccgcctgc cagtgcaaag ccagcttgct caccggcttc     74880
     acgctcatgc gctgcgcggt ggtttgcagc gtatcgcggg gcatgatttt gtaggcgcgc     74940
     tggcgcacat cgccgaacgg cgtgggatcg ggcacgctgt cgtcgatgta aagcgacagc     75000
     aggcggccga cctgcggtgt gtcttgctga cggcgcacct gctcggcgac aaaggattgc     75060
     tttgcgcccg cactgctttc gtcctccaac tgcttcatgt ggtaggccat cgcatcgacc     75120
     aggttgtcgg aaagctgccg gtagcgcacc caggcatagc aaagcaggta gaggtaggtc     75180
     tgatcggcct tcaggttgcg tagatcgtgg acggtgtaga agttcgccag gctggcgtag     75240
     tacagcagat tctgctgcga gacgccgagc ttgggcagca gcgccttggc gatccggtgc     75300
     agcggctcca gcgtggcgcg cttttcgcgt tcgcgggcca tctgacgcca gccaaagtcc     75360
     ttggcgtcct gcttgagcgc cgccaattgc gacagggtgt cgtcacgcac tagaagccga     75420
     cccagcgcgg ccttggccga ttcgtccaac acttccgaca gcaggccagc cagccgccga     75480
     cgctcggcgg acagggcttc gctcaccagc tcttgcaggg tggtatagcc gggccggatg     75540
     atcttgtgct cgtttagcca gacgatcagc tcggcggcga tgaaccccgg catcacgtcg     75600
     cgccgcacgg tctgcgcggc ctgctgcgcg agctgcgcca ggaactcggc cgcccacggc     75660
     cggtagccga acagatcggc aatccactcg cgctgggtgt agtgctcgtg cttggagatt     75720
     ggcttgtgct cgaaggactc gccgtggaag tagcggctca gcacgaaggc gcaatcgtgc     75780
     tcgacctcac tccagtcgaa gcggaagaag gcatgcttgg ccttgaagta accgatctgc     75840
     aagatgcaat agacctgggc atggagacca ggccggctgc tggcgagcgc cagttcggtt     75900
     tcagtcaacg ccaagtattc cagccgctgg gcgtcgtcga agtccggcag gccgtacagg     75960
     gcttcctgct cggcgtccga caggacggtc aatcgttcgc tcttggtcgt catcgcgatg     76020
     acgctccacg agagcccgtc caaccaaccc gtgccagggt ctcgatcagc gtggttcgct     76080
     tgacgccgaa gttgcggcac accgccgcct tggacatgcc gccatcgagc gcagcgacga     76140
     tggcctccag cttctcgccg gtgatcgcct gcggccggcc gccgatccgg ccgcgtttgc     76200
     gggcggcagc cagaccggcg acgacacgtt cctggatcaa ggcgcgttcg tactgcgcga     76260
     gcgcgccgaa cacctggaac agaaactcgc ccgagggcgt cgtggtatcc aggttctccg     76320
     tcagcgagcg gaacgccacc tgcttttctt gagcgaggtc acgatggcga gcaagtgcga     76380
     caacgaacgg ccgagccggt cgagcttcca cacgaccaac acgtcgccag ggcgaacgaa     76440
     ttcgagcgcc cgcgccaggc ccgcgcggtc gtccttcgcg ccggaagcat gatcctcgaa     76500
     cagatgccgc gcatcgacgc cgacggcgag cagcgcatcg cgctgcaagt tcgtgctctg     76560
     gcggtcggag tccgacgaca cgcgcatgta acctaccaac ataagcggaa aaccattaag     76620
     acgaggtttc cgtatggtag cgtctggcga cagagttttc cgcacaattt tgcggccact     76680
     cggaggttgg tgcagaggac cgttgaaggc ctgtcgaaaa acaaatgttt tccgacaggc     76740
     cttggcctag cgcacgcccg ccttgcagcg ttctgtgaat agcgcttagt aatgacggcg     76800
     tatatacttt gttagtatca agtggcagga ggccccgatc atgtcaaaac aagccgtttt     76860
     cacgatgaag ctggagcctg agttgcgcgc cgagtttatg gccgaagccg aggcggccca     76920
     tcgcccggcg tcgcaagtgc tgcgcgagct gatgcgcgag ttcgttcagc gccagcgcga     76980
     gtcgcgcgag tacgacgagt tcctgcgccg caaggtcgaa gccggccggg cttcgatgcg     77040
     cgctggattg gggcggtcga acgatgaagt tgaggccgaa ttcgccgcac ggcgtgccag     77100
     tgtggcgagc caggcgtgag ggttgtttgg acgcccgaag cgcagcaaga ccgtgccgat     77160
     gtgtgggact acatcgcagc cgacaatccg cgcgcggcgg cccggatgga tgagattttc     77220
     agcgacgcgg ccgcccgctt gatccagcac cccatgctgg gcaagccggg aaagattccc     77280
     gggacccgcg agttgatccc gcacgaaagc tatcgcctgg tgtatcagat cgacggcgaa     77340
     acggtgtgga tactgacgct ggttcatact gcccgcctgt ggccgcctgt gcgcgattaa     77400
     gatatgatca tggcaacaat gaaacggcgc gttgacagac tgctttcgag ccagaccgcg     77460
     gtcggcggca ggcggccagt tgcggacggt caagcatctt cccggtagcg gacgttcaat     77520
     agtgtctctg acctgcttcg ctccctctat gaagggaggt cgctggccca tccgcgcact     77580
     cacagcctgc cagtaggcgc aaattggcag cgctccgtcc ggcagcgcac agactgcggc     77640
     cgtacgtccg cgtaggttcg cttcagcagt ttcgattcga aagttcaatg tgattgctgc     77700
     gggcggtcgt cgcagttgcg cggaggcgat gatgcacaag cacgggatcg gcagataggt     77760
     tcttcgaagc tgcaagagtt aaaacattca cacatgaaag attgaaatgg atacacgatt     77820
     atttgctttc gtcggcgcag acattggccc ttggcggatt gtcagggccg aaacgagagt     77880
     tggcgagccc ctgcctgaag ccaaaaggct caacgtcgta tccgcttcag agttgcagtc     77940
     tgaaaccaat gcaccctgga tacttcgtgg aataaccagc aatgaacgat atgtcatgcg     78000
     cgcagagaag aatgaaattg tagcgaagca gcaaggtctg gcgcgcccag aagcaacgtg     78060
     cggtgcgcta ataccgatcc ggaagaacgc agcttggtgg gagctcacgc aagacgaacg     78120
     ccggagcgtt ttcgaacagt cgaagcacgt ccaaatcggg cttcagtatt tgcctgcagt     78180
     agcgcgcaag ctccaccact gccgcgacct ctcagagaat gaaccgttcg attttctgaa     78240
     ttggttcgaa tacgcgccaa ttcatgaggt tgagttcaac aggctgcttt ccgaactgcg     78300
     tgcgtcagag gaatggaaat acgtcgaccg agaagtcgat attcgtctta cgcaagcaca     78360
     ggtctaaccc gccgatgaac acggaccccc aacagcggcg cgttgcgccg ccgtttcggg     78420
     ccggttatcg gcaacgtaga actctcggat acagttgttc tgtaataact tctcaagcta     78480
     aattgatttt tggagtggat atggaaatgg aatcaagaat attttcggta acagaatata     78540
     ttcgtccgtc tgacggcgaa ccaattcgtt cagtggttct ggaaaccaag gactcagcag     78600
     ttgttgtttg gcatgcccat cctgggcaag aaataaccgc tcatgttcac ccggacggcc     78660
     aagatacttg gacggttatc tctggagagg ctgagtatta ccaaggaggc ggcaaagtcg     78720
     ctcatctaaa ggctggagat attgccatag caaaacctgg ccaagtgcat ggcgctctaa     78780
     atactagtcc agtgccgttt gtatttgtct cagtggttgc atctggcaac gcgggttttg     78840
     cgttggctga aaaatagtct ttctcaaatg tgtgccccag agagttctaa cccatccatc     78900
     aacacggacg ctgcgcgatg aagccgcgcc gcgccggcta actccacgtt gagcgtcagc     78960
     tttccatatg tctgggggtc tgcaacgggt cgggtgccgt cgcgtgcgca gtgtcaaagc     79020
     tgacatgact aatacatgag atgggctgat gctcgccgtc cggtcaggca gctgcccccc     79080
     tgcaggactc acagcagttg tatgccaccc gtcatccgag acgtcagtcg gcctcatcca     79140
     gaccggaaca atctggacgt gacgtccggc tggcattgcc gtgatcgaaa tggcggctag     79200
     tgacacgact gttgggtcta ccccatcgac cgggcgcggg acaagccacg ttgatcggct     79260
     gacggaattt tcggcggttc cggcttagaa cccctggtac ttgaaagatg cgatcgaccg     79320
     tcgattcgtc gctcgattta gtgagtaaaa gccatgaaat tgtttggtat ccctcgatcg     79380
     cagccgctgg aaatcttggg cgagctactg actgcgctct acatgggtgc aattgcgtgg     79440
     atcgctgcgg ccacgcaggt tcacttcatt ttgttcccgg aacttggtgc tctcggccat     79500
     gatgtgatta agcggccaca cggcacatgg gccaagtcgc cggggatgct cgttctcacg     79560
     ccgccgctca ccgggcttgt cggaacgatt ctcgtgcgaa acatgggcgg tgggatcgtg     79620
     ccgatcctgc tggcgactgt tgcggccatc ctcatcattc gcggcttgcg gtcaccgatt     79680
     gccccagcca tctcggcagg cgtgctgccg atatcgctca acatcacgag ttggtactac     79740
     cccgcatcgc tactggttgg gctggtgctg cttgccgcga tttccttgat ctggcgcggc     79800
     ttcattgcac cgccacaagt acgctctgct gccgatgtgg ctgacgacac gactgaagaa     79860
     gcgccccaca gctactcgtg gtttccattc ttcgcggttt ttctgatcgg tacagccgtt     79920
     ttggctgaag tgactggatg gcggctgatt ctgttcccgc cgctgatcgt gatcggcttt     79980
     gaaatgtttt cccattcgga cgtttgccct tgggccaaga agccgctctt gcttccggtt     80040
     gcatgcaccc tgagcgcgct tgtcggcgtt gcattggtta cgtccttcgg tgatgccccg     80100
     ctggcagtta tcgccagcat ggcaagcggc atcttgattt tgcgagtctt cgatctgcat     80160
     gttccgccag cgcttgccgt gggcctgctg ccgttcgttg ttcctgcggt cgattacaag     80220
     ttgcctgcct ccgtcggcat tggcaccttg tcgctgaccg tgctgttcct gatatggcgc     80280
     agactgcgag aaatgcgcct cataccgttt tgagtgcaag gcaagtgtca tatttgcagg     80340
     gctatgtacg tgtcgtacag tgtcgcaagc tagagcgcag ccatgaacga aatcaatcgc     80400
     agaaatattc catgagcaca aatcgtctgc cggatcctct tgccgataag acctatttgg     80460
     aggatttgcg tcgccaaatg ttgaagttcg ctgtcttgca attgcgtgag ggagttgcgg     80520
     agtgggcgat aacgctggcg caaggtgctg cctcaggtgt gtagcatgct catcagcttc     80580
     catggcgagg cgctgttgtt tttaggcgtg gacctgaatc aacgttgttt taaagcatca     80640
     gatggacagg tcgctcagtt cggggttgat ggcatgcaag agtatgaatt ccgcgatgga     80700
     cgccgtgtcg gccaaatcca gtttgaccaa gttcggtacc gccaataatt gctctgacgc     80760
     aacaaaccgc gtatcactgg caattgccac gatgcccggc caaaccgatg ccagcggggg     80820
     cttttcaagc gatgcccgcc agacctcaag tttaggaaag gtgccgctct taaagccttc     80880
     aatcaacact aggtcgcaat gctgcattcg gccaagcaaa taatccaatg aaggctcggg     80940
     cgttccacgc agttcatgca tcaacgccca gcggtcgttg cccagtaaaa gcacttcttt     81000
     gcagccggac tcacgcagac gatatgagtc tttaccaggc cgatctacgt caatattttt     81060
     gtggctgtgt ttaagcaagg atatgaccat tccgcgcgcg ctgatggcag gcaccaatcg     81120
     ctccagtaac gtggtcttac ccatgccaga gtggccggcg attccaaaga ttttcataaa     81180
     atgtgccgca acaccacttg ctcattggag tcagtggtgc ctaagagacc ggatgtccga     81240
     tcaggtttac ttgagggtta aaacaaactc gaccattgtt ttgatgtcgg cgtctttgac     81300
     cgtggcgttt ggcggcatcg ggattgggcc ccagatgcca ttggagcctt ttttgatctt     81360
     cactgccaat tgggccgccg cagcggcatt tcccgcatat tttttcccga cttcattcca     81420
     ggccgggccg accagcttct tgtccagtgc atggcatgcg aggcagccac ttttctgggc     81480
     catagccatc gcgacgcctt tgtcgatcgc gaaagatgag actgagaggg tggcgaatgc     81540
     ggccagtacg agaatttttt tcataagcta ttccgagttg aaatgaagca gcgcaacagt     81600
     tgcgctgctt ggtgaaaggt tatggtcagt atccctttca ggtatgcggg tcacaataca     81660
     tgccaagcgg ttgccaccgt cgttacgtcc tcaaaagcga agctgccacc actccatggt     81720
     cacggcttta agcccgtcac gttcctggtt ctcaccatcc caggcggcaa agcctatcgg     81780
     catggtccgt cggccctgta ggttcgcgcc ctcttctgcc ttgacccgca gcggacggct     81840
     gaggactacc tcccaaccat cgccggtgcg caccgacgca ctgcgcagat cctcggtcgg     81900
     caccggcgtt gaagtgccga aacctttggc cagcaggttc aaagtgcgcc cgtcggcgcg     81960
     ccaatgccac acattgacga cgttgacagg atcgcccatg aagtgcagcg tggcgacctt     82020
     accgttgacg gggaactgta ctgcggcgcc gtccaggaac tgatcggtat ccttcatcac     82080
     tgtgttggcg gtgcggtcgc tccaggcaag cttgacgaat agccgccctg aagcgcgcac     82140
     agcttgggca gcgagcttct gagttgcggc cgtgcccacg attgagatgt ggccggggaa     82200
     ggccgttagc agcgtgacct gcgtcgtcgg cgcctttttc cagacggccg cctggggaga     82260
     cgcggcgtca ccccccgcta ccgacagcac gcggatgatg cgctgcgctt gcggcacggc     82320
     gccttgcgct gctgcagcag cacccgtgca cgctgccgcg acggcgagac cgatcactgc     82380
     cattcgcttc actagaatgt ttgttttcat tgcatttctc tcgatttttg tggctgatcg     82440
     ccgaggcggc tgcggtgagt ttccaccagt tcgcccagcg ttggtccgta ctgcgcataa     82500
     gtggtctccg tggcttctag ccgctggcga aaatccggca gccaggccgc caagtgccga     82560
     accagaaagt ctcgcgcagc gttttgaaac ggttctgcgt cgcgcccgtc gcgcagggcg     82620
     gcatgctcct gcagacaaag ccatgcgagg aactccagtt cggtgaccag atggtctggg     82680
     tactcccgct cgtcctgatt gaggtgcacg tcgaagaact cgtagaaacg caacaactcc     82740
     tgcagaatgc catcgcgccc gcgttccggc cggttctgcc cttcgtaaag ggacattgtg     82800
     gaagtgccgc cccccatctc gaagaggccc aggtactccg cctccagcgt ttcacggcca     82860
     agtgccggat ccaccagccc attttcagtc aggcggcgcc aggcgtcggc gtcgggataa     82920
     gagaacatct gggccatcgc cagatagccg ctggccatgg ctttggggtt gtcgatgagg     82980
     gtgttcatac gccgtacctg tccttgttgg tgaagccgat gaggatgtcg gtgagttccg     83040
     acgcctgcgc cttgcgccgc ttggccatct cacccccaag cgttgccaga gcctgcttga     83100
     cgccggggcc aaacagcgct tcgagatcct cgatcgggat gcgtggcttg tcgccgaggc     83160
     ggccgtcctc ctcgaatggc ggcggcgtgg tgttcatggg cggcacgtaa aagacgttgg     83220
     gctcggtgcc gtattcggca tgcagcggca gcgccacttt ccattgctcg accagcttgt     83280
     agatcggacc gtttttgtcg tctcgatagc cccagaagcg aatgcgaccc gagcattgct     83340
     tgacgcaggc gggcgcctcg cccttttcga cgcgcggata gcagccgatg catttctctg     83400
     acttgccttt ctgcaaattg aaatacatct tgccgtacgg gcaggccttg acgcagtaac     83460
     ggtagccacg gcagcgcgtc tggtcaacca ccacaatgcc gtcttcgggg cgtttgtaga     83520
     tcgctttggt ggggcaggcg gccaggcaag ccgggttgga gcaatggttg cagatgcgag     83580
     gcaggtaaaa ggagtggttg ttcgggaatt cgcccttgcc ctcgtcttcg tcccagttcg     83640
     ggccccaggt ggctttctca tggggcacca cctggtcggc tttgccctcc agcaggacct     83700
     cgttcaggtt gaagtcaccg atcctgccgc catagtcggc catgatgggg atgatgccgt     83760
     tggtttttag cttgccttcc tggtcgaagc cgccgccttt tccctcccag tttttgggat     83820
     agcccttgcc ggggcgggtc tccacgttgt tccagtacat gtactcgcga ccgtcccggt     83880
     tggtccacaa ttgtttgcac gccatggtgc aggtgtgaca gccgatgcac ttgttcagat     83940
     cgaatacgta ggctacttgt ctttgactca tgatttgttc ctcaggcctt ctcgacgtca     84000
     accgtcgttt cgtagaaaat gcggttagga ttgaatgccc ccgacgtgta cttgatgtgg     84060
     ccgtagccgc ccaccaactc cagtgggttg atcagctccg agctgaccat gttgtagtgg     84120
     gtcatgttct tgtactggta ctgttcccac ccatgctcag tgaacagcat gttgtcgggc     84180
     aatgcgggca tggccttgac cacggcaaag aactcacccg agtcattgaa aatgcggacc     84240
     atatcgccat ccttaatccc cttggctgcc atggccttgg ggctcatacg cacatccggc     84300
     tcgccgcgtt ggtggcgcag catccattgc tcggtacgcg cgaaggagtg gacaccccaa     84360
     cgggtatggg gcgagttgcg cacaaagggg tactttttcg gccccagaac gccccctcgg     84420
     tactggggct tgggcacggt ggccccaagg cgctgaaacc agtcgtggtc cacataaaac     84480
     tgcaggcgtc cggtaagcgt gccgtacggc ttcttgtcgg tcacgttcac tgtgaagggg     84540
     cggtacggtt tgtccttcgg caccggcccg gtcttgccag ccgagggacc gaccgcgacg     84600
     aagccgtttt tcatcacttc ttcataggtg cccggaccga gggccttgga gttgtccatg     84660
     acgaagcgca ccgcctgctc gtcggtgaca accttgccgt tcatggtgaa ctcgtcgtag     84720
     atcttgtcga agtcgatgcc gctcttgatc tcgggatcat ctacgcgagc gatgccgcgc     84780
     gccttggcac gctcctggat cttggctgcg agcgccacca tgatctgcca gtcggtcttg     84840
     cgctcgtaca tgggcttgac cggttggccg aaggcatgga tgaaacgggt caccgaggtc     84900
     tcgcgaatgt ccagcttctc ggtatttccc gccgccggca gcacgatatc ggcatacatc     84960
     gccccggagt tgagacggaa atccaccacg acgttcagct cgcagcgctt gaggaagttg     85020
     tctcgaagat gctggtagcc gttggaggtg gcgaacatgt tgatgccgcc tgtgatgctg     85080
     accaccggct ccttgatgga ctgccaattg ggcatccagc cgttggcctc ggattccttg     85140
     cgcattgact ccatctcgtc gacgccgaag cccagctcct cgcgtagctg cgcatcatta     85200
     aagtagtctt tcgagcgttg gtactgttcg ccccacaccc actgggccag cactgcggag     85260
     acgctacgtc cgggtttgcc cttcaccgtg cccagttcag agtcgccttc cagccgccag     85320
     ccctcgaagg tggtgtcgat ggagccggtc gtgccatggt ggccgatcag ggtcagaatc     85380
     aatatcttca ggcgaccgca ctggaatccg tcgaagtgct tctggttgtt gtagccgtcg     85440
     agaatgcgca aggccttgca ttcggctatc catcctgcca attggcgtac aacggaagga     85500
     tgcacaccgg tggtggcctg ggtagcctcg ggcgtgtacg gggtgatttc tgccttcaga     85560
     cgctcgaaga ccgtcgtgac cttgatccca tgagtttcaa agtttccctc cagcgccgga     85620
     tcgatggtgc cgagcttcaa ggtcttgtcc ttgctgccca tgctgccggg tgcaagcacc     85680
     gccttgcccg ccttggtgtc ccagacatag aagacctggt cgctgccgtc cgccttgaag     85740
     tccttctcgc gtaggaattt accgttgtcg gtgcgtacca ggaagggcag gtcggtttgc     85800
     tccttgaggt agtcggcctt gtagtgttta ccggcgataa gcacattgac tagcgctgcg     85860
     gcaagatggg agtcggtacc cgaggtcacc ggaacgaaca ggtcggagtg gatcgaggac     85920
     gggttatagt ccgccgagat attcaccagc cgcgcgccgt tgtaacgcgc ttccatgagg     85980
     aagtgggcgt ccggaatccg cgtgacgatg ggattcttgt gccacatcag gatgaggtcg     86040
     gaggtgaacc agtcgtcgaa tgtggacacg gttgaggccg gcacgcgcac cgtctggatg     86100
     ccgggataga gatcgccagc catggaggta acatccggat tgatggcccc tagcagcttt     86160
     gtcatccgcg tgtatgccgt gttggtgatg actgcgaaag ggcgcttggg aatatagatg     86220
     ttgccgggac cgcgcttcac cgtcgtgtcg atgatcttgt ccgcgatttc ggtgagcgct     86280
     tcgtcccagg agatgcgctt ccatttgcgc tcaccgcgtt cgccgacgcg cttgagcggc     86340
     cacttgatat ggtccggctg ctttgaccag gaacagtaca ccgccccctt ttggcaaccg     86400
     cgcggattca tgtccggaat gccgggcagt tgcgggtact tgctgatttg ctcctcgcgc     86460
     atcgggatac cgttcttcac gaacacattc caggcacaac cagcgacgca gccattggag     86520
     tgcgtcatga cgccaactga atcccaggtc cactcctttc ggtaaaggtc ttcccagtcg     86580
     cggtaggggt agtctttcag cggatcctcg atgggctgga tctttgaaaa ggcccacaga     86640
     ctgggggatg cggccgcact ggcaagcgcg gccgcagaga actgtagaaa ccggcggcgg     86700
     ccgttgtgct catcgggact attcatgacg attcctcatt tgatggactc caggttgcaa     86760
     acatgtcggc tgcttttgac agtgaaatag acaggagcca tgcgactctt gtttccaaaa     86820
     tatcgggaag ctgggcacga tgcttgcaac tcccctctca ccatgcctat ttcaaaaaca     86880
     tggttttgtc gttcaaaagg agaaaaaata tagtgttaag tttcggagaa actcttgact     86940
     taaatcaaac acataaaaaa ggagaaatac gaagattcgt gcactttccg cttgctcggc     87000
     gaccaagccg cccagcggat tccgattctt aacactggag tacatcatga aagttcgttg     87060
     cgtttcctta gtcgccgcag ggctcctcac catcgcaggc agcgcaatcg gccaaccggc     87120
     tccagcgccc atgcccgcga tggcaccagc cgcaaagccg gccatgaata ccccagttga     87180
     tcgggcgaag atactcagcg cgccaggcgt gtttgcggcg ttctcaactt acaaaattcg     87240
     tcccgactac ttcaaagttg cattggctga acgcaaaggt gcagcagatg aagtgatggc     87300
     ggtcttggaa aagcacaaag aaaaagtgat tgtcgacgcc tacctgacgc gcggctatga     87360
     agccaagagc gactacttcc tgcgcgttca tgcctacgat gccgtagcgg cgcaggcctt     87420
     tctggtcgat ttccgcgcca cccgctttgg catgtactcg gatgtcacgg agagcctggt     87480
     gggtatcacc aaggcgctaa actatatctc caaggacaag tcgcccgacc tcaacaaggg     87540
     gctttccggt gctacctacg ccggtgatgc accgcgcttt gccttcatga ttccggtcaa     87600
     gaaaaacgct gattggtgga acctgacgga cgagcagcgc ctcaaggaga tggagactca     87660
     tacgcttccg acgctggcct ttctggtcaa cgtcaagcgc aagctctacc actcgacggg     87720
     gctcgacgat accgatttta ttacctactt cgagaccaac gacctcggag ccttcaacaa     87780
     cctgatgctg tcgctggcca aggtgccgga gaacaagtat cacgtgcgct ggggcaatcc     87840
     gaccgtgctg ggtaccatcc agcccatcga gaacctcgtc aagacgctgt cgatgggcaa     87900
     ttgatggctt gaatgttcgg ccaccaggaa catggtggcc gaacgaatcg aggcgtaaat     87960
     ggcttcaata gccaaactgg acacgctgag tatcggccca gcctgatacg gttcttcaaa     88020
     cattcgcaaa ggagttaagc atgaacaaga tcgccgcaat tcttctctct attggttttc     88080
     tgtcaattgc tgacggggct ttggcgcaag atggcatgaa aaaagacact atggccaagg     88140
     aaagcatggc gaaagaggcc atgaccaagg atgacatgaa aaaacctacc atgggcaagg     88200
     acgcaatggc taaggacggc atgatgaaaa aagatgggat gaagaagggc gccatgccca     88260
     aggatgccat ggctaaggaa ggcatggaaa agggtgccat gatgggcaag ggtgaaatga     88320
     agaaataagc cgtccgttgt ttcgaagcga cacaaagttc gatagcggca ctggctggcc     88380
     aagtttcttc aatccggtca agggggcgat caccgagcat gtcgatgact cgcacggcat     88440
     gcggagagtc gaggtgagga gcgccagttc cggcatccat ttgggacatg tttttgacga     88500
     cggacctccg cctacccaca aacgttactg catcaacggc aatgtgctca agttcgtgcc     88560
     agacaatgcc aaatgaagaa attgatatcc tgttatcagg cctaagaaga cgtaggttag     88620
     aactcgacct ttcgcgctct tgagattgtg ccatatttgt aatggctaac tggtgttgga     88680
     gatgcgtatg aaagcagaag gaagaatatt ttcagtggcg gactatgttc gcccctctga     88740
     tagcgaaccg attcgatcag tggttctgga aaccgaggac tcagcgattg ttgtatggca     88800
     tgcccatcct gggcaagaaa tagccgctca tgtccatcca catggtcaag atacttggac     88860
     cgtcatctct ggtgcggctg actattatct tgggagtggc atgaccacgc atcttgtggc     88920
     gggagacatc gccatagcaa aacctgggca ggtgcatggt gctcttaaca ttggttccgt     88980
     gccattcata tttgtctcgg tggttgcttc tggcaatgca ggatttgcat tggctgaaaa     89040
     atagataccc cctatcgcgc aaaaagctcg gcaggctggg ataatatccc agcattcttt     89100
     gagtgaggat agttgggatt gcatcccagc ctattacttt gcccggtggc ttcgtgccat     89160
     gctgcttgat tctgggccag ataccgcttt tgtgatggtt aagcacttgg tgaccggcgg     89220
     ctttcaggcg gcgaatttac aaggttgagt ggccgatttg ggtcgttatg ctgaccactc     89280
     gattatgtgg agtagcctga gtgccatgtt gccaaagcat tgctacaagg gctttcccat     89340
     cggttgatgt aacaaaaagg tcgacataat ttctgcggtg gtctgaagtg gttgttccac     89400
     ttcaggagac cgttatgaat accaccacta cacaccggga cgggccaagc gcacggccat     89460
     ctgcgtcatt cacgaaccac gttgccgagg aactgctgcg ctacgacgaa cacctgtgca     89520
     atgtacgagg gctggcggca agatcgcgcc aaaacaacct tcgtatcgtg ggctggttgc     89580
     tacaacagaa atttgctgag tgcccagtcg aaattgccaa gctacgcccc gaggatgtgc     89640
     gccgcttcct cgccagtcag ttggatgcgc accgaacaac ctccaatgca tcccacttgg     89700
     catcatcact gcggagctat ttccgctacc gtaccacctg tggtgatcgg gtcgatgcac     89760
     tgaccgcagt aatctcttcg cccgtcaact ggaggctggc gaccataccg cgcgcgctca     89820
     agcccgacga ggtcgagcgc ctgctgaact acttcactgc caacctgcgc ttaccaaaac     89880
     gtgattatgc cattgtgcgt tgcgcattgg acatgggatt gagagccggc gaaatcgctc     89940
     atctcatgat cagcgacatt gactggcgtg ctggcacggt aatgctgcga gggacgaaat     90000
     cgctacggca ggacatcatg ccattgccga tgaaaaccgg gcaggcactg gccgattatc     90060
     tgcaacatga gcgacctgcc acccgtaacc ctgccatctt cgtccgacag aaggaagggc     90120
     gagactgccc catcacctcc atggcgatac agaaggtgat caagcacgcc tgctgccgtg     90180
     ttggtctacc acattccagc gcacatgcac ttcggcatac tctggcgtgt cgccttgttg     90240
     agaacggcag ttcgctcaag gaagtcgccg acctgctgcg tcaccggtcg ttgaacacca     90300
     ccctgatcta cgccaagctc gacacgctgc gtattccacg caaactggac agccagtcca     90360
     cggcaaactg gacagtcgga gcgtagcgac gcgggggtta tagttttact ctgaaacttg     90420
     tttttgggtc aaactatttt tgtgttttct catggattct ccggtcagaa ttaattgatg     90480
     agcgttgtga accaggcgat ccagaatggc gtcagccaag gtggggtcgc cgatggattc     90540
     atgccagttc gccaccggca attgactggt tacgatggtt gaacggtggc cgtgccggtc     90600
     gtcaaagatt tccagcaagt cacgtcgcgc ggagtcggtc agtaacgcca atccccagtc     90660
     gtccaatagc agcacatcgg tcttggcgag ttgcatcatc agcttgccgt aacgcccgtc     90720
     cccatgagca atcgccacat cctcgaacaa tcgcggcacc cgcaggtaaa gcaccgattt     90780
     gccctgacgg cacgcttggt tggccagagc gcaggccagc caagtcttgc cgacgcccgt     90840
     ggggcctgtg atcagcacat tctggtgttc tgctacccac gagccggtca atagccggtt     90900
     gaataaggtg cggtccaggc ttcgtgctgc gcggtagtcc acgtcctcgg caacggctgc     90960
     ctgtttgagc tttgcacgcc gtagccggcc ggaagttagt cgggaatcac gctcagtgac     91020
     ttcgcgctca accaagaggc cgaggcgttc ctcgaatgcc agatgcgtaa tgtcgggaat     91080
     ggcctgctgt tcggcgaggg cgcgtgccat tccgaacagg cgtaattgct ggagttggtc     91140
     gtgtgttgga tgattgagca tgggtggttc tcctgtggtg ttaatggtaa tagttcgggc     91200
     cacgcacatt ggcgtgatcc agtggcaggt atgcctgaat ggctatcgcc ggctgttgcc     91260
     ggtccaggcc gttcttgagt attgaatgaa tgctgcggta gcccgccgcg ttcagtttca     91320
     gagcacgagc acacgcagca tttaaacgat cattgccaaa gcccttggcc agacgcagta     91380
     cgccgaggca ggcgcgatag ctttgttgtg gatgcttgcg cgcgcccagc atgactcgca     91440
     ccgcggattc agtggagcta ccaatcttct gtgcccagtc gagcaaccgc gggccattcc     91500
     agccggcaac ggcttggtgt tccgggggca tgtgcgcatc cagcgtggtg tggtgatttt     91560
     tgatcgggct gcgcacgtgt gcggcaatgc gctggcctcg atgaaacacc tccaccgtgg     91620
     tgacggtcat gcgcagctcc aattgcaggc gggaaaggcg gtaaggcacc gagtagtaat     91680
     gctcatcacc ttcaacgtgg taatcaacgc caacgcgcac cttcttccat tcggcgtatt     91740
     catagcggca ttgcgggagg ggattgagcg cagggagatc catctcaagg aaggcgctgt     91800
     ggcggcagcc aggcagtttc ttgaacggcc gctgattcag cgactccaac aattgggcga     91860
     tggcgcggtt ggcttccgcc aaactgaaga agcgttgatt gcgcagccgc gccagtatcc     91920
     agcgttccac aatcagcacg ccgccttcga ccttggcttt gtccttgggc ttgtatggac     91980
     gtgccggcag cactgctacg ccgtaatgcc gggcgaagtc ctgataggtc ggattgagtt     92040
     ccggatcgta gtaggaggca tgtttgacgc ctgacttgag gttgtctggg acaaggatcg     92100
     cagtgacgcc gccaaggaac tcgaaggtgc ggacatggga gccaatccag tccggcagtt     92160
     tctgcgtcca ggtcgcttcg gcataggtgt aattggatgc gccgaggacg gcgacgaaca     92220
     gttgtgcctg gcgaatttca ccagtggcgc catcaatgat cgacagcgtc tggccgacat     92280
     agtcgacaaa cagtttctcg ccgggggtgt gcgtctgccg catgctgacc gacagcttgc     92340
     cggcccactg tcggtaatgt tcgcagaacc aactatatag gtaaccatcc gggtgatccg     92400
     ccttgtattc ctgccacagc aagtcgagcg tgacgctctt cttgcgcatc tctcggtgca     92460
     cccatgccca gtcgggctcc aggcggatga cctccgccga tactgccggc gggaagaggc     92520
     gggactcaat ggcggcgtca tccagcccgt ctggcaaggg ataaccaatg ccagccacac     92580
     gggctcgacg cagatattcc ccgacggtgg tcggcgaggt gccgatgacc agggcgattt     92640
     cacggttggt gcggtcgtgc tcgaaatgca gccgtagtgc ttctgtaatt ttgcgcatgg     92700
     ataacctgtt gttcgccatg tggtctccga agaaaaatct ccgagagtgc cacggttatc     92760
     ccgcgcgcta cgttactatt tttactgtcc agattgctct ggaatcactg tccagtttgc     92820
     cgtggaatcg gtgtccagtt tggtctggaa tacgcactaa ttcagcaggt ggccacggca     92880
     agtggcaaac ttggcgccgt tggagatcaa attgaatcac tggagcgcag agcgatagga     92940
     gcggaaacca gactcgaaga ggcattaaag cggccaacgg cagcgaagaa gaaaagtgaa     93000
     aagccgcacc agcaggactt aattagccgc taagtcctat ttttacacgt atgtcggctg     93060
     tacccgaata ccgaagaaag catgcgacct ccacggtgcg cgctggctct ttgatcttgg     93120
     ctccggctga gggcggcctg gagacaagtc ggcgcgcgta gcggcgcaag atgagatcgg     93180
     ggatgtctgc caggtgctta tgaacgtcca gcgtgtaaag caggtcgatg cgctccagta     93240
     cctcgctgat ttggcgggtt gagtgtttcg ccggtgcagc ccatagccaa ctctgctggg     93300
     tttgtccatc tgggagcagc tctgaaactg aggctcgcca gcgatcaagt gttgctggat     93360
     caacgctggc ggcgatggcg gtgcctgttt caacttcaag ctgggcaagt gccgccgcaa     93420
     tcagtgtccg aattgcccgc tcgtgcacga tcaccagctt gttcttgtac agccattgac     93480
     gcgcccgcac gagtagctga tcgcggtcgg cgcagcgcgc cacttcgtcg cgcagttcac     93540
     gtaccagtga gcggcgctgg tgctcgctca tccactggaa tccaaggacc gtgcaggcta     93600
     cttgttggtg atcgaatagc gtgagcccgc gttcatacat ggctctcagc gaggcgactt     93660
     ctggtgctgc aatgccaagc tcgttgccaa ggtggcgcca caaggctact ggaattaccc     93720
     gaaaggcacc gagcaaacgc ccactcatgc gcaggaaacc aatatggagc gccagaccaa     93780
     gcttgtggga atcacctcgg cgtgcattga ttgcgtcgcg ctcggcacca tcgaaggtga     93840
     aaaatgcctt catctcgaag tcgctgatat cgcgggggag cccacgcatc cccaaaaacg     93900
     ttgtgtgcca accctgcatc gtgaacctca aaagtgggag gccaccatac ccgtttacaa     93960
     agcgaacagg aaagtcaatg aaatcaacga tctacccaga ccacccccgc gccagtgcta     94020
     gctttgcgta ccgtcactta ttgcactgaa aacgagggga ccccttgtac tgaaaatgag     94080
     gtgagggaat ggtggtgatc aatatccagg gcgttttaag ccagattggc tctcagttcg     94140
     cctgaggttt tatgcgaacc gtttaggttt gcgcaccgtt ttcgagcaac gaagtcggat     94200
     cgcggggttc aagcctgggg acctgcgggc tgctggtcgc cgggggcttt gggcgtaatg     94260
     cgccttgatt tgatcgttct tgaggcgagt tctgtcccct ggcttgcaat acttcggaca     94320
     tgcatgcctt ccggagtttc gaggacgctc ggtgtcatgg gtttgtgccc gctgtggctt     94380
     cgcgggccta cgggcattac agaggctgca ccattgctgg cttcgacatg agtaacatgc     94440
     gtcgccttgg tctggttttc tgcctccgag ccatcattcc cgaggagttc acttccaatt     94500
     acatgggggt aacttccgac acgtattttg gtgtctccga accggttcgc atccttgcgc     94560
     gagaaaacgc ctcgcgaaac cagggcgcga tgaatgatca ggagcccaag gtcattcaga     94620
     tgttttcgga acaggtgctt gctggggcgc gtgacggatc tcgccaatgg ataaaccagt     94680
     ggttcgtgta tcaccccaag gccgttgagc aggctttact gcatcaaaaa caggtgcggg     94740
     cacagatcgc gtcaacatga cgcggctccc ctgagtacaa gttatccaca ttttctgtgg     94800
     ataaattact cgccagtgag ttcgatgcta gataggactt agctcagggt tccctgcgca     94860
     aatatgaggc aacgtgcgcg tacggtattt cagcctgcca actccttttc cattgcctca     94920
     tatagatcgt cctcgtcggc gttcgtgtag atcgtcgtgg tcgataggct tgcgtgcccg     94980
     aggaggcgct gcagcatgtg caggggcatg gcctcggcag agtgcgatcc tcgggtgtgc     95040
     cgcagccagt gcgtgctggc ctgggctacc ttgtgtgcat cctcgaagtg ttcctgtttc     95100
     ctcatctcgg tggccacatc ggcgaagaat cgcttgaggg tcttgtagag catgctggag     95160
     gagagggcgt ggccatcgcc ccccaggctg gcgatcagcg gggtctctgc gtcaatctcg     95220
     ttcaggtgcg tgagggggtt ggggaggcct cgggcggcaa agtatttcgc catctcctgc     95280
     atgaccggcg agggcacggg aacaactcgc cacttctgac ccttgcccag cgtcttcagc     95340
     atccagcgaa ggcccatgcc gctcttgcgt tccttggcgt aaaggcggcc agctttcgca     95400
     tcaacgagct cggaaaggcg caggccggtg gcgtaagcga gagccaggat aaagcgcaat     95460
     ctctgggtgc gctcttcatc gggctgccgg tccttgaact cagtgatgaa atcccactga     95520
     ccgcgcgaaa gtgcatgcgt gagctcaatg tcgggcgatg ctccggcaac ctcaatgttc     95580
     ggtttggcca cgccgtcgaa cggattggag tcgaggtagc gcatcttagt gagccattca     95640
     cacaggctct tcaggatgac gtagctttgc tgttgcgagc gaagggagag ggccccttca     95700
     tacgggcgcc agtccggcga ccagcgggcc gtgttgcgag gccctaacca tttttcttgt     95760
     gggatcttcc atcgccagta cccctcgggc gtgcgcccca gcgcgtacag ccactcctgg     95820
     tgcgccgagg catcttcgac ggagagcgac gaaagggctt tgccgcgttc cagaaccgcc     95880
     cacagcagca ggcgttcggc ctcgcgccgg tatgaacggc gagtgtgcgc gttgcgcgag     95940
     accgccacca gccatgcatt gatggcctgg tagtcgttga ccgcttcgat gcggctacga     96000
     cccaggtagc ggttttctcc ctgcacgccg tcgaggagcg ctggaacgag gaaggactcc     96060
     agcggcatga tgtccgtgcg cgcgggccgc acgttgtctt gtgacgcgag gccgcgggcg     96120
     ccaagaaggg ctgtttcgtc gatcgcgggg aggctctcac cgtgagactt gatccaggcc     96180
     accagcctac ccgcttgaat ggtcccgagc tggcgaatgt cgttgtacca gcgttggccg     96240
     tgggcattga tgtgctcgat cagcgcctgc agatttggca ggccgttcgt gatgagccgt     96300
     tcggccatgg gcctgtcgaa ccactcgatc acgttgtcgg tcggcagggg cgctgtggcc     96360
     acatgcgatt cggcccagtt gatcgcctcg atttggcgca cgatcaggcg ctcgatgcgc     96420
     tgctctcgtg gagacttggc tgcctcctgg gcttctgggt actcagcgag gtagatttcc     96480
     aggaggtcgg cctcagagta gaagtaatcg ggatcgcgct cgacccgaaa atcctccagt     96540
     gtcggcaggg cagggggagg ggcttcgtct ctggcctgat tggggatttg gatgcgcagc     96600
     aggcgtacgt agctcatgcg gccgtggcgg cgcgcagcgc ggatcaaggc ctcgcgcatc     96660
     cacttgatcg tggacttggc ctcacgcaga tccatgccct caccaaagta gcgatcggcg     96720
     gcgtgacgca gatccattcc ctgtagccag gcccggtaga aggctaggtg cgagaggtcg     96780
     attttgcgat cagcggggga catgatcggg atccatcaag gatggtgtca taaggagccg     96840
     agaccggtaa ctgccgcaag cagaaaccac ggcgcgcatc aggcggcagc cagtgcgctt     96900
     cgttggcttg aagcgagttt ggtggccgct ttgagcgact gcagggggcc tccccactgg     96960
     ctgtctgcga tgtgctgggt ttcacttcgt gtgactcgta cttgccaacc gcagacgctg     97020
     cggtgcacga aagctggaac ctcgaaatat tggccgtcga tctcagccat gcgcagaatg     97080
     cggatggtgt gtcgtgcttg catcgtcatg ccttcggttt tcagtcggag agctcgcgta     97140
     ggtcgcgctc gatctgagcc atcatggcca cccactggct gcccgctcga tcaatcgcct     97200
     cggccaaggt gtagcccatt tcctgcagcc actccggttt attgagcacc agggcgacgg     97260
     cgactttttc gccggttgac tgcaccgccc atgcatcacg gccaccgcgc agcgcgtcct     97320
     tggccttacc gagaaagtgc tggtactcgg agggttccgg tggtgttgct gagcggacga     97380
     cgccttgatt cgccatcttg actgcccagt cgattttttc gtcttcgccg agcgagtccc     97440
     actggttgtg ttcgtccgcc tggatgttcc agaagtgcat tacgacgttg agcgggttag     97500
     gcatgggatc accttggttt atgtttaggt tacatgatac cttgcgtgtt actcggtatc     97560
     aagggaaccg aagcgggctt cgtgagcctg agcatgtcat ggacaacctg aaactcgctg     97620
     ggcctcacga catcgcccag tgagccgtca tctttgaccc atctcaggcg ctctttgtcg     97680
     ggcgtgagga agagcacctt gccgtagaac ggtgggtagt gctgcgcctt gttgacggca     97740
     tctttcgtgt cctgcttggt ttcgatcagg cgctgcatgg gcggttcgcc tgattcatgc     97800
     gtcacgcaga ccacgaagtc ggggtagaag tagtgctcat gttccgcgcg aacgactcgc     97860
     accgagtacg gctttttgtc cgggtttcga tgccaccaat gcacgaattc agcttcgtca     97920
     aggcaggagg cgaaggattg ttccagcgtg ttgagccgag tcgcgccgtc gtagcgtccg     97980
     atgctcatca cagcgccgtc atcaagctcg aatcgctgtt cttcccacca gcggcgttga     98040
     tccatgaaaa ggacggattc aacgtctgcc gtgctctcct tggagggagg aagaacgccg     98100
     tagatgttct tggatgaacc gatgagcggg agctcgttcg gaaagatcat gacatccggc     98160
     agaggttgcg catcgatcag ctttgcctga tcgacgatgg ccttgaaaat tgcttctttc     98220
     aactccggcg cgctctggcg gattacccaa tgggcggcgt ctcgtgccag gcgtacccgc     98280
     atggatggtg aggctgcgtc atcgggagat tcagcgaggg ttgcatccac ggtagggcgc     98340
     aggcgctcgc tcagtgtgtt gacgatgatg cgatagtcct cttcttcggc gtgaggcaac     98400
     gactgcagcg cattttgggc ttcgcgtgcg agggcggctc ggtctgtcac tacatggatg     98460
     tcctgcgtgt agctcttgcc ttgcgtgagc tccttgtgtt tttctttctg ctgcgtgcga     98520
     ttgagcgcgg cctcaactgc tgcttgtgcc agcaaatcgc ttatgggcag ggctcgcgcg     98580
     atctgtagcg agatgccgga gaggttgacg atgaatggct tctcttcgga cttgagcgaa     98640
     cctttgagcg cgggcaggcc gcggcgaaga gggaatgcct tgagtccgtt ttctgcgagg     98700
     cactgcaata cctgatcacg ggttctgggt cgttgcagcg gcgctggtgg cgtcttggga     98760
     agtgagctcg tatcgacggt atccagtgtc cagccagcgt ctcccagcag gtcctgctgc     98820
     aatgggtccg taggtacggg tgggtgccaa ccggaacctg atagcgtggg tgcggggccg     98880
     gcaggagagt catcttcatc gctggcgggc aaccccatgg tgtagctcag tggcgtctcg     98940
     ggcgttgggc ggttcgtgag cttgaccgcg ccgttcatgg tccgagcggc gatgagtttt     99000
     tcgctttggc cttcgagctg ggtgcggaca gcgctggtgg actggactgc agcctcaaac     99060
     cctgcttgag cctgggcgtt gccaaggtac acgtaggccg tgtccagatc ctctggaatc     99120
     ggtatgggct tggggaattt ttctcgaatc tggcgcgaga cgcgcatcac gcggccgatg     99180
     aactgcatgg caaagtcttc gtcgttgacc ggcttgaggc tggcgagcac gaaggcgcgg     99240
     ggtgcatcaa atccagtgcc tgccgattgc ttgaacacga gcacgtgctt ggtcgggtcg     99300
     ttggcgatct gggccatcag gacaggatcg ggtttgtcgg cggtgtgcgt gccgatggct     99360
     tcgggcggca ccttgcacaa ccgcgtgagc tcctgagcgg cttcttcgac ggaattggca     99420
     ccgttggcca cttgcaccag caggagggga acacagggaa ccccggcctc gcgcaggcgg     99480
     tacccaatga gggcgttgcg catccatgcc tggcgcaaaa ccgtgcggcg aagatctgtc     99540
     acctgctgca tgttctcacc aatgctgtag atgaccgctt cgatgtactg cttgttcagg     99600
     cgggccttca ccacgtcgtc acggcttacg gaaaagtgct cctggccgat tcgaccagcg     99660
     gacgccagaa agtccgtcag acgctgatcc ttgggtgtgg ctgttgccat cagcatgtag     99720
     tccgggttga gccagcgcgc gaacttgccg aattccgtgc tgtggtccag tccgatgtgc     99780
     gcttcgtcaa ccacgagacc aatttgcagc tctttcgcgc gcgcacgggc cacgactgcc     99840
     gccaaggtgc gtacgtcgtc gtctgcgtct gcgtcgtagc cttgcgtgcg ccattgggcg     99900
     cgcgacaccg cctgagcagt ggaaatgagg acggcgccag agcctagatt ttgattgcga     99960
     ccttgtgcca aggtcgtcgg cgccagaccc tgcgcatgtt gcagcagcga atccagcgtc    100020
     tgactgacga gggtgacgaa aggcacgaac caaaaccaca gaaccgggcg ctcatccgac    100080
     acgcgctcaa gaaccttggc catgacgaat gttttgcccg aaccggtggg tgcgcgcagc    100140
     aggcagggag gggagggcga acgaagcagc ttggcgctga tgttcttcac aagtttcccc    100200
     tggaattcct caggctgaag tgagtgcgcc gtgacggcca gatcaagtgc gccctggagc    100260
     atggcgtggg tgtttgtagt agtcgtcatg catgctctcc ggcgcggtgt tcaatggcat    100320
     tgcgcagcga atagacctgc gcctgaatgc ctcgctccga aagatatgct gacaacgatt    100380
     tgggtctggg tgcatagacc acgaggcgcg agacaccatg cagagaaggc agggccgtca    100440
     actgctccaa cgtgtcttca ttgaccatgc tgcacaacac cagcagccag tcgttgccct    100500
     tcgctacgat gcgcatttcc tgcttttgct gcgtgacctg cacggcgctg gcatggcgca    100560
     tggcgagcat ggtggacgcg tgatcaggtt tggcatcgag agccagatca gcaggatcga    100620
     gcttgtccag ttggaggtag gcgaactcgc cgccacgttc aatgggcacg ccgtcgttgt    100680
     tgccgtagcc ttcgatgacc cgacgaaggc gttctgcgca tacgtcacgg cacaagttct    100740
     tgtcaggctc cttgtcgttg gcttcggtgc tcgaacacag gataaatcgg cgcttgcctc    100800
     ggtcttgagc attcaactcc agcacgactt gaccggtggt gccagagccg gcaaagaagt    100860
     caagcacgat gtcgtcaggt cggctggctt gctcaagcag gcctttgatg agtgaaaccg    100920
     gcttcgggtg ctggaaggcc ttcgagccca gaatttgttt cacctcatca gtagcaatcc    100980
     ctccgcgagg ggagcgcaac atcatgagat cgtcgtcgtc ttcccccacg tcttcattga    101040
     caccggcaat ccaactgctc aaaggagcga ggcgttccga ttcgggcttg tccgtccagt    101100
     gttcctttct tgagggacga cccggtgcaa tgggtttgcc gatccaaaaa tccaaattcg    101160
     ggagatcggc acggagtagc ggtgtttttt tctttggaag caccggcccc ttgcctgcct    101220
     tgatggctgc aaggagctcc tgcatgcttg agaagaacaa cacgtcttca tgcttgcatg    101280
     gagggaagta gatcttgcgc ttggcaatca gcgtctcaat ggtgtcgctt cgcaaactgg    101340
     ccagtgcagc tcgaacggcg gtttcgtccc cgtataaacg tcgtattacg gtttcggagg    101400
     caaatcgcca ggtgctgtcg ggatcgcatg gataccagta cccggtttcg ggatcctgga    101460
     tggggtagta ggtgtttggc cgttcaatca aagacttgtt ggctgtaagc ggctgtggcg    101520
     accaatcccc ccgttcatcc ctgtctggat tgcgaaactt gctgcgattt gtgggcctcc    101580
     cattgaaggc aaagccgcta ttggcgtaca ccagcacgtg ttcgtgtaca tggctgaagc    101640
     gctgcgtcag gtcgttgccc gtgtccttgg tgcgccagac caggctgccc agccgccgcc    101700
     ccggaaacac ctcgtccatc agcagttcca gccgcgcccg gttttcgtcg ttgatgctca    101760
     ccagtatcac gccgtcgctg gtcatcaagt cacgcgcaag cgtcaagcgc tggtacagaa    101820
     actccagcca caggctgtgg cgccatcggt cgtttttgcc gacgaactgg tcgttgtaaa    101880
     cccagtcttt gttgccggtg ttgtatggcg ggtcgatgta gatgacccgg atcttccccg    101940
     cgtgggtggc gcgaagtagc cgcagcgcat cgaagttgtc accctcaatg accaggttgc    102000
     gatgttcatt gcatccgttg ggcttgtggc tccactgcgg caccagccgt ggaagcacca    102060
     cgtcggcgtt cagcgcgcgg tcgtggtcga tcgcattgcg ctcccagtac agaccgagtt    102120
     tctgcttcgt caggtgttca acgagcaggc gacgcagttc aacttcgcta aggccatcga    102180
     gactttgcag caggcccttg ttgtcattcg gcatcaaatc attccaatca cgagtaggag    102240
     cgcgcgctca acggccttca tgcgatcgtc atcgagacgg ccgaagggct cgctgagctt    102300
     gttgcgtggc agggtcgaaa tcttgtcggc catcacctgt gaaagcacac gcagcccatt    102360
     ggccgggttc ggctcaacag tcacgcgaaa cgttgcgtca cgtagctcgc tggtgatcgg    102420
     gcagagcacg acgctttgca agccttcgag cagatcggac tggatgacca gagctgggcg    102480
     cggtttgccg tagtcccctt ggatggaaac agcaacaatg tcgccgcgtt gggtcattcc    102540
     cagccctcta tgagctcagc ggctgattgc gtaaacctca aggcttgttc ttcctgagga    102600
     tcctcggcta agcgctggca ttgctcgcgt acacgtgcca tgaattcggc cgaacgggtg    102660
     tcagggaccc agaactgcac tagccgcagg cctgaggcgc gcatgcgctc acggtagcgc    102720
     gctaccttgt ctatcgaaga tgcggaggtc gccatgggat ggtcctttcc ggagttggtt    102780
     acatgctacc atgactgaaa taatttcata ttgacgattg ggagcggcga atgcccagaa    102840
     aacgcaagtc cagcggcctt gacgatctgt tggcccttgc ggcgatgcta ccgtggtggc    102900
     tcgcggtcgc gctcgctgtg ctggcctatg cagtcctgca ccactacgcg ggcgggcaag    102960
     cggtggcaac acccgcgcag cctgggcaac tggcgctgga tcatctgctc aagatgctgg    103020
     ccaccattgg ccagtacctt gttcctgccg ttttcttgct cggtgcgctt gtctctgtct    103080
     tgggcaggcg ccatcggcag cgtctggtgg ctcaggtctg gcgcagcgat gacggcgagg    103140
     cgctgcgcgc catgggctgg cgagattttg agcgtctggt gggcgaggcc ttccggctgc    103200
     gcggctacga cgtcatcgaa acagggggtg gcggcgccga tggcggcatc gatctcaaac    103260
     tcaagcgtgc gagcgaaacc ttcctcgtgc agtgcaagca ttggcaggcc gacaaggtgc    103320
     cggtcaatgt ggtgcgcgag ctctacggcg tgatgtccgc acagggcgca agcggcggat    103380
     tcgtcgtcac ttcgggcgtg ttcacggccg atgctcgcga gttcgcccga gggtgcaacg    103440
     tcgagctgat cgatggccca gcgctcaaga agatgatcga cgccgcgcag ggtgcggcgg    103500
     atgaaggcgc tagcgccgct gtggtggcta cgacgattga gcccagttgc ccacgttgcg    103560
     gtagcgcgat gatcaggcgc gtggccaaat caggcgcgca tgcggggcgc gagttctggg    103620
     ggtgcgtgtc ctatcccaag tgcagaggcg tgcggccctt ggattagggc cgtagggacg    103680
     gcaattacag cgccgcgtcc ttgagcttct tgagcgcgcg cgccttgatg cgaaccgatg    103740
     ccggcttggc ggcaaacacc tgttcttcct tggtgaacgg gttgatgccc ttgcgcttcg    103800
     gtttggccgg gatcttctgc acttcgatct tgagcaggcc ggggagggtg aacgcctgcg    103860
     ctcccttctt gttcaccgag cccagcatgg cgccctcaag cgctgcgagc acggccttca    103920
     ccgatttggc atccacgccc gtccgctcgg ccagcaaagc tgtcagcgat gtcttggtca    103980
     gcacatcctt gatgggcttg atcgacggag cagccttggg tgcggcggtc tttgcgggtt    104040
     ttttggaggt ggccatatcg tctttgggtt gggtttcaga aaaaacacgc cggagagccc    104100
     cgcgcgcgct cgcgaattgt agaaggcgct gaaccgttaa gctcgcctat ctgccgggtt    104160
     gactcaagac tgcggcagag cctttcgtct gtagtcccat tggaattgcc ctcatggcca    104220
     atatcgcctc tgtcctcaaa gccgagatct cgcgcattgc tcgcaaggaa gcccgcgctg    104280
     aagtcgaaag tttgaagaaa gccaatgcgc tgcaccgcag cgcgatcgcg ggcctgcggc    104340
     gtgagctggc ctcgctgcaa aagcagttga aacaggcaca gcgcgagcgc acccctcgcg    104400
     ccgcgaaaga acagaccacc gatcgccaat atcggttcag tgccacgcgt ctggcggcgc    104460
     accgagccaa gctcggggtg tcagcggccg actatggacg gctgatcggt atgagtggcg    104520
     cgaccgtcta tctctgggag caaagcaagg caaggccgcg gccggagcag gtgcagcagt    104580
     tgggcatgct caaggagatg agtcgcaagg tgatcctgga gcgattggag cagaccaaag    104640
     tagccaaggc tccgaaggcc gaatgagccc tcgttcctaa atggcgagcc ctgccttgca    104700
     gatctgaacg actttcgcgc acgccggcgc gtccatccac gaaatgtggg ccttggtttg    104760
     gcccatggcc ttggccagcg cctggtaggc gcgcgagcgg gcctttcccc ctttgccttg    104820
     ccatagcgga tcgaacgcat catgggcggc gcggcgagcc cgcatcgttg cgtcatcagc    104880
     caaggtgcca agaggcagat ccgtcccagg gtgacacccg acccgggcgc ggcacccctt    104940
     gcagcggtag gtcagaggcc agccgaagac gcgcccatag atgacttcgt tgctcacgag    105000
     ctccacggct ctgccgcagt aatggcagcg ttcgggcggt tcaaggaaat ccttcacgcg    105060
     cgcgattgcc tcgggggcat tgatgggcag gcccatgaag cgcgagggct ggcgcgcggc    105120
     ggcgtgtgtc actgagtttt gaatttccgg cattttgcgt cgttgagttc tgagttcgtc    105180
     gggaggccca gtggctgtct gccagcccgt gcgggcattg ggtttttggc gcatgtgatc    105240
     caaaagcgac gttttagatt taaaatcttg atgtcatgat tatatgagtt atcatgactc    105300
     aaagatcata aaattcttga aatagggcac cctgcgccct caggagcaac gaaatggggg    105360
     tctcctcgtt ttcagtgcaa taagtgacgg tacgcaaagc tagcactggc gcgggggtgg    105420
     tctgggtaga ccgttgattt cattgacttt cctgttcgct ttgtaaacgg gtatggtggc    105480
     ctcccacttt tgaggttcac gatgcagggt tggcacacaa cgtttttggg gatgcgtggg    105540
     ctcccccgcg atatcagcga cttcgagatg aaggcatttt tcaccttcga tggtgccgag    105600
     cgcgacgcaa tcaatgcacg ccgaggtgat tcccacaagc ttggtctggc gctccatatt    105660
     ggtttcctgc gcatgagtgg gcgtttgctc ggtgcctttc gggtaattcc agtagccttg    105720
     tggcgccacc ttggcaacga gcttggcatt gcagcaccag aagtcgcctc gctgagagcc    105780
     atgtatgaac gcgggcgcac gctattcgat caccaacaag tagcctgcac ggtccttgga    105840
     ttccagtgga tgagcgagca ccagcgccgc tcactggtac gtgaactgcg cgacgaagtg    105900
     gcgcgctgcg ccgaccgcga tcagctactc gtgcgggcgc gtcaatggct gtacaagaac    105960
     aagctggtga tcgtgcacga gcgggcaatt cggacactga ttgcggcggc acttgcccag    106020
     cttgaagttg aaacaggcac cgccatcgcc gccagcgttg atccagcaac acttgatcgc    106080
     tggcgagcct cagtttcaga gctgcgccca gatggacaaa cccagcagag ttggctatgg    106140
     gctgcaccgg cgaaacactc aacccgccaa atcagcgagg tactggagcg catcgacctg    106200
     ctttacacgc tggacgttca taagcacctg gcagacatcc ccgatctcat cttgcgccgc    106260
     tacgcgcgcc gacttgtctc caggccgccc tcagccggag ccaagatcaa agagccagcg    106320
     cgcaccgtgg aggtcgcatg ctttcttcgg tattgcctgt tcaccaccac agaccagttg    106380
     atccttatgg tgcagcgccg gatcgccgat ctgtggcgtc aggctgccgc cgatgtcccc    106440
     gctaccgtca attgggccgc aatgtacaaa acgctgctcg gcgaacttgt tgccttgagc    106500
     gcgcaaggtg cggtgccaga tgctgagttg cgtgcccgtc ttgaagcctt gatcaccgaa    106560
     acccagaaac gcaaaccacc gagcagggcc tccctggtcc gcgagggatt gattgatgga    106620
     attcgccccg tgcggtcgtt gctcgtcgcc attgcaaagc tgccctggca ggccaccggc    106680
     gagcatcctg ccatcgagta ccttgccaag ctgcaagctt tatatctcaa aggatccaga    106740
     aagctgccag ttgaagtggt ggcaccaagt ctgggaatga tctggcaggt ttcgatctcc    106800
     agcccagacc gggaacgggc gtttcaggcg ttggaggtgg ccaccctgtt tgccctgcgc    106860
     cgcgcggtgc gcaatggctc ggtctggatt gagcacagcc tgagctttcg gggtcgtgcg    106920
     cgcttgttct tcacggacga gcgttggcag gcagagtcca agaaacacta tgcccgtcta    106980
     tcgttaccca gcaaggctgc cactttcttg aagcctttgc tggccagagt aactgccggt    107040
     gtcgatgcgg tggccgctgc agcccgcagt ggcgtactgc gcgtggatga tgaactccat    107100
     ttgtcgccat tgcccgcaga ggacgaagac ccagaagtga ccaagctgcg cgcggctttg    107160
     gatcaccgca tcggtgaggt tcaattgccg gaagtgattc tggccgttga cgcccaggtg    107220
     cgctttagct ggatcatggg gttctaagcc ggaaccgccg aaaattccgt cagccgatca    107280
     acgtggcttg tcccgcgccc ggtcgatggg gtagacccaa cagtcgtgtc actagccgcc    107340
     atttcgatca cggcaatgcc agccggacgt cacgtccaga ttgttccggt ctggatgagg    107400
     ccgactgacg tctcggatga cgggtggcat acaactgctg tgagtcctgc aggggggcag    107460
     ctgcctgacc ggacggcgag catcagccca tctcatgtat tagtcatgtc agctttgaca    107520
     ctgcgcacgc gacggcaccc gacccgttgc agacccccag acatatggaa agctgacgct    107580
     caacgtggag ttagccggcg cggcgcggct tcatcgcgca gcgtccgtgt tgatggatgg    107640
     gttagaactc tctggggcac acatttgaga aagactattt ttcagccaac gcaaaacccg    107700
     cgttgccaga tgcaaccact gagacaaata caaacggcac tggactagta tttagagcgc    107760
     catgcacttg gccaggtttt gctatggcaa tatctccagc ctttagatga gcgactttgc    107820
     cgcctccttg gtaatactca gcctctccag agataaccgt ccaagtatct tggccgtccg    107880
     ggtgaacatg agcggttatt tcttgcccag gatgggcatg ccaaacaaca actgctgagt    107940
     ccttggtttc cagaaccact gaacgaattg gttcgccgtc agacggacga atatattctg    108000
     ttaccgaaaa tattcttgat tccatttcca tatccactcc aaaaatcaat ttagcttgag    108060
     aagttattac agaacaactg tatccgagag ttctacgttg ccgataaccg gcccgaaacg    108120
     gcggcgcaac gcgccgctgt tgggggtccg tgttcatcgg cgggttagac ctgtgcttgc    108180
     gtaagacgaa tatcgacttc tcggtcgacg tattttccat tcctctgacg cacgcagttc    108240
     ggaaagcagc ctgttgaact caacctcatg aattggcgcg tattcgaacc aattcagaaa    108300
     atcgaacggt tcattctctg agaggtcgcg gcagtggtgg agcttgcgcg ctactgcagg    108360
     caaatactga agcccgattt ggacgtgctt cgactgttcg aaaacgctcc ggcgttcgtc    108420
     ttgcgtgagc tcccaccaag ctgcgttctt ccggatcggt attagcgcac cgcacgttgc    108480
     ttctgggcgc gccagacctt gctgcttcgc tacaacttca ttcttctctg cgcgcatgac    108540
     atatcgttca ttgctggtta ttccacgaag tatccagggt gcattggttt cagactgcaa    108600
     ctctgaagcg gatacgacgt tgagcctttt ggcttcaggc aggggctcgc caactctcgt    108660
     ttcggccctg acaatccgcc aagggccaat gtctgcgccg acgaaagcaa ataatcgtgt    108720
     atccatttca atctttcatg tgtgaatgtt ttaactcttg cagcttcgaa gaacctatct    108780
     gccgatcccg tgcttgtgca tcatcgcctc cgcgcaactg cgacgaccgc ccgcagcaat    108840
     cacattgaac tttcgaatcg aaactgctga agcgaaccta cgcggacgta cggccgcagt    108900
     ctgtgcgctg ccggacggag cgctgccaat ttgcgcctac tggcaggctg tgagtgcgcg    108960
     gatgggccag cgacctccct tcatagaggg agcgaagcag gtcagagaca ctattgaacg    109020
     tccgctaccg ggaagatgct tgaccgtccg caactggccg cctgccgccg accgcggtct    109080
     ggctcgaaag cagtctgtca acgcgccgtt tcattgttgc catgatcata tcttaatcgc    109140
     gcacaggcgg ccacaggcgg gcagtatgaa ccagcgtcag tatccacacc gtttcgccgt    109200
     cgatctgata caccaggcga tagctttcgt gcgggatcaa ctcgcgggtc ccgggaatct    109260
     ttcccggctt gcccagcatg gggtgctgga tcaagcgggc ggccgcgtcg ctgaaaatct    109320
     catccatccg ggccgccgcg cgcggattgt cggctgcgat gtagtcccac acatcggcac    109380
     ggtcttgctg cgcttcgggc gtccaaacaa ccctcacgcc tggctcgcca cactggcacg    109440
     ccgtgcggcg aattcggcct caacttcatc gttcgaccgc cccaatccag cgcgcatcga    109500
     agcccggccg gcttcgacct tgcggcgcag gaactcgtcg tactcgcgcg actcgcgctg    109560
     gcgctgaacg aactcgcgca tcagctcgcg cagcacttgc gacgccgggc gatgggccgc    109620
     ctcggcttcg gccataaact cggcgcgcaa ctcaggctcc agcttcatcg tgaaaacggc    109680
     ttgttttgac atgatcgggg cctcctgcca cttgatacta acaaagtata tacgccgtca    109740
     ttactaagcg ctattcacag aacgctgcaa ggcgggcgtg cgctaggcca aggcctgtcg    109800
     gaaaacattt gtttttcgac aggccttcaa cggtcctctg caccaacctc cgagtggccg    109860
     caaaattgtg cggaaaactc tgtcgccaga cgctaccata cggaaacctc gtcttaatgg    109920
     ttttccgctt atgttggtag gttacatgcg cgtgtcgtcg gactccgacc gccagagcac    109980
     gaacttgcag cgcgatgcgc tgctcgccgt cggcgtcgat gcgcggcatc tgttcgagga    110040
     tcatgcttcc ggcgcgaagg acgaccgcgc gggcctggcg cgggcgctcg aattcgttcg    110100
     ccctggcgac gtgttggtcg tgtggaagct cgaccggctc ggccgttcgt tgtcgcactt    110160
     gctcgccatc gtgacctcgc tcaagaaaaa gcaggtggcg ttccgctcgc tgacggagaa    110220
     cctggatacc acgacgccct cgggcgagtt tctgttccag gtgttcggcg cgctcgcgca    110280
     gtacgaacgc gccttgatcc aggaacgtgt cgtcgccggt ctggctgccg cccgcaaacg    110340
     cggccggatc ggcggccggc cgcaggcgat caccggcgag aagctggagg ccatcgtcgc    110400
     tgcgctcgat ggcggcatgt ccaaggcggc ggtgtgccgc aacttcggcg tcaagcgaac    110460
     cacgctgatc gagaccctgg cacgggttgg ttggacgggc tctcgtggag cgtcatcgcg    110520
     atgacgacca agagcgaacg attgaccgtc ctgtcggacg ccgagcagga agccctgtac    110580
     ggcctgccgg acttcgacga cgcccagcgg ctggaatact tggcgttgac tgaaaccgaa    110640
     ctggcgctcg ccagcagccg gcctggtctc catgcccagg tctattgcat cttgcagatc    110700
     ggttacttca aggccaagca tgccttcttc cgcttcgact ggagtgaggt cgagcacgat    110760
     tgcgccttcg tgctgagccg ctacttccac ggcgagtcct tcgagcacaa gccaatctcc    110820
     aagcacgagc actacaccca gcgcgagtgg attgccgatc tgttcggcta ccggccgtgg    110880
     gcggccgagt tcctggcgca gctcgcgcag caggccgcgc agaccgtgcg gcgcgacgtg    110940
     atgccggggt tcatcgccgc cgagctgatc gtctggctaa acgagcacaa gatcatccgg    111000
     cccggctata ccaccctgca agagctggtg agcgaagccc tgtccgccga gcgtcggcgg    111060
     ctggctggcc tgctgtcgga agtgttggac gaatcggcca aggccgcgct gggtcggctt    111120
     ctagtgcgtg acgacaccct gtcgcaattg gcggcgctca agcaggacgc caaggacttt    111180
     ggctggcgtc agatggcccg cgaacgcgaa aagcgcgcca cgctggagcc gctgcaccgg    111240
     atcgccaagg cgctgctgcc caagctcggc gtctcgcagc agaatctgct gtactacgcc    111300
     agcctggcga acttctacac cgtccacgat ctacgcaacc tgaaggccga tcagacctac    111360
     ctctacctgc tttgctatgc ctgggtgcgc taccggcagc tttccgacaa cctggtcgat    111420
     gcgatggcct accacatgaa gcagttggag gacgaaagca gtgcgggcgc aaagcaatcc    111480
     tttgtcgccg agcaggtgcg ccgtcagcaa gacacaccgc gaggtcggcc gcctgctgtc    111540
     gctttacatc gacgacagcg tgcccgatcc cacgccgttc ggcgatgtgc gccagcgcgc    111600
     ctacaaaatc atgccccgcg atacgctgca aaccaccgcg cagcgcatga gcgtgaagcc    111660
     ggtgagcaag ctggctttgc actggcaggc ggtggacggc ctggctgagc gcatccgccg    111720
     ccatcttcgg ccgctgtatg tcgcgctcga cctcgctggc actgatccgg gcagcccgtg    111780
     gctcgtggcg ctggcctggg ccaaggacgt gttcgccaaa cagcagcgcc tatcgcaacg    111840
     gccgctcgcc gaatgtccag cggccacgct gccgaaacgc ttgcgaccgt acctgctgac    111900
     cttcgatgcc gatggcaagc cgacggacct gcatgccgac cgctacgagt tctggctgta    111960
     ccgccaggtc aggaagcgct tccagtcggg tgaactctac ctcgacgaca gcttgcagca    112020
     ccggcatttt tccgacgagc tggtttcgct ggatgagaag gccgccgtgc tggcgcagat    112080
     cgacatcccg ttcctgcggc agccactcga tgcccagctc gatgcgctcg cgaccgagct    112140
     gcgcgctcag tggctggcct tcaaccgcga gctgaagcag ggcaagctga cgcacctaga    112200
     atacgacaag gacacgcaga agctgacatg gcgcaagccc aagggcgaga accagaaggc    112260
     gcgcgagaag gcgttctacg agcaactgcc gttctgcgac gtggccgacg tgttccgctt    112320
     cgtcaacggc cagtgccagt tcctgtcggc gctgacgcct ttgcagccgc gctatgcgaa    112380
     gaaggtcgcc gacgccgaca gcctgatggc ggtcatcatc gcgcaggcga tgaaccacgg    112440
     caaccaggtc atggcacgca ccagcgacat cccgtaccac gtgctggaga gcgcctacca    112500
     acagtacctg cgccacgcaa cgctgcacgc ggccaacgac tgcatcagca acgccatcgc    112560
     cgcgctgccg atcttcccgt actactcgtt cgacctcgat gcactgtacg gtgccgtcga    112620
     tggtcagaaa ttcggcgtcg agcggccgac cgtgaaagcg cgccactcgc gcaaatactt    112680
     tgggcgcggc aagggcgtgg tcgcctacac gctgctgtgc aaccacgtgc cgctcaacgg    112740
     ctacctgatc ggcgcgcacg attacgaggc ccatcacgtg ttcgacatct ggtatcgcaa    112800
     cacgtcggac atcgtgccga ccgcgatcac cggcgacatg cacagcgtca acaaggccaa    112860
     cttcgctatc ctgcactggt tcggcctgcg tttcgagccg cgcttcaccg accttggcga    112920
     tcagttgaag gaactctaca gtgccgacga tccggcgctg tacgatcagt gcctgatccg    112980
     gccggccggg agaatcgacc gcgatctcat agtcagcgag aagccgaacc tcgaccagat    113040
     tgtcgccacg ctcggactga aggagatgac gcagggcacg ctgatccgca agctatgcac    113100
     ctacaccgcg ccgaacccca cgcggcgcgc ggtgttcgag ttcgacaagc tcatccgcag    113160
     catctacacg ctgcgctacc tgcgcgatcc gcaactggag cgcaacgttc accgctcaca    113220
     gaaccgcatc gagtcctatc accagctacg ctcaaccatc gcccaggtcg gcggcaagaa    113280
     ggaattgacc gggcgcaccg acatcgaaat tgagatcagc aaccagtgcg ccaggctgat    113340
     cgccaacgcg gtcatcttct acaactcggc catcctctcg cggctgctga tgaagtacga    113400
     ggcgagcggc aacgccaagg cgcacgctct cctgacccag atatcgccgg cggcctggcg    113460
     gcacatcctg ctgaacgggc attacacctt ccagagcgac ggcaagatga tcgacctgga    113520
     tgcgctcgtg gcggggctgg agctgggatg acggaaattt cggcggttct ggcttagaac    113580
     cccagcaacg gccgagttga tggccgagct catggcctac cgcaaagtaa acggcttgtc    113640
     gacgctaccc gtcagtggag aagagcgccc cttggtgctg cgcatcatcg gcaaggaaaa    113700
     gccgcttgct cgcagcgccg tccatgagat tgtcaaaggt gtcatgcgag cgacggcaga    113760
     tcgtctgcgg gctcgtggca gcgactggga ggcggcggca gcccagatcg aggctgcgtc    113820
     aacgcactgg ttgaggcata ccgccggaac gcacatgacc gatgcgggcc tggacgtcaa    113880
     agccgtgcgc gacaatttcg ggcacgccac catcagcacc accagcatct acgtgcacag    113940
     cgaggacaat gcacggcatg atgctacgca agcggcgcac aaaattggat gggcaccgcc    114000
     cggcaaagca agctgaaggt tcacaggatg ggcgtttctc gggcgagaaa caagcacgcg    114060
     tcataacaac ttgaaatgca actgttgacg atgaatttgg ccaacaacgg ttgcatttcc    114120
     accagttacg cactcaatgt cgggccatcg ggttcagcac caacggtgcc tggggcggca    114180
     gatagacgca taacgatcta gttcattatt actttttcgc ttatgtgcta tttctggcct    114240
     tatcctggct gactccccat agccaactct gctgggtttg tccatctggg agcagctctg    114300
     aaactgaggc tcgccagcga tcaagtgttg ctggatcaac gctggcggcg atggcggtgc    114360
     ctgtttcaac ttcaagctgg gcaagtgccg ccgcaatcag tgtccgaatt gcccgctcgt    114420
     gcacgatcac cagcttgttc ttgtacagcc attgacgcgc ccgcacgagt agctgatcgc    114480
     ggtcggcgca gcgcgccact tcgtcgcgca gttcacgtac cagtgagcgg cgctggtgct    114540
     cgctcatcca ctggaatcca aggaccgtgc aggctacttg ttggtgatcg aatagcgtga    114600
     gcccgcgttc atacatggct ctcagcgagg cgacttctgg tgctgcaatg ccaagctcgt    114660
     tgccaaggtg gcgccacaag gctactggaa ttacccgaaa ggcaccgagc aaacgcccac    114720
     tcatgcgcag gaaaccaata tggagcgcca gaccaagctt gtgggaatca cctcggcgtg    114780
     cattgattgc gtcgcgctcg gcaccatcga aggtgaaaaa tgccttcatc tcgaagtcgc    114840
     tgatatcgcg ggggagccca cgcatcccca aaaacgttgt gtgccaaccc tgcatcgtga    114900
     acctcaaaag tgggaggcca ccatacccgt ttacaaagcg aacaggaaag tcaatgaaat    114960
     caacgatcta cccagaccac ccccgcgcca gtgctagctt tgcgtaccgt cacttattgc    115020
     actgaaaacg aggggacccc tacaagtctg ggggaccgat ccggacggcc gccacaaaga    115080
     ctcggggcct taaacacaaa aaatcaagca aagccattct tgcaccgtcc gatataccga    115140
     cgcgttcaat cgagcgaaat gttagagaac aagctcgggt ttaatcacct gctggtagcc    115200
     agaatggctg tatcggcgac ggcgctcaat cattttcatg tgggcattag cctcatcaaa    115260
     acacgaaaca tgatcaatct tttggcctcc gcgacggttg tgcaacccac cccaccgtcg    115320
     aacaacagtc caatcgccca gaagatcgca aacaatgtaa gcgtggtacc aacggtcctt    115380
     acttacccac cgcacaattt cgctttggaa cattgtctga cctcactatc agctcatgta    115440
     aagcgagcaa acgctttagt gaatttcctc gaagacccaa aattcgtgaa ctaacctcaa    115500
     tcacgacatc agctacacac cgttctcgcg gacctgtctg cgaacttccg aaaagcgatc    115560
     ccgcatgcag gagccccggc cattcagggg catggcgttc atcgatttcc tcaacttgaa    115620
     cccatactga aaagagactc agccgtcgat tgcgtaccaa ttccattcac accccacaca    115680
     gtctgccgaa tcagggacgg gtggtaggga cgaacgatca ctcatcaata gagcaatcga    115740
     agaacaaacg cagccccatc aagccgcatc acatgatagg tatcgcgatg cggctgttgc    115800
     ggcgaatcta tcattgtcga atagatattg caatatcaat ttacgatggc aattaaattc    115860
     atcgaaagcc atcacccctt ccgcccgtgc tcgcggacgc caggggggcc aggaacttgt    115920
     ctgcagaggg cgactagagc tgggatctcc ccctcctgct agcgcgcccg atggcacgcc    115980
     ccacgtgatt cattcgcagg ccggcctcgg ccacatatcc accattagcc ggtcggttat    116040
     accgtccaat caggtaccta aacagccggt agaactcacg atcgcaccca tcatcactgc    116100
     gacggtgggt cgcttattgc gtccaatctg gtaccaaaac agccgggtca aataggcgat    116160
     ttcaggtctc gtttccaacc gcttccgcgt ggtgcgcgaa gatatagttc caatctgaca    116220
     tctaattggc cgggtgcttt tatgaggctc cgggccttct atccaatctg gtacctcgcg    116280
     ggatagctgt aaacctgcta agcaactatg gaaatgcaag aagcgcacga gagtgcaaaa    116340
     gagggtttgg ttgggtacct ggacgccatc catgggcaaa tggaggctct ggtgactgct    116400
     cacctggctg cgtgcgacca actggagacc cagaagaccg actggaaaga tcggagcatc    116460
     ttgcggctgg gcatgcacaa gagcggcaac cacctgcagg tgaagtggtt cacgatcaag    116520
     tggtatggga aggggacggc acgcaagagc gtgaaggggt caatcaggaa gtcgccgaac    116580
     gaagacacgt actcaatggc tcagctacgc gaaaaggccc aggaatggga atggccactg    116640
     gttgaatcga ctgagatacg gttgggaatt ctgcggagac aggcgtcatt cgttgcgaag    116700
     gccttgacct ctctgcgcta cggccaaatg gcgctggaca agtacgcggc ctgggaaccg    116760
     aaggcccaag attgacccca tgaacatcct ctggagcacc cctgttcgac taggcgcaga    116820
     agggtgtgct gtacaagtgt tcaacaattc cttacaatca gggaaggcat cattctttga    116880
     tgttgaactc caaggcagga tcagttccgc tcggagaatt ctttagttcg tattggcggc    116940
     tttacgctta ggaacaagcg ctcaacagtt cgagacgtat tgttccgatt gaagatgcca    117000
     tagagcaccc ctggtcaccc tcttttctag gttatcaaat gaccaacgcc aaaaacgaca    117060
     tcctatacgt ctatattcac gacaacccta gcggtcggac gtggagggcg caaattgatc    117120
     gcgccggctt tcttgatgcc gctacggaaa tcaagctcag cggcgacgcg gaaaaattaa    117180
     agatagccgc cttgctcgca aaccgcattg aagacctggc cctttgtgaa ctgggaagcg    117240
     agcgcgagca cgagctcatg gaaggcgaca ttgaggcgga tataccgggt gtattccacc    117300
     ttggcgccct gcacagtggc tcctctgaaa ccgcgttcgc acaagtgctc aacggccagc    117360
     ctggtggcca ctacatcgtc gttcgctacc tggcagagcg ccacgtgcac ctgcggaccg    117420
     cgcacctgcc ccaagagacc gggttcatcc gtggaccgtt gagcagcgag acactccagg    117480
     gtgcattgcg cgggatggaa gaggcggatc gggactacct caagagcatg gacgcttgat    117540
     tcatggggca tgcccaggcc ctctgcgaag cgtctttgcc taccctcccc tgccccagcg    117600
     cgccaaacgg cccttgaagc gcctcaggcg gcgtcaggct accccaccct taccgaacag    117660
     gaaacgcgac cccgaaggtg cgatgcgggc caacgacagc cgaaaacggc gcggaagccg    117720
     gcacaggggt cgctaaggcc gcgacggcga gagaatcacg tggcctggtc caagccgttg    117780
     tcggcaatga attgagcaaa ggccacccgc acgatcttgg ccttcattcc ggatttgaca    117840
     aattgctcct tgatcagtcc ggtcgcctgt gcttcaaacc gcgtctgaag gggcttcaac    117900
     tctttcgggg aaaggccttt tatgtattcc tcgatcgcgg caagttttga tggtggaaca    117960
     tcctcgcttg gaacaaaatc tgatttgagt ttcttgcgcg gcgcttttga agtctcatcc    118020
     ttggaaggct tggaaacctc tgcggcacca tagccctttt tgagagcatc cctgaagaga    118080
     gccgcaggag acttgattcc acctttggca acacgcgact caacaaaatc cagggttgca    118140
     accaacacct ctggttcgtt ttctgtgtag ataacgtcaa tgattgactt ggcaagccct    118200
     agagcctcca tacgccggag aatgtcaaca tcaatcaaat cctcactaga ttccagcgga    118260
     agcatcgact gaggcttgcg ctgcacggaa aactgcaggt gggtgatctt gcggcccgtc    118320
     ttgaactcca ataatgacac ctgaagccct gaaacggcat tcacttcatt gatggcaggc    118380
     atcaacgtgt cgcgcttgaa aaaccgatac tcccccgtag atttcgagtc gttaatacct    118440
     gaaatccttg gtttccacca ttcccacggc gccttgttcg tcagaccgtt gtagttggac    118500
     aaatacttca tgcaaatctc atacagagcc gcggccgacc ccgaacgaaa attgttgaag    118560
     atcgccagag gaagctgcac atatcggtaa ggatccagca aacgctgacg caccttcggg    118620
     ctgtaggacc actccagata cagccgtcct ccaaccgtca gaaactcagc atctgcaagc    118680
     agggcagaaa tgccccaaga caaaacatca tcctcttcac cccgaatacg atcccactcc    118740
     acagtcgttt tggccatgga acgcagggtt tccttggcaa tctccatgtt ccgcggatcc    118800
     attgcggccg tcgaaaaaat atctgacatc ggcgctcggt acgtctcttg atcgccctgc    118860
     tcctgaaccg tgtgcaaaag gatattgaag aacttacgca tcagcagcgt gatcttcatg    118920
     cctggcgaag gggacacagc aaccgcctga tgcggcttga acacctccgc accgtgatga    118980
     tcgacaatga ccagatcggt cccggtagaa ccggcagcgg cagacgatgg agctctcgcg    119040
     gaaggcttgg agtgagcggc aggcatggat accaactgtg aggctgaagg cgcccaagaa    119100
     tacacaaatg gaggaaaaca gtaaagtgaa ggctcacact aacgtgccct cctcgcaact    119160
     gtgagtggat tcataaactc cctcacctct cgcttccatc caccacgcct cagcggtcag    119220
     aaaggtgcct gccttgaccc ctggaggcct gttcataaag tccctcacac atcaaatcct    119280
     tggcggatag cgcaagaacc acaccaaccg gagcccggac ctcggaacct tcataaacag    119340
     cctcacggat tcatagatcg cctcacaaac acgcatgaac aaaggcaatg attcataaag    119400
     accctcaccg ttgcctcata cagtgccaca caccttcata aagtagctca cagatcgttc    119460
     atgaaagccc tcacagattc ataaaacgcc tcaccgaacg gccggaaaac ccctcaaagt    119520
     gacccctgca gcttcataaa gtagctcaca cctgaggaaa aacacatcat aaagtggctc    119580
     acagaaacag ccgcaagtca ttgaaaacaa aggggaaaac gctcaggcaa actgtctgtt    119640
     tgcataaaag tctgtaaaca accttacgcg cgcgatcacc catcaccaag gcctgtgggt    119700
     aagtccgttc ttggccct                                                  119718
//

If you have problems or comments...

PBIL Back to PBIL home page