(data stored in ACNUC7421 zone)

EMBL: CP002466

ID   CP002466; SV 1; circular; genomic DNA; STD; PRO; 2344824 BP.
XX
AC   CP002466; ACQZ01000001-ACQZ01000096;
XX
PR   Project:PRJNA32585;
XX
DT   25-JAN-2011 (Rel. 107, Created)
DT   23-NOV-2011 (Rel. 110, Last updated, Version 3)
XX
DE   Thermoanaerobacter brockii subsp. finnii Ako-1, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Thermoanaerobacter brockii subsp. finnii Ako-1
OC   Bacteria; Firmicutes; Clostridia; Thermoanaerobacterales;
OC   Thermoanaerobacteraceae; Thermoanaerobacter.
XX
RN   [1]
RP   1-2344824
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Goodwin L., Pitluck S.,
RA   Chertkov O., Munk C., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Mikhailova N., Pagani I., Hemme C.L., Woyke T.;
RT   "Complete sequence of Thermoanaerobacter brockii finnii Ako-1";
RL   Unpublished.
XX
RN   [2]
RP   1-2344824
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Goodwin L., Pitluck S.,
RA   Chertkov O., Munk C., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Mikhailova N., Pagani I., Hemme C.L., Woyke T.;
RT   ;
RL   Submitted (14-JAN-2011) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; df14fcbae14ade043731d954114045ba.
DR   BioSample; SAMN00713580.
DR   EnsemblGenomes-Gn; EBG00001161050.
DR   EnsemblGenomes-Gn; EBG00001161051.
DR   EnsemblGenomes-Gn; EBG00001161052.
DR   EnsemblGenomes-Gn; EBG00001161053.
DR   EnsemblGenomes-Gn; EBG00001161054.
DR   EnsemblGenomes-Gn; EBG00001161055.
DR   EnsemblGenomes-Gn; EBG00001161056.
DR   EnsemblGenomes-Gn; EBG00001161057.
DR   EnsemblGenomes-Gn; EBG00001161058.
DR   EnsemblGenomes-Gn; EBG00001161059.
DR   EnsemblGenomes-Gn; EBG00001161060.
DR   EnsemblGenomes-Gn; EBG00001161061.
DR   EnsemblGenomes-Gn; EBG00001161062.
DR   EnsemblGenomes-Gn; EBG00001161063.
DR   EnsemblGenomes-Gn; EBG00001161064.
DR   EnsemblGenomes-Gn; EBG00001161065.
DR   EnsemblGenomes-Gn; EBG00001161066.
DR   EnsemblGenomes-Gn; EBG00001161067.
DR   EnsemblGenomes-Gn; EBG00001161068.
DR   EnsemblGenomes-Gn; EBG00001161069.
DR   EnsemblGenomes-Gn; EBG00001161070.
DR   EnsemblGenomes-Gn; EBG00001161071.
DR   EnsemblGenomes-Gn; EBG00001161072.
DR   EnsemblGenomes-Gn; EBG00001161073.
DR   EnsemblGenomes-Gn; EBG00001161074.
DR   EnsemblGenomes-Gn; EBG00001161075.
DR   EnsemblGenomes-Gn; EBG00001161076.
DR   EnsemblGenomes-Gn; EBG00001161077.
DR   EnsemblGenomes-Gn; EBG00001161078.
DR   EnsemblGenomes-Gn; EBG00001161079.
DR   EnsemblGenomes-Gn; EBG00001161080.
DR   EnsemblGenomes-Gn; EBG00001161081.
DR   EnsemblGenomes-Gn; EBG00001161082.
DR   EnsemblGenomes-Gn; EBG00001161083.
DR   EnsemblGenomes-Gn; EBG00001161084.
DR   EnsemblGenomes-Gn; EBG00001161085.
DR   EnsemblGenomes-Gn; EBG00001161086.
DR   EnsemblGenomes-Gn; EBG00001161087.
DR   EnsemblGenomes-Gn; EBG00001161088.
DR   EnsemblGenomes-Gn; EBG00001161089.
DR   EnsemblGenomes-Gn; EBG00001161090.
DR   EnsemblGenomes-Gn; EBG00001161091.
DR   EnsemblGenomes-Gn; EBG00001161092.
DR   EnsemblGenomes-Gn; EBG00001161093.
DR   EnsemblGenomes-Gn; EBG00001161094.
DR   EnsemblGenomes-Gn; EBG00001161095.
DR   EnsemblGenomes-Gn; EBG00001161096.
DR   EnsemblGenomes-Gn; EBG00001161097.
DR   EnsemblGenomes-Gn; EBG00001161098.
DR   EnsemblGenomes-Gn; EBG00001161099.
DR   EnsemblGenomes-Gn; EBG00001161100.
DR   EnsemblGenomes-Gn; EBG00001161101.
DR   EnsemblGenomes-Gn; EBG00001161102.
DR   EnsemblGenomes-Gn; EBG00001161103.
DR   EnsemblGenomes-Gn; EBG00001161104.
DR   EnsemblGenomes-Gn; EBG00001161105.
DR   EnsemblGenomes-Gn; EBG00001161106.
DR   EnsemblGenomes-Gn; EBG00001161107.
DR   EnsemblGenomes-Gn; EBG00001161108.
DR   EnsemblGenomes-Gn; EBG00001161109.
DR   EnsemblGenomes-Gn; EBG00001161110.
DR   EnsemblGenomes-Gn; EBG00001161111.
DR   EnsemblGenomes-Gn; EBG00001161112.
DR   EnsemblGenomes-Gn; EBG00001161113.
DR   EnsemblGenomes-Gn; EBG00001161114.
DR   EnsemblGenomes-Gn; EBG00001161115.
DR   EnsemblGenomes-Gn; EBG00001161116.
DR   EnsemblGenomes-Gn; EBG00001161117.
DR   EnsemblGenomes-Gn; EBG00001161118.
DR   EnsemblGenomes-Gn; EBG00001161119.
DR   EnsemblGenomes-Gn; EBG00001161120.
DR   EnsemblGenomes-Gn; EBG00001161121.
DR   EnsemblGenomes-Gn; EBG00001161122.
DR   EnsemblGenomes-Gn; EBG00001161123.
DR   EnsemblGenomes-Gn; EBG00001161124.
DR   EnsemblGenomes-Gn; EBG00001161125.
DR   EnsemblGenomes-Gn; EBG00001161126.
DR   EnsemblGenomes-Gn; EBG00001161127.
DR   EnsemblGenomes-Gn; EBG00001161128.
DR   EnsemblGenomes-Gn; EBG00001161129.
DR   EnsemblGenomes-Gn; EBG00001161130.
DR   EnsemblGenomes-Gn; EBG00001161131.
DR   EnsemblGenomes-Gn; EBG00001161132.
DR   EnsemblGenomes-Gn; EBG00001161133.
DR   EnsemblGenomes-Gn; EBG00001161134.
DR   EnsemblGenomes-Gn; EBG00001161135.
DR   EnsemblGenomes-Gn; EBG00001161136.
DR   EnsemblGenomes-Gn; EBG00001161137.
DR   EnsemblGenomes-Gn; EBG00001161138.
DR   EnsemblGenomes-Gn; EBG00001161139.
DR   EnsemblGenomes-Gn; EBG00001161140.
DR   EnsemblGenomes-Gn; EBG00001161141.
DR   EnsemblGenomes-Gn; EBG00001161142.
DR   EnsemblGenomes-Gn; EBG00001161143.
DR   EnsemblGenomes-Gn; EBG00001161144.
DR   EnsemblGenomes-Gn; EBG00001161145.
DR   EnsemblGenomes-Gn; EBG00001161146.
DR   EnsemblGenomes-Gn; EBG00001161147.
DR   EnsemblGenomes-Gn; EBG00001161148.
DR   EnsemblGenomes-Gn; EBG00001161149.
DR   EnsemblGenomes-Gn; EBG00001161150.
DR   EnsemblGenomes-Gn; EBG00001161151.
DR   EnsemblGenomes-Gn; EBG00001161152.
DR   EnsemblGenomes-Gn; EBG00001161153.
DR   EnsemblGenomes-Gn; EBG00001161154.
DR   EnsemblGenomes-Gn; EBG00001161155.
DR   EnsemblGenomes-Gn; EBG00001161156.
DR   EnsemblGenomes-Gn; EBG00001161157.
DR   EnsemblGenomes-Gn; EBG00001161158.
DR   EnsemblGenomes-Gn; EBG00001161159.
DR   EnsemblGenomes-Gn; EBG00001161160.
DR   EnsemblGenomes-Gn; EBG00001161161.
DR   EnsemblGenomes-Gn; EBG00001161162.
DR   EnsemblGenomes-Gn; EBG00001161163.
DR   EnsemblGenomes-Gn; EBG00001161164.
DR   EnsemblGenomes-Gn; EBG00001161165.
DR   EnsemblGenomes-Gn; EBG00001161166.
DR   EnsemblGenomes-Gn; EBG00001161167.
DR   EnsemblGenomes-Gn; EBG00001161168.
DR   EnsemblGenomes-Gn; EBG00001161169.
DR   EnsemblGenomes-Gn; EBG00001161170.
DR   EnsemblGenomes-Gn; EBG00001161171.
DR   EnsemblGenomes-Gn; EBG00001161172.
DR   EnsemblGenomes-Gn; EBG00001161173.
DR   EnsemblGenomes-Gn; EBG00001161174.
DR   EnsemblGenomes-Gn; EBG00001161175.
DR   EnsemblGenomes-Gn; EBG00001161176.
DR   EnsemblGenomes-Gn; EBG00001161177.
DR   EnsemblGenomes-Gn; EBG00001161178.
DR   EnsemblGenomes-Gn; EBG00001161179.
DR   EnsemblGenomes-Gn; EBG00001161180.
DR   EnsemblGenomes-Gn; EBG00001161181.
DR   EnsemblGenomes-Gn; EBG00001161182.
DR   EnsemblGenomes-Gn; EBG00001161183.
DR   EnsemblGenomes-Gn; EBG00001161184.
DR   EnsemblGenomes-Gn; EBG00001161185.
DR   EnsemblGenomes-Gn; EBG00001161186.
DR   EnsemblGenomes-Gn; EBG00001161187.
DR   EnsemblGenomes-Gn; EBG00001161188.
DR   EnsemblGenomes-Gn; EBG00001161189.
DR   EnsemblGenomes-Gn; EBG00001161190.
DR   EnsemblGenomes-Gn; EBG00001161191.
DR   EnsemblGenomes-Gn; EBG00001161192.
DR   EnsemblGenomes-Gn; EBG00001161193.
DR   EnsemblGenomes-Gn; EBG00001161194.
DR   EnsemblGenomes-Gn; EBG00001161195.
DR   EnsemblGenomes-Gn; EBG00001161196.
DR   EnsemblGenomes-Gn; EBG00001161197.
DR   EnsemblGenomes-Gn; EBG00001161198.
DR   EnsemblGenomes-Gn; EBG00001161199.
DR   EnsemblGenomes-Gn; EBG00001161200.
DR   EnsemblGenomes-Gn; EBG00001161201.
DR   EnsemblGenomes-Gn; EBG00001161202.
DR   EnsemblGenomes-Gn; EBG00001161203.
DR   EnsemblGenomes-Gn; EBG00001161204.
DR   EnsemblGenomes-Gn; EBG00001161205.
DR   EnsemblGenomes-Gn; EBG00001161206.
DR   EnsemblGenomes-Gn; EBG00001161207.
DR   EnsemblGenomes-Gn; EBG00001161208.
DR   EnsemblGenomes-Gn; EBG00001161209.
DR   EnsemblGenomes-Gn; EBG00001161210.
DR   EnsemblGenomes-Gn; EBG00001161211.
DR   EnsemblGenomes-Gn; EBG00001161212.
DR   EnsemblGenomes-Gn; EBG00001161213.
DR   EnsemblGenomes-Gn; EBG00001161214.
DR   EnsemblGenomes-Gn; EBG00001161215.
DR   EnsemblGenomes-Gn; EBG00001161216.
DR   EnsemblGenomes-Gn; EBG00001161217.
DR   EnsemblGenomes-Gn; EBG00001161218.
DR   EnsemblGenomes-Gn; EBG00001161219.
DR   EnsemblGenomes-Gn; EBG00001161220.
DR   EnsemblGenomes-Gn; EBG00001161221.
DR   EnsemblGenomes-Gn; EBG00001161222.
DR   EnsemblGenomes-Gn; EBG00001161223.
DR   EnsemblGenomes-Gn; EBG00001161224.
DR   EnsemblGenomes-Gn; EBG00001161225.
DR   EnsemblGenomes-Gn; EBG00001161226.
DR   EnsemblGenomes-Gn; EBG00001161227.
DR   EnsemblGenomes-Gn; EBG00001161228.
DR   EnsemblGenomes-Gn; EBG00001161229.
DR   EnsemblGenomes-Gn; EBG00001161230.
DR   EnsemblGenomes-Gn; EBG00001161231.
DR   EnsemblGenomes-Gn; EBG00001161232.
DR   EnsemblGenomes-Gn; EBG00001161233.
DR   EnsemblGenomes-Gn; EBG00001161234.
DR   EnsemblGenomes-Gn; EBG00001161235.
DR   EnsemblGenomes-Gn; EBG00001161236.
DR   EnsemblGenomes-Gn; EBG00001161237.
DR   EnsemblGenomes-Gn; EBG00001161238.
DR   EnsemblGenomes-Gn; EBG00001161239.
DR   EnsemblGenomes-Gn; EBG00001161240.
DR   EnsemblGenomes-Gn; EBG00001161241.
DR   EnsemblGenomes-Gn; EBG00001161242.
DR   EnsemblGenomes-Gn; EBG00001161243.
DR   EnsemblGenomes-Gn; EBG00001161244.
DR   EnsemblGenomes-Gn; EBG00001161245.
DR   EnsemblGenomes-Gn; EBG00001161246.
DR   EnsemblGenomes-Gn; EBG00001161247.
DR   EnsemblGenomes-Gn; EBG00001161248.
DR   EnsemblGenomes-Gn; EBG00001161249.
DR   EnsemblGenomes-Gn; EBG00001161250.
DR   EnsemblGenomes-Gn; EBG00001161251.
DR   EnsemblGenomes-Gn; EBG00001161252.
DR   EnsemblGenomes-Gn; EBG00001161253.
DR   EnsemblGenomes-Gn; EBG00001161254.
DR   EnsemblGenomes-Gn; EBG00001161255.
DR   EnsemblGenomes-Gn; EBG00001161256.
DR   EnsemblGenomes-Gn; EBG00001161257.
DR   EnsemblGenomes-Gn; EBG00001161258.
DR   EnsemblGenomes-Gn; EBG00001161259.
DR   EnsemblGenomes-Gn; EBG00001161260.
DR   EnsemblGenomes-Gn; EBG00001161261.
DR   EnsemblGenomes-Gn; EBG00001161262.
DR   EnsemblGenomes-Gn; EBG00001161263.
DR   EnsemblGenomes-Gn; EBG00001161264.
DR   EnsemblGenomes-Gn; EBG00001161265.
DR   EnsemblGenomes-Gn; EBG00001161266.
DR   EnsemblGenomes-Gn; EBG00001161267.
DR   EnsemblGenomes-Gn; EBG00001161268.
DR   EnsemblGenomes-Gn; EBG00001161269.
DR   EnsemblGenomes-Gn; EBG00001161270.
DR   EnsemblGenomes-Gn; EBG00001161271.
DR   EnsemblGenomes-Gn; EBG00001161272.
DR   EnsemblGenomes-Gn; EBG00001161273.
DR   EnsemblGenomes-Gn; EBG00001161274.
DR   EnsemblGenomes-Gn; EBG00001161275.
DR   EnsemblGenomes-Gn; EBG00001161276.
DR   EnsemblGenomes-Gn; EBG00001161277.
DR   EnsemblGenomes-Gn; EBG00001161278.
DR   EnsemblGenomes-Gn; EBG00001161279.
DR   EnsemblGenomes-Gn; EBG00001161280.
DR   EnsemblGenomes-Gn; EBG00001161281.
DR   EnsemblGenomes-Gn; EBG00001161282.
DR   EnsemblGenomes-Gn; EBG00001161283.
DR   EnsemblGenomes-Gn; EBG00001161284.
DR   EnsemblGenomes-Gn; EBG00001161285.
DR   EnsemblGenomes-Gn; Thebr_R0001.
DR   EnsemblGenomes-Gn; Thebr_R0002.
DR   EnsemblGenomes-Gn; Thebr_R0003.
DR   EnsemblGenomes-Gn; Thebr_R0004.
DR   EnsemblGenomes-Gn; Thebr_R0005.
DR   EnsemblGenomes-Gn; Thebr_R0006.
DR   EnsemblGenomes-Gn; Thebr_R0007.
DR   EnsemblGenomes-Gn; Thebr_R0008.
DR   EnsemblGenomes-Gn; Thebr_R0009.
DR   EnsemblGenomes-Gn; Thebr_R0010.
DR   EnsemblGenomes-Gn; Thebr_R0011.
DR   EnsemblGenomes-Gn; Thebr_R0012.
DR   EnsemblGenomes-Gn; Thebr_R0013.
DR   EnsemblGenomes-Gn; Thebr_R0014.
DR   EnsemblGenomes-Gn; Thebr_R0015.
DR   EnsemblGenomes-Gn; Thebr_R0016.
DR   EnsemblGenomes-Gn; Thebr_R0017.
DR   EnsemblGenomes-Gn; Thebr_R0018.
DR   EnsemblGenomes-Gn; Thebr_R0019.
DR   EnsemblGenomes-Gn; Thebr_R0020.
DR   EnsemblGenomes-Gn; Thebr_R0021.
DR   EnsemblGenomes-Gn; Thebr_R0022.
DR   EnsemblGenomes-Gn; Thebr_R0023.
DR   EnsemblGenomes-Gn; Thebr_R0024.
DR   EnsemblGenomes-Gn; Thebr_R0025.
DR   EnsemblGenomes-Gn; Thebr_R0026.
DR   EnsemblGenomes-Gn; Thebr_R0027.
DR   EnsemblGenomes-Gn; Thebr_R0028.
DR   EnsemblGenomes-Gn; Thebr_R0029.
DR   EnsemblGenomes-Gn; Thebr_R0030.
DR   EnsemblGenomes-Gn; Thebr_R0031.
DR   EnsemblGenomes-Gn; Thebr_R0032.
DR   EnsemblGenomes-Gn; Thebr_R0033.
DR   EnsemblGenomes-Gn; Thebr_R0034.
DR   EnsemblGenomes-Gn; Thebr_R0035.
DR   EnsemblGenomes-Gn; Thebr_R0036.
DR   EnsemblGenomes-Gn; Thebr_R0037.
DR   EnsemblGenomes-Gn; Thebr_R0038.
DR   EnsemblGenomes-Gn; Thebr_R0039.
DR   EnsemblGenomes-Gn; Thebr_R0040.
DR   EnsemblGenomes-Gn; Thebr_R0041.
DR   EnsemblGenomes-Gn; Thebr_R0042.
DR   EnsemblGenomes-Gn; Thebr_R0043.
DR   EnsemblGenomes-Gn; Thebr_R0044.
DR   EnsemblGenomes-Gn; Thebr_R0045.
DR   EnsemblGenomes-Gn; Thebr_R0046.
DR   EnsemblGenomes-Gn; Thebr_R0047.
DR   EnsemblGenomes-Gn; Thebr_R0048.
DR   EnsemblGenomes-Gn; Thebr_R0049.
DR   EnsemblGenomes-Gn; Thebr_R0050.
DR   EnsemblGenomes-Gn; Thebr_R0051.
DR   EnsemblGenomes-Gn; Thebr_R0052.
DR   EnsemblGenomes-Gn; Thebr_R0053.
DR   EnsemblGenomes-Gn; Thebr_R0054.
DR   EnsemblGenomes-Gn; Thebr_R0055.
DR   EnsemblGenomes-Gn; Thebr_R0056.
DR   EnsemblGenomes-Gn; Thebr_R0057.
DR   EnsemblGenomes-Gn; Thebr_R0058.
DR   EnsemblGenomes-Gn; Thebr_R0059.
DR   EnsemblGenomes-Gn; Thebr_R0060.
DR   EnsemblGenomes-Gn; Thebr_R0061.
DR   EnsemblGenomes-Gn; Thebr_R0062.
DR   EnsemblGenomes-Gn; Thebr_R0063.
DR   EnsemblGenomes-Gn; Thebr_R0064.
DR   EnsemblGenomes-Gn; Thebr_R0065.
DR   EnsemblGenomes-Gn; Thebr_R0066.
DR   EnsemblGenomes-Gn; Thebr_R0067.
DR   EnsemblGenomes-Gn; Thebr_R0068.
DR   EnsemblGenomes-Gn; Thebr_R0069.
DR   EnsemblGenomes-Gn; Thebr_R0070.
DR   EnsemblGenomes-Gn; Thebr_R0071.
DR   EnsemblGenomes-Gn; Thebr_R0072.
DR   EnsemblGenomes-Tr; EBT00001749567.
DR   EnsemblGenomes-Tr; EBT00001749568.
DR   EnsemblGenomes-Tr; EBT00001749569.
DR   EnsemblGenomes-Tr; EBT00001749570.
DR   EnsemblGenomes-Tr; EBT00001749571.
DR   EnsemblGenomes-Tr; EBT00001749572.
DR   EnsemblGenomes-Tr; EBT00001749573.
DR   EnsemblGenomes-Tr; EBT00001749574.
DR   EnsemblGenomes-Tr; EBT00001749575.
DR   EnsemblGenomes-Tr; EBT00001749576.
DR   EnsemblGenomes-Tr; EBT00001749577.
DR   EnsemblGenomes-Tr; EBT00001749578.
DR   EnsemblGenomes-Tr; EBT00001749579.
DR   EnsemblGenomes-Tr; EBT00001749580.
DR   EnsemblGenomes-Tr; EBT00001749581.
DR   EnsemblGenomes-Tr; EBT00001749582.
DR   EnsemblGenomes-Tr; EBT00001749583.
DR   EnsemblGenomes-Tr; EBT00001749584.
DR   EnsemblGenomes-Tr; EBT00001749585.
DR   EnsemblGenomes-Tr; EBT00001749586.
DR   EnsemblGenomes-Tr; EBT00001749587.
DR   EnsemblGenomes-Tr; EBT00001749588.
DR   EnsemblGenomes-Tr; EBT00001749589.
DR   EnsemblGenomes-Tr; EBT00001749590.
DR   EnsemblGenomes-Tr; EBT00001749591.
DR   EnsemblGenomes-Tr; EBT00001749592.
DR   EnsemblGenomes-Tr; EBT00001749593.
DR   EnsemblGenomes-Tr; EBT00001749594.
DR   EnsemblGenomes-Tr; EBT00001749595.
DR   EnsemblGenomes-Tr; EBT00001749596.
DR   EnsemblGenomes-Tr; EBT00001749597.
DR   EnsemblGenomes-Tr; EBT00001749598.
DR   EnsemblGenomes-Tr; EBT00001749599.
DR   EnsemblGenomes-Tr; EBT00001749600.
DR   EnsemblGenomes-Tr; EBT00001749601.
DR   EnsemblGenomes-Tr; EBT00001749602.
DR   EnsemblGenomes-Tr; EBT00001749604.
DR   EnsemblGenomes-Tr; EBT00001749606.
DR   EnsemblGenomes-Tr; EBT00001749608.
DR   EnsemblGenomes-Tr; EBT00001749610.
DR   EnsemblGenomes-Tr; EBT00001749612.
DR   EnsemblGenomes-Tr; EBT00001749615.
DR   EnsemblGenomes-Tr; EBT00001749618.
DR   EnsemblGenomes-Tr; EBT00001749619.
DR   EnsemblGenomes-Tr; EBT00001749620.
DR   EnsemblGenomes-Tr; EBT00001749622.
DR   EnsemblGenomes-Tr; EBT00001749625.
DR   EnsemblGenomes-Tr; EBT00001749627.
DR   EnsemblGenomes-Tr; EBT00001749628.
DR   EnsemblGenomes-Tr; EBT00001749631.
DR   EnsemblGenomes-Tr; EBT00001749632.
DR   EnsemblGenomes-Tr; EBT00001749634.
DR   EnsemblGenomes-Tr; EBT00001749637.
DR   EnsemblGenomes-Tr; EBT00001749638.
DR   EnsemblGenomes-Tr; EBT00001749640.
DR   EnsemblGenomes-Tr; EBT00001749642.
DR   EnsemblGenomes-Tr; EBT00001749644.
DR   EnsemblGenomes-Tr; EBT00001749646.
DR   EnsemblGenomes-Tr; EBT00001749648.
DR   EnsemblGenomes-Tr; EBT00001749651.
DR   EnsemblGenomes-Tr; EBT00001749653.
DR   EnsemblGenomes-Tr; EBT00001749655.
DR   EnsemblGenomes-Tr; EBT00001749657.
DR   EnsemblGenomes-Tr; EBT00001749659.
DR   EnsemblGenomes-Tr; EBT00001749661.
DR   EnsemblGenomes-Tr; EBT00001749663.
DR   EnsemblGenomes-Tr; EBT00001749665.
DR   EnsemblGenomes-Tr; EBT00001749666.
DR   EnsemblGenomes-Tr; EBT00001749668.
DR   EnsemblGenomes-Tr; EBT00001749671.
DR   EnsemblGenomes-Tr; EBT00001749673.
DR   EnsemblGenomes-Tr; EBT00001749675.
DR   EnsemblGenomes-Tr; EBT00001749676.
DR   EnsemblGenomes-Tr; EBT00001749677.
DR   EnsemblGenomes-Tr; EBT00001749679.
DR   EnsemblGenomes-Tr; EBT00001749681.
DR   EnsemblGenomes-Tr; EBT00001749683.
DR   EnsemblGenomes-Tr; EBT00001749685.
DR   EnsemblGenomes-Tr; EBT00001749687.
DR   EnsemblGenomes-Tr; EBT00001749689.
DR   EnsemblGenomes-Tr; EBT00001749692.
DR   EnsemblGenomes-Tr; EBT00001749694.
DR   EnsemblGenomes-Tr; EBT00001749696.
DR   EnsemblGenomes-Tr; EBT00001749698.
DR   EnsemblGenomes-Tr; EBT00001749700.
DR   EnsemblGenomes-Tr; EBT00001749702.
DR   EnsemblGenomes-Tr; EBT00001749705.
DR   EnsemblGenomes-Tr; EBT00001749707.
DR   EnsemblGenomes-Tr; EBT00001749708.
DR   EnsemblGenomes-Tr; EBT00001749709.
DR   EnsemblGenomes-Tr; EBT00001749710.
DR   EnsemblGenomes-Tr; EBT00001749711.
DR   EnsemblGenomes-Tr; EBT00001749712.
DR   EnsemblGenomes-Tr; EBT00001749713.
DR   EnsemblGenomes-Tr; EBT00001749714.
DR   EnsemblGenomes-Tr; EBT00001749715.
DR   EnsemblGenomes-Tr; EBT00001749716.
DR   EnsemblGenomes-Tr; EBT00001749717.
DR   EnsemblGenomes-Tr; EBT00001749718.
DR   EnsemblGenomes-Tr; EBT00001749719.
DR   EnsemblGenomes-Tr; EBT00001749720.
DR   EnsemblGenomes-Tr; EBT00001749721.
DR   EnsemblGenomes-Tr; EBT00001749722.
DR   EnsemblGenomes-Tr; EBT00001749723.
DR   EnsemblGenomes-Tr; EBT00001749724.
DR   EnsemblGenomes-Tr; EBT00001749725.
DR   EnsemblGenomes-Tr; EBT00001749726.
DR   EnsemblGenomes-Tr; EBT00001749727.
DR   EnsemblGenomes-Tr; EBT00001749728.
DR   EnsemblGenomes-Tr; EBT00001749729.
DR   EnsemblGenomes-Tr; EBT00001749730.
DR   EnsemblGenomes-Tr; EBT00001749731.
DR   EnsemblGenomes-Tr; EBT00001749732.
DR   EnsemblGenomes-Tr; EBT00001749733.
DR   EnsemblGenomes-Tr; EBT00001749734.
DR   EnsemblGenomes-Tr; EBT00001749735.
DR   EnsemblGenomes-Tr; EBT00001749736.
DR   EnsemblGenomes-Tr; EBT00001749737.
DR   EnsemblGenomes-Tr; EBT00001749738.
DR   EnsemblGenomes-Tr; EBT00001749739.
DR   EnsemblGenomes-Tr; EBT00001749740.
DR   EnsemblGenomes-Tr; EBT00001749741.
DR   EnsemblGenomes-Tr; EBT00001749742.
DR   EnsemblGenomes-Tr; EBT00001749743.
DR   EnsemblGenomes-Tr; EBT00001749744.
DR   EnsemblGenomes-Tr; EBT00001749745.
DR   EnsemblGenomes-Tr; EBT00001749746.
DR   EnsemblGenomes-Tr; EBT00001749747.
DR   EnsemblGenomes-Tr; EBT00001749748.
DR   EnsemblGenomes-Tr; EBT00001749749.
DR   EnsemblGenomes-Tr; EBT00001749750.
DR   EnsemblGenomes-Tr; EBT00001749751.
DR   EnsemblGenomes-Tr; EBT00001749752.
DR   EnsemblGenomes-Tr; EBT00001749753.
DR   EnsemblGenomes-Tr; EBT00001749754.
DR   EnsemblGenomes-Tr; EBT00001749755.
DR   EnsemblGenomes-Tr; EBT00001749756.
DR   EnsemblGenomes-Tr; EBT00001749757.
DR   EnsemblGenomes-Tr; EBT00001749758.
DR   EnsemblGenomes-Tr; EBT00001749759.
DR   EnsemblGenomes-Tr; EBT00001749760.
DR   EnsemblGenomes-Tr; EBT00001749761.
DR   EnsemblGenomes-Tr; EBT00001749762.
DR   EnsemblGenomes-Tr; EBT00001749763.
DR   EnsemblGenomes-Tr; EBT00001749764.
DR   EnsemblGenomes-Tr; EBT00001749765.
DR   EnsemblGenomes-Tr; EBT00001749766.
DR   EnsemblGenomes-Tr; EBT00001749767.
DR   EnsemblGenomes-Tr; EBT00001749768.
DR   EnsemblGenomes-Tr; EBT00001749769.
DR   EnsemblGenomes-Tr; EBT00001749770.
DR   EnsemblGenomes-Tr; EBT00001749771.
DR   EnsemblGenomes-Tr; EBT00001749772.
DR   EnsemblGenomes-Tr; EBT00001749773.
DR   EnsemblGenomes-Tr; EBT00001749774.
DR   EnsemblGenomes-Tr; EBT00001749775.
DR   EnsemblGenomes-Tr; EBT00001749776.
DR   EnsemblGenomes-Tr; EBT00001749777.
DR   EnsemblGenomes-Tr; EBT00001749778.
DR   EnsemblGenomes-Tr; EBT00001749779.
DR   EnsemblGenomes-Tr; EBT00001749780.
DR   EnsemblGenomes-Tr; EBT00001749781.
DR   EnsemblGenomes-Tr; EBT00001749782.
DR   EnsemblGenomes-Tr; EBT00001749783.
DR   EnsemblGenomes-Tr; EBT00001749784.
DR   EnsemblGenomes-Tr; EBT00001749785.
DR   EnsemblGenomes-Tr; EBT00001749786.
DR   EnsemblGenomes-Tr; EBT00001749787.
DR   EnsemblGenomes-Tr; EBT00001749788.
DR   EnsemblGenomes-Tr; EBT00001749789.
DR   EnsemblGenomes-Tr; EBT00001749790.
DR   EnsemblGenomes-Tr; EBT00001749791.
DR   EnsemblGenomes-Tr; EBT00001749792.
DR   EnsemblGenomes-Tr; EBT00001749793.
DR   EnsemblGenomes-Tr; EBT00001749794.
DR   EnsemblGenomes-Tr; EBT00001749795.
DR   EnsemblGenomes-Tr; EBT00001749796.
DR   EnsemblGenomes-Tr; EBT00001749797.
DR   EnsemblGenomes-Tr; EBT00001749798.
DR   EnsemblGenomes-Tr; EBT00001749799.
DR   EnsemblGenomes-Tr; EBT00001749800.
DR   EnsemblGenomes-Tr; EBT00001749801.
DR   EnsemblGenomes-Tr; EBT00001749802.
DR   EnsemblGenomes-Tr; EBT00001749803.
DR   EnsemblGenomes-Tr; EBT00001749804.
DR   EnsemblGenomes-Tr; EBT00001749805.
DR   EnsemblGenomes-Tr; EBT00001749806.
DR   EnsemblGenomes-Tr; EBT00001749807.
DR   EnsemblGenomes-Tr; EBT00001749808.
DR   EnsemblGenomes-Tr; EBT00001749809.
DR   EnsemblGenomes-Tr; EBT00001749810.
DR   EnsemblGenomes-Tr; EBT00001749811.
DR   EnsemblGenomes-Tr; EBT00001749812.
DR   EnsemblGenomes-Tr; EBT00001749813.
DR   EnsemblGenomes-Tr; EBT00001749814.
DR   EnsemblGenomes-Tr; EBT00001749815.
DR   EnsemblGenomes-Tr; EBT00001749816.
DR   EnsemblGenomes-Tr; EBT00001749817.
DR   EnsemblGenomes-Tr; EBT00001749818.
DR   EnsemblGenomes-Tr; EBT00001749819.
DR   EnsemblGenomes-Tr; EBT00001749820.
DR   EnsemblGenomes-Tr; EBT00001749821.
DR   EnsemblGenomes-Tr; EBT00001749822.
DR   EnsemblGenomes-Tr; EBT00001749823.
DR   EnsemblGenomes-Tr; EBT00001749824.
DR   EnsemblGenomes-Tr; EBT00001749825.
DR   EnsemblGenomes-Tr; EBT00001749826.
DR   EnsemblGenomes-Tr; EBT00001749827.
DR   EnsemblGenomes-Tr; EBT00001749828.
DR   EnsemblGenomes-Tr; EBT00001749829.
DR   EnsemblGenomes-Tr; EBT00001749830.
DR   EnsemblGenomes-Tr; EBT00001749831.
DR   EnsemblGenomes-Tr; EBT00001749832.
DR   EnsemblGenomes-Tr; EBT00001749833.
DR   EnsemblGenomes-Tr; EBT00001749834.
DR   EnsemblGenomes-Tr; EBT00001749835.
DR   EnsemblGenomes-Tr; EBT00001749836.
DR   EnsemblGenomes-Tr; EBT00001749837.
DR   EnsemblGenomes-Tr; EBT00001749838.
DR   EnsemblGenomes-Tr; EBT00001749839.
DR   EnsemblGenomes-Tr; EBT00001749840.
DR   EnsemblGenomes-Tr; EBT00001749841.
DR   EnsemblGenomes-Tr; EBT00001749842.
DR   EnsemblGenomes-Tr; EBT00001749843.
DR   EnsemblGenomes-Tr; EBT00001749844.
DR   EnsemblGenomes-Tr; EBT00001749845.
DR   EnsemblGenomes-Tr; EBT00001749846.
DR   EnsemblGenomes-Tr; EBT00001749847.
DR   EnsemblGenomes-Tr; EBT00001749848.
DR   EnsemblGenomes-Tr; EBT00001749849.
DR   EnsemblGenomes-Tr; EBT00001749850.
DR   EnsemblGenomes-Tr; EBT00001749851.
DR   EnsemblGenomes-Tr; EBT00001749852.
DR   EnsemblGenomes-Tr; EBT00001749853.
DR   EnsemblGenomes-Tr; EBT00001749854.
DR   EnsemblGenomes-Tr; EBT00001749855.
DR   EnsemblGenomes-Tr; Thebr_R0001-1.
DR   EnsemblGenomes-Tr; Thebr_R0002-1.
DR   EnsemblGenomes-Tr; Thebr_R0003-1.
DR   EnsemblGenomes-Tr; Thebr_R0004-1.
DR   EnsemblGenomes-Tr; Thebr_R0005-1.
DR   EnsemblGenomes-Tr; Thebr_R0006-1.
DR   EnsemblGenomes-Tr; Thebr_R0007-1.
DR   EnsemblGenomes-Tr; Thebr_R0008-1.
DR   EnsemblGenomes-Tr; Thebr_R0009-1.
DR   EnsemblGenomes-Tr; Thebr_R0010-1.
DR   EnsemblGenomes-Tr; Thebr_R0011-1.
DR   EnsemblGenomes-Tr; Thebr_R0012-1.
DR   EnsemblGenomes-Tr; Thebr_R0013-1.
DR   EnsemblGenomes-Tr; Thebr_R0014-1.
DR   EnsemblGenomes-Tr; Thebr_R0015-1.
DR   EnsemblGenomes-Tr; Thebr_R0016-1.
DR   EnsemblGenomes-Tr; Thebr_R0017-1.
DR   EnsemblGenomes-Tr; Thebr_R0018-1.
DR   EnsemblGenomes-Tr; Thebr_R0019-1.
DR   EnsemblGenomes-Tr; Thebr_R0020-1.
DR   EnsemblGenomes-Tr; Thebr_R0021-1.
DR   EnsemblGenomes-Tr; Thebr_R0022-1.
DR   EnsemblGenomes-Tr; Thebr_R0023-1.
DR   EnsemblGenomes-Tr; Thebr_R0024-1.
DR   EnsemblGenomes-Tr; Thebr_R0025-1.
DR   EnsemblGenomes-Tr; Thebr_R0026-1.
DR   EnsemblGenomes-Tr; Thebr_R0027-1.
DR   EnsemblGenomes-Tr; Thebr_R0028-1.
DR   EnsemblGenomes-Tr; Thebr_R0029-1.
DR   EnsemblGenomes-Tr; Thebr_R0030-1.
DR   EnsemblGenomes-Tr; Thebr_R0031-1.
DR   EnsemblGenomes-Tr; Thebr_R0032-1.
DR   EnsemblGenomes-Tr; Thebr_R0033-1.
DR   EnsemblGenomes-Tr; Thebr_R0034-1.
DR   EnsemblGenomes-Tr; Thebr_R0035-1.
DR   EnsemblGenomes-Tr; Thebr_R0036-1.
DR   EnsemblGenomes-Tr; Thebr_R0037-1.
DR   EnsemblGenomes-Tr; Thebr_R0038-1.
DR   EnsemblGenomes-Tr; Thebr_R0039-1.
DR   EnsemblGenomes-Tr; Thebr_R0040-1.
DR   EnsemblGenomes-Tr; Thebr_R0041-1.
DR   EnsemblGenomes-Tr; Thebr_R0042-1.
DR   EnsemblGenomes-Tr; Thebr_R0043-1.
DR   EnsemblGenomes-Tr; Thebr_R0044-1.
DR   EnsemblGenomes-Tr; Thebr_R0045-1.
DR   EnsemblGenomes-Tr; Thebr_R0046-1.
DR   EnsemblGenomes-Tr; Thebr_R0047-1.
DR   EnsemblGenomes-Tr; Thebr_R0048-1.
DR   EnsemblGenomes-Tr; Thebr_R0049-1.
DR   EnsemblGenomes-Tr; Thebr_R0050-1.
DR   EnsemblGenomes-Tr; Thebr_R0051-1.
DR   EnsemblGenomes-Tr; Thebr_R0052-1.
DR   EnsemblGenomes-Tr; Thebr_R0053-1.
DR   EnsemblGenomes-Tr; Thebr_R0054-1.
DR   EnsemblGenomes-Tr; Thebr_R0055-1.
DR   EnsemblGenomes-Tr; Thebr_R0056-1.
DR   EnsemblGenomes-Tr; Thebr_R0057-1.
DR   EnsemblGenomes-Tr; Thebr_R0058-1.
DR   EnsemblGenomes-Tr; Thebr_R0059-1.
DR   EnsemblGenomes-Tr; Thebr_R0060-1.
DR   EnsemblGenomes-Tr; Thebr_R0061-1.
DR   EnsemblGenomes-Tr; Thebr_R0062-1.
DR   EnsemblGenomes-Tr; Thebr_R0063-1.
DR   EnsemblGenomes-Tr; Thebr_R0064-1.
DR   EnsemblGenomes-Tr; Thebr_R0065-1.
DR   EnsemblGenomes-Tr; Thebr_R0066-1.
DR   EnsemblGenomes-Tr; Thebr_R0067-1.
DR   EnsemblGenomes-Tr; Thebr_R0068-1.
DR   EnsemblGenomes-Tr; Thebr_R0069-1.
DR   EnsemblGenomes-Tr; Thebr_R0070-1.
DR   EnsemblGenomes-Tr; Thebr_R0071-1.
DR   EnsemblGenomes-Tr; Thebr_R0072-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP002466.
DR   SILVA-SSU; CP002466.
DR   StrainInfo; 112846; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085038
CC   Source DNA and organism available from Christoper L. Hemme
CC   (hemmecl@ou.edu)
CC   Contacts: Christoper L. Hemme (hemmecl@ou.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Thermoanaerobacter brocki finnii Ako-1 DSM
CC                          3389
CC   collection_date     :: Missing
CC   lat_lon             :: -2.042025 29.407518
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Missing
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 3389
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi03963
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 13759
CC   Funding Program     :: DOEM 2007
CC   Gene Calling Method :: Prodigal
CC   Isolation Site      :: Lake sediment; Africa, Lake Kivu
CC   Source of Isolate   :: Christpher L. Hemme (hemmecl@ou.edu)
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Thermophile
CC   Temperature Optimum :: 65C
CC   pH                  :: 6.8
CC   Gram Staining       :: Gram+
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2344824
FT                   /organism="Thermoanaerobacter brockii subsp. finnii Ako-1"
FT                   /sub_species="finnii"
FT                   /strain="Ako-1"
FT                   /mol_type="genomic DNA"
FT                   /lat_lon="2.04 S 29.41 E"
FT                   /isolation_source="lake sediment from Lake Kivu in Africa"
FT                   /collected_by="Christopher L. Hemme"
FT                   /db_xref="taxon:509193"
FT   gene            86..1417
FT                   /locus_tag="Thebr_0001"
FT   CDS_pept        86..1417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   tpd:Teth39_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78634"
FT                   /db_xref="GOA:E8USU6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E8USU6"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADV78634.1"
FT                   /translation="MYGDHRQIWERIVEVIKSELTPTSYNTWLVHIKPLAIIDDVLFLS
FT                   TPNTFTKNIINGRYINIIYDAASKATNKLYEIKILSEDEEEYREIKESIEKENLTESTT
FT                   LSTLNPKYTFDTFVVGNSNKLAHAACLAVAQAPAKAYNPLFIYGGVGLGKTHLMHAIGH
FT                   FINKHQSGYKIMYVTSETFTNELVNSIKDDKNEEFRNKYRNIDVLLIDDIQFIAKKERT
FT                   QEEFFHTFNTLYEANKQIVISSDRPPKEIPTLEERLRSRFEWGLIADIQPPDYETRIAI
FT                   LKKKAQTENLNIPDEVLAYVAEKIQSNIRELEGALIRIVAFSNLTKANIDLELAKHALK
FT                   EIVSNKTREITVKLIQEEVCKYYNIKLEDFRSRKRTKNIAYPRQIAMYLARELTDLSLP
FT                   KIGEEFGKDHTTVIHAYEKISNEIKQDELLSRQIEELKKRIKGY"
FT   gene            1653..2765
FT                   /locus_tag="Thebr_0002"
FT   CDS_pept        1653..2765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: tpd:Teth39_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78635"
FT                   /db_xref="GOA:E8USU7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E8USU7"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADV78635.1"
FT                   /translation="MKFVCDKNSLFEGVNIAIRGVSSRTTLPILQGIKISALKGQVKFS
FT                   GTDLDIGIECQIPAVIEEEGEIVVPAKIFSELVRKLPEGDVKIESDSQNTVNVVCDSIN
FT                   FTIAGSDAVEFPEIPLVSKENSFKLTQNILKDLIRKTVFCIAQEQTRPILTGVLFEVFQ
FT                   TEVKAVALDGFRMAIYSYQSEEKFFDEDIEKYSIVIPGKTLEEIYRILKDEETEIEIYH
FT                   TANQVLFQIENTKVISRLLEGSFINYNAVLPKDYKTEVVVKREVLTESIERASLIAESK
FT                   NNLIKFEIGDKFITVSSNSEKGKMIEKIEVDVKGMFLEIAFNSRYLLDSLRAIDEEEIT
FT                   LYFINSINPLIIKPIGSKDYLYMILPVKLN"
FT   gene            2786..2992
FT                   /locus_tag="Thebr_0003"
FT   CDS_pept        2786..2992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; PFAM: RNA-binding
FT                   S4 domain protein; KEGG: tpd:Teth39_0003 RNA-binding S4
FT                   domain-containing protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78636"
FT                   /db_xref="GOA:E8USU8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8USU8"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ADV78636.1"
FT                   /translation="MIEVPIETEYITLGQFLKYMKICQTGGQAKQFILEGKVKVNGAIE
FT                   LKRGKKLHKNDIIEVDGKTYIIK"
FT   gene            3003..4091
FT                   /locus_tag="Thebr_0004"
FT   CDS_pept        3003..4091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: tpd:Teth39_0004 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78637"
FT                   /db_xref="GOA:E8USU9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E8USU9"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADV78637.1"
FT                   /translation="MYVKELFVDNFRNLQKQKIEFCEGINIFYGLNAQGKSNLLESIRL
FT                   LSMGRSFRGSKTTELIKFGEDYFYVKAIICQENNDKKIEFGYKKNENKVIKVNGNKIKS
FT                   TSELLGQLLTVIFSPEDLNIIKEGPSHRRKYLDSCISVVEKNYLYNLMQYNKILMNRNK
FT                   LLKSIKEGKSKSILEIFDDQLVEYGAKIIVMRQNYLKNVEINIKKFLLEISNETAEIVY
FT                   LNSVGLKDASDEEIVKKRLKEKLSKNIDVDLRYFTTQVGPHREDFKIIINGYDSRVYSS
FT                   QGQQRTAALCLKLSEFEILKKETSEKPVLLLDDVMSELDENRKKYVLERLKGFQTFITH
FT                   TTKRYLKGDCYFKISNGVVIKE"
FT   gene            4103..4360
FT                   /locus_tag="Thebr_0005"
FT   CDS_pept        4103..4360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78638"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:E8USV0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0005"
FT                   /protein_id="ADV78638.1"
FT                   /translation="MYVHLGGNVVVPDKDIIAIFDMSVVTTSEATVQFLKIAEEEGFVV
FT                   RISDEKPKSFIITERDKRSIIYLSPISAFTLIRRTQKIED"
FT   gene            4373..6631
FT                   /locus_tag="Thebr_0006"
FT   CDS_pept        4373..6631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0006"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: glycoside hydrolase family 31; KEGG:
FT                   tpd:Teth39_0006 alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78639"
FT                   /db_xref="GOA:E8USV1"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="InterPro:IPR032513"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:E8USV1"
FT                   /inference="protein motif:PFAM:PF01055"
FT                   /protein_id="ADV78639.1"
FT                   /translation="MYQKTSEGIVVRNEGKKLELRVLGDKIINVFVSDKEEKRKDTIAI
FT                   ERKEYDIPEFSVRKELESILIETDSLKVKINKNDLSVSFLDKNENIINEDYNGGVKFSE
FT                   TDVRCYKKLREDHFYGFGEKAGYLDKKGERLEMWNTDEFMTHNQTTKLLYESYPFFIGM
FT                   NDYHTYGIFLDNSFRSFFDMGQESQEYYYFGAYGGQMNYYFIYGEDIKEVVEDYTYLTG
FT                   RINLPPLWALGNQQSRYSYTPQERVLEIAKTFREKDIPCDVIYLDIDYMEGYRVFTWNK
FT                   DTFKNYKEMLKQLKEMGFKVVTIVDPGVKRDYDYHVYREGIEEDYFVKDKYGITYVGKV
FT                   WPGEACFPDFLQEEVRYWWGEKHREFIKDGIDGIWNDMNEPAVFETPTKTMPEDNIHIL
FT                   DGEKVLHKEAHNVYANYMAMATRDGLLRIRPNERPFVLTRAAFSGIQRYAAMWTGDNRS
FT                   LYEHLLMMMPMLINIGLSGQPFAGADVGGFEGDCHEELFIRWIEAATFTPFLRVHSAIG
FT                   TKDQEPWSFGKRCEDISRKYIKMRYEILPYLYDLFYIASQKGYPIMRPLVFEYQEDENT
FT                   HKIYDEFLLGDNLLVAPIYLPSKEKREVYLPKGIWYDYWTGKEFKGESYYLVDAPIDII
FT                   PLFVKEGGILLKREPQSFVEEKEIKEIIVEIYRGEEGHYLHYEDDGKSFDYTKGVYNLF
FT                   DISFCYKEGRMDIKFDKIHFGYDKGVKKYKFIFKNFGDIKEIKINGEKVGKENCEIEL"
FT   gene            complement(6649..7380)
FT                   /locus_tag="Thebr_0007"
FT   CDS_pept        complement(6649..7380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0007"
FT                   /product="CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /note="PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase; KEGG: tpd:Teth39_0007 glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78640"
FT                   /db_xref="GOA:E8USV2"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:E8USV2"
FT                   /inference="protein motif:PFAM:PF07685"
FT                   /protein_id="ADV78640.1"
FT                   /translation="MKLVIGHMYPDLLNLYGDLGNILTLKRRCEWRNIETKVKPITVDS
FT                   NTNFADIDILFLGGGSDREQKIVSDDLTIKKGKNLKAAIEDGLTVLGICGGYQLLGNYY
FT                   QTSKGDKLKGVGVLDVWTVAGTKRMIGNVVIEANINEKNFKMVGFENHSGKTYLGKSNP
FT                   LGKIIIGSGNNGEDKTEGCIYKNVYGTYLHGPVLPKNPEFADILIETALKRKYGKVELT
FT                   PLDDSLEQQAKQSLIERFVKK"
FT   gene            complement(7377..8732)
FT                   /locus_tag="Thebr_0008"
FT   CDS_pept        complement(7377..8732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0008"
FT                   /product="domain of unknown function DUF1727"
FT                   /note="PFAM: domain of unknown function DUF1727; Mur ligase
FT                   middle domain protein; KEGG: tpd:Teth39_0008 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78641"
FT                   /db_xref="GOA:E8USV3"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:E8USV3"
FT                   /inference="protein motif:PFAM:PF08353"
FT                   /protein_id="ADV78641.1"
FT                   /translation="MKFLSVNLGKLVNISCKITGKDGTSLPGKIALKSDSKLIKKLIEP
FT                   IKDNKVIITGTNGKTTTSGLIAHILTTSGKSVVHNKEGANMKTGIATTLIKNSNFLGNL
FT                   IKDAAVFEIDEANMPIVIEDIKPNIVIITNFFRDQLDRYGELDTTVEKVKKALLKLPQE
FT                   SIVLLNADEPFTASIGDEIKSKVFYYGIEDNIEGINSSSFEQKYCPICGHKYEYRRIYY
FT                   GQLGDYYCPNCGKKRPNSHFKATNIFLNEDGINFNLYYKDKIFTVKSRLIGLYNVYNLL
FT                   AAISAGILLNIDFNTILKATESYWPIEGRLQKTKIKNKKAIINLIKNPIGFESTLNMLS
FT                   QFNKPLNLLISINDNYADGRDVSWLWDVNLEDFLSKTKVNYIITSGLRAEDMAVRLKYA
FT                   NFDINKIKVINSIDKALDTISELTKEELIAVLPNYTSLYDVNKYLNSQEDKK"
FT   gene            complement(8746..8877)
FT                   /pseudo
FT                   /locus_tag="Thebr_0009"
FT   gene            9106..11007
FT                   /locus_tag="Thebr_0010"
FT   CDS_pept        9106..11007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0010"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA topoisomerase IV, B
FT                   subunit; DNA gyrase, B subunit; KEGG: tpd:Teth39_0010 DNA
FT                   gyrase subunit B; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; ATP-binding region ATPase domain
FT                   protein; TOPRIM domain-containing protein; DNA gyrase
FT                   subunit B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78642"
FT                   /db_xref="GOA:E8USV4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005740"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8USV4"
FT                   /inference="protein motif:TFAM:TIGR01058"
FT                   /protein_id="ADV78642.1"
FT                   /translation="MAKDETYTASQIQILEGLEAVRKRPGMYIGSTGSRGLHHLVYEVV
FT                   DNSIDEALAGYCKNIVVTIHKDNSITVEDDGRGIPTDIHPKVRKPAVEVALTMLHAGGK
FT                   FNNDAYKVSGGLHGVGVSVVNALSEKLEVIVKQHGKIYRQRYERGVPKTDLEVIGETEE
FT                   TGTTITFKPDKEIFEETVFDYDVLAQRLRELAFLNKGINIKLIDERDGKEEVFNYEGGI
FT                   ISFVKYLNRNKEVLHEEPIYMEAKNSDYEVEVCMQYNDSYTENIFSFANNIDTREGGTH
FT                   LVGFKAALTKVINDYARKYGIIKDNEKNLQGEDVREGLTAIVSVKLKNPQFEGQTKTKL
FT                   GNSEMRSIVENVVTEKLSAFLEENPSVAKVIVEKATQAARAREAARKARELTRRKSALE
FT                   NTTLPGKLADCSEKDPSKCELFLVEGDSAGGSAKSGRNSRFQAILPLRGKILNVEKARL
FT                   DKILSNEEIRAMITALGTGIGDEFDISKLRYHKVVIMTDADVDGSHIRTLLLTFFYRFM
FT                   RPLIENGNVYIAQPPLYKITKGKKVYYAYSDRELDRILNEIGRENYTVQRYKGLGEMNA
FT                   DQLWDTTMDPEKRTMLKVTLEDAIAADEIFTILMGDKVEPRREFIEKHAKTVRNLDI"
FT   gene            11022..13445
FT                   /locus_tag="Thebr_0011"
FT   CDS_pept        11022..13445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0011"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: tpd:Teth39_0011 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78643"
FT                   /db_xref="GOA:E8USV5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E8USV5"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADV78643.1"
FT                   /translation="MSEEKEKVIPVGIEDEMKKSYIDYAMSVIVGRALPDVRDGLKPVH
FT                   RRILYAMNELGLTPDKPYKKSVAVVGEVLGKYHPHGDAAVYDTLVRLAQDFSMRETLID
FT                   GHGNFGSVDGDPPAAMRYTEARLSKIALEMLTDINKETVDFVPNFDETLKEPVVLPSRF
FT                   PNLLVNGSQGIAVGMATNIPPHNLGEVIDGIVAYIDNPYISVDELMKYIKGPDFPTGGI
FT                   ILGRDGIKETYETGRGKIVVRAKAEIEEHHGKTRIVITEIPYMVLKAKLIEKIAELVRD
FT                   KHIEGISDLRDESDRNGMKIVIELKRDVNPKVILNKLYMHTQMQQTFGAIMLALVDGEP
FT                   KILNLKQIIEKYVDHQADVVTRRTKFDLRKAEERAHILEGLKIALDHIDEVINIIRSSK
FT                   TEAIAKQNLMDKFGLSEKQAQAIVDMRLGRLTGLERQKVEDELKELIEKIKELKEILAD
FT                   ERKVLEIIKKELLEIKDKYATPRKTSIVAKEEELDLEDLVQLEDVVVTMTHYGYIKRMP
FT                   LDTYKAQKRGGKGILGISTREDDFVEDIFITTTHDRLLFFTNKGKVYSLRTIDIPETGR
FT                   QAKGTAIVNLIQIAQGEKVTAVIPLKKSEDIKYIVMCTKKGIIKKTSIEEFRSIKRNGI
FT                   IAITLEESDELINVKLTNGEREIIIGTARGYAIRFNEKDIRPMGRVAKGVIAISLREDD
FT                   EVVEMDLVHPNSEILVVTENGFGKRTDLEEYRLQTRAGKGIIAIRLSEKTGKLVSIRSV
FT                   NPEDEFMIISANGILIRMKVSDISKMHRDTRGVTLMKLDDGDRVVSTARIENEE"
FT   gene            complement(13471..14484)
FT                   /locus_tag="Thebr_0012"
FT   CDS_pept        complement(13471..14484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0012"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   tpd:Teth39_0012 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78644"
FT                   /db_xref="GOA:E8USV6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8USV6"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADV78644.1"
FT                   /translation="MSILHMPLKIKDITIKNRIMMSPMCMYSASTDGMPNDWHIVHYAT
FT                   RAIGGVGLIMQEATAVESRGRITDHDLGIWNDEQVKELKKIVDICKANGAVMGIQLAHA
FT                   GRKCNISYEDVVGPSPIKAGDRYKLPRELSVEEIKSIVKAFGEAAKRANLAGYDVVEIH
FT                   AAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEVRKNWPENKPIFVRVSADDY
FT                   MEGGINIDMMVEYINMIKDKVDLIDVSSGGLLNVDINLYPGYQVKYAETIKKRCNIKTS
FT                   AVGLITTQELAEEILSNERADLVALGRELLRNPYWVLHTYTSKEDWPKQYERAFKK"
FT   gene            14995..15540
FT                   /locus_tag="Thebr_0013"
FT   CDS_pept        14995..15540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0013"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="KEGG: tpd:Teth39_0013 acetolactate synthase, small
FT                   subunit; TIGRFAM: acetolactate synthase, small subunit;
FT                   PFAM: Acetolactate synthase, small subunit-like; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78645"
FT                   /db_xref="GOA:E8USV7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:E8USV7"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ADV78645.1"
FT                   /translation="MLSGRGMIFIGGDNLHIISVLVNNHPGVLSRVVGLFSRRGYNIES
FT                   LAVGTTEKEDISRITLTVEGDDYTVTQVIRQLNKLVDVLKVQNIGARDNVSRELLLVKV
FT                   GYDSNTRDDIMHIVDTFRAKVIDISMDSLIIEITGDSEKINAFINLISKFEVKELVRTG
FT                   LVALERGNKSLKEYEGEL"
FT   gene            15540..16535
FT                   /locus_tag="Thebr_0014"
FT   CDS_pept        15540..16535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0014"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; KEGG:
FT                   tpd:Teth39_0014 ketol-acid reductoisomerase; PFAM:
FT                   Acetohydroxy acid isomeroreductase catalytic
FT                   domain-containing protein; acetohydroxy acid
FT                   isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78646"
FT                   /db_xref="GOA:E8USV8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8USV8"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ADV78646.1"
FT                   /translation="MAKMYYDKDADLNLLKNKKIAIIGFGSQGHAHALNLKDSGLDVVV
FT                   GLYEGSKSKERAEKEGLRVYTVEEAAKVADIIMILIPDEKQAKVYKESIEKNLTEGKAL
FT                   AFAHGFNIHFKQIVPPKNVDVFMVAPKGPGHLVRRVYQEGKGVPNLVAVYQDYTGKAFD
FT                   LALAYAKGIGGTRAGVIETTFKEETETDLFGEQAVLCGGVTELMKAGFETLVEAGYQPE
FT                   IAYFECVHEMKLIVDLIYEGGFSYMRYSISDTAEFGDYMTGKRIITEETRKEMKKVLSE
FT                   IQSGKFAKEWLLENQVGRPQYNAIKDKEANHLIEKVGKGLREMMAWIKKE"
FT   gene            16555..17751
FT                   /locus_tag="Thebr_0015"
FT   CDS_pept        16555..17751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0015"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   tpd:Teth39_0015 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78647"
FT                   /db_xref="GOA:E8USV9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8USV9"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADV78647.1"
FT                   /translation="MGVKRVIVFDTTLRDGEQTPGVNFNINDKFEIAKQLVSLGVDVIE
FT                   AGFPAASNGDFEAVKNIADKLKGVTIAAMARSVKEDIDRASSALKNAERSRLHVFIATS
FT                   DIHLKYKLKMSREEMLEKAVEMVKYAKGKFDEIQFSAEDASRTDWDFLVKVFSEVIDAG
FT                   ANVINVPDTVGYAMPREFGELIKYIRNNVPNIDGVMISAHCHNDLGMAVANSLSAIENG
FT                   ATQVEVTVNGIGERAGNAAMEEVVMALNTRKDYFGLVHGINTKEIYNTSKLVSELTGIK
FT                   LQPNKAIVGANAFRHQAGIHQHGVINNRATYEIMKPEDIGIIPDTFALGKLSGRNAFEL
FT                   KVRQLGYNNLSPGELSDAFRRFKDLADRKKVIVDEDIRFVVEETLEEFRSFKEGEAWA"
FT   gene            17742..18995
FT                   /locus_tag="Thebr_0016"
FT   CDS_pept        17742..18995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0016"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="KEGG: tpd:Teth39_0016 3-isopropylmalate dehydratase
FT                   large subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   large subunit; 3-isopropylmalate dehydratase; homoaconitate
FT                   hydratase family protein; PFAM: aconitate hydratase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78648"
FT                   /db_xref="GOA:E8USW0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:E8USW0"
FT                   /inference="protein motif:TFAM:TIGR02083"
FT                   /protein_id="ADV78648.1"
FT                   /translation="MGLTLTQKILSAKVGREVKPGELIEVDVDMVLGNDVTAPVAIKEF
FT                   EKIGIDRVFDNTKIALVPDHFVPNKDIKSAEQVNIMRKFAKKHGIVNFFEVGQMGIEHA
FT                   LLPEKGLVLPGDVVIGADSHTCTYGALTCFSTGVGSTDMAAAMATGKAWFKVPEAIKFV
FT                   LKGNLQKWVSGKDVILYIIGKIGVDGALYKSMEFTGNIKALSMDDRFTIANMAIEAGAK
FT                   NGIFDFDEITEAYVKGRAKREYKVFERDVDAEYSEVYEISLDEIRPQVAFPHLPENTRN
FT                   IDEVGKVKIDQVVIGSCTNGRISDMEIAYKILKGKKVHPDVRLLIFPATQEIYLECVKR
FT                   GYIEEFIKAGAAVSTPTCGPCLGGHMGILAKGERALATTNRNFVGRMGHPESEVYLSSP
FT                   AVAAASAIAGYIVSPEEV"
FT   gene            18998..19480
FT                   /locus_tag="Thebr_0017"
FT   CDS_pept        18998..19480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0017"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="KEGG: tpd:Teth39_0017 3-isopropylmalate dehydratase
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78649"
FT                   /db_xref="GOA:E8USW1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:E8USW1"
FT                   /inference="protein motif:TFAM:TIGR02084"
FT                   /protein_id="ADV78649.1"
FT                   /translation="MQGKAIKYGDNIDTDVIIPARYLNTSDPQELAQHCMEDLDKEFKN
FT                   KVQEGDILVVGENFGSGSSREHAPIAIKASGISCIIAKSFARIFFRNAINIGLPILECK
FT                   EAVDGIEEGDIVLVDTDNGIIKNLTKGTEFKAQPFPDFIKEIMKYGGLINYVREKV"
FT   gene            19483..20550
FT                   /locus_tag="Thebr_0018"
FT   CDS_pept        19483..20550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0018"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; KEGG:
FT                   tpd:Teth39_0018 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78650"
FT                   /db_xref="GOA:E8USW2"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E8USW2"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ADV78650.1"
FT                   /translation="MFKIAVLPGDGIGPEVIEEGLKVLSAIEDKYKLKFDVKKYPFGGE
FT                   AIDKYGVPYPEETKNACLSSDAVLLGAVGGPKWDDLEGDKRPEAGLLALRKSLGVYANL
FT                   RPAVLYPPLKEASPLKNELLQEGLDILVVRELTGGIYFGPRGIVAIDYGFKAYDTEVYQ
FT                   TSEIERIAVIAFEAALKRKKKVTSVDKANILDSSRLWRKTVEEISKRYPDVELNHMYVD
FT                   NCAMQLIKNPSQFDVILTSNMFGDILSDEASQLTGSIGMLPSASLREDKVGLYEPIHGS
FT                   APDIAGTKKANPLATILSVAMMLEYSFNLLDAANDIKDAVNKVLEAGYRTFDLGKGIIL
FT                   NTQQMGDKVVEYIKG"
FT   gene            20547..22226
FT                   /locus_tag="Thebr_0019"
FT   CDS_pept        20547..22226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0019"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; KEGG:
FT                   tpd:Teth39_0019 dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78651"
FT                   /db_xref="GOA:E8USW3"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:E8USW3"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ADV78651.1"
FT                   /translation="MRILVSDSIKKGVEKAPHRSLLYALGLTYEEIKRPIIGVANSKNE
FT                   IIPGHIHLDKIAEAVKAGIRMAGGTPIEFSTIGVCDGIAMNHKGMKYSLGSRELIADSI
FT                   EIMATAHGFDGLVLIPNCDKIVPGMLMAAARLNIPAIVVSGGPMLAGKCNGEVCDLSSV
FT                   FEAVGAHKIGKISEEDLYKIELNACPTCGSCSGMFTANTMNCLTEALGLGLPGNGTIPA
FT                   VYSERIRLAKQAGIKIMELVERGIKPSYIITKEAFINAFSLDMALGGSTNTILHLKAIA
FT                   HEAGVEISLDEINDISGRVPNLCKLSPAGKYHIEDLYFAGGVSAVLKELTKANLINTEA
FT                   LTVTGKTLGENIKDAKVLNHDVIRPIDNPYSSTGGLAILYGNIAREGAVVKASAVAKEM
FT                   LRHEGPAKVFNSEEEAIAAIYGGKIQKGDVVVIRYEGPKGGPGMREMLSPTSALAGMGL
FT                   DKDVALITDGRFSGATRGASIGHVSPEAMEGGEIAIIEDGDIIEIDIPARKINVKLTDE
FT                   EIKERMKRWVRPEPKIKTGYMARYAEQVTSANTGAVFKGGGI"
FT   gene            22223..23887
FT                   /locus_tag="Thebr_0020"
FT   CDS_pept        22223..23887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0020"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="KEGG: tpd:Teth39_0020 acetolactate synthase, large
FT                   subunit, biosynthetic type; TIGRFAM: acetolactate synthase,
FT                   large subunit, biosynthetic type; PFAM: thiamine
FT                   pyrophosphate TPP-binding domain-containing protein;
FT                   thiamine pyrophosphate central domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78652"
FT                   /db_xref="GOA:E8USW4"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:E8USW4"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ADV78652.1"
FT                   /translation="MKLKGAQVIIEVLKEMGVDTIFGIPGGAVIPIYDALYDSDIRHIL
FT                   ATHEQMAAHMADGYARVTGRVGVCFATSGPGSTNLVTGIANAYMDSVPVVAITGQVPTN
FT                   LIGKDAFQEVDITGITMPITKHNFIVKSPDKLTDTIRQAFAIAKSGRPGPVLVDIPKDI
FT                   QNADIEYVKGIGDSIDIKNDINGVVSQKELDKAIELILQSKKPVIFAGGGVIWGEASNE
FT                   LVEFAEKTNIPVATSLMGLGAFPEDHPLSLGLIGMHGSRFANLAVYKSDLVIAIGTRFS
FT                   DRVAGKAGGLAPNAKIIHIDIDPAELGKNVEVDVAIIGKVKEVLRLLMNKLSFIERKEW
FT                   LEEISFLKEKHGLKYKNDEVLRPQWIVEKIQELSYDDLIIATEVGQNQMWAAQFYKFKQ
FT                   SRTFVTSGGLGAMGFGLPAAIGAQVGRPDKRVVNIAGDGSLRMNIHALETAAVYNLPVI
FT                   TVLLNNQTLGMVRQWQNLLYDKRFSHTDLNANLNFAKLANDFGVEGIRVTTKEEFEKAF
FT                   KKAYCEKRPFMIECIINKDEMVLPFIPAGGTVENTIG"
FT   misc_binding    23885..23999
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 113.08"
FT   gene            24083..25165
FT                   /locus_tag="Thebr_0021"
FT   CDS_pept        24083..25165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0021"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="1.1.1.193"
FT                   /EC_number="3.5.4.26"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibD; KEGG:
FT                   tpd:Teth39_0021 riboflavin biosynthesis protein RibD; PFAM:
FT                   bifunctional deaminase-reductase domain protein; CMP/dCMP
FT                   deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78653"
FT                   /db_xref="GOA:E8USW5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E8USW5"
FT                   /inference="protein motif:TFAM:TIGR00326"
FT                   /protein_id="ADV78653.1"
FT                   /translation="MEEYMKRALTLAEKGWGHTNPNPLVGAVIVKNGKIIGEGYHEYFG
FT                   GPHAEVNALKNAVEDVKGSTMFVTLEPCSHYGKTPPCVEEIIKSGIKRVYIAMEDPNPK
FT                   VSGNGIKRLKEAGIEVHVGIMEKKARKLNEIFVKYITTKFPFVIVKSAMSIDGKIACYN
FT                   GNSKWITNEKSRKFAHKIRGRVSAIMVGVNTVIKDNPMLTTRLEGYKSPVRIIVDSRGR
FT                   IPFDSNVIRDKTAKTIIATTELMPNNVRKKLEDMDIEVIILKNDNGKVPLKELMIKLGE
FT                   RGIDSVLIEGGGTLNWSALKEGIVDKVMFFISPRIIGGKNALTPVEGIGFSDIGNSIEL
FT                   KDVEIDRIDDDILITAYVRK"
FT   gene            25176..25799
FT                   /locus_tag="Thebr_0022"
FT   CDS_pept        25176..25799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0022"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; KEGG:
FT                   tpd:Teth39_0022 riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78654"
FT                   /db_xref="GOA:E8USW6"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:E8USW6"
FT                   /inference="protein motif:TFAM:TIGR00187"
FT                   /protein_id="ADV78654.1"
FT                   /translation="MFTGIIEETGTVKNIIHGTFTKIVIKCSKVLEGTKIGDSIAVNGV
FT                   CLTVTNMSNESFAADVMPETMRASNLKDLKIGSIVNLERALQVGRRMGGHIVTGHIDCV
FT                   GKIIDKRQEKNAFIFKIAINKEFTKYIARKGSIAVDGISLTVVEDGYDYFTVSVIPHTM
FT                   LKTTLGYKGVGDSVNIEVDILSKYVEKLIGKKDIKDLLKENGFI"
FT   gene            25837..27027
FT                   /locus_tag="Thebr_0023"
FT   CDS_pept        25837..27027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0023"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="KEGG: tpd:Teth39_0023 GTP cyclohydrolase II;
FT                   TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase; GTP
FT                   cyclohydrolase II; PFAM: 34-dihydroxy-2-butanone
FT                   4-phosphate synthase; GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78655"
FT                   /db_xref="GOA:E8USW7"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:E8USW7"
FT                   /inference="protein motif:TFAM:TIGR00506"
FT                   /protein_id="ADV78655.1"
FT                   /translation="MFDRIEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHIN
FT                   FMIKYGRGLVCVPMTEKRLNELGIYQMVENNTDHKETAFTVSVDYKECTTGISAFERAL
FT                   TVKKLVDDNSKPEDFTKPGHIFPLRAKDGGVLVRAGHTEAAVDLAVLAGLKPAGVICEI
FT                   IKDDGNMARLPDLLEFAKKFGLRIISIEDLIKYRMKNEILVRRVAQAKLPTKYGNFEIV
FT                   GYEEILTRKQHVALIKGDINKEPVLVRIHSECLTGDILGSLRCDCGDQLHAAMERIGQE
FT                   GGVLVYLRQEGRGIGLLNKIKAYHLQDQGLDTVEANIKLGFPPDLREYSIAAQILKDIG
FT                   VKKIRIMTNNPQKIMELSDYGLDVVERVSIEICPNHYNEKYLKTKKERMGHLILEV"
FT   gene            27105..27569
FT                   /locus_tag="Thebr_0024"
FT   CDS_pept        27105..27569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0024"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /note="KEGG: tpd:Teth39_0024 6,7-dimethyl-8-ribityllumazine
FT                   synthase; TIGRFAM: 6,7-dimethyl-8-ribityllumazine synthase;
FT                   PFAM: 67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78656"
FT                   /db_xref="GOA:E8USW8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:E8USW8"
FT                   /inference="protein motif:TFAM:TIGR00114"
FT                   /protein_id="ADV78656.1"
FT                   /translation="MKIYEGKLIAEGKKFGIVVSRFNEFITNKLLEGALDALKRHGALN
FT                   EDIEIAWVPGAFEIPLIAKKMAESKRYDAVIALGAVIRGETPHFDYVANEVSKGIAKIS
FT                   LDTEVPVIFGVLTTDTIEQAIVRAGTKGGNKGFEAAVTAIEMANLMEEIK"
FT   gene            complement(27587..28651)
FT                   /locus_tag="Thebr_0025"
FT   CDS_pept        complement(27587..28651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0025"
FT                   /product="sporulation integral membrane protein YtvI"
FT                   /note="KEGG: tpd:Teth39_0025 hypothetical protein; TIGRFAM:
FT                   sporulation integral membrane protein YtvI; PFAM: protein
FT                   of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78657"
FT                   /db_xref="GOA:E8USW9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:E8USW9"
FT                   /inference="protein motif:TFAM:TIGR02872"
FT                   /protein_id="ADV78657.1"
FT                   /translation="MNNFLLRYGDIIKKTLLIVAVFIIFYLIIFKIIPFLMPFVVALLL
FT                   AVIIDPGVNFLEKKLKVPRGLASFILLLILIGVIGSLIAISITQLIYELSSLAEISTNY
FT                   ANTINDIILNLVDRIRMYYISLPPNITSLIESNMQSILNYVSLFAKNLATWLLNFATKL
FT                   PNFFFMTLITLVATFFISKDKQLILDFIKRQIPSHWAQHAKSIQVNLLKTFFGYLRAVA
FT                   TIMLITFLEVSIGLAMIGFDYPFLLGLLVTIVDALPVLGSGAVMVPWALYNIIMKNYMV
FT                   GIYLLILYGLVVVVRQIIEPKIVGQSIGLHPLVTLLSMFIGAKLFGALGLIIGPVFVVV
FT                   FKALQRAEIIPPWK"
FT   gene            complement(28799..30169)
FT                   /locus_tag="Thebr_0026"
FT   CDS_pept        complement(28799..30169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0026"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: tpd:Teth39_0026 IS605 family transposase OrfB;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM: transposase
FT                   IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78658"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E8USX0"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADV78658.1"
FT                   /translation="MRRWSSCIRFAYKRLLQGYDRNTLKRDLQGIFNLNSRYVDDAIMK
FT                   ARSVLESSKELGNNPKKVIFGEKDLFKKLQKRHITGKEYQKLKTKWQEKRKGNLYSRGD
FT                   KSKKGNLNTRIEVKENGIFLRINVGKRKYIYAKIEAGYKKNKSREELLQEIAESNIPYS
FT                   VELKLKNGSIYAYFSIEEEYPETKITKEKGVIGIDVNAYPDNISWAETDEKGNLISYDK
FT                   IPMPELSSGNKDKREYFRWQYAHEIVKIAKEKRKAIVIEELDIKEKGKRGDFSGRKSRR
FT                   IRHNFSYKSLLSKIKTLAKREGIEVIEVNPSYTSIIGMLKYAPQYMTTKDIAAAYVIAR
FT                   RGLGKEEKIPNNYVNFLNTLTEKELEELKEHVKYTVKNKHLKKKHLMEINKAIKFIQSL
FT                   GSESERVLRPLYETSFSTYDFWQVLKVAVVTPLSPEKVPRDFSVLKELLIQGKWGDS"
FT   gene            complement(30492..30662)
FT                   /locus_tag="Thebr_0027"
FT   CDS_pept        complement(30492..30662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78659"
FT                   /db_xref="UniProtKB/TrEMBL:E8USX1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0027"
FT                   /protein_id="ADV78659.1"
FT                   /translation="MREIEYLLDLAEIKDTEYKNLLALLSLIDLLVEKGIITRRELAQK
FT                   SKEIAKIKTAL"
FT   gene            30800..31330
FT                   /locus_tag="Thebr_0028"
FT   CDS_pept        30800..31330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0028"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="TIGRFAM: signal peptidase I; KEGG: tpd:Teth39_0028
FT                   signal peptidase I; PFAM: Peptidase S24/S26A/S26B,
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78660"
FT                   /db_xref="GOA:E8USX2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E8USX2"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ADV78660.1"
FT                   /translation="MSKNIKKEILSWIFTIALAFLIALFIRTYVFELVDVPTGSMLNTI
FT                   QINDKFIVNKFIYRFEPVKRGDIVVFRFPDDPKVNFVKRVIGIGGDVIEIKNGQLIRNG
FT                   KVVKEPYIKEPMKGNFGPYVVPPGHYFMLGDNRNESMDSRFWQHKYVSKDQILGKIVFR
FT                   IWPPDRIGSMSGK"
FT   sig_peptide     30800..30898
FT                   /locus_tag="Thebr_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.610) with cleavage site probability 0.393 at
FT                   residue 33"
FT   gene            31606..32877
FT                   /locus_tag="Thebr_0029"
FT   CDS_pept        31606..32877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0029"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG:
FT                   tpd:Teth39_0029 seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Seryl-tRNA synthetase,
FT                   class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78661"
FT                   /db_xref="GOA:E8USX3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:E8USX3"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADV78661.1"
FT                   /translation="MLDVKRIRNNPEAVRIAIELKGEKADIDRFLELDEKRRQMLVELE
FT                   TLKNRRNVESDNIAKLKREGKDASDLIAEMKELSDKIKEMEQEVKEVEEELERILWTIP
FT                   NIPHESVPIGDSDEDNVEIRRWGEPRKFDFEPKPHWEIGQELDILDFEAAARVTGSRFT
FT                   FYKGLGARLERALINFMLDLHIEKHGYTEVFPPFMVHRRSMFGTGQLPKFEEDAFKVYG
FT                   TDYFLIPTAEVPVTNMYRDTIIDGDKLPIYHCAYSACFRQEAGSAGRDTRGLIRQHQFN
FT                   KVELVKFTEPDKSYEELEKMTRDAEEVLQALGLPYRVVVICTGDLGFTASKKYDIEVWM
FT                   PSYGRYVEISSCSNCEDFQARRANIKYRPKDGGKAQYVHTLNGSGVAVGRTFAAILENY
FT                   QQEDGSVVIPEVLRPYMKVDVIKK"
FT   gene            32960..33049
FT                   /locus_tag="Thebr_R0001"
FT                   /note="tRNA-Ser1"
FT   tRNA            32960..33049
FT                   /locus_tag="Thebr_R0001"
FT                   /product="tRNA-Ser"
FT   gene            33083..33176
FT                   /locus_tag="Thebr_R0002"
FT                   /note="tRNA-Ser2"
FT   tRNA            33083..33176
FT                   /locus_tag="Thebr_R0002"
FT                   /product="tRNA-Ser"
FT                   /note="GenePRIMP; GenePRIMP"
FT   gene            33362..33438
FT                   /locus_tag="Thebr_R0003"
FT                   /note="tRNA-Arg1"
FT   tRNA            33362..33438
FT                   /locus_tag="Thebr_R0003"
FT                   /product="tRNA-Arg"
FT   gene            complement(33523..34644)
FT                   /locus_tag="Thebr_0030"
FT   CDS_pept        complement(33523..34644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0030"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   tpd:Teth39_0030 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78662"
FT                   /db_xref="GOA:E8USX4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:E8USX4"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADV78662.1"
FT                   /translation="MRGHIRKRGSTYSIVVDVGRDENGKRKQKWISGFKTKKEAEKALA
FT                   EIIAKIEKNEFIEPSKITLQQFINEWLKIYGEPKWAPKTLVSNKSLIDNYIIPNLGHIE
FT                   LQKLKPVEIQKFYNSLKEKQLSNTTINYVHRLLNQVLKFAVKWQYIAKNPCELVEAPKK
FT                   DKKEFVTWNFEHVKKAKKIFKDTPIYIHVMIALYTGLRLGEICGLRWEDIDFKNQTITV
FT                   RRTAQRIDGRFIFKEPKTETSKGIISIPDFLVQILKQEKNKQLQNKLIFGEKYITEYEG
FT                   FISVWEDGRFKEPDYVTKKFRKILKKQSDIPVIRFHDLRHTHATLMLRSGVDLKIISKR
FT                   LRHGRISTTADFYSHVDLEMDREALRKLESNLS"
FT   gene            complement(34708..35475)
FT                   /locus_tag="Thebr_0031"
FT   CDS_pept        complement(34708..35475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0031"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: tpd:Teth39_0031 phospholipase
FT                   D/transphosphatidylase; PFAM: phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78663"
FT                   /db_xref="GOA:E8USX5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E8USX5"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADV78663.1"
FT                   /translation="MNGNYIKPFISDNVSCSLYLGRNAGERIKNYIRNAKKSIKIFSPY
FT                   FSGELIDLLLEKTESVKDIKLISSFKISDLYNPMNSNLLRKIILQKRHVDEDSVNKRKS
FT                   LYYFTMAIAIILVLYIIVSAVLLSTKNINLFTSTPLIYFLLAIIILFLRKKIISTRIYT
FT                   YTYYTPFFVKFINDDGIFLHYKLYIIDDSYAFLGSLNFTSSGFFKNYESCITISDENIV
FT                   KALSEYFEYIANSQINEIDISSLGHRLYNEPIN"
FT   gene            complement(35503..35856)
FT                   /locus_tag="Thebr_0032"
FT   CDS_pept        complement(35503..35856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmt:Tmath_0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78664"
FT                   /db_xref="UniProtKB/TrEMBL:E8USX6"
FT                   /inference="similar to AA sequence:KEGG:Tmath_0050"
FT                   /protein_id="ADV78664.1"
FT                   /translation="MSSINLLNTSLMKALLDETIPFHEVMNAFGIRTHIVFNLPSTVLG
FT                   FTYVSRRGNYHLLLNGNINYGTQVKTFLHEIQHILNDMPRCGYIIGLNMEHLELEDEAD
FT                   KVSIQLFRYLVKI"
FT   gene            complement(35862..36251)
FT                   /locus_tag="Thebr_0033"
FT   CDS_pept        complement(35862..36251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0033"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: tpd:Teth39_0032 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78665"
FT                   /db_xref="GOA:E8USX7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E8USX7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADV78665.1"
FT                   /translation="MLGKRIKELRKKKGITQKELASYLGISDRAVGYYESGQRTPPPDI
FT                   LQKIADFFNVSTDYLLGRTNIYNPADEITEAVFDDPELLEFWRELKEREDLKLLFKQTK
FT                   KLSPKDIKQIIRIIKAIEDEEDKGE"
FT   gene            36403..36612
FT                   /locus_tag="Thebr_0034"
FT   CDS_pept        36403..36612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0034"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: tpd:Teth39_0033 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78666"
FT                   /db_xref="GOA:E8UT57"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT57"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADV78666.1"
FT                   /translation="MNKLKELRIKYKLTQKELAKNLGVTPDYISQIERGRIPGMETAIK
FT                   IANFFNTTVDEIFLANNRTKSSQQ"
FT   gene            36698..37027
FT                   /locus_tag="Thebr_0035"
FT   CDS_pept        36698..37027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0035"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: tpd:Teth39_0034 excision promoter, Xis"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78667"
FT                   /db_xref="GOA:E8UT58"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT58"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADV78667.1"
FT                   /translation="MDNRITIKFEVDITDVITQIIQLLNNVEKNKEEQKPLSLLDAYTI
FT                   DEAAKVLGVSRSYMYELAKHKDFPSLKVHGKKIIIPKKGLEEWMQKKFEEEKGSSKVVA
FT                   IGGRR"
FT   gene            37027..37155
FT                   /locus_tag="Thebr_0036"
FT   CDS_pept        37027..37155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmt:Tmath_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78668"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT59"
FT                   /inference="similar to AA sequence:KEGG:Tmath_0054"
FT                   /protein_id="ADV78668.1"
FT                   /translation="MWIEFKPMKNKDLLIKLAEALMKIVPIRIEKADEGWKLMIKT"
FT   gene            37222..37386
FT                   /locus_tag="Thebr_0037"
FT   CDS_pept        37222..37386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0037"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78669"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT60"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0035"
FT                   /protein_id="ADV78669.1"
FT                   /translation="MDVELVRKYYFEDKLKIVEIAKILGVNKSTVSRVPVDLPRSVYVH
FT                   KNVLKQFRV"
FT   gene            37431..37772
FT                   /locus_tag="Thebr_0038"
FT   CDS_pept        37431..37772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78670"
FT                   /db_xref="GOA:E8UT61"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT61"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0036"
FT                   /protein_id="ADV78670.1"
FT                   /translation="MLNKISNSIWDFMIALVSVGLFILSHIIFILVDYKVIISNLSFIK
FT                   GTGFLFIAYITISLIGIFTIEPVSEAFSCLVHKITLKEIETVNITDFLVFSGLYFIVPF
FT                   VIFLIMRFF"
FT   gene            complement(37756..38499)
FT                   /locus_tag="Thebr_0039"
FT   CDS_pept        complement(37756..38499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0039"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78671"
FT                   /db_xref="GOA:E8UT62"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT62"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0037"
FT                   /protein_id="ADV78671.1"
FT                   /translation="MKEKSSKIFWSLLMFLVILLYAVLNMMVDWSNYLVVNLILFFIFK
FT                   SYFQYNLYTTIVLLIFIQGIYLIVFFITSIFYFNRIHLSTTFIMKRSLFRKDSYKINAS
FT                   IHPITFLCIKKHEKQFRSKISKYNKLRNKTLFLNKNQFFSQIMAKDFNLAIQNIMKITQ
FT                   KNKNVKTVTFKTHEVYIDKIQNLIEKLTYANQYNVSIKQRKWDRLYIEPFAYLSLWQSI
FT                   VYILKHPESLWRRRPVYEVKIKKIS"
FT   gene            38689..39057
FT                   /locus_tag="Thebr_0040"
FT   CDS_pept        38689..39057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78672"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT63"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0038"
FT                   /protein_id="ADV78672.1"
FT                   /translation="MNEDKILYLLEKVYTEFSNKFDEFAKRFDAVEERISGVEGKITGI
FT                   EEKIKVVEEEVKKLGIKIDTEITDKVRALFDDRQLLHEKIDEIDEKIDMLQLDVNNLTV
FT                   KTLYHDNRIKELSKKLGV"
FT   gene            39240..40244
FT                   /locus_tag="Thebr_0041"
FT   CDS_pept        39240..40244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78673"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT64"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0039"
FT                   /protein_id="ADV78673.1"
FT                   /translation="MSNFTARFGEVIVRSGIASIPDAVFSFQKELGLSVGECWFVAQIL
FT                   RFKWTTELPRPSLRKMAEYTGVSERTLHNYKNSLIGKGYLRVISRTNERGGQIANYYDF
FT                   TGLFEKIISLLEEKEQETNPFEDAVEEEIQEEATEKISDPLCKNFSAPLKNFQCPSEKI
FT                   TEPPLKKFQTKQNNNKTEKYKTEEYINNNPPNGGTNSQPSAGVVAEINKQYKKITGRDK
FT                   LSFFASLLEEYSAEKVMNAVAYLEKAMSRNKIDNPEGFIVSALKENWDTHPFEQEQKLK
FT                   KEFAPPKNYFNSYTQRTYDVEELERKLLEHSMGKFLSSNNESLEDEKVLFDDS"
FT   gene            40291..40569
FT                   /locus_tag="Thebr_0042"
FT   CDS_pept        40291..40569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78674"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT65"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0040"
FT                   /protein_id="ADV78674.1"
FT                   /translation="MLTKITTEEFKKLLKNKENEDFAKFIKTALKSTAKRDKVGDAFEL
FT                   ANEILEALKKHFGEEAKFLKGVYISALVLLLLPEYEEYKAFVKQLKH"
FT   gene            40569..41273
FT                   /locus_tag="Thebr_0043"
FT   CDS_pept        40569..41273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0043"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   tpd:Teth39_0041 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78675"
FT                   /db_xref="GOA:E8UT66"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT66"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADV78675.1"
FT                   /translation="MRRGVFVEFALLVLDYDGYYKLEIAGGYCDGNCSVCRKCTNNRNI
FT                   LTLIKEENAEFYQKYVLDHQTRTAKLCRRTAEALSLDESEKRILIQSALLHDVGKLLIP
FT                   FGALSKNGILSPFEMRIIQLHPSKGAEWLRERGFSEEITAVIKAHHERVDGSGYPYGLK
FT                   GDEIPYLAKVLSVCDAFEVMISGRHYKLSNSISEALDELKREAGKQFDEKVVIAFAEMW
FT                   YNEVKEEKKVVV"
FT   gene            41270..41527
FT                   /locus_tag="Thebr_0044"
FT   CDS_pept        41270..41527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78676"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT67"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0042"
FT                   /protein_id="ADV78676.1"
FT                   /translation="MKITKKIEIPAEILLSLKKSEDEFITELKRTAAVRYYKEKKLSLG
FT                   QCAVLAEMSEEEFIKYLSNFDASIFSFDNKEELLEDIKNA"
FT   gene            41520..41987
FT                   /locus_tag="Thebr_0045"
FT   CDS_pept        41520..41987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0045"
FT                   /product="nucleic acid binding protein"
FT                   /note="KEGG: tpd:Teth39_0043 nucleic acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78677"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT68"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0043"
FT                   /protein_id="ADV78677.1"
FT                   /translation="MRKVVANSTPLIILSNISKIEILKKLYETIYIPSGVFEEVNFTGN
FT                   SKNYDFIKVVNIKNKEAKQFFPVSLHKGEIEVMILAKEINADLCIIDDYLARKHAKNLG
FT                   LTVTGTLGVLVKAKEKNILKEVKPVMDEMLEKKFYIDKKLYNEILEICGEK"
FT   gene            42047..43084
FT                   /locus_tag="Thebr_0046"
FT   CDS_pept        42047..43084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0046"
FT                   /product="StbA family protein"
FT                   /note="PFAM: StbA family protein; KEGG: tpd:Teth39_0044
FT                   StbA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78678"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT69"
FT                   /inference="protein motif:PFAM:PF06406"
FT                   /protein_id="ADV78678.1"
FT                   /translation="MFKIGLDLGYGYTKGINETGRMVLFPSLVGNAYQRNLIGLFGQNL
FT                   NNLIENMHVVLRNGKEEQEEYFIGDLARREGRNVSYAFDENKINHPNTKAVLASASALL
FT                   FPSNDEPVHIVSGLPLEQYIHQKDELRDMLKNFKAIVEFKGYNILKIVKFDRVTVFPQA
FT                   AGAVYYAIMDDLQKYLIKGSYIGLIDIGYRTTDYIVFVVDGKLSLREDLSGTLDIGMSQ
FT                   LNNAADKLFTQKTGSKLDIPELIQLVNEGSIFYRGKVLNFEKELNEVKLEISRVIQDRI
FT                   KAVWGSKLDFFNTIFLAGGGAVSLFDSLKNLYENTVLVKNSQFANAKGFLKVAELEEKK
FT                   ERDRE"
FT   gene            43081..43263
FT                   /locus_tag="Thebr_0047"
FT   CDS_pept        43081..43263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmt:Tmath_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78679"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT70"
FT                   /inference="similar to AA sequence:KEGG:Tmath_0072"
FT                   /protein_id="ADV78679.1"
FT                   /translation="MIKERDLDYKGAWELMKQMVDYYTGEKKYLTRREIKYIIQVCENK
FT                   DKNIVKILNDIEGGI"
FT   gene            43266..43535
FT                   /locus_tag="Thebr_0048"
FT   CDS_pept        43266..43535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78680"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT71"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0045"
FT                   /protein_id="ADV78680.1"
FT                   /translation="MIKITLPKKKSMKEKVYEMWDELKLTGHMLIDQKDKSHVVTLEPE
FT                   REISIELIKNKLTKETVVEQVKSTYDSKAKEDMFTDDNLEDMDA"
FT   gene            43836..44123
FT                   /locus_tag="Thebr_0049"
FT   CDS_pept        43836..44123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78681"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT72"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0046"
FT                   /protein_id="ADV78681.1"
FT                   /translation="MKVYSFRTNKEDKDIEELLESLKEDKSQYIKNALRFYRDFGAKIA
FT                   KIEATLEKLEHSGIQAQIPPQTLEHEQDAGSETSDDERVLLESLEDILSL"
FT   gene            44147..44476
FT                   /locus_tag="Thebr_0050"
FT   CDS_pept        44147..44476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0050"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78682"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT73"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0047"
FT                   /protein_id="ADV78682.1"
FT                   /translation="MKKLYSILEPYDSWWNDEGEEKNLEAKKALQNFYKELKKLKPSKK
FT                   YEKNITHFSYIPYLVKIKKALDERKYMRACNEIISLMHYEPFLQGRIYYNVLKLLEKEV
FT                   AQDSA"
FT   gene            44523..45167
FT                   /locus_tag="Thebr_0051"
FT   CDS_pept        44523..45167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78683"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT74"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0048"
FT                   /protein_id="ADV78683.1"
FT                   /translation="MDQAYEFKYALEFTHQVLKNEKTKEDKILILDFMLDVIREDLKYD
FT                   FLTAIFYREEYFEKGVRIPLPFPYSYYDETGTKRSIYENVVGIKKVYLAEECILVFPWH
FT                   RGRIRESIKNIGKNEFQYDEFNHKAFYFSPVNICFVYNGMHSTAAGIGFKKGYIKANNY
FT                   DVTKLFPHVHTDGLYWYNSHNNQKLEELFDFRIGVIYEISKIKHYIEKDIT"
FT   gene            45623..47035
FT                   /locus_tag="Thebr_0052"
FT   CDS_pept        45623..47035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0052"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: tpd:Teth39_0961 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78684"
FT                   /db_xref="GOA:E8URH0"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:E8URH0"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADV78684.1"
FT                   /translation="MDSKDMQRLQTTQQRGYPLNREMEFQKTTEVHSISSASKDRRNDV
FT                   QRYTSKMLEMIVERGNMRAAYKRVVANKGSHGVDGMEVDELLPYLKENWATIKQQLLEG
FT                   KYKPQPVRRVEISKPDGGVRLLGIPTALDRLIQQAIAQILNRVYNHTFSDSSYGFRPGR
FT                   SAKDAIKAAEAYINEGYTWVVDMDLEKFFDRVNHDIIMSKLEKRIGDKRVLKLIRRYLE
FT                   SGVMINGIKVSTEEGTPQGGPLSPLLANIMLDELDKELEKRGHKFCRYADDCNIYVKSR
FT                   SAGNRVMKSIKKFIESKLKLKVNEAKSAVDRPWRRKFLGFSFYTKENEVRIRIHEKSIK
FT                   RFKEKVREITNRNKGISMENRIKRLNQITTGWVNYFGLADAKSIMKTLDEWIRRRLRAC
FT                   IWKQWKKIKTKHDNLVKLGVEEQKAWEYANTRKGYWRISNSPILNKTLTNKYFESIGYK
FT                   SLSQRYLIVHNS"
FT   gene            47356..47724
FT                   /locus_tag="Thebr_0053"
FT   CDS_pept        47356..47724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78685"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT76"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0050"
FT                   /protein_id="ADV78685.1"
FT                   /translation="MKKITVKVSDEIYSLLLDLSARRQETVSSIVRKILEKGLTQEAAE
FT                   SGIDAVTEAVRKAMRDVLRPTEDRLAKLMAKAAVAAATAMYMNVQTIADLGKHNAVEIY
FT                   NEARVKAAAYLKERDDNE"
FT   gene            47721..48902
FT                   /locus_tag="Thebr_0054"
FT   CDS_pept        47721..48902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78686"
FT                   /db_xref="InterPro:IPR041073"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT77"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0051"
FT                   /protein_id="ADV78686.1"
FT                   /translation="MSSPFVMKIAFYPPTAKNQARNSAHVQYIATRPGADKGELSIEDE
FT                   LEPDTPEWHTKYMHERPGSHGLFTAEEEIPDLGEVQKELKNHNGIVWRMVLSLKEDDAV
FT                   RLGYTTRESWEKVLRAALPEAAAKMGIPESNLRWAAAFHQTKGHPHVHVILWEKEPKRT
FT                   RGVLSHGERKDIRKIFIREIYAKERLALTAEKSAVRDLIRDTARSDIVNVLRKVESARV
FT                   KVRALDGGKPGLPPPLDQTTRDELLEKLKELSKIMPQKGRIALAYMPSEVKEKAKEITD
FT                   WLLKQPGFSQSVERYKDLAKELASHYTTNPEVLEKAAEKAYEDIQKRVAQIVLKGAAAL
FT                   QKDPSKVINTVWRSAWRALERERLRAEAEASIAAQKEMEKKRRMAERGESREI"
FT   gene            48892..50724
FT                   /locus_tag="Thebr_0055"
FT   CDS_pept        48892..50724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0055"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: tpd:Teth39_0052
FT                   TraG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78687"
FT                   /db_xref="GOA:E8UT78"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT78"
FT                   /inference="protein motif:PFAM:PF02534"
FT                   /protein_id="ADV78687.1"
FT                   /translation="MRFRIIVAVLILMLDFLFAPFLLIFPLYAKDYGFKEGLPKWEAYI
FT                   KERPLSGISLLLKKEDIKTTWLWLQPAVFAALISVLFPIYGRRKRKTDELGLPEAAGQG
FT                   QHGTARWRTEKEISKTFTVWNTNNNPPKGGFVVGFNSSNSKAWLDTGDTHGLVIGATRS
FT                   GKSRRIILPTIWTLARAGESMIVSDPKGELHSYSFKYLKELGYKVILIDLRNPYRGNQW
FT                   NPVLEIATKLEIGDYSTASQNAWDIANIITNQQPHIGVDPIWPQSQESLTAALILAVAS
FT                   SAPHEAKHLGSVYEILHRLGADGGELLDKYFRSVPREHPAASAYGVAALSEDRLRSSIF
FT                   TGTAAQLRLWSDPAVIWLTSDQDHELDAVGKEKAAVFIVIPDERSTRNVLATLYISQAY
FT                   QALVDLANKNGGRLAQRVNFVLDEFGNLPPIPDFDKKITVAAGRGMRFLLAVQDISQIK
FT                   AKYRELAQTITGNCAVWVYILTTDLETARIISGKTGQYTIRTESYSSQVKHTDYSHGTT
FT                   EGLTGRPLLLPDEVLRWPQDRALILQARQNPAILPLPDLSMWPASKDLIPSALEELKKE
FT                   VMSVPVWIPEIEFLEEEKNEEIDRTNKNLLSKLR"
FT   gene            50737..50979
FT                   /locus_tag="Thebr_0056"
FT   CDS_pept        50737..50979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78688"
FT                   /db_xref="GOA:E8UT79"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT79"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0053"
FT                   /protein_id="ADV78688.1"
FT                   /translation="MPTLVTGAFKLLNDALTWILYLIPAASGAAIGYHALMKQMSDGDP
FT                   SVTAAHNRAIRNVLIAGAIGMSAASLVKVVLAYFK"
FT   gene            51021..51878
FT                   /locus_tag="Thebr_0057"
FT   CDS_pept        51021..51878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78689"
FT                   /db_xref="GOA:E8UT80"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT80"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0054"
FT                   /protein_id="ADV78689.1"
FT                   /translation="MFSAITNMISDAVTNFFQNLLESLVSMFTSFFGDEMAVALKILNT
FT                   PYITNGIKLAQIIAGTLLALKVAAEALKTYILYNSGDSSAQPLELVKRTAFAAAMVSTS
FT                   PWLVTKVYTFGADLAKEVAALPAVKLENPVLNIVSDISQMSTALLLILLAVIVIWILIL
FT                   IQTAIRAVEIAFIAVSGPIMAVGLTRPDEGVWSVWWRELVVLSLSQAVQTFMIRGFLST
FT                   IANMYFTSEILSKLMLIGWLWVAFKTPSVLRQFAYHSGVGGAVGQAAQSAGSMYIMRKM
FT                   IMKG"
FT   gene            51884..52162
FT                   /locus_tag="Thebr_0058"
FT   CDS_pept        51884..52162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78690"
FT                   /db_xref="GOA:E8UT81"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT81"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0055"
FT                   /protein_id="ADV78690.1"
FT                   /translation="MYQVPKNISAKFEFFPGFGWKELFFVLIGLSIGLFVYLILSIFTK
FT                   SIIRYLIVLILTGLSYFAVVPGPDGNSVFSLIKYYLVISQINLAQNR"
FT   gene            52266..52847
FT                   /locus_tag="Thebr_0059"
FT   CDS_pept        52266..52847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78691"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT82"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2036"
FT                   /protein_id="ADV78691.1"
FT                   /translation="MQIIFHVDNIEEYLRKGKDYNFPAPPDRCPYPDCKCRVKLKKHGF
FT                   YYRYYLDGSNCIKIAIRRYICPVCKRTLSYLPDFCLPHFQYSFNMIVKSLKETLTREKT
FT                   LSSFISDLKRNFPTILFSRQHIYFYTKRIMNNLSFIIYGLRQIDPYIKLSETDSQRERA
FT                   REILDIISIVPLFSQRFYAHCQKSFLASLT"
FT   gene            52984..54309
FT                   /locus_tag="Thebr_0060"
FT   CDS_pept        52984..54309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0060"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; Transposase-like
FT                   Mu; KEGG: tpd:Teth39_2035 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78692"
FT                   /db_xref="GOA:E8UT83"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT83"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADV78692.1"
FT                   /translation="MLDEKAREAIALKRFSLISPVLNGQVKNQKEYFDALSDKPIEIPY
FT                   LGMRRYTPKTLRGWLYQYLRGGIEALKPGYRSDRGKYRKIDFELSERIKQKKLEHPEMP
FT                   NKLLYETLIGEGIISPDKVSISTFYRFLKNIPVKSLDKEKEGKTKRFSHEYINELWQTD
FT                   VMYGPYIKEGKTKRQTYLIAYIDDASRLCTYAHFYYTQNFLALRDSFKEAVLRRGIPKM
FT                   LYTDNGKIYRSTQFEYICASLGTSLIHAEPFSPHSKGKIERFFHTVRMRFLSTIDPTSI
FT                   KSIDELNMMFFKWLEDDYNRKEHSSIGMSPLDFFMSQISRVNMCGDIDMLNECFLIRVN
FT                   RKVNKDATLKVENILYETEEKFKGMRLEVRYDPQWLKDNTPLLLFHEGKKVGEAYKVNF
FT                   HENAKIPVEYIEDRKVVSENEDTVDFAAKPNPPVISFNDIID"
FT   gene            54326..55126
FT                   /locus_tag="Thebr_0061"
FT   CDS_pept        54326..55126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0061"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: tpd:Teth39_2047 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78693"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT84"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADV78693.1"
FT                   /translation="MFTQYFGMKFNPFSKEISVNDLYISEDIAELNARLKYLQETRGIG
FT                   LIVGEAGSGKSTALRRYAESLNRSTFKPCYFALSTLTVREFYQALAMILGETPSYKKVT
FT                   LFHQIQRAITELYYSQKITPVIILDEIQLVSNDVLEDLRIIFNFNMDSQNPYILILSGQ
FT                   PHIRNKLALNVNSALRQRISIKYVMQGLKKEEIQDYIKTRMKIAGVMDDIFTPSAYEAI
FT                   YSLTKGLPRIINNLVTASLLYAYSKRLREIDEEVIYQAQNEISL"
FT   gene            55399..56025
FT                   /locus_tag="Thebr_0062"
FT   CDS_pept        55399..56025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78694"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT85"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0059"
FT                   /protein_id="ADV78694.1"
FT                   /translation="MIGVFKKEKTVKKDKTKIEEQKRKAVQEWIPVKDVFEDLILLKDG
FT                   RYVCVLKVMPLNIELKSENEKKRIIQAVHEALNGLNDTMQILSIGRPVDLDQYLNYLQE
FT                   KSREETMSVKKRLLNEYLKYVASIVTSGEAIERRFFVMLSGKEKEELKAKTHELSNNLE
FT                   KSGLKVELAVDQDIIDLLFSFSHPSQAAFERAPAFNGPYLPPMYS"
FT   gene            56040..57824
FT                   /locus_tag="Thebr_0063"
FT   CDS_pept        56040..57824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0063"
FT                   /product="type IV secretory pathway VirB4 components-like
FT                   protein"
FT                   /note="KEGG: tpd:Teth39_0060 type IV secretory pathway
FT                   VirB4 components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78695"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT86"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0060"
FT                   /protein_id="ADV78695.1"
FT                   /translation="MKKKDNVSVLTGLVDMISPQALEFNAKQVVFNDQLARVLVIAGYP
FT                   PKVNAAWLSRIAGMPGVVCSVHIEPSDPTDLINSLNKAIGEYAGRLEMGGNALTMQRTE
FT                   QALKDAEELMRKIDQEQQQVFYVTVILMVLAPNQQELDRRTRQVEAALAASGMRGRVLI
FT                   FRQEEGLKAAGPFCTLPDEVKEAGARNMPAETVAASFPFTASGINDGSGIVLGKDRDGG
FT                   LVLVDIWKRGGDRTNSNWTILAKPGAGKSFTAKMLLLREYMQGSRVIIIDPEREYKEMC
FT                   RKLGGVWINCTGGEGKINPLQVRLRPVEEEDEENAVFQSPLALHIQTLRTFFSLYLRDL
FT                   TDTEKAALEDALVEVYKEAGITWDTDPRGVPNDKWPTVKELYEYCVKKAEENPETYGRL
FT                   SVLLKRAAEGADSYLWAGPTAVEADSDFIVFDVHDLQNAEDQVKRAQYFNVLSFAWNIL
FT                   ERDRRERTVLVVDEAWMLVDPQTPQAIAFLRDTSKRIRKYNGSLIVISQNVIDFLAPEV
FT                   QRYGQALLDNPTYKLLLAQGEKDLEAITTLMNLSEAEHDLLVNAKRGEGLFVAGTQRIH
FT                   IKIEAAPYEMQYLTGGGN"
FT   gene            57824..58768
FT                   /locus_tag="Thebr_0064"
FT   CDS_pept        57824..58768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0064"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: tpd:Teth39_0061 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78696"
FT                   /db_xref="GOA:E8UT87"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT87"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADV78696.1"
FT                   /translation="MHILSKILLAFLPDDLESIFKFALLFIVVPALLIALLFAGPITAA
FT                   EKIPLINTEQVKMYIYTANKVSDSTKNKYSQRIQIDWRQLVAIDAVRFQQDFSKANPAE
FT                   IEKLAKMFIKKVDEVEEIEGEFPNQVVKKYEVYKLRSLDEVLSLLNFSTAEKEKVKEFI
FT                   EFDFSLLLNSAANLPDNWAAVEKNFKWPVPGVYRITSGFGPRVDPVYGTMGFHSGVDIA
FT                   APTGKIVIAAADGEVGYAGWNGGYGNVIYITHNGGYETRYAHLSRIAVKKWQKVKAGDI
FT                   IGYVGSTGKSTGPHLHFEIRINGQAVDPLGFYR"
FT   sig_peptide     57824..57958
FT                   /locus_tag="Thebr_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.763 at
FT                   residue 45"
FT   gene            58783..59364
FT                   /locus_tag="Thebr_0065"
FT   CDS_pept        58783..59364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78697"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT88"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0062"
FT                   /protein_id="ADV78697.1"
FT                   /translation="MLISVIASDEIKNSLNDVGNVVFHYNEMLQQQNIKDVFYSLSRIN
FT                   TDVLILDLDFVNSKDFITVLQGYRIARPHTRIIVIINNRVAGDQTIATIVSLGIYDIVT
FT                   NKEAVKEVVFSPPATYTQAARWHTGEFLNFGVHDKDNEKGIVGEINIAKRQIEGIVKFL
FT                   GESYNCRNLNEGLLKIEQLLVKEVLYEQDY"
FT   gene            59348..59890
FT                   /locus_tag="Thebr_0066"
FT   CDS_pept        59348..59890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0066"
FT                   /product="SAF domain protein"
FT                   /note="PFAM: SAF domain protein; KEGG: tpd:Teth39_0063 SAF
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78698"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT89"
FT                   /inference="protein motif:PFAM:PF08666"
FT                   /protein_id="ADV78698.1"
FT                   /translation="MSRIIKIALITAVVFAAFMFVFMQNIQKTEKVVVVEKDIPAGTVI
FT                   SQDAVKVTDVPASVVRPNYAKSLADVIGKVVKEGRVQGDFIPVEILTSQDEKLLEAGHV
FT                   IMTIQIDKVEAKTLQSGDTVSFIVFDQTGSKVLEGFKVISVFSDSDKANLILNADLNAA
FT                   SELAPYIKLNSFKIVRR"
FT   sig_peptide     59348..59434
FT                   /locus_tag="Thebr_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.775) with cleavage site probability 0.679 at
FT                   residue 29"
FT   gene            59896..60612
FT                   /locus_tag="Thebr_0067"
FT   CDS_pept        59896..60612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0067"
FT                   /product="chromosome partitioning ATPase"
FT                   /note="KEGG: tpd:Teth39_0064 chromosome partitioning
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78699"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT90"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0064"
FT                   /protein_id="ADV78699.1"
FT                   /translation="MVITIFSPKGGVGKTTLTLALAKVLSEKSRVCVLECDFSPGDFVS
FT                   LLDLDKEKNIVNACLGDYKACIQRPQGEKFDVIVGGFPDMQENLKYADMEKLIKSLSNE
FT                   YDYVLIDLQPQISEVTVAALLKADKVLFVMEDDISAVSRTVGMFEYLRLHGFLDAGRTC
FT                   AVVNKVRGKKKYITAVDLGIPVIYHIPYLRKLNEYKDKKMLKHARNLKDALFGVKKEKS
FT                   LWRRLVNGFKRVKQKN"
FT   gene            60581..61738
FT                   /locus_tag="Thebr_0068"
FT   CDS_pept        60581..61738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0068"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   tpd:Teth39_2224 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78700"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8US69"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADV78700.1"
FT                   /translation="MALRELSRRINDGAVDVEKMTDEIREIMMKHHGKPNIKDILREEV
FT                   KEYLKKKYPFALDRLIEYTEMLYSSLYGLGIIEKYLKDPEVTDIHVNGTKIMYKKAGVK
FT                   IDAEEEFPNEQAVRVIQDRILAPLNKSINIANPSQDAELYDGSRALLVIPPESDKPVII
FT                   IRKHNLLNVPLKELVKTTIGLTKEMQEYFKKAVKDRKNIIVAGETGAGKTTFINSLGFE
FT                   IQEKHVVAVLEDTREIKLHIPYVYYFKTRKGTAEARSVTYSDILNDCLRADPDRIILTE
FT                   IRTPESAYELIHVLNSGHRGSMTTIHANSCLDALLRLEMLIQEFKNLDYRIIRKLISRA
FT                   VDIVVFLRLTEDEKGNLKGRELAEVIEIEGIDENGDYILKHVVGD"
FT   gene            61740..62645
FT                   /locus_tag="Thebr_0069"
FT   CDS_pept        61740..62645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0069"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   tpd:Teth39_2223 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78701"
FT                   /db_xref="GOA:E8UT92"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT92"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADV78701.1"
FT                   /translation="MAVSFLFGAAVFMVVVLLYSIRENKRLKLKRRLERHLVISQKNEF
FT                   SIVDLFGLGSFIEKLEKKLKKSGIKVDAEEVFLWFILFTIVILVFLSFKGFTLLGFTLP
FT                   VMLYYLIDYILDYLGRRKIRKTEEQFRDFVKMLGAYLKMVPSFAGAFIKAAEEAENPLK
FT                   EHTDRVLRRFQLGEDLEEALKEFKNIESTYIKVWIDSIIFAVRMKSDLSRVCERTAKKL
FT                   YERIKMSNRIAAMTVQAKSLMVSLVGIMAFMIVSTVSVSPDFIRTFSSPIGKLVIAYAA
FT                   LSYFISTLYILKRIDREMEL"
FT   gene            62642..63367
FT                   /locus_tag="Thebr_0070"
FT   CDS_pept        62642..63367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0070"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   tpd:Teth39_2222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78702"
FT                   /db_xref="GOA:E8UT93"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT93"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADV78702.1"
FT                   /translation="MRKIVSEKHLQKLGIRQDMIEKWDKEIKAVGGVKIFFFKAHDVLE
FT                   LFSFGVLILGGLIVLSVVGTVNGANIFALLSVVTGSIIMFYQYWKKPIDSYRESFYKEE
FT                   ELPAAIEIFINGLEVGMNKENIISYIVRTREGVVRDLLHEAQVRLDTGSSLKDALTYAA
FT                   SKSLNDHFKRFVKIITGEFASEQDIKENLEELLDEVREINYNKKTESASVLDNSLFFPI
FT                   FLGYFIPILIIFALPFVLS"
FT   gene            63424..63645
FT                   /locus_tag="Thebr_0071"
FT   CDS_pept        63424..63645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78703"
FT                   /db_xref="GOA:E8US66"
FT                   /db_xref="UniProtKB/TrEMBL:E8US66"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2221"
FT                   /protein_id="ADV78703.1"
FT                   /translation="MIRNMLMKVQNMVRKFLKDRKGESHLLSVIGMIAIVVGILVVVSP
FT                   TIRTNVSNMVTNALNTASGFFSNAVQGK"
FT   gene            63626..64045
FT                   /locus_tag="Thebr_0072"
FT   CDS_pept        63626..64045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78704"
FT                   /db_xref="UniProtKB/TrEMBL:E8US65"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2220"
FT                   /protein_id="ADV78704.1"
FT                   /translation="MPFKASDKQVIKMIRRFLKDNRGASQLISTAALLPILLFIMASIV
FT                   NISVVSNMQTLVNEAAFEGARIGIKSDTPEQTAQMAVLNFGDGITGWKMGDRLAVSTSL
FT                   KNDMLTVEVRYTFYLLGGQQKTLVGRSSLRIGDTP"
FT   gene            64042..64449
FT                   /locus_tag="Thebr_0073"
FT   CDS_pept        64042..64449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78705"
FT                   /db_xref="GOA:E8US64"
FT                   /db_xref="UniProtKB/TrEMBL:E8US64"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2219"
FT                   /protein_id="ADV78705.1"
FT                   /translation="MSILKRFFQDKRGDAVLLFLIFLVFLSLLFMQVVYYVTNGISARE
FT                   YLVKVCDEIAYNISLNALDINSAEKGEVVIDITKANKYAEDTFKNLNIPTKNIIVEIKN
FT                   NYVYVTIVVDGSYYKTTTDFVITGMAKVRDI"
FT   gene            64446..65267
FT                   /locus_tag="Thebr_0074"
FT   CDS_pept        64446..65267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78706"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8US63"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2218"
FT                   /protein_id="ADV78706.1"
FT                   /translation="MMKVLIISNDREYIKRAKKNYVDADVVFSTESAEIIVRKNRYDFI
FT                   VSNMLGKKFNNIEVKDIEEYKSKNFITTKQEVIAVYSFKGGVGKTTLVKTLFENFNKDV
FT                   KVLIVDLNFQDGGSDLSFALDLPVLPHIGMWLRERIKESFFENLIEYSPNVFILQSPPK
FT                   VSLVKDISGNDIDTIVKFARSKFDVIIFDLPDEFNEIVKAALDNASKIIVLSQGTKGEL
FT                   ARMKEFPYEYLTLFIKPEKGFGKYAKMLNLKYEIIDNIKKEIDRVYDFILL"
FT   gene            65651..65845
FT                   /locus_tag="Thebr_0075"
FT   CDS_pept        65651..65845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tit:Thit_2099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78707"
FT                   /db_xref="UniProtKB/TrEMBL:E8US62"
FT                   /inference="similar to AA sequence:KEGG:Thit_2099"
FT                   /protein_id="ADV78707.1"
FT                   /translation="MSMKEMRDKVMEFLREHLEIDEFTLEDCNFMPGGVFVKDREGKSM
FT                   LFFYDFKKDKVDYWFGDEK"
FT   gene            65931..66284
FT                   /locus_tag="Thebr_0076"
FT   CDS_pept        65931..66284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78708"
FT                   /db_xref="GOA:E8US61"
FT                   /db_xref="InterPro:IPR031451"
FT                   /db_xref="UniProtKB/TrEMBL:E8US61"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2217"
FT                   /protein_id="ADV78708.1"
FT                   /translation="MAQIEEIKKFLNDAKELMKAGTFDFVPRKKNMDSIKEAGLTIKHV
FT                   KEIIMDLTYKNYYRGPSVDVGSNRQGSIWEFGYDIEGTDFYIKLKIEQRGEKECLVCLS
FT                   FHIAEYPLIYPYK"
FT   gene            66298..66879
FT                   /locus_tag="Thebr_0077"
FT   CDS_pept        66298..66879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0077"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: tpd:Teth39_0073 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78709"
FT                   /db_xref="GOA:E8UTA0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022452"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="InterPro:IPR032758"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTA0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADV78709.1"
FT                   /translation="MKKFCPVCGIEQETEIIEKEEASNVRGDEIKALARIRVCSVCGEE
FT                   LFDEELEEGNIKRVYDIYREKHGILSTKEIRNIRENYGLSQRAFAKLLGIGEASIARYE
FT                   TGALPEKSLSNLLMLLKDPKNMEKLLEKNEDVLSQREKARLIRRIEEMKEERENTLKIS
FT                   EELYKLLEEKAKREGKTTDKFVEEILIKVI"
FT   gene            66959..67270
FT                   /locus_tag="Thebr_0078"
FT   CDS_pept        66959..67270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78710"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTA1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0074"
FT                   /protein_id="ADV78710.1"
FT                   /translation="MIDIKRTIAIVGIGLLVGSATIAAPKLIETYKEKKAAAVQEQVQE
FT                   QKETQQQQQEQQEQIQQEEQKQEQTQEEVQQQQQEQVQNQEQVQQQEQNNSKSKTKQQ"
FT   sig_peptide     66959..67030
FT                   /locus_tag="Thebr_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.976 at
FT                   residue 24"
FT   gene            67718..70987
FT                   /locus_tag="Thebr_0079"
FT   CDS_pept        67718..70987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0079"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   tpd:Teth39_2214 peptidoglycan binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78711"
FT                   /db_xref="GOA:E8US58"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:E8US58"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADV78711.1"
FT                   /translation="MSKIKVNKRKIIVFTVIGILLLAFILKGLAYMDIISFGFNQNRTR
FT                   YNYEMYGGIAATQVTSTTRAKLGWYVTGLGQSLSQPLIISPKELGINASQPIVIAFNGN
FT                   NLYAYESISPYSKSLYDFNTSTSPYTFTPKIVPNSNKKWGPLPVYGSSTVPANPSGSHP
FT                   TYYVSPNGNKYIAAGSKDGYVFIYQIINGSPVLKVRINTTTGGGTDIVSAPLMMRWQGY
FT                   NIVVVGDGNGGHVSIGYFTDDFSDVGITDIALGTTYTRISSSAAPVNAGETSPETGFII
FT                   GTTHEPNKTADGYLYRIRFSDLFNVISSSTISSRTDILKLGSTGNGVKILQETLNIIGY
FT                   SLVEDGQFGSGTEAAVRDFQSKNGLTVDGIVGPQTWQKLGSKLTRTYIRPVYQWNYAWG
FT                   INISKAYAGAGIGIPASFSVDGSNAYFTDVLGGIYKINNIFSSTLNLTVNGNLRNTNNL
FT                   VNHSPAVDDRYLYIPYYYSDSSKQHGKIVVLDKNNLNVIKQIDFSSSSLKSQLPNSPNY
FT                   IVYSAVSVGADRIYANVGNYFVTIKKSDWTIDGDGTIQLNAPATGEVSIAHGLVATETS
FT                   DGIYVYYLAKNGIDLAITNVNPIGYMEPNKNYTVQVTVSLGNSSTSIPATVALYDAGSF
FT                   NFNTVITGDPVRLNTANAVASAQITLSPNSSQTVNLSFTGTSSDRNLIAVVQPNPPSNP
FT                   DSYLQYWDYNQTNNTRQFTAPAKRLVDLYVTNLNAGTSNMVGGHTYTGSVVVGLQNASF
FT                   ISGYPVTGTLKIYDAANPSSPFKTQTVSFTSNTTQTVSFNYTGKSSDMILVAEISLASA
FT                   DKYYETNLSNNKIQTLVKANNGVDLYIASINPGTTYVVPDETYTGSVTVGLQKSYAFPV
FT                   NGVVKVYDKADSSVFLTKSVQFNSNSTQTFSFSYPGKNTDITLVAEIQLTDTNKYDLDL
FT                   SNNKKEVTVPYSSEMDKLRGTVTISKTPQYVFTNKHTREDGSVCDMTLNISYTFNKKIT
FT                   SIRAVHVINRYQNKGVLYVEPYSVIKNIGDVTGSAVMKFQYDKPGDENSTLYIYFTAED
FT                   GKTAEVQLKIPVNGFYADSKFNLPDPQWKKSEQDNWTVIFK"
FT   gene            70984..71370
FT                   /locus_tag="Thebr_0080"
FT   CDS_pept        70984..71370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0080"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   tpd:Teth39_0076 peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78712"
FT                   /db_xref="GOA:E8UTA3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTA3"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ADV78712.1"
FT                   /translation="MKILILLILFFAAVEDIKKMEVGYIYPASILILSFINVLLNPYIN
FT                   LNFMLLNSLLIFIVLFLFWLLGGIGGGDVKILTALAFYAGFKIWDILLFSSLIFLLYSL
FT                   ALRKFKAKIPFMPAVVAGTLLSFL"
FT   gene            71400..71918
FT                   /locus_tag="Thebr_0081"
FT   CDS_pept        71400..71918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0081"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   tpd:Teth39_0077 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78713"
FT                   /db_xref="GOA:E8UTA4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTA4"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADV78713.1"
FT                   /translation="MEDLIKHQYSVGVLCRNIGIYIGLPLKEIKLLETAAFFHDIGKLF
FT                   VPKSLLNKKEPLSIEEFEVVKMHSLYGAELLRKIGFDSIVVSAVRHHHERYDGRGYPDG
FT                   LHGEKIPLCSRIIAVADAFDVMTAGRIYKKPISNDKAVEELIRCSVTQFDPEVVKIFVK
FT                   MFKEEDAYV"
FT   gene            71911..72939
FT                   /locus_tag="Thebr_0082"
FT   CDS_pept        71911..72939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78714"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTA5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0078"
FT                   /protein_id="ADV78714.1"
FT                   /translation="MFKVGLDLGYGYVKGINEKGKEVLFPSLVGNAYERVLSGLFGTDN
FT                   NKADNMHVVIVNENKEEYFVGELARREGKNVSYAFDEDKIYHPNTRALLTASCLLLLPE
FT                   EEVPVHIVTGLPLEQYIHKKEEFKNMLKNFKVMAYFKGDEKVKTIKFEKVTIFPQAAGA
FT                   VYHAVMADIQKYLVKGSYIGLIDIGFKTTDYIVFMVEDKLILREDMSGTVEVGMSALNN
FT                   TVDKIFTQRTGSKIDVSELIRLISDGKIFYKGRELDFTKEIDAVRSEIARVMKDKIKLI
FT                   WGSKLDFFNTVFLAGGGAKELVEYMKDFYEKIVLVKNAQFANARGFLKVAELEEKKAVN
FT                   VR"
FT   gene            72953..73129
FT                   /locus_tag="Thebr_0083"
FT   CDS_pept        72953..73129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmt:Tmath_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78715"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTA6"
FT                   /inference="similar to AA sequence:KEGG:Tmath_0072"
FT                   /protein_id="ADV78715.1"
FT                   /translation="MGKRIRDEEELNYKNVWELMKQMVDYYTSEKKYLTRREIKYIIRV
FT                   CESGQPSIPIKER"
FT   gene            73398..73706
FT                   /locus_tag="Thebr_0084"
FT   CDS_pept        73398..73706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78716"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTA7"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0079"
FT                   /protein_id="ADV78716.1"
FT                   /translation="MKDKKYSFRIRENDEDIEEILSRLSSNERSEFIRSAIRFYAEFKS
FT                   KLDDIDNKLEEILKKLETKSESLSVSPSVSQSNNEENQKTDETEKLLIESVMDLLSL"
FT   gene            73926..74774
FT                   /locus_tag="Thebr_0085"
FT   CDS_pept        73926..74774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0085"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   tpd:Teth39_0080 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78717"
FT                   /db_xref="GOA:E8UTA8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTA8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADV78717.1"
FT                   /translation="MDRITRKTLLYKTGVEYGDYTINHVEGCAHGCKFPCYAYMLAKRF
FT                   GRIKSYEEWIKPKLVSNSLEILDKELPKLKDKINFVHLSFTTDPFMVGYPEVTNLSLEI
FT                   IKKLNSNGIKVTTLTKGIYPDELLDKNSYSEYNEYGITLVSLDENFKKEYEPYSSDYKD
FT                   RIASLKKLHNAGLKTWVSIEPYPTPNIINQDLRVILNEVAFVDKIVFGRLNYNKKVREY
FT                   LWYKEFYNYCSDVVIRFCEQRNILYHIKDGTITDDAPYILKGYQNDTQDLFFKHTQRAV
FT                   K"
FT   gene            74896..75981
FT                   /locus_tag="Thebr_0086"
FT   CDS_pept        74896..75981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78718"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTA9"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0081"
FT                   /protein_id="ADV78718.1"
FT                   /translation="MFFNEVKSQSLIKKEIVVKYFDAWAKIMNKRSDRLGYIDLFSGPG
FT                   NYEDGTDSTPIAIMKLILKNNDYRNKFVTVFNDKNKRYIGKLESAISNLENIKSLKYEP
FT                   IFLNLELDIQTSDIFAATSIIPSLIFIDPWGYKGVTQKLISSLTKDWGCDAILFFNYNR
FT                   IRSGIKNPKVEEHMISLFGEKRYLKLREELNKSNCLDKESLIMNEFREAMSDIGIEYIL
FT                   TFRFKNEDKEDTSHYIVFLSKNFTAHNIMKEVMASLSSDKIHGVAKFEYIPDKERQLSL
FT                   KDLYENPLDELRNELLTQYAGKTITFERLFYEHSKNKPFIKKNYKEVLTRLEEEGKILC
FT                   NPDKSRRKKNTFSDKVVIKFL"
FT   gene            76466..77089
FT                   /locus_tag="Thebr_0087"
FT   CDS_pept        76466..77089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78719"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTB0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0082"
FT                   /protein_id="ADV78719.1"
FT                   /translation="MQLTKRDLEILYWINRMRYVTVNQVAKKFKIGIWYTYKRLKKLCD
FT                   DEYLYSLRIFRNKPGVYICTKKGAEISGSNLWAPKHYVNLANYEHDLKVVDLSIELERQ
FT                   GEWISMRELRQDSKTDMIPDGVLIKDGKKIAVEVELTKKSERNLKKKMGYYKRSIDYDE
FT                   IWYFVSSRVVYDAVEKAAKEMDYVKIFYLSEVLKDEQQRAYANR"
FT   gene            77058..78734
FT                   /locus_tag="Thebr_0088"
FT   CDS_pept        77058..78734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0088"
FT                   /product="type IV secretory pathway VirD4 components-like
FT                   protein"
FT                   /note="KEGG: tpd:Teth39_0083 type IV secretory pathway
FT                   VirD4 components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78720"
FT                   /db_xref="GOA:E8UTB1"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTB1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0083"
FT                   /protein_id="ADV78720.1"
FT                   /translation="MNSRELTQTDKIAILVIGLVGALMFLPGIILGLMIYTAADRLKNK
FT                   KWMVYAAVAAAVTLVILTVKDFNMLILDYFKLILETYKSLFNSKIPHNLDWIVLIKVGI
FT                   PVGFTLSLMMELYTAAQPEWVKKKKKIGKDKERSFNERLVKKLEKLSQPDDGTLIGIDE
FT                   AGNTVKITDEELNGHCLVLGATGAGKTTTLMNFIESAARRGIPVIIVDGKGEIGFAEKV
FT                   KNMAEKYNQKFYLFSMVTQEGNMHYNPLRVGNFTELKDKLISLSDWTEPHYKFLSERYL
FT                   QSAIRILQNTNNRVDLVNISKKLNYNALLEEAKKLVREGEMDKNEYEAFYDMIDSAKKD
FT                   IIGLVNRLAVFSESEIGELLSDTEDEGTIDLIKCIEENAVVFFSLDALRFSEYSRLLGR
FT                   LIVIDLKTTAARMFESNKKVFTIFDEFGVFAGPQVTDFINKSRAAGFHVILSTQELADL
FT                   RIEGKIELMEQILGNTNIKIIHRQDVPVSAELLSSLIGTRDDITITMQVNEISPTGMGT
FT                   VKEEKSFIVHPDEIKRLKRGEAFVVRKFPAFFVEKVLVRKV"
FT   gene            79857..80105
FT                   /locus_tag="Thebr_0089"
FT   CDS_pept        79857..80105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78721"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTB2"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0084"
FT                   /protein_id="ADV78721.1"
FT                   /translation="MPEITRFYGIVIKMYFGDHFPPHFHAIYGEYIGVFDINTLKMIEG
FT                   DLPRRARELVVEWASKYQRELLEMWETQVFRKLPGLE"
FT   gene            80112..80366
FT                   /locus_tag="Thebr_0090"
FT   CDS_pept        80112..80366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0090"
FT                   /product="Protein of unknown function DUF2442"
FT                   /note="PFAM: Protein of unknown function DUF2442; KEGG:
FT                   tpd:Teth39_0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78722"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTB3"
FT                   /inference="protein motif:PFAM:PF10387"
FT                   /protein_id="ADV78722.1"
FT                   /translation="MYKVVSVKPTDDYKLLVTFDNGIVKEYDMKPKLNEWQFELLKSKA
FT                   FFKAVKVDPGGYGVSWNSEMDLSEYELWKNGKEVNHSLN"
FT   gene            80873..81718
FT                   /locus_tag="Thebr_0091"
FT   CDS_pept        80873..81718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0091"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78723"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTB4"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0086"
FT                   /protein_id="ADV78723.1"
FT                   /translation="MNLAYGEMEPQDNIISKENARNIFLNTIKKEMPEILHTLYNNVYS
FT                   IYKQLIIEIEEAKKVQTNYISRLNKYKNKKNEFTILAWNDKDIEDAINHYINELTDEFY
FT                   PDLIPLKDELIKWAERYNINCSWILETAIETMSHWYRLSPYVGSKIYEEWQYRGVVFWG
FT                   LDLPLFEFPEKFKWDIAFETEKQFKEKVQAKFNEYLNKYIEKCKMEAQEKNYVKGTEKR
FT                   QVEHFEWFVRYQVQGWSKEKIAREYHVTRQNVSNAINEIADLVGLEPRPTSKGGRPKKG
FT                   "
FT   gene            81827..82030
FT                   /locus_tag="Thebr_0092"
FT   CDS_pept        81827..82030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0092"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: tpd:Teth39_0087 DNA binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78724"
FT                   /db_xref="GOA:E8UTB5"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTB5"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADV78724.1"
FT                   /translation="MDKKLLRLPEVARILDLKEDRVYALAREGLLPVIRIGRQLRVDPD
FT                   KLQEWLDNGGQGYPGGWKREAE"
FT   gene            82251..82460
FT                   /locus_tag="Thebr_0093"
FT   CDS_pept        82251..82460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afn:Acfer_1949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78725"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTB6"
FT                   /inference="similar to AA sequence:KEGG:Acfer_1949"
FT                   /protein_id="ADV78725.1"
FT                   /translation="MLTPLKAIRKKCLECSNYQYKEVELCPIKDCPLYPYRLGKRPSTI
FT                   KGNAKKHEIAEDELSITEVIDLLE"
FT   gene            82484..83095
FT                   /locus_tag="Thebr_0094"
FT   CDS_pept        82484..83095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0094"
FT                   /product="zinc finger, CHC2-family protein"
FT                   /note="KEGG: tpd:Teth39_0088 zinc finger, CHC2-family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78726"
FT                   /db_xref="GOA:E8UTB7"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTB7"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0088"
FT                   /protein_id="ADV78726.1"
FT                   /translation="MINSAIDKFTLIKDSIPLVQAIEYYGLHPIKRGRYHWIKCPFHND
FT                   KNPSLAIYEESFYCFGCGAHGDVIDFVARYFNLEPLEAVYRLAEDFNVPLPEERRLTKE
FT                   EKKKIQQRIRQKQEEDKLYNDFLKAVDETYDYLCELNHLYTKIKQAISEPKDMELSEFV
FT                   EACHEQDLINYWLDLLLEGNIQDKLFVVEEVKQWKLSKKL"
FT   gene            83071..84453
FT                   /locus_tag="Thebr_0095"
FT   CDS_pept        83071..84453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78727"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTB8"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0089"
FT                   /protein_id="ADV78727.1"
FT                   /translation="METKQEVIEAIKKFKQERQLPNTEKFFNTIIPQRQKDNIQEEEIE
FT                   EAIPWPEDLPEAAYHGLIGEIIRAIEPYTEADNVALLMSFLTTIGNYIGKNIYTKVAAD
FT                   THGTNIFTLLIGDTAKARKGTSLGPVREAFKRIDEDYIKDKNVEGLASGEGLIWAIRDP
FT                   IVEKVKDKKTGEFKEELTDLGVEDKRLLVTESEFATILKRMQREGNILSPIIRQAWDGY
FT                   KIQSLSKNNPAIVTGPHVSIIGHITVEELRNHLRNVELFNGFANRFIWQCVRRSKLLPE
FT                   GPVIPDTIYNEIIQKLDDVFRWARENKGEIRRDDEATEFWKEAYPILTEDKDGVIGAIT
FT                   SRAEAQVLRLSLIYAILDKSKVIRKEHIEGAIAIWQRSEQSIEFIFGDSSGDEIQDRIL
FT                   EALKRGPMTQTEIFVNVFNRKIPAIRIRDTLQRLSAKGLISGKSIPTKGRPKTVWELNE
FT                   QK"
FT   gene            84707..85126
FT                   /locus_tag="Thebr_0096"
FT   CDS_pept        84707..85126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0096"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78728"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTB9"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0090"
FT                   /protein_id="ADV78728.1"
FT                   /translation="MEAKSYWEDKNILNKVKKAWEQKQKWDEDKAYNYLKEKVEELAKK
FT                   YYENGSYGAITWIEKHNPTLNQKHNEAMEKVNQAFREKSISKLYEGVAELYSVFAEIEE
FT                   AYKKAKEMAKKYEVDIYTIYWDEEIKAYKIVSKNL"
FT   gene            85326..85481
FT                   /locus_tag="Thebr_0097"
FT   CDS_pept        85326..85481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cla:Cla_1174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78729"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTC0"
FT                   /inference="similar to AA sequence:KEGG:Cla_1174"
FT                   /protein_id="ADV78729.1"
FT                   /translation="MLTNANLVKLKVLREWKGHRRVTKRSQKRAEGEQKSSKKVAKEMQ
FT                   KGVEEV"
FT   gene            complement(86083..86253)
FT                   /locus_tag="Thebr_0098"
FT   CDS_pept        complement(86083..86253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0098"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="KEGG: tpd:Teth39_0091 DNA binding domain-containing
FT                   protein; TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78730"
FT                   /db_xref="GOA:E8UTC1"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTC1"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADV78730.1"
FT                   /translation="MEEYFTVKEVSEKLKLNTMTIYKWIKQGKIRAIKLGDTWRISESE
FT                   LNRILNENKNV"
FT   gene            86494..86856
FT                   /locus_tag="Thebr_0099"
FT   CDS_pept        86494..86856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78731"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTC2"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0092"
FT                   /protein_id="ADV78731.1"
FT                   /translation="MPSEVYVKLEIEEDHLKRLSNLLERDKTHLQDKERIALFHILSGK
FT                   DSLYQNIDKIYDFKDHTIKPECLDDGEWTNEDRKLIALAFNLYNNYKITPLEVFSGLSK
FT                   DSFLLALAGIVERIYS"
FT   gene            86990..88201
FT                   /locus_tag="Thebr_0100"
FT   CDS_pept        86990..88201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0100"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   tpd:Teth39_0093 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78732"
FT                   /db_xref="GOA:E8UTC3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTC3"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADV78732.1"
FT                   /translation="MARQRGSVKEIIKGKKYKISFYIGTDGNGKRKYYIETIECKNKAE
FT                   AQKYLAKKIVEYDTGTLPIDETNITVKDYLKKWLETKKSSLALKTYNDYEQKIRLYINP
FT                   AIGNYKLLKLTPLIIQNMYNNMLEQGLSARTIRYTHTVLNEALKQAIKWQMLRYNPCDG
FT                   TTLPKQAKKEMKVLTPEQAKKFLEACVYNRWGILFELLLISGMRPSEALGLKWEDIDWK
FT                   NNRIAVQRTLTRVKNNWQLKEPKTPQSRRTIPLPREVMNDLKEHRKQQSKEKLKAKEYI
FT                   NYDKDKNKFKPEEWEEKLKDPKVYVDYGLVFATETGRPLDLANINYQYFKPLLKNAGLP
FT                   NIRLYDLRHTCATLLLLAGENPKVVSERLGHANITLTLDTYSHVLPTMQEEATQKLKQM
FT                   LFGS"
FT   gene            88832..89053
FT                   /locus_tag="Thebr_0101"
FT   CDS_pept        88832..89053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78733"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTC4"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0094"
FT                   /protein_id="ADV78733.1"
FT                   /translation="MPKKNEICVIDRFEGDWAVIEWKDKIFNFPRELLPKKVNEGDVLI
FT                   FNVDVDKSETEKRKKAIEDLAKDLFKDE"
FT   gene            89104..90060
FT                   /locus_tag="Thebr_0102"
FT   CDS_pept        89104..90060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0102"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="KEGG: tpd:Teth39_0095 beta-lactamase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78734"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTC5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0095"
FT                   /protein_id="ADV78734.1"
FT                   /translation="MYKKRLLLPFILILFAFILTNYTIFDNTLTHEVQQVLQDEGIKKQ
FT                   HEAVKKSATDSLTVNYIDVGQGDSIFIQTPSGKTMLIDAGTPEMGSKVIKYIKSQGINK
FT                   IDVLIGTHPHNDHIGGIVEIIKTFKIGKFYMPKVTTTTRTFEEVLKAAKSKGLSINVAK
FT                   TGVVIDLGDGIIAKMLAPNSSHYEDLNNYSAVIKITYGNTSFLFTGDASEQSEKEMLSK
FT                   GYNLKADVLKIGHHGSSSSSTWAFLKAVHPKYAVISCGKYNDYGHPHKETMKKLRSLGI
FT                   IVYRTDECGTVIAVSDGKTINFNVEPGDNLSGSEIKR"
FT   gene            90147..91394
FT                   /locus_tag="Thebr_0103"
FT   CDS_pept        90147..91394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0103"
FT                   /product="Uncharacterized conserved protein UCP033563"
FT                   /note="PFAM: Uncharacterised conserved protein UCP033563;
FT                   KEGG: tpd:Teth39_0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78735"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTC6"
FT                   /inference="protein motif:PFAM:PF06245"
FT                   /protein_id="ADV78735.1"
FT                   /translation="MATVKPFKAIRPVPGLADKIASLPYDVVNTEEARNLAKDNPYSFL
FT                   HVDRAEIDLAPSINPYDEIVYEKARENFDRMLKKGLLIKDNEENCYIYREIMNGRSQVG
FT                   LVATVSIDEYLEGIIKKHELTLPEKEQDRINHMDYCDAHTSPVFLTYKANQELKKLLNS
FT                   WMESKNPIYDFTSEDEIRHTVWIIDDKSLINKITSVFKAIDYLYIADGHHRAAASVKVG
FT                   LKRREQNPDYKGDEEFNYFLAVLVPHDEVYIMPYNRVVKDLNGYSESEFIEKIKEKFEV
FT                   EKCNEGQPFNPSQKHTFGMYLSGKWYKLTAKGGTFNPSDPIESLDVSILQKNLLDPILG
FT                   IKDPRTDKRIDFVGGIRGLEELERRVKEDMKVAFSMHPTTVEDLIAVADARMIMPPKST
FT                   WFEPKLRSGLFIHELR"
FT   gene            91847..93259
FT                   /locus_tag="Thebr_0104"
FT   CDS_pept        91847..93259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0104"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: tpd:Teth39_0149 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78736"
FT                   /db_xref="GOA:E8UTC7"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTC7"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADV78736.1"
FT                   /translation="MDSKDMQRLQTTQQRGYPLNREMEFQKTTEVHSISSASKDRRNDV
FT                   QRYTSKMLEMIVERGNMRAAYKRVVANKGSHGVDGMEVDELLPYLKENWATIKQQLLEG
FT                   KYKPQPVRRVEISKPDGGVRLLGIPTALDRLIQQAIAQILNRVYNHTFSDSSYGFRPGR
FT                   SAKDAIKAAEAYINEGYTWVVDMDLEKFFDRVNHDIIMSKLEKRIGDKRVLKLIRRYLE
FT                   SGVMINGIKVSTEEGTPQGGPLSPLLANIMLDELDKELEKRGHKFCRYADDCNIYVKSR
FT                   SAGNRVMKSIKKFIESKLKLKINEAKSAVDRPWRRKFLGFSFYTKENEVRIRIHEKSIK
FT                   RFKEKVREITNRNKGISMENRIKRLNQITTGWVNYFGLADAKSIMKTLDEWIRRRLRAC
FT                   IWKQWKKIKTKHDNLVKLGVEEQKAWEYANTRKGYWRISNSPILNKTLTNKYFESIGYK
FT                   SLSQRYLIVHNS"
FT   gene            93416..94858
FT                   /locus_tag="Thebr_0105"
FT   CDS_pept        93416..94858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0105"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: tpd:Teth39_0098 peptidase M1, membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78737"
FT                   /db_xref="GOA:E8UTC8"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTC8"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ADV78737.1"
FT                   /translation="MKIKQKALLGLVIIVIIGLVLYLLPEETQLTSYTIEAKYDDQNKI
FT                   IYATQTVKYINTNDIPLKEIYFHLYPNAFKTQENLPFTKEELPFAYPNGFQPGFIEIEK
FT                   VTFDKDIPATYELEEPNEEILKINLPKELKKGETIEINMTYKVQIPPCRSRFGYGNNTV
FT                   QIGNWYPILSVYDKNGWNNDPYYIFGDPFYSDIANYKVKLSVPKKMIVASTGEIKQEKN
FT                   YGDSKELVIEAQKVRDFAMVLSTKFKIAEQQVDGIKVKSYYFTEGYGDKALKFAVDAIK
FT                   FYNDYIGKYPYKQYSVVQTDFYMGGMEYPNLVMISKDLYTKANLFHLEYVIAHETAHQW
FT                   WYGVVGNNQIKESWLDEGLTEYTTIMYIERYYGKATADEIYRLVIEGEFNKFLNTNSDI
FT                   SLAKTLADFKEWKEYTNIAYNKGAMVFYNLRNLIGDEEFKKVLQNYYDKYKYKIATTQD
FT                   LIDVVDSVTGKDTGGFFQEWFY"
FT   gene            complement(94855..95838)
FT                   /locus_tag="Thebr_0106"
FT   CDS_pept        complement(94855..95838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0106"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: tpd:Teth39_0099 DNA
FT                   replication protein DnaC"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78738"
FT                   /db_xref="GOA:E8UTC9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTC9"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADV78738.1"
FT                   /translation="MNENIIHEILKEYEMKRDRALKDALNRKNKLYKEIPELEKIDEEI
FT                   KKVGIEITQSIFKEPENGRELLNLLKERLNNLKKKKAYLLESNGYPEDYLEPKYECNIC
FT                   KDTGYVNRKRCKCFDQKLINIYYKQSSIAEILKKENFSNFNFEYYSDKPYGDKPSPRSN
FT                   MKNIVEFSLNFIKNFDTTAESLFFYGDSGLGKTFLANCIAKELLDRGKSVIYRTAPDLI
FT                   EGLRINKLNADSSSYNEYLELLKECDLLIIDDLGTESITAFSLQEFFNILNTRLLLGKK
FT                   FIISTNLLLSEIMAIYPERIYSRIFGHFKLLNFYGEDIRLKRKMII"
FT   gene            complement(95831..96805)
FT                   /locus_tag="Thebr_0107"
FT   CDS_pept        complement(95831..96805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0107"
FT                   /product="primosome, DnaD subunit"
FT                   /note="TIGRFAM: primosome, DnaD subunit; KEGG:
FT                   tpd:Teth39_0100 primosome, DnaD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78739"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR017019"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTD0"
FT                   /inference="protein motif:TFAM:TIGR01446"
FT                   /protein_id="ADV78739.1"
FT                   /translation="MSVFRFLNENDDWGSTPISNYFINHFMLDAPGEYVKVYILGLKYC
FT                   YYGNEISLKTLADKLFMSDIEIDRALKYWEKSGLVKLKYIDGEYTVEYLPVIPQPTLNH
FT                   SVSLQDPQVKQMFEAIELTLGRPLTSTEMETYLSWIDEYGFSLEIITMLVSYCASKNKT
FT                   SLRYMEKVAIAWHDAGLKTALDVEEYLKAENKRWQNYRRILNALGLKEDELMESHKEMM
FT                   DRWMDDLGFDVDVIIKACNECTLKLNEPSFPYINKILINWFNEGIRTVEDLENKKSSTK
FT                   KKTPVTSGFKAPKNYFNSYSQRSYDIEDLEKKLLAHSRGELNE"
FT   gene            97043..98401
FT                   /locus_tag="Thebr_0108"
FT   CDS_pept        97043..98401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0108"
FT                   /product="Peptidase M23"
FT                   /note="KEGG: tpd:Teth39_0101 peptidase M23B; PFAM:
FT                   Peptidase M23; G5 domain protein; Peptidoglycan-binding
FT                   lysin domain; SMART: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78740"
FT                   /db_xref="GOA:E8UTD1"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTD1"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADV78740.1"
FT                   /translation="MGKVGDKSYKFFLGLLKTYKNNIIAFVVALSIGLSFIVYEEGFAY
FT                   KITVDGETIGITKNIDEVKSFIEELHKKEKQKTGTDIVLNQQIKFERVRVSNKELTDVH
FT                   KIYANLENAMSFSCKAAAIIVDGKFVTALKNEEEANKVLEMLKNKYARDSDRTYFKEDV
FT                   KIEEKYIPPKYLVSFEEALKILQQPVKKAVTYTVKENDSLWSIARAHDMYIDDILKLNP
FT                   GLTENLKPGQVIYLSSAVPNVTVVTEKRIVYKEKIPFETKLTKDDKLYTNQSKVLVEGK
FT                   KGLKEVTAVVVSYNGVEVSKEVKSENILEKPINKIVAVGSRRISYVATGSFNYPARGTI
FT                   TSRFGQRWGRFHTGVDIAAPQGSPIYAADGGTVIFSGWESGYGYLVKIDHHNGYVTYYG
FT                   HASKLLVKKGDKVAKGQKIALVGSTGRATGPHLHFEVRKNGVPIDPMPFLNRR"
FT   gene            98579..99385
FT                   /locus_tag="Thebr_0109"
FT   CDS_pept        98579..99385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78741"
FT                   /db_xref="InterPro:IPR039568"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTD2"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0102"
FT                   /protein_id="ADV78741.1"
FT                   /translation="MKRKLFIFIFVIILFVGFYFSNKIETVSYTFIKSAKENILKNNVS
FT                   SYKTAESEHFILKYSPEDQKYVSLVLKIAEKHYKGVTKDLGYEPKNKSLIIMYHDPEKM
FT                   NKDFSLAKGESAMGLYLNGVISIQSPELWISPGQDLEKVFEHDGPIVHEFTHLIVDNVA
FT                   KGNYPVWFTEGIALLEEYRENGFIWGEGIEEDKPYSLEELTYKFNQLDEVLAYKRSFEI
FT                   VKAISDKYGMQSIRDILKYLGNGLSLENSFYKVTGEDLNHFVNSLQ"
FT   gene            99531..100784
FT                   /locus_tag="Thebr_0110"
FT   CDS_pept        99531..100784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0110"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="KEGG: tpd:Teth39_0103 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78742"
FT                   /db_xref="GOA:E8UTD3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTD3"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADV78742.1"
FT                   /translation="MEKFIIKGGKPLKGSIQISGAKNSAVAILPAALLADTPSVIDNLP
FT                   DIKDIELLVQMIRHLGGKVEKKKHEVVIAPEGINSFYPPRDLASQMRASYYLIGALLSR
FT                   FNEAVIAMPGGCNIGVRPIDQHIKGFEALGAKTTIEHGLIRIKADKLVGNHIYFDVVSV
FT                   GATINLMLASVKAEGVTILENCAKEPHVVDVANFLNAMGANIKGAGTDTIKITGVDKLH
FT                   GCHYTIIPDQIEAGTYMVAAAATKGDVYIKGIIPNHLEAIIAKLAEMGVIVEEYDDVIR
FT                   VRREGPLKHVDIRTLPYPGFPTDMQQPFAVLLALADGISVITENIYENRFKYLNELKKM
FT                   GAKVRVEGRTAIIEGVEKLTGAPLYATDLRAGAAMVIAGLAAEGTTEVMEVYHIDRGYE
FT                   AMEVKLQQLGADIVRVKE"
FT   gene            100850..101953
FT                   /locus_tag="Thebr_0111"
FT   CDS_pept        100850..101953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0111"
FT                   /product="HtrA2 peptidase"
FT                   /EC_number="3.4.21.108"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: tpd:Teth39_0104
FT                   peptidase S1 and S6, chymotrypsin/Hap; SMART: PDZ/DHR/GLGF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78743"
FT                   /db_xref="GOA:E8UTD4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTD4"
FT                   /inference="protein motif:PRIAM:3.4.21.108"
FT                   /protein_id="ADV78743.1"
FT                   /translation="MQRQLKSFFAVAIITTLVSSLVFVYIAPKYLWGKVIPIPYPPSSG
FT                   IRTEVVIPTKESPTIAEVVAKKDTPAVVGITTVEFQREYYFIEKAVEGVGSGFIVNPNG
FT                   YIITNNHVANEKSKNIKVYLSNGSILPGKVLWTDPVLDLSILKIDAKDLPVIPLGDSDK
FT                   ISVGQTAIAIGNPLGLRFQRTVTSGIISALNRSLPITEDGKPRIMEDLIQTDASINPGN
FT                   SGGPLVDSQGYAIGINTAKVTTAEGLGFAIPINIVKPILKKVIETGTFKAPYIGIVAYD
FT                   KEIASYISADVYIYEGIYVADIDPKGPAYKAGIRKGYIILEIDERPVNTMTSLKCIIYE
FT                   KNPGDKIKVKYQTVSGKTGYTTITLGE"
FT   sig_peptide     100850..100924
FT                   /locus_tag="Thebr_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.706) with cleavage site probability 0.700 at
FT                   residue 25"
FT   gene            101964..102131
FT                   /locus_tag="Thebr_0112"
FT   CDS_pept        101964..102131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78744"
FT                   /db_xref="InterPro:IPR025626"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTD5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0105"
FT                   /protein_id="ADV78744.1"
FT                   /translation="MFVVCEKHLEDAIEEFVEVYEQPPDIYKLDEVSFTDWLVPHKCDF
FT                   CDEPPKYLVV"
FT   gene            102149..102616
FT                   /locus_tag="Thebr_0113"
FT   CDS_pept        102149..102616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0113"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   tpd:Teth39_0106 rRNA large subunit methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78745"
FT                   /db_xref="GOA:E8UTL3"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTL3"
FT                   /inference="protein motif:PFAM:PF02590"
FT                   /protein_id="ADV78745.1"
FT                   /translation="MKIYIIAVGKIKENYISDGIVFYLKKLRPYCEIEIKEVEEEKAPQ
FT                   NLSEKEKEEILRKEGERILSKIKKGSFVVSLAIEGKEIDSYKFSQFIKATFQSGYREMT
FT                   FVIGGSLGLWENIKKQSHLNLSFSKMTFPHQLMRLILLEQLYLAFDGKNHL"
FT   gene            complement(102607..103008)
FT                   /locus_tag="Thebr_0114"
FT   CDS_pept        complement(102607..103008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0114"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   tpd:Teth39_0107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78746"
FT                   /db_xref="GOA:E8UTL4"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTL4"
FT                   /inference="protein motif:PFAM:PF02590"
FT                   /protein_id="ADV78746.1"
FT                   /translation="MNYKVYATGNKIEKFYSDAIKEYQKRLNRFCNISFTNYKNPQQLP
FT                   KQQIDKYYKIGILPSGKSLSSEELAEKIKELELSAKTDILIVIGNEEIPLNESISISPM
FT                   EMSLGLASTILFEQLYRAYKILNNEPYHK"
FT   gene            103140..104360
FT                   /locus_tag="Thebr_0115"
FT   CDS_pept        103140..104360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0115"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; KEGG:
FT                   tpd:Teth39_0108 tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78747"
FT                   /db_xref="GOA:E8UTL5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTL5"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ADV78747.1"
FT                   /translation="MSALDVLQERGYIQQMTHEEEIRELLEKEKITFYIGFDPTADSLH
FT                   VGHFLQIMVMSHMQKAGHRPIVLIGGGTAMVGDPSGRTDMRKMLTKEEINRNAEAFKKQ
FT                   MQRLIDFSDGKAIMANNADWLLNLNYIEFLRDIGVHFSVNRMLTAECFKSRLERGLSFL
FT                   EFNYMLMQAYDFLELNKRYNCVMQMGGDDQWSNIIAGIELIRKKEGKQAYGMTFTLLTT
FT                   SEGKKMGKTQKGAVWLDPNKTSPYEFYQYWRNIADADVEKALALLTFLPMDEVRRLGAL
FT                   KDKEINEAKKILAYEVTKLIHGEEEAIKAQKAAEALFESGGDLDNVPSVTVSSDVLGKK
FT                   ILDVLFEAKIIPSKSEGRRLVQQGGLYINNEKVESIDEYIKDDMIKDNSILIRKGKKEY
FT                   HRLVIKE"
FT   gene            104375..104803
FT                   /pseudo
FT                   /locus_tag="Thebr_0116"
FT   gene            104827..105684
FT                   /locus_tag="Thebr_0117"
FT   CDS_pept        104827..105684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78748"
FT                   /db_xref="GOA:E8UTL6"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTL6"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0111"
FT                   /protein_id="ADV78748.1"
FT                   /translation="MTQILYVLERGAKMVFIATALYIEAKPLIEYFGLKKDVENRYFQV
FT                   FKNEEITLVVTGVGKINSSIAVSHAVTKYLWDPQSFIINLGVCGSKDIDEKIGNIYLIN
FT                   KIVDNETQKNYIPDILVNHPFEESDIETFNYIVKEKGLMTARLCDMEASGFYQAASKFF
FT                   ETHRIYILKIVSDRTDFEDVSKDKIYELIKNKLKEIDEFIKILKNNFKTREIFSFYEKE
FT                   IINFFSQKLKLTVSQRQIFYKACLHYKVRKSEGIDFLKNFYDVQVNNKEERKKAFEKIL
FT                   SHLR"
FT   gene            105656..106654
FT                   /locus_tag="Thebr_0118"
FT   CDS_pept        105656..106654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0118"
FT                   /product="DNA repair photolyase-like protein"
FT                   /note="KEGG: tpd:Teth39_0112 DNA repair photolyase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78749"
FT                   /db_xref="GOA:E8UTL7"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTL7"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0112"
FT                   /protein_id="ADV78749.1"
FT                   /translation="MKKFSHIYAEKEVLPNPITQNILKKFPKSKVVLIDRYSEVFNRPN
FT                   QNYLIQKERQNLILAKKRYDFIYKGSKLCEDFGNINFYHTSIIFNCVYDCDYCYLQGMY
FT                   PSGHLVIFVNIEDYFKEVDKLTQEHKVYLSISYETDLLTLEYLTGFTKQWIEYAKGNKN
FT                   LVIEIRTKSANFYSVEFIDIPSNVIFAWTLLPQPVIDKYEKLTPSLSKRIESIKRAISK
FT                   GLKVRISIEPVMYIEGFEKIYKGFVEYVFSKIPKEGIQDVNIGAFRMVKEQAKKIEKLK
FT                   EYSPIFCYDTVLKDGIFTYKEAEYFEEFVYREVIKYIEKEKVYVLNKLPSN"
FT   gene            complement(106853..108112)
FT                   /locus_tag="Thebr_0119"
FT   CDS_pept        complement(106853..108112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0119"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: tpd:Teth39_1510 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78750"
FT                   /db_xref="GOA:E8UTL8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTL8"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADV78750.1"
FT                   /translation="MNKLFVGMDVSLNDVKVHILDQEGNDASSRFSVENNPHGCDVIVS
FT                   RILECCNKYNIQKVFIGLESTSVYGWHLQYYLADHSALKPYQPSITTFNANIINAFKKS
FT                   LGNLPKNDWIDAFAIAEKLRFGRLPKSCSVDFRYLALQRLTRHRFHIVNSIVREKNYLL
FT                   SNLFLKFSGLCQNKVFSNNFGATATEIFNEFFTLDDIAARPLDELAGFLVDKSKDRFDD
FT                   PEATAKLLQEAVRKSYRINATVDDSLNFVIKSCFDNLQSLEKQKKAVEKAIINEVKGFN
FT                   NEFLCLTSVKGIGPTIAAGLISEIGGISRFDNDNALAKFSGLYWSEYQSADFKAEDTYL
FT                   KRTGNEYLRYYFIQAADQLRKYLPEFSQYYARKFKESKTHKHKRALVLTARKTVRLVFA
FT                   LLREEKLYKSPIMKGDDCIS"
FT   gene            108759..109343
FT                   /locus_tag="Thebr_0120"
FT   CDS_pept        108759..109343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0120"
FT                   /product="glutaredoxin-like protein, YruB-family"
FT                   /note="KEGG: tpd:Teth39_0114 YruB family glutaredoxin-like
FT                   protein; TIGRFAM: glutaredoxin-like protein, YruB-family;
FT                   PFAM: glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78751"
FT                   /db_xref="GOA:E8UTL9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011911"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTL9"
FT                   /inference="protein motif:TFAM:TIGR02196"
FT                   /protein_id="ADV78751.1"
FT                   /translation="MLEFIKDTQHFEEVKNKEEFFMLMFYSNSSQKSLEALEVMKKFSE
FT                   DNPKVPVYVVNASEIRDIHPQYGIKVVPSVILFKDKEPWQFVFGLQSKEYYEKLLVVAP
FT                   SKASDGKGLKAHRVTIYTTPSCPWCNATKAYLRQHNIPFREIDVSKNPSAAAELVRRSG
FT                   QRGVPQTDIDGTIVVGFDKAKLNRLLGITEQ"
FT   gene            109437..109721
FT                   /locus_tag="Thebr_0121"
FT   CDS_pept        109437..109721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0121"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: tpd:Teth39_0115
FT                   chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78752"
FT                   /db_xref="GOA:E8UTM0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTM0"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADV78752.1"
FT                   /translation="MTKIQPINGHALIKLEKEPEEKKIGGVIIPKTAEEKLNQGVIEAL
FT                   AAGASDELAVGDRVIYKEFSGTKIKHEGEEYLIIPVDDILAKFVEVDEI"
FT   gene            109909..110655
FT                   /locus_tag="Thebr_0122"
FT   CDS_pept        109909..110655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0122"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="TIGRFAM: FeS assembly ATPase SufC; PFAM: ABC
FT                   transporter related; KEGG: tpd:Teth39_0116 FeS assembly
FT                   ATPase SufC; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78753"
FT                   /db_xref="GOA:E8UTM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTM1"
FT                   /inference="protein motif:TFAM:TIGR01978"
FT                   /protein_id="ADV78753.1"
FT                   /translation="MRETLLEIKDLHIEVEGKYILKGLNLTIKKGEIHAIMGPNGGGKS
FT                   TLCNSIMGNPKYKVTSGQILFEGEDITNLKVNERAKKGIFLSFQYPEEIPGITVDNFIR
FT                   TSVNIVTGQNVSMLQFAKEMKNTLELLDMNSEYRSRYLNVGFSGGEKKKAEILQMAFLK
FT                   PKLVMLDEIDSGLDIDALKVVAEAVKKLKSEDMSILIVTHYNRILDYLEPDVISVLMDG
FT                   KIVKSGDKDLAKILEEKGYDFVRNGV"
FT   gene            110675..112078
FT                   /locus_tag="Thebr_0123"
FT   CDS_pept        110675..112078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0123"
FT                   /product="FeS assembly protein SufB"
FT                   /note="KEGG: tpd:Teth39_0117 FeS assembly protein SufB;
FT                   TIGRFAM: FeS assembly protein SufB; PFAM: SufBD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78754"
FT                   /db_xref="GOA:E8UTM2"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTM2"
FT                   /inference="protein motif:TFAM:TIGR01980"
FT                   /protein_id="ADV78754.1"
FT                   /translation="MKKPDIKEIDFSIYDVKDNVKYEYQTGKGLSKEVVLEISEQKNEP
FT                   SWMRDFRLKALEIYQKMPMPTWGVDLSQLDIDSIIAYIRPSAKMQRSWDEVPEEIRRTF
FT                   ERLGIPEAERKALAGVGAQYDSEVVYHNIKESLTQQGVIFEDMDTAVKKYPDIIKEYFM
FT                   TKNVTPYDHKFVALHAAIWSGGTFVYVPEGVKVEVPLQAYFRMNAPGSGQFEHTLIIAD
FT                   KGSEVHFIEGCSAPQYTVSNLHAGCVELFVNEGARIIYSTIENWSKNTYNLNTKRAIVE
FT                   KDGIIEWISGSFGSHKTMLYPASILKGEGAKAEYTGVTFAAKGQHLDTGSKMIHLAPHT
FT                   SSKVLAKSISKDGGISSYRGLLKIGPNAEGAKASVQCEGLMLDDISRSDTMPVIEIEND
FT                   NVDIGHEAKVGRISDEQIFYLMSRGLSEDDARAMIVRGFVEPIAKALPLEYAVEMNRLI
FT                   KLELEGAIG"
FT   gene            112089..113138
FT                   /locus_tag="Thebr_0124"
FT   CDS_pept        112089..113138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0124"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: tpd:Teth39_0118 SufBD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78755"
FT                   /db_xref="GOA:E8UTM3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTM3"
FT                   /inference="protein motif:PFAM:PF01458"
FT                   /protein_id="ADV78755.1"
FT                   /translation="MWKRVSMEEIQQPSYKEYTSAVIKNLSHDTVKIKETKKLAGLPTE
FT                   ILALRDKAFGIEGKFINMVRDFYNAGFHIEISQNSNVEKPIVIDYITNEQNDTLIDYNI
FT                   IEAEANSQVTIVFDYNSGTKGFHNGITQVIAKEGSTVNIVKIQRLGDEFNDFDNNLVIV
FT                   GKNAMVNWSNVVIGSKVSAFDVAVYLDEVGGTFTSKSIFLGVDSQKYDMAYKVYHQAPK
FT                   TTSSVDLKGALKGSAKATFIGNIDIKKGAKKAKAEENETVLLLDKTVKSVAIPALYCGE
FT                   DDVQANHSASAGQIDEDKLYYVMSRGFSLEEARLLMVQAILNPVIDLIPYDPVREIIIK
FT                   GHIGRRIIK"
FT   gene            113135..114364
FT                   /locus_tag="Thebr_0125"
FT   CDS_pept        113135..114364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0125"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="KEGG: tpd:Teth39_0119 SufS subfamily cysteine
FT                   desulfurase; TIGRFAM: cysteine desulfurase, SufS subfamily;
FT                   PFAM: aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78756"
FT                   /db_xref="GOA:E8UTM4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTM4"
FT                   /inference="protein motif:TFAM:TIGR01979"
FT                   /protein_id="ADV78756.1"
FT                   /translation="MKNIDIERIKKDFPILSVKPHGKRLVYLDNAATTQKPIEVIKAMD
FT                   KYYEELNANVYRSPHYLSVLSTQAYEEARERVKKFINAKKEESIVFTRNTTESINFIAY
FT                   TWGMKHINEGDEILLTIAEHHSNILPWQMVAEAKGAKLKYVYLDENFRLSMKDFKEKMS
FT                   EKVKLVAVQHMSNVLGIINPVEEITHIAHKYGAKVLIDGAQSVPHMPVDVQKIDCDFFA
FT                   FSGHKMLGPMGIGVLYIKEDLLKEVPPFLRGGEMIDEVYEDHSTFAPSPLKFEAGTPNI
FT                   EGAYVLISAIDYIEKIGLTNIYKHEGELLEYGLQKMRELDFVKLYGPKDAKERGGIISF
FT                   NVEGVHPHDVATILDEEGVAVRSGHHCCQPLMRYLGVPATVRASFYLYNDFEDIDALVE
FT                   GLKKVRKWFK"
FT   gene            114361..114774
FT                   /locus_tag="Thebr_0126"
FT   CDS_pept        114361..114774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0126"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="KEGG: tpd:Teth39_0120 NifU family SUF system FeS
FT                   assembly protein; TIGRFAM: SUF system FeS assembly protein,
FT                   NifU family; PFAM: nitrogen-fixing NifU domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78757"
FT                   /db_xref="GOA:E8UTM5"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTM5"
FT                   /inference="protein motif:TFAM:TIGR01994"
FT                   /protein_id="ADV78757.1"
FT                   /translation="MSDLNQLYSEVIMEHYENSPHRRELKDATHKERGHNPLCGDDITL
FT                   YLKMNGDIIEDASFTGHGCAISQASTSMMIDLIKGKDKKEALRLVQEFIDMIHKKDVNL
FT                   DELGDAQVLHGVSDFPARVKCALLAWKTLQEIL"
FT   gene            114963..115718
FT                   /locus_tag="Thebr_0127"
FT   CDS_pept        114963..115718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0127"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="KEGG: tpd:Teth39_0121 CRISPR-associated Cas family
FT                   protein; TIGRFAM: CRISPR-associated protein Cas6; PFAM:
FT                   protein of unknown function DUF57"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78758"
FT                   /db_xref="GOA:E8UTM6"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTM6"
FT                   /inference="protein motif:TFAM:TIGR01877"
FT                   /protein_id="ADV78758.1"
FT                   /translation="MRITLEFVGEKNLVLPIHYNYIVQGFLYDLMGDSEFAAFLHDEGF
FT                   QYEKRKFKLFTFSRIEGEFKILTDSKGQKKISIKPPFKFTVASPLDEFIFDISKNALKK
FT                   EYCHFNGQKFILNSLNIDNPPVFKNKARIKFISPVVMYTTLKDGDIKYTYYYSPWDEKF
FT                   SPLLLNNLLKKYELVYKIKAEDPYFKLYPLSEKEDRRYSKMIKYKNVYVKGWMGIYDVE
FT                   SSPELLELAYYTGLGAKNSQGFGCFEIIG"
FT   gene            115738..117501
FT                   /locus_tag="Thebr_0128"
FT   CDS_pept        115738..117501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0128"
FT                   /product="CRISPR-associated protein, TM1802 family"
FT                   /note="KEGG: tpd:Teth39_0122 CRISPR-associated Csh1 family
FT                   protein; TIGRFAM: CRISPR-associated protein, TM1802 family;
FT                   CRISPR-associated protein, Csh1 family; PFAM:
FT                   CRISPR-associated protein TM1802"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78759"
FT                   /db_xref="InterPro:IPR013389"
FT                   /db_xref="InterPro:IPR013420"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTM7"
FT                   /inference="protein motif:TFAM:TIGR02556"
FT                   /protein_id="ADV78759.1"
FT                   /translation="MITAIKELGEMVLKSQNKTLLDVLIENPNQDGRYSKIIAINFIVK
FT                   EDEIEYEGIRLEEYDDSKISRYLFTDTGGNAPGYTPAAKITEVPKTFNGKIKNWFNKVL
FT                   KDKSIKIDEKDRAFLERIKDILEEKSDEIIKEAEKIRGDFPKKEGLSLILKFNVDGEYK
FT                   YIGDFNVFRDLMLQLDSQKYQKIYAEDKVCSICGQKKDIVFGTVDTYKFYTIDKPGYIA
FT                   GGFNEKESWKNYPVCAECRLALEEGKRYLENELTFRFYGLEYQLIPNFIIGKEFVRKEV
FT                   REIFESSERLLSLKREVKKRFIGDEDEILDYLADAEDSMTVNLLFLRKSNSAERILLLI
FT                   EDVFPSHLREIFNAKEQVDKIFGNSFTFKNIRSFMSKSDSNKRDNDLDGYFLDITDRIF
FT                   RGRPVDLGFLYNLIMKKIREEFVKDGYYKAATADGLMTIAFLEKMKLIKMEVIPMEERI
FT                   FDSFFAKYGPTFEMPLKRGLVLLGALTELLLRKQYSDREAKPFMKNLKGLKMDEKDIKG
FT                   LLPKVQNKLEEYDSFEKGKRLLAKEASNYLLLAGDNWNMSVDEINFYFACGINLADELT
FT                   SIIYKKEGEEK"
FT   gene            117502..118413
FT                   /locus_tag="Thebr_0129"
FT   CDS_pept        117502..118413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0129"
FT                   /product="CRISPR-associated protein, Csh2 family"
FT                   /note="KEGG: tpd:Teth39_0123 CRISPR-associated Csh2 family
FT                   protein; TIGRFAM: CRISPR-associated protein, Csh2 family;
FT                   CRISPR-associated protein, CT1132 family; PFAM:
FT                   CRISPR-associated protein TM1801"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78760"
FT                   /db_xref="GOA:E8UTM8"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013419"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTM8"
FT                   /inference="protein motif:TFAM:TIGR02590"
FT                   /protein_id="ADV78760.1"
FT                   /translation="MENVIKNRAEILFLYDVSFANPNGDPVDENKPRIDEETGINIVTD
FT                   VRLKRTIRDYLAYYKGKEVFIIETRKDNGELRTKKDRIEDFGTNEDIIAKCIDVRLFGA
FT                   TTAVKDKMMILTGPVQFKYGKSLHRVNLMYVKGTTVMPSGEGREQGTFTEKYILPYSLI
FT                   AFYGIVNENAAINQNIPLTDEDVDLMLEGMWNGTKNLMSGSKIGHMPRLLIEVVYQENN
FT                   YQIGELEKRIKFVHEMEDEEIRDIQDGKLDITELVAVLKQNQEKIKLIKYIYDDRVTFT
FT                   CNGEECTLEKALKGLNIQKLQY"
FT   gene            118426..119139
FT                   /locus_tag="Thebr_0130"
FT   CDS_pept        118426..119139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0130"
FT                   /product="CRISPR-associated protein Cas5, Hmari subtype"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5, Hmari
FT                   subtype; CRISPR-associated protein Cas5; KEGG:
FT                   tpd:Teth39_0124 CRISPR-associated Cas5 family Hmari subtype
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78761"
FT                   /db_xref="GOA:E8UTM9"
FT                   /db_xref="InterPro:IPR013421"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTM9"
FT                   /inference="protein motif:TFAM:TIGR02592"
FT                   /protein_id="ADV78761.1"
FT                   /translation="MKTLVFDVFGDYGHFRKYYTTSSPLTFSFPPPPTVKGMLGAIAGI
FT                   DKKEYLKVFSEENCKVAIRILNPIKKIRLGLNLINTKGNYWIPYKAKNHEARTQVKTEF
FT                   VKDAAYRIYFMHKDNDLFEDIVEKIKNRRNVYTLSLGLSEMIADYKFIGVYEAEEIENA
FT                   EVDILSVLPFQSIVEDKIYFENGKKYFKEKIPAGMNEDRVVLSYEDVLYEVNGQSIKCH
FT                   VKKCWEVKGEHVIFF"
FT   gene            119123..121477
FT                   /locus_tag="Thebr_0131"
FT   CDS_pept        119123..121477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0131"
FT                   /product="CRISPR-associated HD domain protein"
FT                   /note="KEGG: tpd:Teth39_0125 CRISPR-associated helicase
FT                   Cas3; TIGRFAM: CRISPR-associated HD domain protein;
FT                   CRISPR-associated helicase Cas3; SMART: DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78762"
FT                   /db_xref="GOA:E8UTN0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTN0"
FT                   /inference="protein motif:TFAM:TIGR01596"
FT                   /protein_id="ADV78762.1"
FT                   /translation="MSSFSELYSHPDKFLEDHLINTSKIIRSYFNEKKVAIIDKETFLK
FT                   TATIISLCHDFGKATNYFQKYLFTENEKERNKLKTMEEMHHSLLSAVVAFYLVKNEINA
FT                   QDRKGILFPFIAFLIVKNHHGDLKNVFNEVILDDKELEVLKKQLNSIDDEKLQVLNGKL
FT                   RNAGLNENLTKSAINDYIDSINSELRKIKRELRRLKEEQDVSIYLLLNFLFSLLVDADK
FT                   TEVVVGIDNIKRPEIKFEEQLVKEYKASFPDKESKINLLREEAYKEVLEKDIDIKQKIM
FT                   SINLPTGLGKTLTTIAFAMKLWAKLYKETGVKYRIIYSLPFLSIIEQNSNVLEDLLRYN
FT                   GIQPDTEIILKHHHLSDIRYTKNNTEFEDEQAKILIEGWNSEIIITTFVQFFHTLVSEK
FT                   NKTLRKFHRLANSIIILDEVQSIPFKYWLLTKELLKAVANELNSYIIFVTATQPLIFRE
FT                   EEIYPLVAKTKYFTQMDRVEIIPKLSRDITLEELSEMFDLNDGKSYLFILNTIKSAQQF
FT                   YNILRAKIPNDEIIYMSTHVVPMERMERIEKIKEGKIRFAVTTQLVEAGVDIDFDVVVR
FT                   DIAPLDSINQSAGRCNRNWRGKGEVYVVSLIDEKGQKYSKYVYDKILLGITREILSKYD
FT                   TIKEQELLKIIEKYYQEVSERMSSNEGRELLDAIYTLRYDSEDGNMCISKFELIEDDYY
FT                   KVDAFIELNDEAKELWHKYVELKDIKNLFERRNIFNRFKADFYKYVISIPATVENMPPD
FT                   IWGFKYVNYDSLNDYYDKETGFITKGVTSIW"
FT   gene            121471..121623
FT                   /locus_tag="Thebr_0132"
FT   CDS_pept        121471..121623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78763"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADV78763.1"
FT                   /translation="MVTNLSSIPNKAKTPGDRRHFYFSDFHKVIDFIGQYGIIKSRYLT
FT                   EIKKL"
FT   repeat_region   121660..124831
FT                   /rpt_unit_range=121660..121690
FT                   /note="CRISPRS"
FT   gene            complement(124983..126202)
FT                   /pseudo
FT                   /locus_tag="Thebr_0133"
FT   repeat_region   126529..127963
FT                   /rpt_unit_range=126529..126559
FT                   /note="CRISPRS"
FT   gene            complement(128115..129335)
FT                   /pseudo
FT                   /locus_tag="Thebr_0134"
FT   gene            complement(129774..130994)
FT                   /locus_tag="Thebr_0135"
FT   CDS_pept        complement(129774..130994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0135"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: tpd:Teth39_0914 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78764"
FT                   /db_xref="GOA:E8URJ6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E8URJ6"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADV78764.1"
FT                   /translation="MDLVYSHVCGLDVHKKNVVACIITPEGKEIRTFSTMTDDLIALKE
FT                   FIKAKGCSVVAMESTGSYWKPIYNLLELESIKILLVNAKHIKNVPGRKTDVKDAEWIAS
FT                   LLQHGLLQGSFVPDREQRELRELVRYRKSLIEEKSRELNRIQKVLEGANIKLSSVVSDI
FT                   NGASSRSILEAIINGEENPETLAELSQGKLKNKMDELKRALKGLINHHQRMLLEIQLRH
FT                   IDYLDEEIAKLDEEIKNRMLPFEKDLALLDTIPGVGRRTAEQIIAEIGTNMEQFPSAAH
FT                   LCSWAGLCPGHNESAGKQKSARTRKGNQKLRSSLIEAARAASRAKDTYLSSQYHRIAAR
FT                   RGANRAAVAVAHSILIIVYHILKQKQPYIELGPTYYEEKKRNMIIRQSLKKLESLGLKV
FT                   TVESAVS"
FT   repeat_region   131317..133488
FT                   /rpt_unit_range=131317..131347
FT                   /note="CRISPRS"
FT   gene            complement(133641..134861)
FT                   /locus_tag="Thebr_0136"
FT   CDS_pept        complement(133641..134861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0136"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: tpd:Teth39_0914 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78765"
FT                   /db_xref="GOA:E8URJ6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E8URJ6"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADV78765.1"
FT                   /translation="MDLVYSHVCGLDVHKKNVVACIITPEGKEIRTFSTMTDDLIALKE
FT                   FIKAKGCSVVAMESTGSYWKPIYNLLELESIKILLVNAKHIKNVPGRKTDVKDAEWIAS
FT                   LLQHGLLQGSFVPDREQRELRELVRYRKSLIEEKSRELNRIQKVLEGANIKLSSVVSDI
FT                   NGASSRSILEAIINGEENPETLAELSQGKLKNKMDELKRALKGLINHHQRMLLEIQLRH
FT                   IDYLDEEIAKLDEEIKNRMLPFEKDLALLDTIPGVGRRTAEQIIAEIGTNMEQFPSAAH
FT                   LCSWAGLCPGHNESAGKQKSARTRKGNQKLRSSLIEAARAASRAKDTYLSSQYHRIAAR
FT                   RGANRAAVAVAHSILIIVYHILKQKQPYIELGPTYYEEKKRNMIIRQSLKKLESLGLKV
FT                   TVESAVS"
FT   repeat_region   135184..136814
FT                   /rpt_unit_range=135184..135214
FT                   /note="CRISPRS"
FT   gene            complement(136968..138188)
FT                   /locus_tag="Thebr_0137"
FT   CDS_pept        complement(136968..138188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0137"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="KEGG: tpd:Teth39_0131 transposase IS116/IS110/IS902
FT                   family protein; PFAM: transposase IS116/IS110/IS902 family
FT                   protein; SMART: Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78766"
FT                   /db_xref="GOA:E8UTN4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTN4"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADV78766.1"
FT                   /translation="MDLVYSHVCGLDVHKKSVVACIITPEGKEIRTFSTMTDDLIALKE
FT                   FIKAKGCSVVAMESTGSYWKPIYNLLELESIKILLVNAKHIKNVPGRKTDVKDAEWIAS
FT                   LLQHGLLQGSFVPDREQRELRELVRYRKSLIEEKSRELNRIQKVLEGANIKLSSVVSDI
FT                   NGASSRSILEAIINGEENPETLAELSQGKLKNKMDELKRALKGLINHHQRMLLEIQLRH
FT                   IDYLDEEIAKLDEEIKNRMLPFEKDLALLDTIPGVGRRTAEQIIAEIGTNMEQFPSAAH
FT                   LCSWAGLCPGHNESAGKQKSARTRKGNQKLRSSLIEAARAASRAKDTYLSSQYHRIAAR
FT                   RGANRAAVAVAHSILIIVYHILKQKQPYIELGPTYYEEKKRNMIIRQSLKKLESLGLKV
FT                   TVESAVS"
FT   gene            138327..139055
FT                   /locus_tag="Thebr_0138"
FT   CDS_pept        138327..139055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0138"
FT                   /product="peptidase S51 dipeptidase E"
FT                   /note="PFAM: peptidase S51 dipeptidase E; KEGG:
FT                   tpd:Teth39_0132 peptidase S51, dipeptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78767"
FT                   /db_xref="GOA:E8UTN5"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTN5"
FT                   /inference="protein motif:PFAM:PF03575"
FT                   /protein_id="ADV78767.1"
FT                   /translation="MKKVVAIGGGEISKFETFKIDEEIVKLTDKAKPKALFVPTASGEP
FT                   EAYCDNFDFVYGKMLGCETDILFLIKDDPDSSQIEKKISWADLIYVGGGNTKRMMEIWR
FT                   SKGVDKMLIDAYQRGTVLSGLSAGAICWFKYGFSDSQRFENQENWHYTKVEGLGLFDAI
FT                   LCPHLNEENRRELFEKFMIDFEGVGIGLENGCAIEIVDDTFKIINSFENAHAYVFRRSE
FT                   NKLFVDEIRHRDYIPFNLLI"
FT   gene            139384..139881
FT                   /locus_tag="Thebr_0139"
FT   CDS_pept        139384..139881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0139"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas4; KEGG:
FT                   tpd:Teth39_0133 CRISPR-associated Cas4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78768"
FT                   /db_xref="GOA:E8UTN6"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTN6"
FT                   /inference="protein motif:TFAM:TIGR00372"
FT                   /protein_id="ADV78768.1"
FT                   /translation="MEFEVTGALMQSYTICKRQVWLMAHQIVPDQEHPYIEIGRLIDEN
FT                   SYQRDRKKIHFENVVLDLVRMEKDNILIGEVKKSSKAEDSAKMQLLFYLYKLKQSGITA
FT                   KGQLFFPEERKREVVELTPEFEREVIKAIEEIKDIVYKEKPPAFIKIPYCKNCGYKEFC
FT                   MS"
FT   gene            139878..140870
FT                   /locus_tag="Thebr_0140"
FT   CDS_pept        139878..140870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0140"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="KEGG: tpd:Teth39_0134 CRISPR-associated Cas1 family
FT                   protein; TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78769"
FT                   /db_xref="GOA:E8UTN7"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTN7"
FT                   /inference="protein motif:TFAM:TIGR00287"
FT                   /protein_id="ADV78769.1"
FT                   /translation="MKKTIYIFSDGELKRKDNTLFFEGENGRKFIPVENTSEIMVFGEV
FT                   SLNKRLLEFLTQSEIILHFFNHYGYYVGSYYPREHLNSGYMILRQAEHYNDESKRLYLA
FT                   QKFVEGAYKNIRQVLKYYSNRGKDLEDVIYSIEKLGESVDSTSTINELMAIEGNIREYY
FT                   YKAFDEIIQNPDFKFDFRSKRPPQNFLNTLISFGNSLMYTTTLSEIYKTHLDPRIGFLH
FT                   ATNFRRFSLNLDVSEIFKPIIVDRTIFTLLSKKMVTKEDFEEDAEGLLLKEKGKKVFVQ
FT                   EFEDKLATTIKHRNLSNNVSYRRLIRLELYKLEKHLIEEEQYKPFIAQW"
FT   gene            140887..141150
FT                   /locus_tag="Thebr_0141"
FT   CDS_pept        140887..141150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0141"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; KEGG:
FT                   tpd:Teth39_0135 CRISPR-associated Cas2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78770"
FT                   /db_xref="GOA:E8UTN8"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTN8"
FT                   /inference="protein motif:TFAM:TIGR01573"
FT                   /protein_id="ADV78770.1"
FT                   /translation="MFLILVYDVNEKRVNKVLKTCRKYLHWVQNSVLEGEISEANLKKL
FT                   KIELSRIIDKDEDSVIFYILRTTKYSEREILGLRKGGEDIII"
FT   gene            141271..143196
FT                   /locus_tag="Thebr_0142"
FT   CDS_pept        141271..143196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0142"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: tpd:Teth39_0136 NADH:flavin
FT                   oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78771"
FT                   /db_xref="GOA:E8UTN9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTN9"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADV78771.1"
FT                   /translation="MELTKPIKIGNLSLKNRVVMAPVKTGYATPEGQVTEELIQYYVNR
FT                   AKGGVGLIVLESAYVDLSGKEIPRQLGIYDDSMVEGLRRLITPLQEAGSKVAVYINHAG
FT                   RIANPMVTKLPLIAPSSIACPTIGVEPQGIPHEDIKKWQNTYVKAAVRAYEAGADALEI
FT                   QFGHGYLIHQFLSPHTNKREDEYGGSFENRIRFGMEILDEIKKEIGADFPIIVRISADE
FT                   FVPGGWALEDAIRLAKILEDKGVAAIDVSLGSSCESGAITLQTLGTQKGLAWEFASKIK
FT                   KQVNIPVIAVGRINTPELAEEILVSGKADLVALGRPLVADPLFVEKATSGRSKEIRRCA
FT                   ACHQGCLDELRAGRRFGCNFNPSVGKEEEIEIQKAPQPGKKVFIIGAGLAGLEAAYTAA
FT                   ARGHKVYIYEEKGEIGGQVLPGSVPPHKEELKGIVEYYKEVLPKVGVTLNLNHKVTAEE
FT                   IAKWEADEVVFATGGQPIVPPIPGLKEYGFLTAVEVLRGEKQAGDKVAIIGGGLIGMET
FT                   ADYLSEQGKKVMVIELLEEVARDMGVFEKILIMKRLKERGVEIYVKTRLKEVGKALLVE
FT                   TPEGEKELPLPDTIVLAVGLKPDPSLYEEVSKILPQEKLHVIGDAKEVRKIVHAISEGR
FT                   NLGLSL"
FT   gene            143457..144236
FT                   /locus_tag="Thebr_0143"
FT   CDS_pept        143457..144236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0143"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="KEGG: tpd:Teth39_0137 beta-lactamase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78772"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTP0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0137"
FT                   /protein_id="ADV78772.1"
FT                   /translation="MKFCSLRSGSSGNAIYINHKDVHILVDAGLSGRTIEKALLNIGIN
FT                   PKSLSAILITHEHKDHIIGAGVLSRRYNIPIYANKATWEVMEKDIKEISEKNKLYFTTG
FT                   EEFEIGDVKIMPFKKSHDAVEPVGFSFKCGDKKISIATDLGYMTRGVANHLIGSDIVLL
FT                   EANHDIEMLINGSYPWPLKKRILSNLGHLSNDAAADTLMKLFKMKAIGIAFLGHLSQNN
FT                   NRPELAFATVTNVLKKSGVKFEVRMALRNIESDLVEI"
FT   gene            144691..146103
FT                   /locus_tag="Thebr_0144"
FT   CDS_pept        144691..146103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0144"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: tpd:Teth39_0138 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78773"
FT                   /db_xref="GOA:E8UTP1"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTP1"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADV78773.1"
FT                   /translation="MDSKDMQRLQTTQQRGYPLNREMEFQKTTEVHSISSASEDGRNEV
FT                   QRYTSKMLEMIVERGNMEAAYKRVVANKGSHGVDGMEVDELLPYLKENWATIKQQLLEG
FT                   KYKPQPVRRVEISKPDGGVRLLGIPTALDRLIQQAIAQILNRVYNHTFSDSSYGFRPGR
FT                   SAKDAIKAAEAYINEGYTWVVDMDLEKFFDRVNHDIIMSKLEKRIGDKRVLKLIRRYLE
FT                   SGVMINGIKVSTEEGTPQGGPLSPLLANIMLDELDKELEKRGHKFCRYADDCNIYVKSR
FT                   SAGNRVMKSIKKFIESKLKLKINEAKSAVDRPWRRKFLGFSFYTKENEVRIRIHEKSIK
FT                   RFKEKVREITNRNKGISMENRIKRLNQITTGWVNYFGLADAKSIMKTLDEWIRRRLRAC
FT                   IWKQWKKIKTKHDNLVKLGVEEQKAWEYANTRKGYWRISNSPILNKTLTNKYFESIGYK
FT                   SLSQRYLIVHNS"
FT   gene            146343..146783
FT                   /locus_tag="Thebr_0145"
FT   CDS_pept        146343..146783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78774"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008310"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTP2"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0139"
FT                   /protein_id="ADV78774.1"
FT                   /translation="MGEDGKLYIIREEILSDSLKKTLKVKELLESGKVKTINEAVKQVG
FT                   ISRSAFYKYRDYVFPFSKFSKGKIITLSMVLDHMPGVLSSILDVVANARGNVVTINQSM
FT                   PSMGVASVTISIDTQYMEMSLENFLEKLSSQNGVRKIEILGE"
FT   gene            146796..148052
FT                   /locus_tag="Thebr_0146"
FT   CDS_pept        146796..148052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0146"
FT                   /product="homoserine dehydrogenase"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; amino acid-binding ACT domain
FT                   protein; KEGG: tpd:Teth39_0140 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78775"
FT                   /db_xref="GOA:E8UTP3"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTP3"
FT                   /inference="protein motif:PFAM:PF00742"
FT                   /protein_id="ADV78775.1"
FT                   /translation="MKIGLMGLGTVGTGVVHLINQNGKNIEKKIGEKIEIKKILVKDPN
FT                   KKRTPLAEGKITFDANDILEDEEIDVVVEVMGKEHPALEYIIKALKKGKHVVTANKEVI
FT                   AVHGKELIKLATENKVSLLYEASVGGGIPIIRPLKQCLAANKIYEIKGILNGTTNYILT
FT                   EMKEKGFDFEEVLKEAQQKGYAEADPTDDVEGFDAARKLAILSTLAFNKFILPEKIYTK
FT                   GIKSISKSDIKYAEELGYNVKLIAYAKIDEEDRLEAWVHPVMIKKDNPLNGVNGVFNAI
FT                   LVDGNAVGEVMFYGQGAGMMPTASAVVADIMDVKNHIVIQNGCEDGDLLPIVDTVSKYY
FT                   IRLIAFDKPGVMSKITGILGDKGISLLSVVQKGVLGDTAEIVLITHIANTGKVFEALEE
FT                   IQNLKEVECIESVIRVEGE"
FT   gene            148056..149111
FT                   /locus_tag="Thebr_0147"
FT   CDS_pept        148056..149111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0147"
FT                   /product="threonine synthase"
FT                   /note="KEGG: tpd:Teth39_0141 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78776"
FT                   /db_xref="GOA:E8UTP4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTP4"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADV78776.1"
FT                   /translation="MGWEGLIKAYREFMPKIKEENIVTLKEGNTPLYEAVNLQKLFPGI
FT                   KIYLKYEGLNPTGSFKDRGMTVAVSQAKEEGSNAVVCASTGNTSASAAAYAAKAGLKSI
FT                   VLIPGGKIALGKLAQAIAYGAKVIAIDGNFDDALRLVREISQKFPITLVNSINPYRLEG
FT                   QKTASFEICDELKDAPSYVALPVGNAGNITAYWMGFKEYYNAKRITRLPKMLGFQAAGA
FT                   APIVENRVIEKPETIATAIRIGNPASWEKAVAARDESGGLIDKVTDEEILEAYALLAKS
FT                   EGIFAEPASAASIAGVIKKYKEGFFKEGESVVCVLTGNGLKDPDTAVKLGGEIKTIEAN
FT                   LKALEEVLYGE"
FT   gene            149101..150027
FT                   /locus_tag="Thebr_0148"
FT   CDS_pept        149101..150027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0148"
FT                   /product="homoserine kinase"
FT                   /note="KEGG: tpd:Teth39_0142 homoserine kinase; TIGRFAM:
FT                   homoserine kinase; PFAM: GHMP kinase; GHMP kinase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78777"
FT                   /db_xref="GOA:E8UTP5"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTP5"
FT                   /inference="protein motif:TFAM:TIGR00191"
FT                   /protein_id="ADV78777.1"
FT                   /translation="MESDMVKVKVPASSANLGPGFDSIGVALNLYTEISMGFIEEGLLI
FT                   EVSGEDYKEIETTENNLVYKAAKKVFEKTETQYEGLKIEIKNGIPIGSGLGSSAAAIIG
FT                   GMLAANELAGGILTHKEILDLAASMEGHADNVAPALNGGLNVTVFDGNTTYYVKKELEE
FT                   ELKFIAFTPKKLLKTEIARNILPQKIDFKDAVFNTGRSSLLTAALFSGRYDLLKIASQD
FT                   MLHQKYRSKLIPEMYACFEKALEAGAYSVFLSGAGPTIMAICPEEKVKRVVYEVSKVYI
FT                   DRGIDYRVYKLHCENNGAQVLKASLSI"
FT   gene            150477..155807
FT                   /locus_tag="Thebr_0149"
FT   CDS_pept        150477..155807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0149"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="KEGG: tpd:Teth39_0143 hypothetical protein; PFAM:
FT                   peptidase S8 and S53 subtilisin kexin sedolisin;
FT                   protease-associated PA domain protein; protein of unknown
FT                   function DUF1034; Ig domain protein group 2 domain protein;
FT                   SH3 type 3 domain protein; SMART: SH3 domain protein; Ig
FT                   domain protein group 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78778"
FT                   /db_xref="GOA:E8UTP6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTP6"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADV78778.1"
FT                   /translation="MAKKFLVFLVVFTLVFSAFGTFGYSQQIPTSEYSKLIIDFLKVDY
FT                   NLLKQIAQDNFKQNFQPYQSKSKIAERLGKEIQNLGEDAQQEIEKYSPDETVRVIIELQ
FT                   QDSVASYALKANKTLKTLAETEKANILNKIAQQQNQVKNELTKNFNFKVRHIYKTAING
FT                   ISGEVKVKDIEKIKLLPGVKDVRIANEYFLDMTSAVYSTNAPTVWNELGYKGEGMVVAV
FT                   IDTGIDYRHQDMKVADPNRVKLTKEKVQQIAAQTGLPYKYFTEKVPVGWNWADNNDEII
FT                   DIGATQSMHGQHVAGIIAANGNIKGVAPEAQLIVEKVFTNNPNFPSAFSDDIVAGIDHA
FT                   VAFGADVINMSLGSTAGFVRPDDPEHVAIKNAVDNGVIVVVSAGNSSYSTSAEFYPYAM
FT                   DPDIGTVGSPGLWLDAIQVAASINPGLTGKSFSVNPAPQGFDKVVYSVGSPSDHDPIDP
FT                   ADVLKGEYEVVYCGLGKPEDFQGKDVSGKVALISRGSITFNAKTINAQNAGAVAAIIYN
FT                   NTTGTISMALGEGTKIPSVSILKDAGLAIKALLDQGQKVTVKFDGAIATNNLGTPPGDN
FT                   VTDFSSWGVTPSFDFKPEIMAPGGGIYSTLNKDSYGLMSGTSMSSPYVAGAMALIAEVL
FT                   KERVAKGELKFENGRDFVEMAKIMAMNTAKVIIDTNDNAAPYTGKILRSPKPYSPRQQG
FT                   AGMIQIDKAIETPVTITDANGKAGIALGSIGNSVTFTLILKNHSNSDVTYNLKDEYGVL
FT                   TDYVLWGFNFAETTTLTGATVKFDKDTVTVPANGQATVNVTLIIPQNALQNIFAEGFLS
FT                   FIPQDSSLPKLSVPYTAFYGSWDEPRIIDSPLYEDDTYYGLTGMAGVINNELYFLGNLG
FT                   SKTPDPSTIAISPNGDGVFDFVQPVLSFLRNAREFKVSVVDENGNVIREITQEEYIRKN
FT                   VAATSMARISDSWIWDGTAFNPATGEFEVAPDGQYYMCFESKIDYPNAKTQLLEMPVKV
FT                   DTIAPEVMINKDYIDQYGYLKDIYISNGKATIEWGGQDEGSGIDSYIILTGKIDPITGN
FT                   VTNVEAKALPSDANVADVSIPYRYTFIAVVGVDYAGNVSETTIGQNGCIAFNSDIKDNF
FT                   GPVINVVEPQVGEIINTRDIVVSGNIQDETTFMGKLYINGELVPVDENNNFKTTVHFDS
FT                   DGRQKIQFLAIDHLYNENDPSTHEHKTEFEVPIYIDTTTPEITLDTKNLKGYISPNDIS
FT                   LIISGNVHDTGFGYKLYINGNMKSNKEADDYTTFDDTFAEKISLSREGDTFILIKAIDE
FT                   AMNTAEVKITARVYTSEVENYAMLTYEGNQIKVPLENVDLVSVAAEPNQIEIPAGKTAK
FT                   VAITAEFKDRTVDVTNKVRFESADESIAKVEADGTVKGIKQGETTVTAMYQNKTVEIKV
FT                   KVVAPVQEGIEVQPSSIEVPAGLTSAIKVYSILSNGEKIEVTQSAKYTVADKTIAEYNN
FT                   GVVKGLAKGNTILKVEYSGSSFEVPIKVTEAVLRDIIVQPLLIEVQIDGTYQMKVTGIY
FT                   SDGTEKDITKDANYTSKDTSIATVDKGLVKGVKKGTTVININYGGKTISVNVTVKEKPQ
FT                   LQGVVKALALNVREGASTSTKVIGVLPRGTVVTLLEEVNGWYKINYNGKTGYIYGVYVT
FT                   VMPSSSEVKTGRVTASVLNVREEASTSTKVIGTLSKGTVVTLLEEVNGWYKINYNGKIG
FT                   YIYGKYVDVISSSSDVTIIKTVKVTAKSGLNVRVSNSTSAAKLGVVPYGAELKVVGEYN
FT                   GWYKILYKGGFGYVYAKYTK"
FT   gene            156011..157093
FT                   /locus_tag="Thebr_0150"
FT   CDS_pept        156011..157093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0150"
FT                   /product="Alanine--glyoxylate transaminase"
FT                   /EC_number="2.6.1.44"
FT                   /note="KEGG: tpd:Teth39_0144 alanine--glyoxylate
FT                   transaminase; PFAM: aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78779"
FT                   /db_xref="GOA:E8UTP7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTP7"
FT                   /inference="protein motif:PRIAM:2.6.1.44"
FT                   /protein_id="ADV78779.1"
FT                   /translation="MKEMILMTPGPTMVPEDVKKVAGAQPLHHRTEDFYELFSNLNKNL
FT                   KEIFKTKNEVITLTSSGTGGMEAVIANLFSTGDKVLVASIGYFGERFYDIARAYGLDAE
FT                   LQDFGWGNAVDLDVLEDKLKNGNYKALLVTHNETSTGVTNNVKEIAKIANKYGVAIVVD
FT                   AVSSLGGIPLEMDEWGIDAVITCSQKCLMSPPGLSFVALSERAWKMAETSNLPKYYFNL
FT                   KKAKEGVLKPNPDTPATPAVSTIMAVAKATNMILEFGLDNVYKRQANYGKRVREYVKNL
FT                   GLELLPEEDIASDLITAIKVPEKYKASEIISHMKEKHGVLITGGQGPLKGKIIRIGHMG
FT                   YVTEEMLTKTLEALKDATEW"
FT   gene            157107..158702
FT                   /locus_tag="Thebr_0151"
FT   CDS_pept        157107..158702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0151"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="TIGRFAM: D-3-phosphoglycerate dehydrogenase; KEGG:
FT                   tpd:Teth39_0145 D-3-phosphoglycerate dehydrogenase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78780"
FT                   /db_xref="GOA:E8UTP8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTP8"
FT                   /inference="protein motif:TFAM:TIGR01327"
FT                   /protein_id="ADV78780.1"
FT                   /translation="MRIIVTEKISENGIEYLKKHADVDVKTNISRDELLEIIKDYDAII
FT                   VRSATKVDRELIEKGERLKVVGRAGNGVDNIDVTAATEKGILVVNTPAGNTVAAAELTI
FT                   GLMLAIARNIPQAYHAGLNGDFRRDKFKGVELNGKTVGIIGLGRIGSLVAARLAAFNMR
FT                   VIAYDPYMPDSRFEKYGVEKVTLDELLQQSDFITIHLPKTEETKKMLSEKEFKKMKKGV
FT                   RIVNAARGGIIDEKALYNAIKEGIVAAAGLDVLEVEPKYNVERQDFNNPLLELPNVVFT
FT                   PHLGASTYEAQENIGISIAQEVISALNGNLYGNIVNLPGVKSDEFSQLKPYMKLAEAMG
FT                   AFYYQINDTPVRLVEVIYRGEISKTNTDIVTLYALKGFLKPVLEEDVSVVNAKLRAKEM
FT                   GIEVVEGKIEEINHYSSLIILKITDTNGKTTQFAGTTYGEEVRIVEYMGHKVNFEPTEY
FT                   MLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDGTALMIVSTDKEIPDEAVESL
FT                   NKLNSIIKARAVRG"
FT   gene            complement(158751..159569)
FT                   /locus_tag="Thebr_0152"
FT   CDS_pept        complement(158751..159569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0152"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /note="KEGG: tpd:Teth39_0146 HisJ family histidinol
FT                   phosphate phosphatase; TIGRFAM: histidinol phosphate
FT                   phosphatase HisJ family; PFAM: PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78781"
FT                   /db_xref="GOA:E8UTP9"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTP9"
FT                   /inference="protein motif:TFAM:TIGR01856"
FT                   /protein_id="ADV78781.1"
FT                   /translation="MAADYHVHIENGPYTIEWLKKFIDVALQKGLTEIGISEHEHRFKE
FT                   GYNAYKSDGFRSEWIKNYMNQNISEYVELITEAKAMGLPVKLGIEADYFPGKEKEIKEF
FT                   IEPYPWDYVIGSVHWIEDWGIDLEESIEEWKSRDTDEVYLEYFNIIEKMAKTGLFDIIG
FT                   HIDLVKIFGFRAKPYTFDKIRQNIEEISKTGIVIEVSTAGLRKPVGEIYPSKEIMGMIK
FT                   EYNIPIVVNSDAHNPYDVARDFDKAYAYVKSYGINTLYYFEGRKRTPYNI"
FT   gene            159929..161530
FT                   /locus_tag="Thebr_0153"
FT   CDS_pept        159929..161530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0153"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="TIGRFAM: CTP synthase; KEGG: tpd:Teth39_0147 CTP
FT                   synthetase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78782"
FT                   /db_xref="GOA:E8UTQ0"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTQ0"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ADV78782.1"
FT                   /translation="MTKYIFVTGGVVSSLGKGITAASLGRLLKSRGISVAIQKFDPYIN
FT                   VDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDINLTKNSNVTAGKVYWSVITKERK
FT                   GDYLGATVQVIPHITNEIKERVYRVAKEKNVDVVITEIGGTVGDIESLPFLEAIRQVAI
FT                   EQGKDNVMFIHVTLVPHLGNTGELKTKPTQHSVKELRSIGIQPDMIVCRTELSLTQDLK
FT                   EKIALFCNVDVEAVIENRDVESIYEVPLEFEKQKVDEYVLRRLNLPLGQSDLKEWREYV
FT                   EREKNPIKEVEVALVGKYVDLHDAYISVVEALKHAGVYHSAAVNIRWVNAEHVNDETVE
FT                   TLLKGADGILVPGGFGDRGVEGKIRAIQYARENKIPYLGLCLGMQCAVIEFARNVAGLK
FT                   GANSTEFDPNTSYPVIDLMPEQKDIDEKGGTMRLGVYPCKVIEGTKAYQAYQDELVYER
FT                   HRHRYEFNNQYRELLTSKGLVLSGLSPDERLVEIIELKDHPYFVASQFHPEFKSRPLKP
FT                   HPLFRDFIGAILKIKG"
FT   gene            161792..162835
FT                   /locus_tag="Thebr_0154"
FT   CDS_pept        161792..162835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0154"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   tit:Thit_2281 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78783"
FT                   /db_xref="GOA:E8UR59"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8UR59"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADV78783.1"
FT                   /translation="MVHNNDTTKKRSFKHLSSYERGEIYALLKEGRSIRYIAKKLNRSP
FT                   STISREIKRGTTTQLRSDLSSYTSYFPETGQAIYEKNRSNCGAKFKVAKAEDFLKYAEN
FT                   KILNEKWSPDAVVGYCKKDPSWNNKTIVCTKTLYNYIDRGLLKVKNIDLPLKLRLKPRK
FT                   KQNRKNKRIMGKSIDFRPKEVESREVFGHWEIDTLIGKKSNDKVLLTLIERKTRHEIIF
FT                   LLDAKDNKSVKDALSKLKDMFGDNLSKVFKTITSDNGTEFSDLESALLEYGVEVYYTHP
FT                   YSSWERATNERHNGLIRRFIPKGKSIKDLSIDTIKRVENWLNNLPRKLLNYKTPKEYFY
FT                   EELAKIC"
FT   gene            163485..164895
FT                   /pseudo
FT                   /locus_tag="Thebr_0155"
FT   gene            165057..165887
FT                   /locus_tag="Thebr_0156"
FT   CDS_pept        165057..165887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0156"
FT                   /product="regulatory protein DeoR"
FT                   /note="KEGG: tpd:Teth39_0150 DeoR family transcriptional
FT                   regulator; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78784"
FT                   /db_xref="GOA:E8UTQ2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTQ2"
FT                   /inference="protein motif:PFAM:PF00455"
FT                   /protein_id="ADV78784.1"
FT                   /translation="MNMSISDRMFGEERRLKIAEIISKDKSISVSELSKLFNVSESTIR
FT                   RDLHVLEEKGFIQRTHGGAILNVGTHYEPAFFEKEDVELEAKRKIGKIAASMIEEGDSI
FT                   ILDAGTTTLEIARNLKNTKLTVVTNSPLIAIELSKHEDIELIVTGGIQRWRTKALVGPI
FT                   AEMVIRQFKVDKAFIGTNAISFEDGLMTPDLIEANTKKAMCDVSSEVYIVADHTKFGKK
FT                   SFVKFADIKDITAIITDDEIDYEIVRKYEQANIDIVSFGKDENNDNDGNGESSN"
FT   gene            165853..166785
FT                   /locus_tag="Thebr_0157"
FT   CDS_pept        165853..166785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0157"
FT                   /product="1-phosphofructokinase"
FT                   /note="KEGG: tpd:Teth39_0151 1-phosphofructokinase;
FT                   TIGRFAM: 1-phosphofructokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78785"
FT                   /db_xref="GOA:E8UTQ3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTQ3"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ADV78785.1"
FT                   /translation="MITTVTANPAIDRTIIVEDLKIGYVNRVIRSRVDAGGKGINVAKN
FT                   LKNFGDDVIALGFIGPNAKYIIDCLEDEGIKTDFVKIKNETRTNIKISDISRMEVTDLN
FT                   EYGPYVSEEEIELLKKSIFKYAKESKVLVLSGSLPQGVPKTFYKDIIREVKSGDLKIIL
FT                   DADKEALLYGIEEKPYMIKPNVQELEDVVGKKLESLEEVIEEGKKLKDSGIEIVAISMG
FT                   GRGSVVITKEGIYRVMPVKVEVKGTVGAGDAFVAGFAHGIYKGLPIEETIKIAAALSTS
FT                   VVMKEGTRAGTLEEVNILKDKIGIERIER"
FT   gene            166782..167237
FT                   /locus_tag="Thebr_0158"
FT   CDS_pept        166782..167237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0158"
FT                   /product="PTS system, fructose subfamily, IIA subunit"
FT                   /note="KEGG: tpd:Teth39_0152 putative PTS IIA-like
FT                   nitrogen-regulatory protein PtsN; TIGRFAM: PTS system,
FT                   fructose subfamily, IIA subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78786"
FT                   /db_xref="GOA:E8UTQ4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTQ4"
FT                   /inference="protein motif:TFAM:TIGR00848"
FT                   /protein_id="ADV78786.1"
FT                   /translation="MREMEIKDVLNEKMMVFDLKAKDKNGVLEELVSVLKENGVVDDEE
FT                   GFLEVVKRREEEFSTGIGYGVAIPHGKSSLVKKPAIVFGKSRQGIDYNSMDGKPAHLFF
FT                   LIAVPDNSDELHLKVLAELSRSLMHKEVREELEKALTPEEVINAFNK"
FT   gene            167261..168619
FT                   /locus_tag="Thebr_0159"
FT   CDS_pept        167261..168619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0159"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIC
FT                   subunit; PTS system, fructose-specific, IIB subunnit; KEGG:
FT                   tpd:Teth39_0153 PTS system, fructose subfamily, IIC
FT                   subunit; PFAM: phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78787"
FT                   /db_xref="GOA:E8UTQ5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTQ5"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ADV78787.1"
FT                   /translation="MKKVVAVTACPTGIAHTYMAAENLQMAAKEMGVDIKVETQGSIGA
FT                   ENQLTEEDIKAADAVIIAAATKVDKSRFAGKPVLEVPVEDAIKDAKGLIEKALKMEKPK
FT                   DYVEKVEEIHKERSAQRTGAYKHLMTGVSYMIPFVVAGGILIALSFFWGYKAFEVEGTL
FT                   PWALMKIGGGSAFALMVPILSGYIAFSIADRPGLVPGMVGGMLAVSTGAGFLGGIISGF
FT                   LAGYTIVYLKRLIKLPKTLEGLMPILILPVLSTLIVGLLMIYVIGSPMKAIMTSLTDWL
FT                   TGMSSTNAVIFGAILGLMMAFDMGGPVNKTAYTFATGLLASNVFAPMAAVMAAGMTPPL
FT                   GLALATALFKNRFTKEEIEAGKAAWVLGASFITEGAIPFAAADPFRVIPSIMVGSAVTG
FT                   ALSMLFHIELRAPHGGIFVIPIAVSNPLLYIGVIAVGTVVTALMVALLKKKVE"
FT   sig_peptide     167261..167323
FT                   /locus_tag="Thebr_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.728) with cleavage site probability 0.727 at
FT                   residue 21"
FT   gene            complement(168648..168938)
FT                   /locus_tag="Thebr_0160"
FT   CDS_pept        complement(168648..168938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78788"
FT                   /db_xref="GOA:E8UTQ6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTQ6"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0154"
FT                   /protein_id="ADV78788.1"
FT                   /translation="MEMQNITLSLPKGLLQKIKHIAIDRQTSVSSLLTETLEEIVRKEN
FT                   SYDKAKSRHILEKGFNLGTEGELTWSREDLYRDLNSGQYSGKVKVQNPFSK"
FT   gene            complement(168961..169398)
FT                   /locus_tag="Thebr_0161"
FT   CDS_pept        complement(168961..169398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0161"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   tpd:Teth39_0155 heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78789"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTQ7"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADV78789.1"
FT                   /translation="MSLMRRGRDWWDWPFDFNIRNLPSIFDVNFPSISGLFSRPRVDIT
FT                   ESETEIVATAELPGVDKKDIEINVYDNILEIKGQTTVDEEREDKNYYMRERYYGSFARR
FT                   IELPAEVDPERTTAKFENGILKITMPKLHPSKPKGRKIDIE"
FT   gene            169562..170470
FT                   /locus_tag="Thebr_0162"
FT   CDS_pept        169562..170470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0162"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   tpd:Teth39_0156 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78790"
FT                   /db_xref="GOA:E8UTQ8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTQ8"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADV78790.1"
FT                   /translation="MRPDEKDVSKLYFFVMLLFITVGYLVQKASLYIGILITEFFLVLL
FT                   PVILYLFLKKYDVKYVLRLNPIKGDKVFLVIIIAILGWIVSGFFALLTNYFLSKLGKIP
FT                   VMQMPAASNIQELFMQILIFGAVAACSEEIFMRGLVMRSFEMRGSIKSIFITAIFFAML
FT                   HLNVQNFLSILFLGSLLGYVVYRTNSIYAGMIGHFTNNTISVLLSYFVAQQNLGKATPL
FT                   QQVNIPFIVVVGYGIFALFASVLLYVLLRYLKKITDPYIIRGTTTVKEDLHIFLYWPVL
FT                   LSVLVFVYRISWEILKIAGVI"
FT   gene            170583..171596
FT                   /locus_tag="Thebr_0163"
FT   CDS_pept        170583..171596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0163"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="KEGG: tpd:Teth39_0157 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78791"
FT                   /db_xref="GOA:E8UTQ9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTQ9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADV78791.1"
FT                   /translation="MNVTIKDVAKRANVAPSTVSRVIADNPRISKETKERVWKAMEELG
FT                   YYPNAIARSLASKVTNTLGLIMPRSTEEAFSNPFFPEVMRGISVVAHREKYDLLLSTSG
FT                   NQEEEKEAVINMVKGKRVDGIILLSSRTTDELIPWLRDEKFPFVVIGKPLDAKGVYWVD
FT                   NDNIGASKLATNYLIKHGHREIAFISGSLEYVVSLDRLDGYKLALEENGIPFKRELVEQ
FT                   DEFSEDGGYRAMMRILEREKPTAVVVTDDVMAFGVIRAAIDKGYRVPEDISIVGFNNIP
FT                   LSAFANPPLTTIDISTFDLGIKSAELLIARLKQKDVDTDHIIVPVKLVERKSCVAR"
FT   gene            complement(171610..173004)
FT                   /locus_tag="Thebr_0164"
FT   CDS_pept        complement(171610..173004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0164"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="KEGG: tpd:Teth39_0158
FT                   UDP-N-acetylmuramate--L-alanine ligase; TIGRFAM:
FT                   UDP-N-acetylmuramate/alanine ligase; PFAM: Mur ligase
FT                   middle domain protein; cytoplasmic peptidoglycan synthetase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78792"
FT                   /db_xref="GOA:E8UTR0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTR0"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ADV78792.1"
FT                   /translation="MDINLENFKRVHFIGIGGISMSGLAHILLNNGHIVTGSDIKNSHI
FT                   IERLRQEGAVITIPHNENSVIGADLVVYTAAIHEDNPEYQKAKELNIPIIDRATLLGLI
FT                   MKKYKYGIAVAGSHGKTTTTSLISVILDGMEFDPTVLVGGEVDVIGGNVRVGSSEYFVT
FT                   EACEYTDSFLKFYPYIAVILNVDSDHLDYFKNIDNIKQSFRQFANLVPPDGFVVACKDD
FT                   ANTMYVVNGLNKNIVTYGIYQDSDWKAKNISFDDKGCAIFDVYYKEEYMGNFKLSIPGK
FT                   HNVYNALAALAVSHLVGIDIKKASHYLTEFKGTHRRFEIKGIVDGITIVDDYAHHPAEI
FT                   KATLEAAKNYPHKRIICIFQPHTYSRTKSLLNDFAGSFDNADKIIIADIYAAREKDTGI
FT                   VSSKDLVELISQRGKDVLYLKDFDSIVEYLNKNAKAGDLVLTVGAGNIYEVGEMFLKGH
FT                   KKAVGM"
FT   gene            173179..174003
FT                   /locus_tag="Thebr_0165"
FT   CDS_pept        173179..174003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0165"
FT                   /product="pur operon repressor"
FT                   /note="KEGG: tpd:Teth39_0159 pur operon repressor; TIGRFAM:
FT                   pur operon repressor; PFAM: purine repressor ;
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78793"
FT                   /db_xref="GOA:E8UTR1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTR1"
FT                   /inference="protein motif:TFAM:TIGR01743"
FT                   /protein_id="ADV78793.1"
FT                   /translation="MDKYKRYERLAAIVKIFSENPNTLINLEYFVNFFGIAKSTASEDI
FT                   DILKNVIEKFSFGKLITLPGAGGGVKYIPIANIKSYLPFVQEIKEKLKDPSRIIPGGFL
FT                   YTADLIYSPNIVTKIGEILVFPFLDKNVDAIVTVETKGIPIALMCARTLNVPLVIIRKD
FT                   SRVTEGSFVSINYISGSQRHIRSMSLARRSLQKGSKVLLIDDFMKAGGTIRGMMELMEE
FT                   FDAEVVGAGVMISTEKPENKLVDNYISVFVLKNMEEEKNIIDIEISDWILKG"
FT   gene            174146..174424
FT                   /locus_tag="Thebr_0166"
FT   CDS_pept        174146..174424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0166"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: tpd:Teth39_0160
FT                   regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78794"
FT                   /db_xref="GOA:E8UTR2"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTR2"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ADV78794.1"
FT                   /translation="MEITDVRVRKLNEEGKMKAVVSVTFDNEFVVHDIKVIEGQNGLFI
FT                   AMPSRKTPEGEFKDIAHPINSDTRNRLQSAILKEYEKAKEQEAAHKE"
FT   gene            174530..175903
FT                   /locus_tag="Thebr_0167"
FT   CDS_pept        174530..175903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0167"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="KEGG: tpd:Teth39_0161 bifunctional
FT                   N-acetylglucosamine-1-phosphate
FT                   uridyltransferase/glucosamine-1-phosphate
FT                   acetyltransferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78795"
FT                   /db_xref="GOA:E8UTR3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTR3"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ADV78795.1"
FT                   /translation="MEGLVTLILAAGLGKRMKSKHPKVVHKVCGKPMIEWVVDAVEEIG
FT                   SKEVIVVVGHKAEEVKEVLKERVKYAYQEVQLGTGHAVMMAEDLLPEEGNVLILTGDTP
FT                   LITSNTLKELINFHIKEGNSVTILSSVLEDPTGYGRIIRDKSGNVIRIVEDKDATEEEK
FT                   SIHEINSAMYVMDIAKLKKALRMITNNNAQGEYYLTDAVEIIRDMDGKIGAFTVPSEEI
FT                   TGVNSRVQLFEAEKIMRKRINYRHMENGVTIVDPDTTYIGAEVEIGADTVVLPGCVIEG
FT                   KTKIGSDCEIGPNCRIVDSEIGDGCSVTYSVILSSKIKNNVKIGPFAHIRPETVIQSNV
FT                   KIGDFVEIKKSIIDEGSKVPHLTYVGDAEVGKNVNMGCGSITVNYDGKQKHKTVIGDNV
FT                   FVGCNVNLVAPVKIGNNAYIAAGSTITEDVPEGALAIARSRQTNKEGWVQERIKKGRL"
FT   gene            175909..176859
FT                   /locus_tag="Thebr_0168"
FT   CDS_pept        175909..176859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0168"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; KEGG:
FT                   tpd:Teth39_0162 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78796"
FT                   /db_xref="GOA:E8UTR4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTR4"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADV78796.1"
FT                   /translation="MARYTNSLKIFSGNSNPKLASEIAEHLGLKLCDSEVGTFSDGEIS
FT                   VRIGESVRGASVFVIQSTCAPVNNNLMELLIMIDAFKRASAAEINAVIPYYGYARQDRK
FT                   AKARDPITAKLVADLITAAGAHRVVTMDLHAPQIQGYFNIPVDHLLGGPILAKYFLDKE
FT                   LGNDVVVVSPDHGSVTRARYFAEKLNAPLAIIDKRRPKANVAEIMNIIGDVRGKKAILV
FT                   DDLIDTAGTLVQGAEALLDSGATEVYACATHGVLSGPAIERLKESPIKELVITDTIPLP
FT                   EEKKIDKIKVRSVAPLFAEAILRIHEGMSVSKLFV"
FT   gene            177304..178716
FT                   /locus_tag="Thebr_0169"
FT   CDS_pept        177304..178716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0169"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: tpd:Teth39_0163 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78797"
FT                   /db_xref="GOA:E8UTR5"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTR5"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADV78797.1"
FT                   /translation="MDSKDMQRLQTTQQRGYPLDREMEFQKTTEVHSISSASRDGRNEV
FT                   QRYTSKMLEMIVERGNMRAAYKRVVANKGSHGVDGMEVDELLPYLKENWPTIKQQLLEG
FT                   KYKPQPVRRVEIPKPDGGVRLLGIPTALDRLIQQAIAQILNRVYNHTFSDSSYGFRPGR
FT                   SAKDAIKAAEAYINEGYTWVVDMDLEKFFDRVNHDIIMSKLEKRIGDKRVLKLIRRYLE
FT                   SGVMINGVKVSTEEGTPQGGPLSPLLANIMLDELDKELEKRGHKFCRYADDCNIYVKSR
FT                   SAGNRVMKSIKKFIESKLKLKVNEAKSAVDRPWRRKFLGFSFYTKENEVRIRIHEKSIK
FT                   RFKEKVREITNRNKGISMENRIKRLNQITTGWVNYFGLADAKSIMKTLDEWIRRRLRAC
FT                   IWKQWKKIKTKHDNLVKLGVEEQKAWEYANTRKGYWRISNSPILNKTLTNKYFESIGYK
FT                   SLSQRYLIVHNS"
FT   gene            178856..179539
FT                   /locus_tag="Thebr_0170"
FT   CDS_pept        178856..179539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0170"
FT                   /product="response regulator receiver"
FT                   /note="KEGG: tpd:Teth39_0164 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78798"
FT                   /db_xref="GOA:E8UTR6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTR6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADV78798.1"
FT                   /translation="MGDNRKIYVVDDDKNICEIVSLYLEKEGFDVEQIYDGQTALKKIQ
FT                   EKPPKLVILDIMLPGIDGIALCREVRKFSKVPIIMLTAKGDTLDKVLALEIGADDYIVK
FT                   PFDGKELVARVKAVLRRYEPESEEKQAVSYPELYVSLSEYKVVYKGQNVDLTPKELELL
FT                   YFLCTHPNRVFTRDQLLENVWGYDYMGDSRTVDVHIKRLREKMGDGPNWKLTTVWGVGY
FT                   KFEVN"
FT   gene            179542..180954
FT                   /locus_tag="Thebr_0171"
FT   CDS_pept        179542..180954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0171"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: tpd:Teth39_0165 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78799"
FT                   /db_xref="GOA:E8UTR7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTR7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADV78799.1"
FT                   /translation="MSKNRLFKKLFISNMIIILITLSILSGMFYLMFQNYYFADKEKIM
FT                   LEEAQEINAILNEFAVGDINIDKWNQELNVVTRLINATVWIVDKEGLIYSQSQQQGKAW
FT                   TGVSLSKEEIKSILDGQSVVKKGYFGGKFNQPVLTVGVPLVINGRIEGAIFMHAPLTEM
FT                   NKTIINIFILMLLSGGVALIIGFVLISYTSSKISQPLKEMSLAVQQVAKGNFSARVQHK
FT                   EEDEIGDLAKSFNIMAKELEQLENMRKDFVANVSHELRSPLTSIQGYIDGILDGTIPKE
FT                   KACDYLKIVQKETRRMSRLIDDFLEMTKLESGQFPLHKTEFDINELIRLAVIKFEKRIV
FT                   EKDLTVKVDFEEDRRIVIGDKDKIEQVLTNLIDNAIKFSKEKGIIHIFTEIKDDKVFIT
FT                   IKDNGIGISPEDQEHIWDRFYKADKSRGKDGAGLGLYIVKRIINAHNEEIWVESEVGKG
FT                   TAFTFTLSVKKF"
FT   gene            181219..182580
FT                   /locus_tag="Thebr_0172"
FT   CDS_pept        181219..182580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0172"
FT                   /product="HtrA2 peptidase"
FT                   /EC_number="3.4.21.108"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: tpd:Teth39_0166
FT                   2-alkenal reductase; SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78800"
FT                   /db_xref="GOA:E8UTR8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTR8"
FT                   /inference="protein motif:PRIAM:3.4.21.108"
FT                   /protein_id="ADV78800.1"
FT                   /translation="MDYEKDFEDKIEKNDPENVVLPEENEKEELYQTEELNSEILKAEE
FT                   QKQEELETTAPIPKVVFRNNKKSLGKMVKRFRKRMLASFIAVALVAALIGGGITGTVMK
FT                   YYGTQNDASAQVVTRYLPLDATSSDESGILNLIPNIYKIVSPAVVEISTSVAYNYGYRT
FT                   RGSGSGFIISSDGYIVTNNHVIDGASKITVKLSDGRSADAKLVGKDDRTDLAVLKINLP
FT                   NLPIVKLGDSSKLQPGELAIAIGNPLGESFAGTVTAGIISGLNRNLQSDYGPVKLIQTD
FT                   AAINPGNSGGPLVNSKAEVIGITSVKLTSIGPSIQDPFGMFQSQGTPVEGMGFAIPINE
FT                   AKPIIDQIIKHGYVERPMMGIGAQTITQQDAAQYNLPVGVYVVQVQPNSGAEKAGIQPG
FT                   DVIIKADGKTITSFEDLQSIINNHKVGDVISVTVWRNGKTFTVPVKLQSSANFQ"
FT   gene            182709..183263
FT                   /locus_tag="Thebr_0173"
FT   CDS_pept        182709..183263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0173"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   tpd:Teth39_0167 peptidyl-tRNA hydrolase; PFAM:
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78801"
FT                   /db_xref="GOA:E8UTR9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTR9"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADV78801.1"
FT                   /translation="MYVIAGLGNPGREYEGTRHNVGFMVIDELAKKLGMNVTKLKFKSL
FT                   VGEGNFKGEKIILLKPQTFVNSSGEALYDAVNFYKIPLENVIVIYDDKDLDVGKIRIRK
FT                   KGSSGGHNGMNSIIYLLNSEEFPRVRIGIGKPQKDLVSHVLGKFEESEKKLIDEAVIKA
FT                   ADAVIDIIENGIEHAMSKFNG"
FT   gene            183295..183663
FT                   /locus_tag="Thebr_0174"
FT   CDS_pept        183295..183663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78802"
FT                   /db_xref="GOA:E8UTS0"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTS0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0168"
FT                   /protein_id="ADV78802.1"
FT                   /translation="MWLLSGIGGVILAYFLNRMAVTKYKRRAIIYLVPAIEETCKTVVG
FT                   YLTSSILLSHLIFGIAEAVNDYIKASYKINLRASILSILSHSFFGITSYILVMQTNIFL
FT                   AIIVTSLIHGLWNSLMLR"
FT   gene            183669..187166
FT                   /locus_tag="Thebr_0175"
FT   CDS_pept        183669..187166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0175"
FT                   /product="transcription-repair coupling factor"
FT                   /note="TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   transcription factor CarD; DEAD/DEAH box helicase domain
FT                   protein; helicase domain protein; TRCF domain protein;
FT                   KEGG: tpd:Teth39_0169 transcription-repair coupling factor;
FT                   SMART: DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78803"
FT                   /db_xref="GOA:E8UTS1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTS1"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ADV78803.1"
FT                   /translation="MFTRQIEELKEIKTIEEFLQQRKGPVLAYGLTDSQKAHIAHYIMT
FT                   KFNKKVLVIAPDEVEARKIYEDLYSFNFGNASLFPKREALFYKIDAASQEVVSQRLQVI
FT                   KKLSEESPHAVVTSIDAAVGKLIPMDLFKKYQFVFKLGDTVNLEEVIKSLVTMGYERVQ
FT                   IVEGKGQFSVRGGIIDVFSPTEEYPYRIELFDDEIDSIRTFDVITQRSLENIDKINIFP
FT                   ATEFIAEAEHIKKGISAVSNYLNSYLSKIKKPKSGIAEKLQQKFEEIMEEITESKRVEN
FT                   IYELIDYFYDDVYSIVDYMGEDAVIILDESSRIKQRVNNLQMEFNENFKALLEKGEVLP
FT                   EQSKLFFDYEEILKRVKNNFLLIMNTLAKPGNELQPQTIVNFVSRSMHHFHGNMDILVD
FT                   DLKYYKNAGYKVLLLSGNQERARILKDTLDSFNIDTVVIKDSEYDIQKGQVVIYAASVS
FT                   KGFEYVDAKFAVISDGEIFGQTKRRKRTVKIKNADKIKSFTELEIGSYVVHVNYGIGKY
FT                   EGIEKIKVDGIVRDYLKIIYAGGDTLFVPVEQLDLVQKYVGPTDNPPKLNKLGGSEWLR
FT                   AKRKAKKAVEDLAKDLIQLYAKRQMVKGHAFSPDTPWQKEFEEQFPYEETEDQLRCIKE
FT                   IKEDMEKDRPMDRLLCGDVGYGKTEVALRAAFKAVADGKQVAFLCPTTILAYQHYANFI
FT                   ERFKEFPVKIEMLSRFRTPKEQSKIIKELAEGNIDIIVGTHRLLQNDIKFKDLGLLIID
FT                   EEQRFGVVHKEKIKKLKENIDVLTLSATPIPRTLHMSLIGIRDMSVLENPPEDRFPVET
FT                   YVVEFNEELIKDAILREIARGGQVYFVYNRVNGIEKMASFVKDLVPGCRVAVAHGQMEE
FT                   SQLEKVMIDFLNGEYDVLVSTTIIETGLDIPNVNTIIVYDADKLGLSQLYQLRGRVGRS
FT                   NRLAYAYFTYRKDKVLSEVAEKRLEAIKEFTEFGSGFKIAMRDLEIRGAGNLLGAEQHG
FT                   HIDAIGYDLYLKLLEEAIRNLKGEAPKEEITTTIDIKVNAYIDSSYIEDENLRLEMYKK
FT                   IASIKSREDMIEISEELVDRFGDYPKPVEALLEIAYLKAIASQVNITEITEKGNSVILK
FT                   FNDMNLVNMEVIEKVIKEYGGNLVFSSQVQPYLTYKFNKKETLQKELIELVEKIKSLQ"
FT   gene            187232..188137
FT                   /locus_tag="Thebr_0176"
FT   CDS_pept        187232..188137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0176"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: tpd:Teth39_0170 PpiC-type
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78804"
FT                   /db_xref="GOA:E8UTS2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTS2"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ADV78804.1"
FT                   /translation="MKRKIALLLSFVFIVFLTVSCSAEKDVVAVVNGENITNAEYKKVF
FT                   DQVKAQIESSPQYTKDIWDEDYQGKKFLDVVKENVLDSLIAEKLLVQEALKNNITVTDK
FT                   EIEDEYQKQKEVNKDITKEDVKNYLLINKLFDEYTKDVKVTEEELKKYYEDNEEQFETV
FT                   KASHILVVDEKTAEDIYNRLMKGEDFATLAKEYSVDTATKDQGGDLGEFPHGVMVPEFD
FT                   QVVFSLKKGEISKPVKTDYGYHIIKSDGVIIKPFDEVKDTIESYLLDDKKNQVIIEKYD
FT                   ALEKAAKIQKFPQNIKVTVG"
FT   sig_peptide     187232..187303
FT                   /locus_tag="Thebr_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.645 at
FT                   residue 24"
FT   gene            188243..188794
FT                   /locus_tag="Thebr_0177"
FT   CDS_pept        188243..188794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0177"
FT                   /product="stage V sporulation protein T"
FT                   /note="KEGG: tpd:Teth39_0171 AbrB family transcriptional
FT                   regulator; TIGRFAM: stage V sporulation protein T;
FT                   transcriptional regulator, AbrB family; PFAM: SpoVT/AbrB
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78805"
FT                   /db_xref="GOA:E8UTS3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTS3"
FT                   /inference="protein motif:TFAM:TIGR02851"
FT                   /protein_id="ADV78805.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIKEGDPLEIFTDREGEII
FT                   LKKYSPISELSDFAQEYADSIYQSTKHPVCITDTDNVIAVSGVAKKELIDKPISQELEK
FT                   YLEAKKTIMLGTGKDKGPIKIADGQEFNITSQVIVPIISRGDTIGSVVIFTKEAGEAVT
FT                   EVEAKIAETAAAFLGKQMEE"
FT   gene            188867..189721
FT                   /locus_tag="Thebr_0178"
FT   CDS_pept        188867..189721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0178"
FT                   /product="sporulation peptidase YabG"
FT                   /note="KEGG: tpd:Teth39_0172 peptidase U57, YabG; TIGRFAM:
FT                   sporulation peptidase YabG; PFAM: peptidase U57 YabG"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78806"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTS4"
FT                   /inference="protein motif:TFAM:TIGR02855"
FT                   /protein_id="ADV78806.1"
FT                   /translation="MAFRINDIVMRKSYGSDILFRVINVIDNKGVRHYLLHGLNMRIIA
FT                   DAPEDDLIEVSRAKIAEYDRPYKEKAEYLLKKIASSKSLQRKKGMVRASRQEPYGRPGK
FT                   VLHIDGDEEYLNICLDAYKKVGMEVVGVVVKEEEQPDKVYDLLEKYRPDILVLTGHDSI
FT                   RSNSRDYGDINNYRNSKYFVEAVKNARKYEPALDNLVIFAGACQSNYEALIKAGANYAS
FT                   SPERVLIHCLDPVLVSEKVAFFHINELVKIEELIENTITGAPGIGGLQTIGKFRYGIPK
FT                   GKY"
FT   gene            189898..190941
FT                   /locus_tag="Thebr_0179"
FT   CDS_pept        189898..190941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0179"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   tit:Thit_2281 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78807"
FT                   /db_xref="GOA:E8UR59"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8UR59"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADV78807.1"
FT                   /translation="MVHNNDTTKKRSFKHLSSYERGEIYALLKEGRSIRYIAKKLNRSP
FT                   STISREIKRGTTTQLRSDLSSYTSYFPETGQAIYEKNRSNCGAKFKVAKAEDFLKYAEN
FT                   KILNEKWSPDAVVGYCKKDPSWNNKTIVCTKTLYNYIDRGLLKVKNIDLPLKLRLKPRK
FT                   KQNRKNKRIMGKSIDFRPKEVESREVFGHWEIDTLIGKKSNDKVLLTLIERKTRHEIIF
FT                   LLDAKDNKSVKDALSKLKDMFGDNLSKVFKTITSDNGTEFSDLESALLEYGVEVYYTHP
FT                   YSSWERATNERHNGLIRRFIPKGKSIKDLSIDTIKRVENWLNNLPRKLLNYKTPKEYFY
FT                   EELAKIC"
FT   gene            191267..191536
FT                   /locus_tag="Thebr_0180"
FT   CDS_pept        191267..191536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0180"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   tpd:Teth39_0174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78808"
FT                   /db_xref="GOA:E8UTS6"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTS6"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ADV78808.1"
FT                   /translation="MVADRSTLDEIKKQLDKHIGARVRLKTNGGRKKTIIKEGLLEKTY
FT                   PSIFIVVLDGQGATRRVSYSYSDILTDTVELTVMEGNKKIQCLQ"
FT   gene            191643..193169
FT                   /locus_tag="Thebr_0181"
FT   CDS_pept        191643..193169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0181"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="KEGG: tpd:Teth39_0175 peptidoglycan-binding LysM;
FT                   PFAM: Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78809"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTS7"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ADV78809.1"
FT                   /translation="MPQVYKDILEFDSVSGTYDTQLLVESDIIVPENEPDVLVLLALNP
FT                   RTYINEVFVTEGKVQFEGKLALDILYLGEKNGELERIEKEIDYSHVIEDEGIDKRSRCM
FT                   LVANVENVDYKLVNSRKISMRAVIKIQCRLVVSDKKEVVIGAEDSIKVESLKKKVKLMH
FT                   TVGQNSVEVFVKDKIKVPEGEAPIQKVVKTDVAVKPEEIKVTDNKVIVQGSVQCNILYI
FT                   SQEGEFGNLEADLNYANFVDIPGALSYMSAKTQEELMEVITTAVEDEKGENTILDIEVT
FT                   IRVKVQVFETEDRELPVDAYGTKAYIQPMKENLTVIEELQSYKSQFVVKTNVELPSLLK
FT                   RFIDVVVIPIISDYSVDVDKLVLEGILDYTILYLSEEGSVKSYRDEYPFKTFVEISQVK
FT                   GPMLVDIKISHVSYEIIAMKEIELKFAIDNTVDLLAEKEIEVIVDLKEIEAPREIDNKH
FT                   SIVVYMIQKGETLWDIAKRYRVGLEELISANGLEEEKVSEGMKLIIPMEE"
FT   gene            193268..194137
FT                   /locus_tag="Thebr_0182"
FT   CDS_pept        193268..194137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0182"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="KEGG: tpd:Teth39_0176
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78810"
FT                   /db_xref="GOA:E8UTS8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTS8"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ADV78810.1"
FT                   /translation="MKKIKVKAYAKINLSLDVLGKREDGYHEISTIMQSIDLADILEFE
FT                   KSEIVKVFCNDHRVPLGEDNLIVKVINLLKEKYQMEEGVLVKLDKRIPLAAGLAGGSAD
FT                   AAATIVALDKLWNLNMSKEEKKEIALKVGADVPFCLEGGTKLAKGIGEIFEDLKITSMN
FT                   LLLVKPDIEISTKEIYDKWDRLNFKSHHATVPVVQAIQEGNIYKIAENIKNDLELVTSQ
FT                   KYGIINKIKEELLKKGALGCAMSGSGPTVYGIFDDLEKLRKAYEDLKEVYSFVFFSKTI
FT                   DKGLELYE"
FT   gene            194130..194807
FT                   /locus_tag="Thebr_0183"
FT   CDS_pept        194130..194807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0183"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: tpd:Teth39_0177 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: GntR domain protein; regulatory protein
FT                   GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78811"
FT                   /db_xref="GOA:E8UTS9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTS9"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADV78811.1"
FT                   /translation="MNDFLPLENYKPLRDVVFDYMKDAIITGKLKPGERLMEVQLAEKL
FT                   GASRTPVREAIRKLELEGLVVMVPRKGAYVADLDAKDLLNVLEVRSSLEGLAASLAAER
FT                   ITEEEIDKLKKIIEEFQKKIEEGDNEGLVKLDKEFHDLIFTASRNDKLIQIMNNLQEHV
FT                   HRFRVRYINEEKKAKKIHQEHKKITEAIEARDTDAARKWAEKHIRNFQTEVVKDIKYFS
FT                   YKE"
FT   gene            194813..195541
FT                   /locus_tag="Thebr_0184"
FT   CDS_pept        194813..195541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0184"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A-like protein"
FT                   /note="KEGG: tpd:Teth39_0178 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78812"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTT0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0178"
FT                   /protein_id="ADV78812.1"
FT                   /translation="MNAIILAGSTKEDKLPDKAFIEIKGKYMISYVIEALRGCDKIDKI
FT                   AVVGDPEKLKKVVGIDVIIEQADNIMDNVLKGVELFKNDKRVLILTCDIPMLTKEAVCD
FT                   FIEKSEATGADLCYPIVRKEDNLKKFPEAKRTYARVKEGVFTGGNIFYVNPGIIDRLIK
FT                   DAKQFITYRKRPWKLGKLLGGKILFLFLIGRLSISHIEKKAEELFNINGKAIISEYPEI
FT                   GNDVDKEEDVVMATKYLSRK"
FT   gene            195610..195822
FT                   /locus_tag="Thebr_0185"
FT   CDS_pept        195610..195822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78813"
FT                   /db_xref="GOA:E8UTT1"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTT1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0179"
FT                   /protein_id="ADV78813.1"
FT                   /translation="MYSLLHFVRQYFTVYMFANVFIVGIYEAFIEPKFLERKGLDRDAK
FT                   LCRWIGLFYVFIGIVAIILRTFFPM"
FT   gene            195833..197437
FT                   /locus_tag="Thebr_0186"
FT   CDS_pept        195833..197437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0186"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   tpd:Teth39_0180 GerA spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78814"
FT                   /db_xref="GOA:E8UTT2"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTT2"
FT                   /inference="protein motif:PFAM:PF03323"
FT                   /protein_id="ADV78814.1"
FT                   /translation="MRFFDKIFGKKNDKKEAKNGTLASNSLKVNLDYIKNKLKDCDDVI
FT                   YRDIWVGENQQYNLAIVFIDGLVDKDLINDHVLHSLLLDSRQAAPSIEKIKGNLYEVIK
FT                   KGTITGGDIKQITDLDKCILSILSGDTALLFEGSPEIVIISSKGWQMRSISSPEAETVI
FT                   RGPREGFTETIRVNTALVRRRIRDPNLKIKQIQIGERTHTDVAVLYIEDIVDRNVLDKV
FT                   MKRLKNIKIDGVFESGYIEQLIEEDWHSPFPQVLSTERPDKVAASLLEGRVAILTDNTP
FT                   FALIIPTTLATLFQSPEDYYERWMISSLLRILRFLAAIVALVSPAVYIAFTAYHPGLIP
FT                   TKLTLYVAATRQGIPFPAFFEALIMEATFELLREAGVRLPVPIGQTIGIVGGLIIGQAA
FT                   VEAGIVSPLMVIVVAVTAVASFAIPSYSAAIAFRMLRFIFMLLAAVFGLYGIMLGFMVV
FT                   LTHLVVLKSFGVPYLSPFVEIDISDLADTLIKAPLMYFKNRPEILDTPDRKKMKDLREE
FT                   KIESIEDDRRDNNDKKQ"
FT   gene            197421..198530
FT                   /locus_tag="Thebr_0187"
FT   CDS_pept        197421..198530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0187"
FT                   /product="spore germination protein"
FT                   /note="KEGG: tpd:Teth39_0181 spore germination protein;
FT                   TIGRFAM: spore germination protein; PFAM: Spore germination
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78815"
FT                   /db_xref="GOA:E8UTT3"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTT3"
FT                   /inference="protein motif:TFAM:TIGR00912"
FT                   /protein_id="ADV78815.1"
FT                   /translation="MIKNNDKISANQVAIILFTTMVGAGILSLPADVSKEVGPNGLIAI
FT                   LGGGIASLFFARLILYLSSKFPTETFVEYAGKLITRPISIVISAVLVFYFVMFVSLDAR
FT                   IFGEVLKIYLLPSTPIEIIILTMLFSSAYLVRYGLEPIARMSEILFPIMVIPLVLLFLP
FT                   ALTDVDLSNFLPFMRVSLIKFFKGMLMTTYSFVGFEILYLLFPYVIDRDKLKRSVNSAM
FT                   FSTMLFYMYITFFVIGIFGYKETREQLWPFLTLIKSINFPVFFIENVEGIIMGIWTFTI
FT                   FTTIYSFHYFATLILSKLLKAREHSYFVLPAVPIIYLISLIPDSIVTVYKYAGYVSQYM
FT                   SVFFIAILPILLYIILKVKRLGGKDEEKT"
FT   gene            198514..199665
FT                   /locus_tag="Thebr_0188"
FT   CDS_pept        198514..199665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0188"
FT                   /product="germination protein, Ger(x)C family"
FT                   /note="KEGG: tpd:Teth39_0182 spore germination B3 GerAC
FT                   family protein; TIGRFAM: germination protein, Ger(x)C
FT                   family; PFAM: spore germination B3 GerAC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78816"
FT                   /db_xref="GOA:E8UTT4"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTT4"
FT                   /inference="protein motif:TFAM:TIGR02887"
FT                   /protein_id="ADV78816.1"
FT                   /translation="MKRKLKIVILWVLILLMLTGCWDKIEIEDRAFVMAIGIDLSSSNK
FT                   RYVVTFQFPNAAQITKGTSGGGGGSEKPSFAVSEVADTIFSASRHISTRIDKALYLGHT
FT                   QAIIFGKDVVENKDKFQQVLDSLDRSYELSRKVYLLVTPQKAQDILLKKYEMEPNTGAY
FT                   IRDIFKHYNRTSRFPTIDYNKITKSLHETNGNAIIPKIIAGKDEIKIAGSAIIKNYKLA
FT                   GWMEDDENMGYMLLTGLVKGGDVAVSTPGDEERIEIPFNISNVIRRRAVKEENGKIIYR
FT                   VILEVEGDITEYTFEKHGEMMKGDLLNVIERKTSDEIKKMTQKAINRFQKELKVDMLGI
FT                   GDYIEKYHPSLWEKVGKDWDKIFPEVEIKVDVTSHVRRIGLFR"
FT   gene            199735..200370
FT                   /locus_tag="Thebr_0189"
FT   CDS_pept        199735..200370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0189"
FT                   /product="stage II sporulation protein R"
FT                   /note="KEGG: tpd:Teth39_0183 hypothetical protein; TIGRFAM:
FT                   stage II sporulation protein R; PFAM: Sporulation stage II
FT                   protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78817"
FT                   /db_xref="InterPro:IPR014202"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTT5"
FT                   /inference="protein motif:TFAM:TIGR02837"
FT                   /protein_id="ADV78817.1"
FT                   /translation="MKRLIALLVLAIIIAVNFYGAKSSNLQKEDLSRKLIRFHVIANSD
FT                   SEEDQELKLKVRDAILVDLTPKFEKVKDLKDSERIIKQSIEEIKKVAEEVIRKEGKNYD
FT                   VKVAYGTFDFPTRYYGTITLPAGNYNAIKVVIGNGEGKNWWCVIFPPLCFIDVTHGFTD
FT                   TQTAEEVAKYLSQDEIELIEEEKPKVKFKILEIIEEYYNKFKMAWMAP"
FT   sig_peptide     199735..199800
FT                   /locus_tag="Thebr_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.792) with cleavage site probability 0.671 at
FT                   residue 22"
FT   gene            200464..201174
FT                   /locus_tag="Thebr_0190"
FT   CDS_pept        200464..201174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0190"
FT                   /product="spore cortex-lytic enzyme"
FT                   /note="KEGG: tpd:Teth39_0184 cell wall hydrolase, SleB;
FT                   TIGRFAM: spore cortex-lytic enzyme; PFAM: cell wall
FT                   hydrolase SleB; Peptidoglycan-binding domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78818"
FT                   /db_xref="GOA:E8UTT6"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR014224"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTT6"
FT                   /inference="protein motif:TFAM:TIGR02869"
FT                   /protein_id="ADV78818.1"
FT                   /translation="MRKDFILRIKIIITVLVIFITAVFEYAAYDLTKTAMSNLYWGNTG
FT                   SDVAKVQARLKDWGYYTGAVDGFFGVRTWLAVRKFQAYNGLRVTGIVDDDTKVALGFTT
FT                   TAQDLAAYYASSSVTTNDDVYLLAMLINGEARGEPYIGKVAVGAVVMNRVRDPRFPKTI
FT                   AGVIFQPGAFSAVDDGQMWLPPTNDSIRAARDAIAGWDPTGGALYYYNAARVTSYWIFN
FT                   RPIITQIGSHIFAR"
FT   gene            201184..202518
FT                   /locus_tag="Thebr_0191"
FT   CDS_pept        201184..202518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0191"
FT                   /product="germination protein YpeB"
FT                   /note="KEGG: tpd:Teth39_0185 peptidase; TIGRFAM:
FT                   germination protein YpeB; PFAM: Propeptide PepSY amd
FT                   peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78819"
FT                   /db_xref="GOA:E8UU09"
FT                   /db_xref="InterPro:IPR014239"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU09"
FT                   /inference="protein motif:TFAM:TIGR02889"
FT                   /protein_id="ADV78819.1"
FT                   /translation="MLKRGLTAFALILILILGAWGYRQYIEKISYHRYLQAQYDRSFYQ
FT                   LVSNVENIETSMGKLMVASSDKTTIPILDEIWREAFSGQEHLNQLPIGQPEIDNTSKFL
FT                   TQIGDYAYSLTKKVASGQKLSQQDLETLTKLQNYAVFLGKNLQDLRKKIQGGYELGNLR
FT                   QKGTQKMGEIDRKILNVKMSNVNQTMTNYPTLIYDGPFSESLAKTTPKGLVGKEVSYDR
FT                   ALQIAKDFYGKPVESQNKYSPNNGKIKAYGVELKSPGKLPVYINVSQKGGYVVWMMDQR
FT                   SVNKINISQSQALQYAKKFLEKHGFKNVESTYSMKADGSVQFNFVPVQDEVYLYPDIVK
FT                   VKVALDNGDIIGFDATAYYMNHTERKLEKPKLTEKEAEQKVNKNLKIEGRKLTLIPLES
FT                   GKEVLAYEFKGTYKGDTFYVYINALNGNEEKILKVIKTEHGDLTM"
FT   gene            202584..202781
FT                   /locus_tag="Thebr_0192"
FT   CDS_pept        202584..202781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78820"
FT                   /db_xref="GOA:E8UU10"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU10"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0186"
FT                   /protein_id="ADV78820.1"
FT                   /translation="MGRRRGLMSDQLKYELAKELGVYDTVMKEGWGSVSSRNCGNLVKL
FT                   AIEKAEKMLVGNYNNGNTTF"
FT   gene            202914..203993
FT                   /locus_tag="Thebr_0193"
FT   CDS_pept        202914..203993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0193"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /note="KEGG: tpd:Teth39_0187 D-alanyl-alanine synthetase A;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78821"
FT                   /db_xref="GOA:E8UU11"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU11"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ADV78821.1"
FT                   /translation="MEKKKIAVLFGGQSGEHEVSLMSAKSIINNLDKDKYEIYMVGITK
FT                   KGEWYLYRGDVGKIETGEWEKEGIPAIMGASTKYRGIITFEDGENGFYPIDVVFPVLHG
FT                   PNGEDGTIQGLLELLDMPYVGANVLSSALCMDKVFTKRIFKEAGLPTPDFVVVYGKEIE
FT                   DLEAIKKKIEHLGYPCFVKPANLGSSVGITKVHNEEELPGALKLAAKYDRKLLIERGID
FT                   AREIECSVLGNENPEASIAGEIVPSNEFYDYNAKYFDGGKSLLLIPAPLPDEKMEEVRK
FT                   LAIKAYKALDLRGMARVDFLMDRNTGTLYLNEVNTIPGFTKISMYPKLWESSGKSYSTL
FT                   LDELINLAVESHNEKCREW"
FT   gene            204021..204443
FT                   /locus_tag="Thebr_0194"
FT   CDS_pept        204021..204443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0194"
FT                   /product="Domain of unknown function DUF1934"
FT                   /note="PFAM: Domain of unknown function DUF1934; KEGG:
FT                   tpd:Teth39_0188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78822"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU12"
FT                   /inference="protein motif:PFAM:PF09148"
FT                   /protein_id="ADV78822.1"
FT                   /translation="MKKAIISVKGTQKNDQNESDTIELITEGNFYIKGNTFYVVYEESE
FT                   LSGMDGTTTTLKITEDKVTLLRFGTNKSKMVFEKNKRYESDYDTPYGKILLGILPTDVK
FT                   VAMSEAGGEITIKYALDLNNKTVSNNELYLKVWEVN"
FT   gene            204445..206133
FT                   /locus_tag="Thebr_0195"
FT   CDS_pept        204445..206133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0195"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase; KEGG:
FT                   tpd:Teth39_0189 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78823"
FT                   /db_xref="GOA:E8UU13"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU13"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ADV78823.1"
FT                   /translation="MENIIQKVKDEIKDMVTTAIKNSVKEGLMNIEVIPEIEIEEPKEK
FT                   QHGDLAINTAMVIAKQAKMPPKKIAEIIVSKMDPSNTFIEKIEIAGPGFINFFLKDKFL
FT                   EETLKLVYERGKDYGRVNIGNGKKVQVEFVSANPTGPMHMGNARGGALGDALAAVLDYA
FT                   GYDVTREFYINDAGNQIEKFGYSLEARYLQLLGIPAEVPEGGYQGEDIIDRAREFLEIY
FT                   GDKYKDVPSEVRRKALIDYGLKKNLEKIKEDLALYGIEYDVWFSEQSLYDSGEVYKVIE
FT                   ELKQKGYTYEKDGALWFKMTLFGAEKDDVLVRTNGFPTYLASDIAYHKNKFITRGFDWV
FT                   INVWGADHHGHVAPMKGAMQALGIDPDRLDVVLMQLVKLIEGGQVVKMSKRTGRMVTLR
FT                   DLIDEVGKDAARFFFNMRSADSSIDFDLDLAKEQSNENPVFYVQYAHARICSIIRQLEE
FT                   EGVKIDNIDEVDLSLLKEEEEKELIKKLAYFPEEITIAAKTLAPHRITRYILDVASLFH
FT                   SFYNSHRVKGVEEDLMKARFVLILAVKTVIKNALDILKITAPERM"
FT   gene            206180..207919
FT                   /locus_tag="Thebr_0196"
FT   CDS_pept        206180..207919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0196"
FT                   /product="DNA mismatch repair protein MutS domain protein"
FT                   /note="KEGG: tpd:Teth39_0190 DNA mismatch repair protein
FT                   MutS domain-containing protein; PFAM: DNA mismatch repair
FT                   protein MutS domain protein; SMART: DNA mismatch repair
FT                   protein MutS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78824"
FT                   /db_xref="GOA:E8UU14"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU14"
FT                   /inference="protein motif:PFAM:PF00488"
FT                   /protein_id="ADV78824.1"
FT                   /translation="MFNNEMVLEILYVILIGGGLILGFEVNTLFFLLLFVAIILIFIIN
FT                   NYKKTAKIKEIKEKIEEQWGKEHVEKRNFEFIKKLYDILLLDSRNSSNIDDITWRDLDM
FT                   DFVFGKLDHTMSNPGQQYLYNLLRNPVYDKKELEGRSKIINNFMKNNDFAKRIQLYLHF
FT                   LGKDPKEDVTEFLWNGIKITSNPVLLYKLLVFLLIISPLIIIFVNPGAGIFMLMLLLIS
FT                   NSMIYSSTKYKIYSEMMTFKYVLKLISCAKNIIKESDGNPEFDIERLKDLYNNTKIIRR
FT                   NLNYLDYLSNSTGVADNLGITGFFSIIFLMEPIGFYEAANLINKHLKDLQELYIEIGKI
FT                   DTYIALASYRASLKYCTEPQLTKSDVRFIKAEDIYHPLLKDPVPNSIEVRDRGILITGS
FT                   NASGKSTFLKTIGINAIFAHTFYTVLAKSYSSNYFKILTSIGTLDNIIGGDSYFMVEAK
FT                   SLKRIIDVIDDNVTVLCILDEIFRGTNTIERISAANEVLKYMIRRNCLVVAATHDIELT
FT                   RLAADYYDNYHFEEEVNDKDIKFNYILKEGPSKSRNAIKILKLLGYPEEIYKNALDNTQ
FT                   KIL"
FT   gene            207952..208596
FT                   /locus_tag="Thebr_0197"
FT   CDS_pept        207952..208596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0197"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: tpd:Teth39_0191 Zn-dependent hydrolase of the
FT                   beta-lactamase fold-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78825"
FT                   /db_xref="GOA:E8UU15"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU15"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0191"
FT                   /protein_id="ADV78825.1"
FT                   /translation="MNIKWLGHACFKLTSEKGTVIVTDPFDESVGYPMPNVKADIVTSS
FT                   HSHFDHNYFKAVKGNFDIVDTVGEHNIKGINIKGVNTFHDDEHGAKRGKNIVFVFDIDG
FT                   IRVCHMGDLGHVLTEKQVEEIGPVDVLLIPVGGYYTIDAKQAVEVMNQLKPKITIPMHY
FT                   KTEFINFPIDTVDNFLDMTGGKKILSTEMDVKKEDLEGEPRVVALNYQYSV"
FT   gene            209287..210741
FT                   /locus_tag="Thebr_0198"
FT   CDS_pept        209287..210741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78826"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU16"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0192"
FT                   /protein_id="ADV78826.1"
FT                   /translation="MRKLFLFLTVMFFLTSCDVVKLKESSTTRKEPPIRLVFSLPNSSE
FT                   DFDNTLYTVLLYDGNSNKIASEFLKNKRIGYYKLLPRQDKNVVGIHYDAASFEYYVINI
FT                   DGSAPERLTLPVRDGIYPVWSDDGEYIYGISPDSLNAKSGYIFSYDVNKGTFEKYPLES
FT                   EINSCGKIKPYFDNKGVLFICDNKINYLNFENKVVKPVYSFNGSVTYGSLDKSRTIFVL
FT                   NDEKNCLDVLDGNNFKIIKTYKNILKYKFYSLDSMAFPDGEHVIFKIYKYDDKGNFIGA
FT                   PIVSVDLNGNVRELKESDNLEWNSVKFISERKLAGVSRAEKVLFYDLNSFQDMPYMEMV
FT                   LCRNNEIGYLKKLKIALPNGWKEKFTGGNEVYILNSKDEINGGIYVISYYKDQYFGGFL
FT                   PNHSELLKEEDIKTPIGEGKIAVLRRSPPAASNDPATYIEIFGIIPIADNDLAYCIWLG
FT                   PLKDDVKTINEAVRIMEYMMKNLNTM"
FT   gene            210896..211831
FT                   /locus_tag="Thebr_0199"
FT   CDS_pept        210896..211831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0199"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_0193 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78827"
FT                   /db_xref="GOA:E8UU17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU17"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADV78827.1"
FT                   /translation="MKIVKMKEVIKRFGDVIALDNVNLEIEEGEIYGLLGPNGAGKTTA
FT                   ISIICGLISFDRGEVYVFDKDIRKDAEFIKKNIGIVPQDVAIYGDLTAYENVKFFASLY
FT                   GLRGKELKESVEMALEFVGLSDKAKEVPNKFSGGMKRRLNIACAIAHRPKLIIMDEPTV
FT                   GIDPQSRNHILESVKKLNEMGSTIIYTSHYMEEVEAICTRISIMDHGKVIAEGTKEELT
FT                   SMVTDVNTVYIEIGSIDGIKEEELKGIKGVKAVEIRDSTIKITSLKDVSNFDDIIHYFI
FT                   SKNIPIRNLRNEIPDLETVFLTLTGRKLRD"
FT   gene            211842..212957
FT                   /locus_tag="Thebr_0200"
FT   CDS_pept        211842..212957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0200"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tpd:Teth39_0194
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78828"
FT                   /db_xref="GOA:E8UU18"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU18"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADV78828.1"
FT                   /translation="MRIFTIMLKEIKEILYDKQVMALMILLPIVLIGILGFAFSSTSDI
FT                   KLRDIKVIYTDEGDTILSQGFDIFIKETDKMGVKFVEIKDVNKGISDIEKRKYDGYVFL
FT                   KGKDITFYKNAHGDIKTEIAASMIDSFADTFKGMTAIASQNPAFLKNSGDINLNREFIK
FT                   ITSIDRKVKQTSFDYYSVTMLTLIILYGAMSGVFSIDMERTKKTGRRILASPIKKYEIF
FT                   MGKVLGVTFSVFIQALIIVLFSKYIFGANWGKDIVTVFVIIISEIIFVVGLGVSLGFII
FT                   KNGAMAQGLLNGIIPFIAFLGGSYIPVKEMGSQFIEKLSNFSPITWTNTAIFNVILGGN
FT                   YQYVPTALMVNLIPAAFFIVLSAYLFRREAF"
FT   gene            212958..214097
FT                   /locus_tag="Thebr_0201"
FT   CDS_pept        212958..214097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0201"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tpd:Teth39_0195
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78829"
FT                   /db_xref="GOA:E8UU19"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU19"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADV78829.1"
FT                   /translation="MRELFLVMKNTVKLFFRRKGNIILLISGIIIPLFFLLFTYGGSGQ
FT                   LRIGVVNRDKSQISTDLINSLEKTDKFKVVFLKENEINDKVSKGEVDSAIVIPQRFEEE
FT                   ILKGNPKDVEIVSIKGEETTLFLKSYLDRKINVLYNLSKASEGNKENFYKMYDLYKNSP
FT                   FSLKTYIVEDIGKTAVATTRSLGFFIMFLMFSTFNISNFILVEKRDKTFYRIFASPLKP
FT                   RTYLVSNFFVNLILTVFQIAFILALITFILNLGFTKATFDVFLVLVSFGITSIGLSSMI
FT                   VAFSPSTSYSNTLSTLIITPTCMLGGAFWPLYLMPEALQKLSDFIPQKWAIDAIEKIQM
FT                   GGSLSDVYMNIIILLAFALTFILLGIYKIKTSEKMGDFI"
FT   gene            214168..214971
FT                   /locus_tag="Thebr_0202"
FT   CDS_pept        214168..214971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78830"
FT                   /db_xref="GOA:E8UU20"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU20"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0196"
FT                   /protein_id="ADV78830.1"
FT                   /translation="MPRKSRVKSKSGYYHVMLRGNEKKNIFRSDEDKKRFIEILAEKKL
FT                   GGKFYLTAFCLMSNHVHLMIKEGNEDLSSSIKRIAGIYASYFNKKYDRTGHLFQDRFRS
FT                   EPVEDESYVIALVRYIHQNPVKAGLVKKVSDYKWSSYSCYLSDNDEMCQIVDTDLILGI
FT                   FSDDKKKAIEQFKKYMEQTEGTEVFIDIEEEKMSTEEAKELFKEMAMEFGIKDIENLEI
FT                   KKRKEWHDLIKKYREKTGLSIKDIASIAGVTRYSIHKILKEKGKA"
FT   gene            215442..216713
FT                   /locus_tag="Thebr_0203"
FT   CDS_pept        215442..216713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0203"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tpd:Teth39_0197 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78831"
FT                   /db_xref="GOA:E8UU21"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU21"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADV78831.1"
FT                   /translation="MSFIAQVKFLPKEVKRFIATEALLGIGMGIFGLVLNLHLLALNVS
FT                   PEQIGALNSVGTLVMGAAAIPAGFFANYIGRKRIFISGITLTGIGYGLFGLGESIGVFY
FT                   LAQIIQFIGISFLITTEIQLLFSYAETNELETVSYSLLFAVFTLFSGVGTLLGGFIPNW
FT                   FPYGNTKYQSSVYISAVLILVAALLRGILLPCVNNSFDKGKSKLLLSNIRIYQVFDKKI
FT                   LLIIFYLFLAGMAFSTIIPFQNVIVKFRMGWSDEYVSYLLTINGLILFFASMIMPWIIN
FT                   KFGTIKAYYYVYGMNLLFALILAFNNISVMMFSTIFLLRSGSFTLLNNMIESQTMSVVE
FT                   EEKRDFFAGVKSLLRSIGSAIASYLAGYILENQNYTYPFLITFVILLVSLLYFAIFIKP
FT                   IFIEKLNNSNFSFEEEIQKDVEGI"
FT   gene            complement(216714..217679)
FT                   /locus_tag="Thebr_0204"
FT   CDS_pept        complement(216714..217679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0204"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: tpd:Teth39_0198 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78832"
FT                   /db_xref="GOA:E8UU22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU22"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADV78832.1"
FT                   /translation="MSEPLIEVKNLKKYFPIRGGILQRTIGYVKAVDGVTFTINKGETL
FT                   SLVGESGCGKSTVGRTIIRLYDKTDGEVFYKSIPIHSLKKSELRKLRPKMQLVFQDPFS
FT                   SLNPRLRVGDAIGEALLDHGLISKNELRDKVIETMEICGLAPYHIDRYPHEFSGGQRQR
FT                   IGIARALILDPEFIVLDEPVSSLDVSIQAQIINLLMDLQEQKGLTYLFISHDLSVVEHI
FT                   STRVAVMYLGSIVEMAARDELFAHPLHPYTQALLSAVPIPDPDLKRERIILEGDIPSPA
FT                   NPPKGCKFHTRCPLAKDICREQVPEYKDVGGGHFVACHLV"
FT   gene            complement(217676..218659)
FT                   /locus_tag="Thebr_0205"
FT   CDS_pept        complement(217676..218659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0205"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: tpd:Teth39_0199 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78833"
FT                   /db_xref="GOA:E8UU23"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU23"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADV78833.1"
FT                   /translation="MAKNLVEFRNLKTFFYTEEGVVKAVNDVSFSIREGETVCIVGESG
FT                   CGKSVTALSLMRLIQSPPGKIEGGEIIFDGRDILKLSEAEMRRIRGNEIGMIFQEPMTS
FT                   LNPVLTIGEQIMEPLIVHKLMTKKEAWNKAIELIKQVGIPRAEQIMTSYPHELSGGMRQ
FT                   RIMIAIALSCDPKLLIADEPTTALDVTIQAQILDLLRKIKQERNMALMLITHDLGIVAE
FT                   IADYVVVMYAGKVIEEAPVRELFKNPKHPYTRGLLKAKPIIGQRQERLYTIPGQVPNPI
FT                   GLGDYCYFSDRCEYAMDICRQKIPQLAADENGHKVACWLYEGEWKK"
FT   gene            complement(218671..219599)
FT                   /pseudo
FT                   /locus_tag="Thebr_0206"
FT   gene            complement(219613..220578)
FT                   /locus_tag="Thebr_0207"
FT   CDS_pept        complement(219613..220578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0207"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_0201
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78834"
FT                   /db_xref="GOA:E8UU24"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU24"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADV78834.1"
FT                   /translation="MTQFIIRRLLQSIPTLIGASIIIFLIFAMAPGDYVTSQLQNPKMT
FT                   EERAAQLRALYGLDKPLPERYISWASGVLKGDLGDSLMFKKPVIQVINDFIWNSFILGV
FT                   AIMFFEWLIASIIGIYSAIRQYSVFDTIATLLVFILYSLPSFFLGLVMLKVFAVDLKWF
FT                   PLGGMITTGSNYTGWAHIVDVAKHMVLPVATLTLISVGGLSRYFRANMLEVIKQDYIRT
FT                   ARAKGLKERTVIFKHALRNALLPLITLFTLELPSLFAGAMITERIFNWPGIGKVVLEGI
FT                   YIRDYPLFLGYTMLITVLTILANILADVLYGVADPRVRLK"
FT   gene            complement(220640..222382)
FT                   /locus_tag="Thebr_0208"
FT   CDS_pept        complement(220640..222382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0208"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: tpd:Teth39_0202 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78835"
FT                   /db_xref="GOA:E8UU25"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU25"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADV78835.1"
FT                   /translation="MLRKKWLPLVVTLIFILSVFLTSCGKTETQTPQQSQEQKTTPTAS
FT                   VQDSDNWTKAKDTSKIPEASKARTDTLIIGLHEPKGVFNPLYSETSYDNYVNSAIFDSL
FT                   LEVDFDGTYIPSLAKSWDIDKDNNTITFHLRDDVKFSDGTPLTAKDVEFSYYVLADPTY
FT                   DGPIALSAAGIKGFKEYNEGNADKIEGIKVIDDHTIQIQLEKVLGTSLSDLNIPVIPQH
FT                   YYGKDFAKGKLDGVKALEQQPLGSGPYVFEKFVPGQEVRLVANENYWKGAPKIKHLIYK
FT                   TTTEETAVQMLQTGETDYETSNITAKKDNVELLESLGFVDYSLLPTNGYGYIAFNHKLP
FT                   KFQDVRVRKALAYGLNRKAIVDAVYQGLAEVRDVPQSKVSWAYPDEKDIIHYDYNPEKA
FT                   KQLLDEAGWKLGPDGYRYKDGQKFTIHFLASSPNPVNDALVPMAVENYKELGIEFVAEP
FT                   LEFNAIIDKVNKGDFEMYFMAWGLTPEPDPYTIFFSKGSQNKIGYANPKVDELILKGRE
FT                   ETDINKRKEIYHELYKVLNDDLPYIFLYQRNDLNAKNSRVVGFQISSFRDFTYSLYQAE
FT                   ILQY"
FT   gene            222901..223575
FT                   /locus_tag="Thebr_0209"
FT   CDS_pept        222901..223575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78836"
FT                   /db_xref="GOA:E8UU26"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU26"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0203"
FT                   /protein_id="ADV78836.1"
FT                   /translation="MSDNFVPEITSPLRQKMVLVPEVIHQKASGIKVYGKLIKSLVFTT
FT                   DIALIRNTNAHAVLAVYPFTPQPVITHALMMAADIPVFCGVGGGLTQGKRVVNLALDAE
FT                   FSGAMGVVVNAPTANDIIKKIRATIDIPIVVTIVSEKEDIKGRVEAGATILNISGAQKT
FT                   PDLVKRVKDICPDIPIIATGGPTEETILKTIEAGANAISYTPPTNAEIFSEIMDKYRKE
FT                   RE"
FT   gene            223626..224759
FT                   /locus_tag="Thebr_0210"
FT   CDS_pept        223626..224759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0210"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: tpd:Teth39_0204
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78837"
FT                   /db_xref="GOA:E8UU27"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU27"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADV78837.1"
FT                   /translation="MQYRQFGKLNIAISALGFGLMRLPAIDNDNSKIDEAEAIRMIRYA
FT                   IDNGVNYIDTAWPYHGGNSEIVAGKALKDGYREKTFLATKLPTWLINEKEDMDKYLNEQ
FT                   LKKLQTDHIDFYLLHALDKNKWENMKKVDALSWAEKKKQEGKIRYIGFSFHDEYPVFQE
FT                   IVDYYDKWDFCQIQYNYMDIDVQAGEKGLKYAASKGLGVVIMEPIRGGRLANPPKAVQD
FT                   IWDTAKVKRTPAEWALQWLWNQPEVSVVLSGMSTFEQLKENIESAKRSGINTLTKEELE
FT                   IVSKVRNKYKELSPIACTGCNYCMPCPNGVNIPRNFELYNEAHMYNTYEANRRDYENLG
FT                   DAKASSCIECGTCESVCPQHLTIIDYLKEVADYFERA"
FT   gene            225036..226319
FT                   /locus_tag="Thebr_0211"
FT   CDS_pept        225036..226319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0211"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: tpd:Teth39_0205 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78838"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR027017"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039439"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU28"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADV78838.1"
FT                   /translation="MFEVFEDMLSPEYWIRKIDNTDKVIMTQQEIENFNRKIINKVVTV
FT                   YDLETYKKSLKKDELIKLIKSYEMPKKPMYDKYGNLIEEDFYDDVIKNTNLEGIKDVNP
FT                   VRYGIAIRNTSIRSFPTKEAVFDKQGDIEFDRFQETGCQALEPVVILHESKDRKWLFIQ
FT                   MYNYRGWIKAEDIAIAKDKKELFDYINSLSFLVVTGNYIKTQSNPFDKNVSKLEFTMGT
FT                   KIYLEEGNVLHQVGNQSVIGHYLIKLPIRNEERNLEFRYALISKKEDVNVGYLPYTREN
FT                   ILKQAFKLIGDRYGWGDSLGGRDCSSYIMYIFKTFGIRLPRNADEQEVSEGKSYKFTEE
FT                   MPIEERIKVFDSVKPGALVYMPGHAMIYIGKEKGVPYMIHDFHGYGEKKEDKYEFVPVN
FT                   EVMVTSSLLLTASGVSFIEKFTSVLEIE"
FT   gene            complement(226344..228962)
FT                   /locus_tag="Thebr_0212"
FT   CDS_pept        complement(226344..228962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0212"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase;
FT                   Aldehyde Dehydrogenase; KEGG: tpd:Teth39_0206 bifunctional
FT                   acetaldehyde-CoA/alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78839"
FT                   /db_xref="GOA:E8UU29"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU29"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADV78839.1"
FT                   /translation="MPTLLQEKKETKEKTEVKETTDVKKQIDLLVERAKRAQEKFMSYT
FT                   QEQINEIVKAMALAGIEKHVELAKLAHEETKMGVYEDKITKNLFAVEYVYNYIKDKKTV
FT                   GILKENLEENYMEVAEPVGVIAGVTPVTNPTSTTMFKCLIAIKTRNPIIFSFHPKALKC
FT                   SIEAAKTMYEAALKAGAPEGCIGWIETPSIEATQLLMTHPDISLILATGGAGMVKAAYS
FT                   SGKPALGVGPGNVPCYIEKTANIKRAVSDLILSKTFDNGTVCASEQAVIIDEEIADEVK
FT                   KLMKEYGCYFLNKEETKMLEEFAIDKNTGLMNPAVVGQPATKIAEMAGFKVPENTKILV
FT                   AEYPAVGPEYPLSREKLSPILALYTVKDYNEGIKRCEDMTEFGGLGHSAVIHSENQQII
FT                   NEFAKRVRAGRILVNAPASQGAIGDIYNTAIPSLTLGCGTMGRNSTTDNVSVYNLINIK
FT                   RVFIRKERMKWFRVPPQIYFERGSLQYLSQVKGKKAFIVTDPVMVKLGFVDKVTYQLDK
FT                   ANIKYEIFSEVEPDPSVDTVEKGVKIMRGFEPDLLIAVGGGSAIDAAKGMWLFYEYPDT
FT                   KFEDLRLKFMDIRKRTYRFPELGKKALFIAIPTTSGTGSEVTAFAVITDKKKNIKYPLT
FT                   DYELTPDIAIIDPDLTMTIPPSVTADTGMDALTHAIEAYVSVMASDYTDALAEKAIKLI
FT                   FEYLPKAYKNGQDKVAREKMHNASCIAGMAFTNAFLGINHSMAHILGAKFHLPHGRANA
FT                   ILLPYVIEYNAELPKKFAAFPQYEYPKAAEKYAEIAKMLGLPASTVEEGVQSLIEAIKN
FT                   LMKELNLPLTLKEAGINKEEFEKQIMEMSDIAFNDQCTGSNPRMPLVSEIAEIYRKAYG
FT                   E"
FT   gene            229269..229739
FT                   /locus_tag="Thebr_0213"
FT   CDS_pept        229269..229739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0213"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: tpd:Teth39_0207
FT                   methylated-DNA--protein-cysteine methyltransferase;
FT                   TIGRFAM: methylated-DNA/protein-cysteine methyltransferase;
FT                   PFAM: Methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78840"
FT                   /db_xref="GOA:E8UU30"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU30"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADV78840.1"
FT                   /translation="MLYKKFISPVGVLTIFSSGKGICRIDFENEKSSLEGFKEGSDFYI
FT                   EECIRQLDLYFQKKLKNFDVRLDLQGTEFQKAVWKEILKIPYGEVKTYGEIARLIGKPK
FT                   AARAVGQALNKNPIPIIIPCHRVIGSSEDLTGFGGGIEIKKFLLRHEGVEVH"
FT   gene            229768..229926
FT                   /locus_tag="Thebr_0214"
FT   CDS_pept        229768..229926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78841"
FT                   /db_xref="GOA:E8UU31"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU31"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0208"
FT                   /protein_id="ADV78841.1"
FT                   /translation="MRMDYLKILKEFFKNKDNIVMAFLFGSVAVFNIYRLRQERREINL
FT                   YKIVAVS"
FT   gene            230082..230525
FT                   /locus_tag="Thebr_0215"
FT   CDS_pept        230082..230525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0215"
FT                   /product="regulatory protein MarR"
FT                   /note="KEGG: tpd:Teth39_0209 transcriptional regulator,
FT                   TrmB; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78842"
FT                   /db_xref="GOA:E8UU32"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU32"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADV78842.1"
FT                   /translation="MEEINNGLKILKLLKQIMDIIKHSMKYECKDFDITGPQGMLMGIL
FT                   AHYGEMKVSDLSQKLGLSNSTVSGIIDRLEKQGLVERTRSTEDRRVVYVSVTPKFKDTF
FT                   QKHFKEAEEKFEKLISRASPQDLNKIIEGLEALKKILEKQHDL"
FT   gene            230636..232861
FT                   /locus_tag="Thebr_0216"
FT   CDS_pept        230636..232861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0216"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_0210 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78843"
FT                   /db_xref="GOA:E8UU33"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU33"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADV78843.1"
FT                   /translation="MVKLAKYLKPYILLIFLAVFFIFVQAMSDLSLPDYMSKIVNNGIQ
FT                   QGGIVNAVPEAIRKSEMDKLLLFVTPEEKEEILKDYTLVDKSSPDYDKYVKKYPILSKE
FT                   PVYVLKSVDKSEIDKINLPMGKAFLAVTGVEKAKASAKNGSIEFNGKKIPANVDLFAMM
FT                   SQLPEEQLIQIRDEMNKKFASLGDNMVIQAATMAVKEEYKAIGINTDKIQTDYILHTGL
FT                   IMLLITGLSALSTIMVAFFASKVAAGVARDLRRDLFARVESFSNAEFDKFSTASLITRT
FT                   TNDITQIQMLLVIMIRMVFYAPIMGIGGVFRALSKSVSMSWIIALAVIVLLGIISALYS
FT                   IAMPKFMLMQKLIDRLNLVTRENLSGIMVVRAFNNQKFEEERFDKANQDITKVGLFVNR
FT                   AMAFIFPSMMLVMNGITLLIVWVGAHQIQNSSMQVGDMMAFMQYAIQIIFAFLMFSMLF
FT                   IMIPRASVSAERIAEVLATEPSIKDPENPKQFNENMAGTVEFRNVSFKYPGAEEYALKD
FT                   INFKVLPGQTVGIIGRTGSGKSTLVNLILRFYDVTEGQVLVDGVDVREVRQEDLRSRIG
FT                   YVPQKSWLFSGTIKSNLKYGNDQATDEEVKEAAEIAQAMEFINEKTKKFDSEIAQGGTN
FT                   VSGGQKQRLSIARALVKKPEIYIFDESFSALDFKTESALRKALRERLKSSTVIMVSQRV
FT                   STLLHADQIIVLEEGKIVGIGKHKELLKNCQTYREIALSQLSEEELA"
FT   gene            232858..234741
FT                   /locus_tag="Thebr_0217"
FT   CDS_pept        232858..234741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0217"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_0211 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78844"
FT                   /db_xref="GOA:E8UU34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU34"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADV78844.1"
FT                   /translation="MSENRRIDPKQMPRLRGPGMGGGPHGMVRGGEKARDFKGTMKKLI
FT                   KYLSVYKASIISVFVLAALSASFSIAGPKILSKAITKIFEGVMDKITGKGSGIDFEYVE
FT                   KIILILIGLYGLSALFGYLQGWIMSGVSMKVTYRFRKEISQKINRLPLKYFESTNQGEI
FT                   LSRITNDVDTITQTLNQSLTQIITSVTTVVGVLIMMFTINWLMTLVALLIIPLSSLVIA
FT                   FIVKHSQRYFREQQDYLGHVNGHVEEMYGGHNIVKAFNGEKKSIEKFNVLNNSLYGAAW
FT                   KSQFLTGIMMPLMNVTGNLGYVAVTVLGSWLVIKNAIEVGDIQAFIQYIRSFTQPIAQI
FT                   ANISNILQQTAACAERVFEFLEEEEEVPDNSQPVKIEDIKGNVEFRNVRFGYRSDKMVI
FT                   NNFSASIKAGQKVAIVGPTGAGKTTIVKLLMRFYDVNEGAILIDGHDIRDFTREDLRSL
FT                   FGMVLQDTWLYNGTIMDNIRYGRLDATEEEVIKAAKAAYVDHFVRTLPGGYNMVLNEET
FT                   TNISQGQKQLLTIARAILKDPKILILDEATSSVDTLTEIQIQKAMDYLMKGRTSFIIVH
FT                   RLSTIRDADLILVMNHGDIVEQGTHEELLKKGGFYASLYNSQFEKEEEMAS"
FT   misc_binding    234813..234915
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 78.89"
FT   gene            234978..235616
FT                   /locus_tag="Thebr_0218"
FT   CDS_pept        234978..235616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0218"
FT                   /product="proton-coupled thiamine transporter YuaJ"
FT                   /note="KEGG: tpd:Teth39_0212 putative proton-coupled
FT                   thiamine transporter YuaJ; TIGRFAM: proton-coupled thiamine
FT                   transporter YuaJ; PFAM: thiamine transporter YuaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78845"
FT                   /db_xref="GOA:E8UU35"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU35"
FT                   /inference="protein motif:TFAM:TIGR02357"
FT                   /protein_id="ADV78845.1"
FT                   /translation="MSYLLSIFSDFAQIKPVTLSVILAILLAAFLLYLMRKSVKFDTKM
FT                   LVYGALSIAISFVLSYIRFYHWPQGGSITPASMLPLFIFAYYYGPGPGVIVGMAYGFLQ
FT                   LIQDPFIVQWVQVLLDYPLAFGALGLAGFFRKNLSLGILVGGFGRFFSHFLSGVFFFAS
FT                   YAPEGMSPIVYSLLVNGSIIGVEVAICFAVSLIPQVRNAIEEIKKKAIA"
FT   gene            235863..236399
FT                   /locus_tag="Thebr_0219"
FT   CDS_pept        235863..236399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0219"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="KEGG: tpd:Teth39_0213 phosphoesterase,
FT                   PA-phosphatase related; PFAM: phosphoesterase
FT                   PA-phosphatase related; SMART: phosphoesterase
FT                   PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78846"
FT                   /db_xref="GOA:E8UU36"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU36"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADV78846.1"
FT                   /translation="MQIKRVLLDKDKNIFFYINERIKCNILDKIMPKITHIGGPFFTIF
FT                   SCLFLIFFGKNDVKASAVEALTALVSSHLFVQLLKRKYTRPRPYMVLANTNTFKHLLKD
FT                   YSFPSGHATASFSLAMTFSIFFPSLAVFFISLAVLVGLSRIYMGLHYPSDVLMGSTIGI
FT                   TFSYLTHFIGTKLFL"
FT   gene            237006..239693
FT                   /locus_tag="Thebr_0220"
FT   CDS_pept        237006..239693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0220"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.2"
FT                   /note="TIGRFAM: magnesium-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; KEGG: tpd:Teth39_0214 magnesium-translocating P-type
FT                   ATPase; PFAM: E1-E2 ATPase-associated domain protein;
FT                   cation transporting ATPase domain protein; Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78847"
FT                   /db_xref="GOA:E8UU37"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU37"
FT                   /inference="protein motif:TFAM:TIGR01524"
FT                   /protein_id="ADV78847.1"
FT                   /translation="MIKIAKKNGFTDSILTQLIEFARKDVDEILAQLGTDREGLTSEEA
FT                   QDRLEMYGLNEIAHEKPAPWYIQLIKAFVNPFIGILVFLAIVSYITDVLFTAPQDRDWS
FT                   TIIIISIMVTVSGLLRFVQEYRSNVEAEKLKALVYTTAAVIRKDTGEKEIKIEEIVPGD
FT                   IIHLAAGDMVPADVRVITSKDLFINQATLTGESEPVEKYPDLKEEKRKAKDLNLSDLEN
FT                   ICFMGTNVVSGSAIAVVLSTGDRTYFGSMAKSLVGHRVMTSFERGINNVSKVLIKFMTV
FT                   MFPIVFVINGLTKGNWLDALLFALAVAVGLTPEMLPMIVTTNLAKGAVTMAKRKTIVKR
FT                   LDAIQNFGAMDVLCTDKTGTLTLNKIVVEKHLDIHGNEDDRVLRHAYLNSFYQTGLRNL
FT                   MDVAILEYGAEKGFNGLEKIYKKVDEIPFDFVRRRMSVVLESEGGKRQLVTKGAVEEVL
FT                   SICEYAEYKGEVVPLTDEIRQEVREMVKRLNEDGMRVLAVAQKNDVPPEGVFSVADESK
FT                   MVLMGYIGFLDPPKESAPYAIKALKEHGVDVKILTGDNEIVTKKICKEVGINVENVLLG
FT                   NEIENMTDEELAEVAEKTTIFAKLSPMQKSKIIKTLQNKGHIVGYMGDGINDAPALREA
FT                   DVGISVDSAVDIAKESADIILLEKSLTVLEEGVVEGRRIFGNIMKYIAITSSSNFGNVF
FT                   SVLVASAFLPFLPMHPLQLLFLNLIYDLSMTSVPWDTVDKEYIQKPRKWDAANIGNFMV
FT                   WFGPTSSIFDITTYALMFFLIGPIVIGGSYFLLPEVLKQNFVSLFQTGWFVESLWTQTM
FT                   VVHMLRTEKIPFIQSIASWPLLLFTSAAVTVGTIVPFTSFGAKLGMMPLPGIYFLFLAA
FT                   TLLAYLTLAQSVKMRFIKRFGSLL"
FT   gene            239788..241518
FT                   /locus_tag="Thebr_0221"
FT   CDS_pept        239788..241518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0221"
FT                   /product="PHP domain protein"
FT                   /note="KEGG: tpd:Teth39_0215 phosphotransferase
FT                   domain-containing protein; PFAM: PHP domain protein; SMART:
FT                   DNA polymerase X; Helix-hairpin-helix DNA-binding class 1;
FT                   phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78848"
FT                   /db_xref="GOA:E8UU38"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU38"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADV78848.1"
FT                   /translation="MDKKEIANILNDIGLLLELKGENPFKSRAYYNAARTIELLEEDIE
FT                   TLVKEDRLKEIKGIGEAINKKITELVLTGKMEYYENLKASIPEGLVEMLKIPGLGPKKI
FT                   KIIYEKLNITTIRELEYACIENRLVDLPGFGVKTQKKIFEGIQFVKQFSGQHLFAEVYT
FT                   EALKLKEYLDMTKTALVTEIAGSLRRKKEIVKDIDILASASDSSKVMEAFVNYQDVREV
FT                   IAKGDTKTSVTLKSGINTDLRVVTEKEFPYALHHFTGSKEHNTAMRHRAKQMGIKMNEY
FT                   GLFKGDKLIECKSEEEIFNKLGLLYIPPELRENMGEIEAAEKGELPKLIEEKDIKGVFH
FT                   VHTTYSDGANTLVEMVEAARKLGYKYIGITDHSKSAFYAGGLKEEDLVRQWEEIEELNK
FT                   KYNDIVIFKGIESDILPDGSLDYGEEILKQFEFVIASIHSHFRMSKEDMTKRMIKAIEN
FT                   KYTTIIGHVTGRLLLARDSYEIDIYEVIEAAAHYGKIIEINANPYRLDLDWRYVKHAKE
FT                   KGVKLAICPDAHSIEGLNDVKYGVGIARKGWLEAKDVINTYEVHEICGSLFFQKMQNRR
FT                   "
FT   gene            complement(241681..243081)
FT                   /locus_tag="Thebr_0222"
FT   CDS_pept        complement(241681..243081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0222"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /note="KEGG: tpd:Teth39_0216 glutamate synthase (NADPH),
FT                   homotetrameric; TIGRFAM: glutamate synthase (NADPH),
FT                   homotetrameric; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78849"
FT                   /db_xref="GOA:E8UU39"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU39"
FT                   /inference="protein motif:TFAM:TIGR01316"
FT                   /protein_id="ADV78849.1"
FT                   /translation="MPLNRSKKKTPMPTQKPEVRRRNFNEVALGYSEEEAVSEAQRCLQ
FT                   CKKPGCVEGCPVQVQIPQFIKRIAERDFEGAIKIIKETNSLPAICGRVCPQETQCEKNC
FT                   VLGKVGEPVAIGRLERFAADWERAKGIRPPVIPKKLGKKVAIIGSGPAGLTCAGDLAKL
FT                   GYDVTIFEALHKPGGVLVYGIPEFRLPKIIVEQEVKFIQQLGVEIKTNMVMGKVLTIDD
FT                   LFEMGYEAVFIGTGAGLPKFMGIPGENYLGVYSANEFLTRINLMKAYSFPNTDTPIKVG
FT                   KKVAVIGGGNVAMDAARSALRMGADEVHIVYRRSEEEMPARKEEFENAKEEGIIFDFLT
FT                   NPVRIIGNENGWVKGIECIRMELGEPDASGRRRPVPITGSEFIMDVNTVVIAIGTGPNP
FT                   LLTKTTEGLELTKHGYIAVDEEGRTSREGVWAGGDIVTGSATVILAMGAGKKAARSIHE
FT                   YLQNKKWR"
FT   gene            complement(243068..243946)
FT                   /locus_tag="Thebr_0223"
FT   CDS_pept        complement(243068..243946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0223"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   Dihydroorotate dehydrogenase, electron transfer subunit,
FT                   iron-sulphur cluster binding domain; KEGG: tpd:Teth39_0217
FT                   ferredoxin-NADP(+) reductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78850"
FT                   /db_xref="GOA:E8UU40"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU40"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADV78850.1"
FT                   /translation="MFKILEKRELAPSIKLFVIEAPLVAKKARPGQFVMLRIKEGGERI
FT                   PLTIADYNSENGTVTIVFQEVGKTTRELGTLEAGDYIQDFVGPLGVPVEFPNHKKVLGI
FT                   GGGLGIAPLYPKLKMLHQQGVEVVSIIGARTAELLILEEEIKAVSDRMYICTDDGSKGR
FT                   HGFVTVVLKELLEQGEKFDEIIIIGPPILMKIGSEITKPYGIPTMVSLNPIMVDGTGMC
FT                   GGCRVTVDGEIKFACVDGPAFDGHKVDFDELIKRLATYKEEEKISLERFNEVHECKLIN
FT                   KIEGADKDAVK"
FT   gene            complement(244146..245207)
FT                   /locus_tag="Thebr_0224"
FT   CDS_pept        complement(244146..245207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0224"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   tpd:Teth39_0218 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78851"
FT                   /db_xref="GOA:E8UU41"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU41"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADV78851.1"
FT                   /translation="MMKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTV
FT                   FEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHS
FT                   GGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELA
FT                   DIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDG
FT                   PIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLE
FT                   WGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKD
FT                   KPKDLIKPVVILA"
FT   gene            complement(245719..246762)
FT                   /locus_tag="Thebr_0225"
FT   CDS_pept        complement(245719..246762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0225"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   tit:Thit_2281 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78852"
FT                   /db_xref="GOA:E8UR59"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8UR59"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADV78852.1"
FT                   /translation="MVHNNDTTKKRSFKHLSSYERGEIYALLKEGRSIRYIAKKLNRSP
FT                   STISREIKRGTTTQLRSDLSSYTSYFPETGQAIYEKNRSNCGAKFKVAKAEDFLKYAEN
FT                   KILNEKWSPDAVVGYCKKDPSWNNKTIVCTKTLYNYIDRGLLKVKNIDLPLKLRLKPRK
FT                   KQNRKNKRIMGKSIDFRPKEVESREVFGHWEIDTLIGKKSNDKVLLTLIERKTRHEIIF
FT                   LLDAKDNKSVKDALSKLKDMFGDNLSKVFKTITSDNGTEFSDLESALLEYGVEVYYTHP
FT                   YSSWERATNERHNGLIRRFIPKGKSIKDLSIDTIKRVENWLNNLPRKLLNYKTPKEYFY
FT                   EELAKIC"
FT   gene            246978..248189
FT                   /locus_tag="Thebr_0226"
FT   CDS_pept        246978..248189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0226"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   tex:Teth514_0654 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78853"
FT                   /db_xref="GOA:E8UU43"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU43"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADV78853.1"
FT                   /translation="MWETKINPTRIFELRCKNTTYFGVGSIKKIEDILEVLKHKGIDNV
FT                   IFVTGKNSYKVSGAWDVIEPALNTLGFKYSLYDKVGPNPTVDMVDEAAKFGRETGAKAV
FT                   IGIGGGSPIDTAKSVAVLLEYTDKNARELYELKFTPEKAAPIIAINLTHGTGTEVDRFA
FT                   VATIPEKNYKPAIAYECLYPMYAIDDPALMIKLDKKQTIAVTIDALNHVTEAATTLVTS
FT                   PYSILLAKEAVRLIVRYLPVAVNDPENLVARYYLLYASAIAGISFDNGLLHLTHALEHP
FT                   LSAVKPEIAHGLGLGAILPAVVKTIYPAVAEVLADIYSPIVPGLKGLPAEAEYVAKKVE
FT                   EWLFNVGCTQKLSDFGFTKDDVPTLVKLAKTTPSLDGLLSIAPVEATETVIAKIYEESL
FT                   NPIS"
FT   gene            248461..250188
FT                   /locus_tag="Thebr_0227"
FT   CDS_pept        248461..250188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0227"
FT                   /product="PAS sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: PAS fold domain
FT                   protein; hydrogenase large subunit domain protein; Fe-S
FT                   cluster domain protein; KEGG: tpd:Teth39_0221 hydrogenase
FT                   with PAS/PAC sensor; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78854"
FT                   /db_xref="GOA:E8UU44"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU44"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADV78854.1"
FT                   /translation="MDVISVSKANCKNCYRCVRHCPVKAIKVVGGQAEVVDSLCIYCGR
FT                   CVIECPQNAKKIRNDLHAVKEFINAGEKVVASIAPSYPAVFDVTSPQEMFSILKALGFY
FT                   GAEETAVGAEMVSMEYQHLIKKGQKGPIITTACPVVKNLVEKYYPGLIRNLAPVVSPMV
FT                   AHARSLKQRYGLDIKVVFIGPCIAKKAEALDRSVLGNVDAVLTFQELADWIDEKASAVA
FT                   GVDFGERENVLEPFIARSYPLPGGLLKTSSMEDDLLSREVVVVDGMEDCMELLDALERG
FT                   SVSGRLFEMMACRGGCINGPSMPCDSSLYERRERLLSFIENNQQQQGYEDIKASAAGID
FT                   LRRSFEPKAFKAPRPTESEIREILASIGKTTPEKELNCGACGYPSCRKKAEAVYRGMAE
FT                   PDMCIPYMRSRAESLANLIIDHTPNGIILVDSNLNIKEINRAAEKMFGVEKEQVQGKPL
FT                   STVIDDRDFAWVLANKTNLQDKKVNYPRNFLTTLQTICYIEEEDLVLAIIQDITEQEKQ
FT                   RMELERVREETLEKAQEVINRQMCVAQEIAGLLGETTAESKMLLLKLIELVKGREEEK"
FT   gene            250185..251363
FT                   /locus_tag="Thebr_0228"
FT   CDS_pept        250185..251363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0228"
FT                   /product="Stage II sporulation protein E"
FT                   /note="KEGG: tpd:Teth39_0222 protein serine/threonine
FT                   phosphatase; PFAM: Stage II sporulation protein E; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78855"
FT                   /db_xref="GOA:E8UU45"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU45"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADV78855.1"
FT                   /translation="MKVFAEVFTKSLTKKGEELCGDSVEVMQSEDGIIAVMADGLGSGV
FT                   KASILSTLTVRIASTMIKNRASIEEVVRTLINTLPVCRVRQLAYSTFSILEINDDGEGR
FT                   LFEFDNPPVIYIRDGRVLKLPYRELRVEERRILEYRFEAFPGDKIFLVSDGVIHAGVGG
FT                   VLNLGWQWPNVAEYLQRLDRSGCFVSEMVDQLIKTCSHLYSGNPGDDTTVVGVGLRKSE
FT                   LITVLVGPPEDRSKDTEVVKKLIDSEGKKVVCGGTTANIVSRETGRKVVTNMDYADPAI
FT                   PPVGSIEGIDLVTEGLITLSRCVEILRNFVNTYSFSPHFLDDIRKKKDGASMLADLLVN
FT                   RSTHIRFLVGRAVNPAHRNAYLPEGVSDKLKIVEELAQILKKCGKRVYIELY"
FT   gene            251748..252782
FT                   /locus_tag="Thebr_0229"
FT   CDS_pept        251748..252782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0229"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; KEGG: tpd:Teth39_0223
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78856"
FT                   /db_xref="GOA:E8UU46"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU46"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ADV78856.1"
FT                   /translation="MVKVGIFGATGYTGVELIRILSKHEKVEIKYLSSQSYNTKAISDV
FT                   YSSLIGFCDKVLEEVDFQKAMSECDVIFTALPSGHASKIAREAVKKGVKVIDLGADFRF
FT                   DDYSVYKEWYSGDYEDYGDIKRVYGIPEIYRDDIKEAQVVGNPGCYPTSVILGLMPLLK
FT                   NGIIEGNIIVDSKSGVSGAGHNPSYNNMYAECNENIKAYNVAKHRHIPEMEQELSKIFG
FT                   EKVSVVFTPHLAPMTRGILSTMYCKLKKDMDVNTVYNIYTDFYKNEYFVKVLKPGNYPA
FT                   TKNVYGSNFCHIGFEVDKHTNTLIVMSAIDNLVKGASGQAVQNMNIMFGIEENTALDIV
FT                   PIYP"
FT   gene            252829..254049
FT                   /locus_tag="Thebr_0230"
FT   CDS_pept        252829..254049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0230"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: arginine biosynthesis bifunctional protein
FT                   ArgJ; KEGG: tpd:Teth39_0224 bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein; PFAM:
FT                   arginine biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78857"
FT                   /db_xref="GOA:E8UU47"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU47"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ADV78857.1"
FT                   /translation="MEKLEILEGSIELPKGFLASGIFAGIKKRKKDVALIYSEKVANAS
FT                   AVFTTNKVKAAPVILDMERIKKGVAQAIVINSGNANACTGEKGFEDAVNMAKKVSQLLK
FT                   IDEENVLVCSTGVIGVPLPMEKVLKGIEAAAENLSTEGGYQAAEAIMTTDTFLKGVTAK
FT                   FVIEGKIVTMTGFAKGSGMIHPNMATMLSFVLTDANITKTALNKAFKETVDKTYNMISV
FT                   DGDMSTNDTAIILANGEAQNKTIEEGTHEFDIFYRALEHVNKILAKLIVKDGEGATKFM
FT                   EVNIVNAKTEKDARLAAKSIVNSNLVKTAIFGEDANWGRILAAVGYSGADFDASRVDIY
FT                   LKSMKGEIKVCENGGYIFFDEALAKEILKEKEITVTVDMKAGEYSGTAWGCDLSYDYVK
FT                   INGSYRT"
FT   gene            254046..254945
FT                   /locus_tag="Thebr_0231"
FT   CDS_pept        254046..254945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0231"
FT                   /product="acetylglutamate kinase"
FT                   /note="KEGG: tpd:Teth39_0225 acetylglutamate kinase;
FT                   TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78858"
FT                   /db_xref="GOA:E8UU48"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU48"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ADV78858.1"
FT                   /translation="MIRRQKYGDEIAKAQVLIEALPYIKKFSGKTVVIKYGGSAMLDCN
FT                   LKRMVMQDIVLMKFVGLNPIVVHGGGPEINKMLERLGIESKFVNGLRVTDEATMEIVEM
FT                   VLTGRINKEIVSLINELGGQAIGVSGKDGRLLKAEKDTSNGDIGYVGKIVDVNIDVITM
FT                   MLEKGYIPVIAPTSFGDDGKTYNVNADTAAGKIAEALKAEKLILLTDVEGILSNINDKS
FT                   SLISRMDLEHAKEFMNSGRINGGMIPKLECCIKAVENGVKRAHIIDGRLTHSLLLEIFT
FT                   DEGIGTMIGKECFDDDNL"
FT   gene            254932..256116
FT                   /locus_tag="Thebr_0232"
FT   CDS_pept        254932..256116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0232"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferase; KEGG: tpd:Teth39_0226 acetylornithine
FT                   aminotransferase; PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78859"
FT                   /db_xref="GOA:E8UU49"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU49"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ADV78859.1"
FT                   /translation="MITFEDKKYLMNTYSRYPITLVEGKGTKVWDDKGNVYLDFIAGIA
FT                   VNSLGHCHPALVNALKNQSEKLIHCSNLYWNENQIELAKIIAENSFGGKVFFANSGAEA
FT                   NEGAIKLARKYASLKHGDKRHKVISAKNSFHGRTFGALTATGQEKYHKGFGPLLSGFKY
FT                   VPFNDIDALYEAIDDEVCAIMLEVVQGEGGIHEATPEYIKAVREICDENDILFIIDEVQ
FT                   TGIGRTGKLFGYEHYGITPDIMTLAKGLGGGFPIGAIVAKEDKSVFSPGDHASTFGGNP
FT                   LACAAGIAVMKEITKEGFLDSVAQKGEYFKGKLESLKEKHSVIKEVRGKGLMIGCEMDM
FT                   EEASDIVTKAMGKGLLINCISHNVLRFVPPLTVTEEEIDTAIIILDDVFCEMGF"
FT   gene            256100..257188
FT                   /locus_tag="Thebr_0233"
FT   CDS_pept        256100..257188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0233"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="KEGG: tmt:Tmath_2086 carbamoyl-phosphate synthase,
FT                   small subunit; TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: Carbamoyl-phosphate synthase small chain;
FT                   glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78860"
FT                   /db_xref="GOA:E8UU50"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU50"
FT                   /inference="protein motif:TFAM:TIGR01368"
FT                   /protein_id="ADV78860.1"
FT                   /translation="MKWGFSMKGYLKLEDGSIFEGKLISKNKKGYGEVVFTTGMTGYQE
FT                   AITDPSYAGQIVVMTYPLIGNYGINKYDFQSEKPHIRGFVIREYCDKPSNFQSEKSLLS
FT                   YLDEHNIPVLSGVDTRALTKKLRENGTMRGIITSNADDNIEFDQTNLLEEVSTKRSYRI
FT                   AGIGPKLAFIDLGTKKSILKMLNSVGFDIYVFPYNASYDDVMQINPDAIFLSNGPGDPK
FT                   DAVYAIELTKHFIGIKPVLGICLGHQIIALALGCNTVKMKFGHRGANQPVKDLLTNKDY
FT                   ITSQNHGYAVEEESIDKDKITVTHINLNDGTVEGIMHKFLPVFSVQYHPEACPGPRDST
FT                   DIFDKFMDIVMVYKRRSYFAEV"
FT   gene            257175..260393
FT                   /locus_tag="Thebr_0234"
FT   CDS_pept        257175..260393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0234"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="KEGG: tpd:Teth39_0228 carbamoyl-phosphate synthase,
FT                   large subunit; TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; Carbamoyl-phosphate synthetase large chain
FT                   oligomerisation; MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78861"
FT                   /db_xref="GOA:E8UU51"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU51"
FT                   /inference="protein motif:TFAM:TIGR01369"
FT                   /protein_id="ADV78861.1"
FT                   /translation="MPKYKDINKVLVIGSGPIIIGQAAEFDYSGTQACKSLKEEGVQVV
FT                   LVNNNPATIMTDTDIADIVYIENPTVSVVEKIIAKERPEGILATLGGQTGLNLAVKLKE
FT                   EGILDKYNVKLLGTSFESIKTAEDRELFKRKMQEIGEPVAESVTVTNIEDALKFAKNYG
FT                   YPLIIRPAYTLGGTGGGIAHNDEELISIVDLGLKKSMVGEVLVEKSLYGWKEIEFEVMR
FT                   DAADNCITICSMENFDPVGVHTGDSIVVAPTQTLSDYEYQMLRSASIKIIKALKIEGGC
FT                   NIQFALDPKSHKYYVIEVNPRVSRSSALASKATGYPIAKIAAKIAIGLRLDEIKNPVTG
FT                   KTTAFFEPALDYVVTKIPRWPFDKFYTTDRKIGTQMKATGEVMAIERSFEASLLKAVRS
FT                   LEIKAYGLRLNNVKAMKTEEILKGISVPNDMRLFYIAEALRRDIDIDYINEVTKIDKWF
FT                   LNKLLNIVNMEREVEKSELSEGILKKAKRMGFSDREIATIKGIKEEDVRMLRKQHGIYP
FT                   SYKMVDTCAAEFESVTQYIYSTYGEEDEVEIHDMPKVIVIGSGPIRIGQGIEFDYCSVK
FT                   ALWALREAGIKSIIINNNPETVSTDFDTGDRLYFEPITLEDVLNIYEKEKPLGVMVMFG
FT                   GQTAINLTEGLVKNRVKILGTSYESIDISEDREKFSKLLRELNINQPKGDYALTVEDAK
FT                   DIALKLGFPLLIRPSYVIGGQSMEKVNTLQEIIDYVSNATQVSPGRPILIDKYIDGREV
FT                   EVDAVSDGECVLIPGIMEHIERAGVHSGDSFSIYPARNLSEREINTIIEYTERISKALN
FT                   VKGLINIQFAVKEGTVYVLEVNPRASRTVPIMSKATGVPMVKLAVEVALGKKLKELGYK
FT                   SGLWPQTPYTVVKAPVFSMEKLTDAEVSLGPEMKSTGEIMGIDLSYEGALYKALEGAGL
FT                   KIPKKGKILLSIAERDFQEVPSLVEKLQSLGYEIYATYRTGKYLSLMGIHVNVISLDNA
FT                   IKLLKDGYFDAVINTPTKGKKPDNTGFKLRRTAVEYRIPLFTSMDTIKAALNAVAKVNV
FT                   NGLSILSINEYEEIQKDNVKNLVL"
FT   gene            260407..261639
FT                   /locus_tag="Thebr_0235"
FT   CDS_pept        260407..261639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0235"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="TIGRFAM: argininosuccinate synthase; KEGG:
FT                   tpd:Teth39_0229 argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78862"
FT                   /db_xref="GOA:E8UU52"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU52"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ADV78862.1"
FT                   /translation="MLKGEKVVLAYSGGLDTSVIIPWLKENYECEIIAACINVGQGEEL
FT                   KYIKDKALASGASKVYIEDVKEEFVKDYIFPTLKAGAVYEGKYLLGTSMARPLIAKKLV
FT                   EIAHKEGAKAIAHGATGKGNDQVRFEVSIHALDPSIKIIAPWRIWDLKSREDEIDYAKK
FT                   KGIPIPATYEKIYSVDNNLWHVSHEGGDLEDPWNEPKSDLYDIITPPDKAPDKPEYVLI
FT                   EFEKGIPVKVNGKALEPVKLIEELNAIAGRNGVGIADLVENRLVGMKSRGVYETPAGTL
FT                   LYAAHKELEYLVLDKETMRFKDLVSQKYADLVYNGLWFSPLKAALDAFVEETQKNVTGV
FT                   VRLKLYKGNVINAGVKSPYSLYNQEFVTFGKDEVYNQKDAEGFINLFGLSLKIKALMEM
FT                   ERKDMDEAVGR"
FT   gene            261620..262945
FT                   /locus_tag="Thebr_0236"
FT   CDS_pept        261620..262945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0236"
FT                   /product="argininosuccinate lyase"
FT                   /note="KEGG: tpd:Teth39_0230 argininosuccinate lyase;
FT                   TIGRFAM: argininosuccinate lyase; PFAM: fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78863"
FT                   /db_xref="GOA:E8UU53"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU53"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ADV78863.1"
FT                   /translation="MKLWGGRFKSETDKLMEEFNSSISFDIRLLKHDILGSIAHAKGLY
FT                   KAGVLTEDELNLIEKGLKEILDETNVGEIPNDEDVHSYVERLLTEKIGDVGRKLHTGRS
FT                   RNDQVATDERLYLRDEIDKIKEDLIKLIDTLKEMAETYKKAIMPGYTHLQRAQPVTFGH
FT                   HLLAYVEMFKRDLSRLEDMYKRVNVMPLGSGALAGTTFDIDRKYVASLLGFDDITLNSM
FT                   DGVSDRDFVIEFLSFASITMMHLSRFCEELILWSTKEFDFIEMDDRFSTGSSMMPQKKN
FT                   PDAAELIRGKTGRVYGDLITILTVMKGLSLAYNKDMQEDKEALFDGIDTLKMSLKVFTE
FT                   MIKTIKVKTDNMEKAAKYGYMNATDFADYLVSKGIPFRTAHEIAGKVVLYAIERNLAIE
FT                   DLPLNELKKFSDVIDEDVYEAIDLKNTLKKKKTIGAPTSIQS"
FT   gene            263244..265997
FT                   /locus_tag="Thebr_0237"
FT   CDS_pept        263244..265997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0237"
FT                   /product="calcium-translocating P-type ATPase, PMCA-type"
FT                   /note="KEGG: tpd:Teth39_0231 calcium-translocating P-type
FT                   ATPase, PMCA-type; TIGRFAM: calcium-translocating P-type
FT                   ATPase, PMCA-type; ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: E1-E2 ATPase-associated
FT                   domain protein; cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78864"
FT                   /db_xref="GOA:E8UU54"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005782"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU54"
FT                   /inference="protein motif:TFAM:TIGR01517"
FT                   /protein_id="ADV78864.1"
FT                   /translation="MRKNKCRYNKGGSLLENRKWYTLHATDIAELLSTHLSKGLSSEVA
FT                   RQRLEEQGYNELVSKRGLTFFEMFLSQFKDFLVIILIIASLVSMLVGEVIDSAVIIMIV
FT                   ILNAILGVIQEYRANKALDALKKMAAPEARVIRDGTVQVIPARELVPGDIVLLEAGNYV
FT                   PADLRLVESVNLKIDESALTGESVPVEKNADIVFNEEMPLGDRANSAFMGTVVTYGRGK
FT                   GIVVSTGMKTEIGMIAEMLESYQDEVTPLQKKLEQTGKALGIASLVISGIVFLLGLLRG
FT                   IQFLEMFMTAVSLAVAAIPEGLPAIVTIVLALGMQRMVKRNALVKKLHAVETLGSTTVI
FT                   CSDKTGTLTQNQMTATKIFTNGQFFSISGEGYRPYGEFYIDSSKIDPKSDTCLELLLKI
FT                   GALCNDSRLEGSGTEHEDQKSWRILGDPTEGALVVAAAKAGIFVEDLEKTQPRLNEIPF
FT                   DSDRKLMTTIHPFDGKYIAYTKGAPDVLLSLSSYIYKNGQEVPLTQEDIEAIIAANKAM
FT                   ASQALRVLALAYKPLNDLPEEPKAEDIEKDFVFVGLIGMIDPPRPEAIEAIKTCKQAGI
FT                   WPVMITGDHRDTAVAIAKDLGLIESEAGVLTGAELDSMSDDEMFQKSREVSVYARVSPI
FT                   HKLRIVEAIKNNGHIVAMTGDGVNDAPALKKADIGVAMGITGTDVAKETADMILVDDNF
FT                   ASIVSAVEEGRVIYSNIRKFIFFLLSCNIAEILIIFVSMLAGLPIPLKPVQLLWINVLT
FT                   DAFPALALGMEKKEPDIMQQPPRRPEEPIIDTRMRWQIAIQSIFMTVSIIGVFVFALKY
FT                   TDSIEKARTFAFATLIFSELLRAFSARSETHSVFKIGFFTNHFMLWGTFISLILLLAVI
FT                   YVPFLRTIFDTTYLSFYEMDIVIIFGLIPFAAAEISKIFLSSRGHR"
FT   gene            complement(266051..266320)
FT                   /pseudo
FT                   /locus_tag="Thebr_0238"
FT   gene            266549..267304
FT                   /locus_tag="Thebr_0239"
FT   CDS_pept        266549..267304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0239"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /note="KEGG: tpd:Teth39_0233 phosphoglyceromutase; TIGRFAM:
FT                   phosphoglycerate mutase 1 family; PFAM: Phosphoglycerate
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78865"
FT                   /db_xref="GOA:E8UU55"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU55"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ADV78865.1"
FT                   /translation="MHKVVLLRHGESLWNMENRFTGWTDVDLSPKGIEEARESGKTLKA
FT                   EGYTFDCAFTSVLKRAIRTLWIVLDELDRMWIPVYKSWRLNERHYGALQGLNKAETAKK
FT                   YGEEQVKIWRRSVDVRPPALEKDDPRYPGFDPRYADLSEEEIPLTENLIDTINRVIPYW
FT                   ESTIAPTIKSGKKVLIVAHGNSLRGLVKYLDNLSKQEIMELNIPTGIPLVYELDDDLKP
FT                   IRHYYLADEEKVKEKKELVENQGKIQGNS"
FT   gene            267396..267917
FT                   /locus_tag="Thebr_0240"
FT   CDS_pept        267396..267917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0240"
FT                   /product="Ferroxidase"
FT                   /EC_number="1.16.3.1"
FT                   /note="KEGG: tpd:Teth39_0234 ferritin, Dps family protein;
FT                   PFAM: Ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78866"
FT                   /db_xref="GOA:E8UU56"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU56"
FT                   /inference="protein motif:PRIAM:1.16.3.1"
FT                   /protein_id="ADV78866.1"
FT                   /translation="MLSNRMLEGLNKQLNYEIYSAYLYVAMENYFQEKNLEGFANFFKV
FT                   QTQEELAHARIFYEYIYRMGGKVTLYPIEKPEENFESILELFKKALSHEKTVTERIHKL
FT                   VDIAIEEKDHATNAFLQWFVNEQVEEEESFQRLVDKLELIGDNIQPIFILDAELAQRIF
FT                   VLPAPLAQGQ"
FT   gene            268164..269949
FT                   /pseudo
FT                   /locus_tag="Thebr_0241"
FT   gene            269974..270354
FT                   /locus_tag="Thebr_0242"
FT   CDS_pept        269974..270354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0242"
FT                   /product="protein of unknown function DUF1312"
FT                   /note="PFAM: protein of unknown function DUF1312; KEGG:
FT                   tmt:Tmath_2071 protein of unknown function DUF1312"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78867"
FT                   /db_xref="GOA:E8UU57"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU57"
FT                   /inference="protein motif:PFAM:PF07009"
FT                   /protein_id="ADV78867.1"
FT                   /translation="MKKGDILIMLFVVVLAIGLLVFYKISTTQHYHHKYAVIMVDGKIY
FT                   KEISLEDVNYREEIPIVTKYGKNVLLVKNGGIQVIYAECPDKICIKEGFIDKPGQSIVC
FT                   LPFRMVVEIRGVKNAEVDQVVY"
FT   gene            270326..270880
FT                   /locus_tag="Thebr_0243"
FT   CDS_pept        270326..270880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0243"
FT                   /product="Heptaprenyl diphosphate synthase component I"
FT                   /note="PFAM: Heptaprenyl diphosphate synthase component I;
FT                   KEGG: tpd:Teth39_0237 heptaprenyl diphosphate synthase
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78868"
FT                   /db_xref="GOA:E8UU58"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU58"
FT                   /inference="protein motif:PFAM:PF07456"
FT                   /protein_id="ADV78868.1"
FT                   /translation="MPKSTKLSIESTTMSKTHRMVFLAILATNSLILYIIEGMLPVPFV
FT                   APGAKLGLANIITVISLYLFGFFDTFIVLFVRILLATLFASLPSTFFYSIGGGVLSLFA
FT                   MYFAKSIGKENISEVGVSVIGAVFHNIGQMLVASLVVQNINIMVYLPILMIAGIGTGVF
FT                   VGLTAKFVLKHWRKLKNLNLH"
FT   gene            270894..271861
FT                   /pseudo
FT                   /locus_tag="Thebr_0244"
FT   gene            271912..272949
FT                   /locus_tag="Thebr_0245"
FT   CDS_pept        271912..272949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0245"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: tpd:Teth39_0239
FT                   ApbE family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78869"
FT                   /db_xref="GOA:E8UU59"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU59"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADV78869.1"
FT                   /translation="MKKSMTFFAAFFLIFTVASIFSGCSNKNSQPISDTQFALDTYCTI
FT                   SIYDNVPKKVLDEGFKAIKDVEDKMSVTIKNSEVNQINENAGIRPVKVSPDTFYVIKKA
FT                   VHFSDVEKGYFDITVGPIVKLWNIGTDKAKVPSPEEIKAKLPLVNYKDIILDEKNMTIM
FT                   LKNKGMSIDLGGIAKGYAADKVAQVLKKEGVKHAIINLGGDVLTIGTKPDGGNWRIGIQ
FT                   TPFKPRGEYLGIVEVSNKAVVTSGVYERYFKKDGKLYHHILNPFTGYPVDNHLYSVTII
FT                   TDTSIDGDALSKIFVIGLEEGLKLAESLPGVQAIFVTDDKKVYITSGLKGNFKVTDPEY
FT                   TLMTK"
FT   sig_peptide     271912..271995
FT                   /locus_tag="Thebr_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.774 at
FT                   residue 28"
FT   gene            272996..273103
FT                   /locus_tag="Thebr_0246"
FT   CDS_pept        272996..273103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tit:Thit_1134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78870"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU60"
FT                   /inference="similar to AA sequence:KEGG:Thit_1134"
FT                   /protein_id="ADV78870.1"
FT                   /translation="MIASKFVQNIAKRGKKSIKRMRKTEIQFIAKAKKA"
FT   gene            complement(273173..274204)
FT                   /locus_tag="Thebr_0247"
FT   CDS_pept        complement(273173..274204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0247"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; Insertion element
FT                   protein; KEGG: tpd:Teth39_0240 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78871"
FT                   /db_xref="GOA:E8UU61"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU61"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADV78871.1"
FT                   /translation="MQNIVPLKCPKCNNTSLFYKYGKTKDGYQKYLCRKCHHQFAPDKP
FT                   SSKKTPKYPRCPVCGKASFLHHDYEYYSNYRCCDKKCNHSFFVPKPTAIPSTSMSKLVG
FT                   KTNFKRMRYPLHIILSALSMFFLGKNSFRNISLILKTTFNVEVSHTTISNWCRKFAPLF
FT                   HNISLELIPMLNFNSDEWHVDETVVKIAGEKYYIWFVIDSETRFILGFHLTPYRDSRQA
FT                   FALLNSVRNLGTPSAIVSDRYSAYKVPVKSLFGYSVKHIRVESFKNDISNNLIESFHHQ
FT                   FKAWYKAKQGFASFESANNLISMFVFFYNFVRPHSSLNGWTPAQVAGLNLTPKEKKKYL
FT                   LVA"
FT   gene            274329..274745
FT                   /locus_tag="Thebr_0248"
FT   CDS_pept        274329..274745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0248"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG:
FT                   tpd:Teth39_0241 FMN-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78872"
FT                   /db_xref="GOA:E8UU62"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR017058"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU62"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ADV78872.1"
FT                   /translation="MKRVLALVLVGLFALVVMSGCSSKTASGGYKDGTYKAEQPDFDDH
FT                   GWKGQIEVTVKDGKIASVTYNEVNKDGQLKRDDQQYAENMKAKVNITPKEAYEKLEQQL
FT                   VEKQDPAKVDAVTGATHTSETFKELATEALKNAK"
FT   sig_peptide     274329..274400
FT                   /locus_tag="Thebr_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.715 at
FT                   residue 24"
FT   gene            complement(274811..275188)
FT                   /locus_tag="Thebr_0249"
FT   CDS_pept        complement(274811..275188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0249"
FT                   /product="desulfoferrodoxin"
FT                   /note="KEGG: tpd:Teth39_0242 desulfoferrodoxin; TIGRFAM:
FT                   desulfoferrodoxin; PFAM: Desulfoferrodoxin ferrous
FT                   iron-binding region; Desulfoferrodoxin Dfx domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78873"
FT                   /db_xref="GOA:E8UU63"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR004462"
FT                   /db_xref="InterPro:IPR004793"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="InterPro:IPR038094"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU63"
FT                   /inference="protein motif:TFAM:TIGR00320"
FT                   /protein_id="ADV78873.1"
FT                   /translation="MADLYGVYKCEKCGNIVEVLHAGQGTLVCCGEPMVKMQEKTGDAG
FT                   TEKHTPVIERNGNIVTVKVGSIPHPMEEKHWIEWISLLADGVYMRKVLKPGEKPEAVFV
FT                   TDAKNLKAWSYCNLHGLWKSE"
FT   gene            275481..275597
FT                   /pseudo
FT                   /locus_tag="Thebr_0250"
FT   gene            275673..277091
FT                   /locus_tag="Thebr_0251"
FT   CDS_pept        275673..277091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0251"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; Fumarase C-like; KEGG:
FT                   tpd:Teth39_0244 aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78874"
FT                   /db_xref="GOA:E8UU64"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU64"
FT                   /inference="protein motif:PFAM:PF00206"
FT                   /protein_id="ADV78874.1"
FT                   /translation="MKYRIEHDLLGQKEVPVDAYYGIHTLRAYENFNISGQKIHRELII
FT                   SLAMVKKAAAIANMKAGLLDEKRAKAIILACDEIISGKYHDQFIVDALQGGAGTSSNMN
FT                   ANEVIANRAIELLGGSKGDYSIVHPLEHVNLSQSTNDVFPTAVRIAAIRLLKPLSEDLA
FT                   ELQSVLQEKEEEFSDVCKMGRTELQDALPVMLGQEFGAYAQAVARDRWRIYKVEERLRQ
FT                   VNIGGTAVGTGVNAELKYIFSVIEILREITGLGLARAEYMMDPTQNNDVFVEVSGLLKA
FT                   AAVNLIKISNDIRLMSSGPKCGLMEINIPEVQSGSSIMPGKVNPVIPEAVKQAAFQVIA
FT                   CDHAITLCAQAGEFELNFTLPQIAYNLFMQIGLLRNAIRIFIDKCIKGITANKDYLKET
FT                   IEKSYSYATALVPYIGYEKATEIAKMAKEKGKTIREVVLEAGLFTEEELDIIFNPYEMT
FT                   KPGIPGKRRLKGEK"
FT   gene            277094..278320
FT                   /locus_tag="Thebr_0252"
FT   CDS_pept        277094..278320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0252"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; KEGG: tpd:Teth39_0245
FT                   small GTP-binding protein; SMART: Ras small GTPase, Ras
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78875"
FT                   /db_xref="GOA:E8UU65"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU65"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ADV78875.1"
FT                   /translation="MNTTPISSRLHIAIFGRRNAGKSSLINALTNQEVALVSDVAGTTT
FT                   DPVSKAMEILPIGPVVIIDTAGLDDTGELGELRVKKTYEVLNRTDLAILVIDGTIGLSE
FT                   FEENVLKIIRDKNIPVVGVINKKDLSQYSEEDKRKWEEKLKLELIEVSALKKHGIEALK
FT                   MMLIKKAPYDDRELSIVGDLIKPGDFVVLVIPIDKAAPKGRLILPQQQTIRDILDNDAM
FT                   AIVTKEHELKETLQNLGKKPSLVITDSQAFLKVSADTPKDIPLTSFSILFARYKGDLEE
FT                   LVRGVKAIKKLKPGDKVLIAEGCTHHRQSDDIGKVKIPRWIRQIVGGDIQFDWSSGITF
FT                   PDNLEEYSLIVHCGACMLNRREMMYRISYAKSKNIPIVNYGVLIAYVQGLMPRAIEMFP
FT                   LAKMIYEEE"
FT   gene            complement(278331..279569)
FT                   /locus_tag="Thebr_0253"
FT   CDS_pept        complement(278331..279569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0253"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tpd:Teth39_0246 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78876"
FT                   /db_xref="GOA:E8UU66"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU66"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADV78876.1"
FT                   /translation="MNTVEKLEYSFPALKHRNFRLFWFGQMISLIGTWMQNIGQGWLVL
FT                   ELTNSSFLLGLVSAVQFLPVMLFSLFAGVIIDRFPKRKLILFTQISFAISAFILATLTA
FT                   LKIINYWEILALALVNGFLNTIDMPARQSFIIDLVGKKDLMNAIALNSAVFNAARIIGP
FT                   GIAGILIGKLGYSICFYLNSASFIAVIIGLILITVEGITPKANDGKTKIFDDLRDGLRY
FT                   IKNTPVIFTTILMIAILSTFSMNFNVLVPVFTKDVLHREATDYGLLMSAMGTGALIGAL
FT                   TLASVSRRGVKPVYLFGGGIGLGIFQILIGIQSSYLLTALLLALSGWFMITFNSSANTT
FT                   IQINAADEFRGRVMSVYSLVFGGVTPIGSLYAGTLSQKFGPHITFIVSGIIALSYTLYV
FT                   LVFQYKKVYGTKV"
FT   gene            complement(279588..280895)
FT                   /locus_tag="Thebr_0254"
FT   CDS_pept        complement(279588..280895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0254"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: tpd:Teth39_0247 TPR repeat-containing protein;
FT                   PFAM: helix-turn-helix domain protein; Tetratricopeptide
FT                   TPR_1 repeat-containing protein; SMART: helix-turn-helix
FT                   domain protein; Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78877"
FT                   /db_xref="GOA:E8UU67"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU67"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADV78877.1"
FT                   /translation="MDMVELGKRIREERKRQFLKQGDLSGDEFSKGYISLIEKGKISPS
FT                   LKALNFIAQKLNKPVVYFLDEDYVEKEELKKELAKYKNILEKFLTAQKAFDNKNYEEAI
FT                   KLYIDILDNAIDEYSTNLINFYLAKSYFAIKDYTKVLEILDKISPYFEKSSLNEIIVEM
FT                   HYMKGLCLGNLQKFQSSLENYLKALDGFEKYSLKHTQLKSRILYSIANLYSKMGEFIKA
FT                   RDYYMKCLEYSTQIKAVDFIALSNNGLGLVNHELKQYKDALKYIRRAILISKTLNLKED
FT                   IANEYNYLGFVYTDLKKYDIAEKYFVKSYSLYKDLGNERGMAYNLTEIGRIYYLKEDYP
FT                   KALEYLNQSLEIVTKLGEEEMGRIYTILGNLHLKQGQFELSEKELLKSVEILKTLGLKK
FT                   DLSEAYKGLGNLYIALNNPEEAKKYFNQSIELLYEN"
FT   gene            281048..282535
FT                   /locus_tag="Thebr_0255"
FT   CDS_pept        281048..282535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0255"
FT                   /product="MazG family protein"
FT                   /note="KEGG: tpd:Teth39_0248 MazG family protein; TIGRFAM:
FT                   MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78878"
FT                   /db_xref="GOA:E8UU68"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU68"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ADV78878.1"
FT                   /translation="MNKLFIVGLGPGSADSITLGTIEKMKNADKVFLRTEKHPVVPYLK
FT                   TQGIIFDTFDKMYEKSTTFEEVYENIAREIIDIAKKYRKVVYAVPGHPYVAEKSVEYIL
FT                   NFCNDCADISIEVIPAISFIDAIIGELKIDPIYGLKIIDGLSLDVQKPDKRCGNIVVQV
FT                   YDRFIASEVKLKLAEVYGDSYPVTVIKNAGIPGKQVIETIPLYMIDRLDWIDYLTSLYI
FT                   PPVQTLFQEKYDIYDLLEIMRILRSEKGCPWDKEQTHQSLEKYLVEESYELVDAIEKES
FT                   EDKMVEELGDVLLQVVFHSQIAKERGTFNFGDVVDGICKKMIWRHPHVFGTEELKTSKA
FT                   VLEKWDELKKEEKDLNSYTEVLKDVPRYMPALMRSYKIQEKAAKVGFDWERVEDALSKV
FT                   YEELEELKEVYKGKDKEKIIEEVGDLIFAVVNVARFLDVEPESATHNTVEKFIKRFEYI
FT                   EKTAAKNGQKLDEMTLSDMDKLWNEAKMNNFNKKNEK"
FT   gene            282613..282888
FT                   /locus_tag="Thebr_0256"
FT   CDS_pept        282613..282888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0256"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="KEGG: tpd:Teth39_0249 histone family protein
FT                   DNA-binding protein; PFAM: histone family protein
FT                   DNA-binding protein; SMART: histone family protein
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78879"
FT                   /db_xref="GOA:E8UU69"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU69"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ADV78879.1"
FT                   /translation="MNKADLVAKIAEKSELTKKDAEKALNAFIEAVEEALKNGDKVQLV
FT                   GFGTFEVRERAERKGRNPQTKEEITIPASKAPIFKAGKALKDLVNS"
FT   gene            282943..283188
FT                   /locus_tag="Thebr_0257"
FT   CDS_pept        282943..283188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0257"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: tpd:Teth39_0250 RNA-binding S4
FT                   domain-containing protein; PFAM: RNA-binding S4 domain
FT                   protein; SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78880"
FT                   /db_xref="GOA:E8UU70"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU70"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADV78880.1"
FT                   /translation="MRVDKFLKVSRLIKRRTIAKEACDKGLVFINGKQAKASDEVKEHD
FT                   IIEINFGNKIVKVEVLDVKEHALKDEAYKMYKLIEE"
FT   gene            283244..284224
FT                   /locus_tag="Thebr_0258"
FT   CDS_pept        283244..284224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0258"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="KEGG: tpd:Teth39_0251 SpoIID/LytB domain-containing
FT                   protein; TIGRFAM: SpoIID/LytB domain protein; PFAM: Stage
FT                   II sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78881"
FT                   /db_xref="GOA:E8UU71"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU71"
FT                   /inference="protein motif:TFAM:TIGR02669"
FT                   /protein_id="ADV78881.1"
FT                   /translation="MYRNILKLIAVLVALLFAMTSCKPPTKKPEPIRKPRMELPKIPAK
FT                   INVGENKEPVLKVYVVQTGKIENMPLEKYVEGTVAGEIKNYWPIEALKAQAILARTYVL
FT                   NFVSTKKSKYPGADISTDFEEAQAWNPSNINSKIKEAVKDTRGVVAVYDGKFINAWFHS
FT                   HAAGQTALAKEGLNYKEPEPPYIVSVKSNESPSAPANVKHWTAIFTKSEVIDALKKMGL
FT                   GINDFKTVKIGTKGASGRTVNFLFDKTPVNAPDFRMAIGSERLKSTMIDEVSYDGSKLV
FT                   IKGRGFGHGVGMSQWGAYQMAKEGKKAKDILNYYFKGINIVKIWD"
FT   gene            284325..284621
FT                   /locus_tag="Thebr_0259"
FT   CDS_pept        284325..284621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0259"
FT                   /product="sporulation protein YabP"
FT                   /note="KEGG: tpd:Teth39_0252 YabP family protein; TIGRFAM:
FT                   sporulation protein YabP; PFAM: YabP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78882"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU72"
FT                   /inference="protein motif:TFAM:TIGR02892"
FT                   /protein_id="ADV78882.1"
FT                   /translation="MEDKRNFSRTGKPHNITIENRERISISGVTNVVSFDEETVILETD
FT                   LGVLTIRGQGLHINKLNLDDGQVSIDGEVINLNYSDKSGLIGKSGGFISRMFR"
FT   gene            284730..285389
FT                   /locus_tag="Thebr_0260"
FT   CDS_pept        284730..285389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78883"
FT                   /db_xref="GOA:E8UU73"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU73"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0253"
FT                   /protein_id="ADV78883.1"
FT                   /translation="MSEERKNWFKNMTTKEKVEYIWDYYKVYIIVSILVIYLLVSFTSS
FT                   IINRKDYVLNIALIGKYMDFDRQSEFSKKVTKELIGDPSGKKQASIDFYRFVKGPNGNF
FT                   TLDPASTQKLMARMGAQDIDVIVLDKNNFDILARQGAFLRLDKVKELNLSGLNVAKVEK
FT                   PSGELKPGVYGIYVGWNNEYLKNLGYDYNDKIIAIMANGQRKDLAIKFVKWLLDVK"
FT   gene            285405..286043
FT                   /locus_tag="Thebr_0261"
FT   CDS_pept        285405..286043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0261"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /note="KEGG: tpd:Teth39_0254
FT                   2,3-diketo-5-methylthio-1-phosphopentane phosphatase;
FT                   TIGRFAM: 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase; HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); PFAM: HAD-superfamily hydrolase subfamily IB
FT                   hypothetical 1"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78884"
FT                   /db_xref="GOA:E8UU74"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR016965"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU74"
FT                   /inference="protein motif:TFAM:TIGR01489"
FT                   /protein_id="ADV78884.1"
FT                   /translation="MKKMKKVFLVDFDGTVTKVDTVDLMVKKFAKDGWQYYEELWEKGE
FT                   MSTEECAIETLKLMEVDEKKLLDLLYTIEIDDYFMEFLNFCRTKDYEVVIVSDGYDFNI
FT                   KAIMDKYGFNIKFYSNKLWFEDGIIKVDFPHKSKDCDKCGMCKLEVLNRYKIRGYYVVY
FT                   IGDGYSDFCVSQHADKVFAKGVLEKYCKENEIPCTPFRNFGDIIEKLKR"
FT   gene            complement(286047..287666)
FT                   /locus_tag="Thebr_0262"
FT   CDS_pept        complement(286047..287666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0262"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: DRTGG domain protein; CBS domain containing
FT                   protein; DHHA2 domain protein; KEGG: tpd:Teth39_0255
FT                   putative manganese-dependent inorganic pyrophosphatase;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78885"
FT                   /db_xref="GOA:E8UU75"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU75"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADV78885.1"
FT                   /translation="MTTVYVSGHRNPDTDSICSAIAYAYLKRISEGINAIPVRLGPINR
FT                   ETKFVLDYFGVEEPIFIENVYTQVQDIKFDKPLVFKENTSMFEAWNAMMEKNIRTIAVV
FT                   DNENKLIGIATVGDLAKAYLSSSHELSKYKIPIDNILATLKGEEILRYVDYLEGDILVA
FT                   AMSKENVLKRIKKGDILIVGDRDDIQQAAIQQGIKALIITGNNGISEKILELAKQYKVT
FT                   IIKVVPDTFDTVKLLNQSIPLSYVIKKEDLLTFRVSDYIDDVKEVMLKYRYRNFPVVDE
FT                   EGKVVGLLARRHILDYERKNVIMVDHNEFSQAVEGIEQARILEIIDHHRIGTIETEQPI
FT                   LFRNHPVGSTATIINRLFEEKGLIPEPKIAGIMCAAILSDTLVFKSPTCTPEDVRAAKK
FT                   LAEIANIDINEFGTEMFKAGTSLEGKTVEEIFYTDFKEFTINNYKIGIGQVNTLTDAGE
FT                   LKQQLISFMEKVKKDKDYDILLLMLTDIINEGSEILFVGNNKELLQRAFNVEIKNNSFY
FT                   LPYVISRKKQVLPPLVKAINTH"
FT   gene            287744..288220
FT                   /locus_tag="Thebr_0263"
FT   CDS_pept        287744..288220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0263"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="KEGG: tpd:Teth39_0256 hypothetical protein; TIGRFAM:
FT                   spore cortex biosynthesis protein YabQ; PFAM: Spore cortex
FT                   biosynthesis protein, YabQ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78886"
FT                   /db_xref="GOA:E8UU76"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU76"
FT                   /inference="protein motif:TFAM:TIGR02893"
FT                   /protein_id="ADV78886.1"
FT                   /translation="MVITIQNQVYAFLVTVYGGFVLGFIYDIFKVTRRVFRLKKTFSNI
FT                   ADIIFWLFGTITMLYFMYISNYVEIRFYSFLGFAIGVILYYVLLSYFITQALIGIYEFT
FT                   IKFLKKMAEIIIYPVKIVVNFFIVPYRFTRKILTLPGAFLKNNLTHFKIFKRKK"
FT   gene            288289..288576
FT                   /locus_tag="Thebr_0264"
FT   CDS_pept        288289..288576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0264"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   tpd:Teth39_0257 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78887"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU77"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ADV78887.1"
FT                   /translation="MKKLKKILFFAFIAYVAFTFFQQQVALEKLNNRYRDLKNKEAAVI
FT                   KENKYLNELLHQMNSESFIENEARQKLGLVKKGEIIYVDISKTKTQETKK"
FT   sig_peptide     288289..288369
FT                   /locus_tag="Thebr_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.769 at
FT                   residue 27"
FT   gene            288664..289086
FT                   /locus_tag="Thebr_0265"
FT   CDS_pept        288664..289086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0265"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   tpd:Teth39_0258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78888"
FT                   /db_xref="GOA:E8UU78"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU78"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADV78888.1"
FT                   /translation="MPFEVGDVVEGTVLNITDFGAFIQLPEGKTGLVHISEVANTYVKD
FT                   IREHLKEHDKVKVKILSMDANGRISLSIKKALPKNNKERDPKDFVWQSNRNYNTNSSFE
FT                   ERLLKFLKDSDERQQQLRKNFDSKRRNTGYRKSNGY"
FT   gene            289166..290071
FT                   /locus_tag="Thebr_0266"
FT   CDS_pept        289166..290071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0266"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: tex:Teth514_0697
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78889"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU79"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ADV78889.1"
FT                   /translation="MRICAIDIGTNSIRQLICDIDNENINKIQKDVEITRLGEGISKTG
FT                   KLNNNAIQRSIEVIERFVKLAQEKGAEVIYAFATSAMRDAKNKDAFFEQIGKLGLEVEI
FT                   IDGETESLFGYMGAVMGVNKENALVLDIGGGSTELAYKGREFVKESFDIGAVRLTEKFI
FT                   KNDPPTAEEYDEIRLHIIDTMVNSINKYKEVENVIGIGGTITTLAAVSQQLEIYSQEKV
FT                   HGYQLKKEEIKRILDKFMSVTLEERKKFFGLQPQRADIIIAGTAILLTILEMLSFKEIT
FT                   VSEWDNLEGAVLYKFREFKL"
FT   gene            290169..290258
FT                   /locus_tag="Thebr_R0004"
FT                   /note="tRNA-Leu1"
FT   tRNA            290169..290258
FT                   /locus_tag="Thebr_R0004"
FT                   /product="tRNA-Leu"
FT   gene            290263..290339
FT                   /locus_tag="Thebr_R0005"
FT                   /note="tRNA-Met1"
FT   tRNA            290263..290339
FT                   /locus_tag="Thebr_R0005"
FT                   /product="tRNA-Met"
FT                   /note="GenePRIMP"
FT   gene            290347..290423
FT                   /locus_tag="Thebr_R0006"
FT                   /note="tRNA-Met2"
FT   tRNA            290347..290423
FT                   /locus_tag="Thebr_R0006"
FT                   /product="tRNA-Met"
FT   gene            290545..291771
FT                   /locus_tag="Thebr_0267"
FT   CDS_pept        290545..291771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0267"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: tpd:Teth39_0260 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78890"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU80"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADV78890.1"
FT                   /translation="MKLRIGNKELIKDINRSLVINEIRMNGPISRTDISKNLNLGLSTV
FT                   TNIVEELENQNLVHEVGEADSTGGRKPILLEFNYNYGYIIGIKIEENNLIFALTNLKSE
FT                   IIEKRVVPFKKGTNSNTVLNMVVENIEKLITKIPYNKNLMGIGVAVSGLVDQQKGKLIY
FT                   SGMLNWSNVEIGNILENKFNVPVYIDNDVNAYTLAELWYGHGRELNNFIVVTYGSGIGS
FT                   GIVINKKLYTGDFGGAGEIGHMVLVAEGRKCECGQRGCLEAYASEDFIVDYIRDNIKMY
FT                   SESKIDLTEDLSIEKVYEYAKEGDMLAIDVLRLSAKYLGYGLLSVINLLNPSTIILAGE
FT                   GMIAKDIILPVINDIVKNNFFKMHEKKVQIKVSELGDEGWVIGASTLAISKLFEIPLYE
FT                   GQDNALTVF"
FT   gene            291896..293185
FT                   /locus_tag="Thebr_0268"
FT   CDS_pept        291896..293185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0268"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tpd:Teth39_0261 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78891"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E8UU81"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADV78891.1"
FT                   /translation="MSKKMISVLVAAILVLTFVLPGCGSNSSTKQSTDNTSANDTQKVE
FT                   PVTIEFWHTFSDTEDKILNEQIIPDFEQKYPNIKVKATRMPYDGLKQQVISAVAGNATP
FT                   DVMRMDIIWVPEFAKLGALQPVDNLEGFDAIKEKAFKGPMETNYFNGHYYGIPQDTNTK
FT                   IAIYNKTLLQQAGLTEPPKTFDELVAAAEKIKGKDRWGIAISGTGPWGIAPYFLSLGGK
FT                   VTDDKYTKATGYLNSPESVAALQKLLDLYNKKLIGPCILGGQPDTWGGMKGNNYLMIDD
FT                   GPWFYSIQGDAAKQSTVPALFPQGPGGSISVVGGEDLVLFKTTKHPKEAWIFMKYMFSE
FT                   TPQKLLAKQAGLIPTNMDVANSPEVSGEPIISLYVEQLKTAWPRTPSPNWGKIDETLGQ
FT                   AFEKVFRGKATPQQALDEAAKQIDEFLQNN"
FT   sig_peptide     291896..291988
FT                   /locus_tag="Thebr_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.326 at
FT                   residue 31"
FT   gene            293252..294199
FT                   /locus_tag="Thebr_0269"
FT   CDS_pept        293252..294199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0269"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_0262
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78892"
FT                   /db_xref="GOA:E8UUF5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUF5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADV78892.1"
FT                   /translation="MLSQPILENKSKNNKKNSHFKQKFKEWFEVLPFIGLGLVLLSVFV
FT                   VYPQIKNIYMAFTNYNIMPGQPSEFVGFANFMRAFHSEKFWLAFRNTVLYGVVTVPGQM
FT                   AIGLIVAVLINNVIKGKNLYKVMIYIPVITSWIVVSLIFKYLFTDGKEGLINYALLKLH
FT                   LISNPISWLQNTWTANFVIWVLGIWKGIGWVMVIYLAALQGIPNELYEAAEVDGANPVQ
FT                   TFFKIIIPLIKPTTFFILINLIIGAFGVFIQVMMITNGAPLGTTDVLLNYMYNRAFSDF
FT                   EFGYASAISVIIGIVIMAITLLLKRLLKYDEFNY"
FT   gene            294215..295048
FT                   /locus_tag="Thebr_0270"
FT   CDS_pept        294215..295048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0270"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_0263
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78893"
FT                   /db_xref="GOA:E8UUF6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUF6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADV78893.1"
FT                   /translation="MVKSKFGQFIIHILLLICSAAMVIPFMYMVATALTQDTYVMPYPP
FT                   ILIPKSLYLGNFIEAWNANNFERYFLNSLFLAITNTILSLFISTLSAYGFARFNFPGKN
FT                   LIFNIYLFTMMVPGVLNIVAQYTVINGMHLVDTYTGLLLLYVGGGIAGNTFFLKGFFEQ
FT                   IPRELEESIIIDGGSRWTIYRHIILPLSKPALATFAIFAFSGTWDEFFTALTLIKTPIK
FT                   RTLPIAIRMFQGQFATKWGLVFAASLIAVIPIILIFIIFQKYFIRGGIQEGALKG"
FT   sig_peptide     294215..294322
FT                   /locus_tag="Thebr_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.768 at
FT                   residue 36"
FT   gene            295088..296920
FT                   /locus_tag="Thebr_0271"
FT   CDS_pept        295088..296920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0271"
FT                   /product="Dextranase"
FT                   /EC_number="3.2.1.11"
FT                   /note="KEGG: tpd:Teth39_0264 dextranase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78894"
FT                   /db_xref="GOA:E8UUF7"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025092"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUF7"
FT                   /inference="protein motif:PRIAM:3.2.1.11"
FT                   /protein_id="ADV78894.1"
FT                   /translation="MSKKIIALILIISTAIFGALYMYRNIFSFKDDNNIVALTKGKLIS
FT                   DVYTDKARYYPSDKVTVKIELNNELQEDFRGTIYIFYKHLESIVGKAKIQVNIKSGQKK
FT                   QLNIFWEAPKDDFKGYLVEVYAVKGNKAIDNKNTAVDVSSDWSKFPRYGYIANFPEQSK
FT                   EKSALIIEDLNKYHLNGLLFYDWQYKHNKPLAGTVENPDPKWKDIANRDIYGQTVKDYI
FT                   ELAHSKNIMVANYNLMYGGYFDYVKDGAKPEWGLYKDPNHEEQDNHPLPHTWATDRLYL
FT                   FNPANKDWQNYIFNAEKDAFRVYNFDVWHVDTLGPRGMVYDYNGNPVELSFTYADFLNN
FT                   AKNALGKRIVCNTVNEYGLINVASGADVDFLYVEIWPPARAHYNFLKQTVDNGYNYSDG
FT                   KKATVVAAYMNYGIADRSAEFNKHSVRLTDAAIFAAGGDHIELGDTGMLSKEYFPSANL
FT                   KMSESLVKAMRNYYDFLTAYENLLRDGLKESDNKIEIPGIEISNNGSARTVWTYAKQKD
FT                   GYDVIHMINLLGIEVSNWRDDLGNYSAPPIIKDFKVKYYLENDNIKNVYLASPDINDGK
FT                   VMKLQFKKKEDSKGKYLEISVPELQYWDMIFIKK"
FT   gene            296938..298029
FT                   /locus_tag="Thebr_0272"
FT   CDS_pept        296938..298029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0272"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   tpd:Teth39_0265 glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78895"
FT                   /db_xref="GOA:E8UUF8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUF8"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ADV78895.1"
FT                   /translation="MENLVEKSIKIIKNNQSEYGSFVASPSFPTYHFSWLRDGSFIAYS
FT                   MDLMGQYAEAEKFYRWVNEVIIRYSYKVDKIIEKIKNGNKLEPNDFLYARYTLEGYEEK
FT                   DSGWGNFQLDGYGTWLWGLSEHIKITGKTELINDFFKSIDITIKYIDNLWYYPNFDVWE
FT                   ENSDKIHTSTLACLYGGLNSINKYLNDDKVKELANKIKTYILTNCVVENSFVKYVGSNS
FT                   VDSSLIWLAIPFEVVDVNDEIFLNTIKRIEKELLHNGGMHRYRKDTYYGGGQWILLSAW
FT                   MGLYYCKSGDYKKAEEVKKWIEEQADENGYLPEQVPYHLNNEVYYPYWVNKWGNIAKPL
FT                   LWSHAMYLVLDYELKKAGVQLED"
FT   gene            298034..299719
FT                   /locus_tag="Thebr_0273"
FT   CDS_pept        298034..299719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78896"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR025092"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUF9"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0266"
FT                   /protein_id="ADV78896.1"
FT                   /translation="MYPSKSQYRPGEKVEIIATFEVTDDLGNYTVSCTVLNFYDILYKT
FT                   EKELKLHDEKVVFEFNIEKNEKEMMGFGVEVDLYRNNEKINSLSTSFDITESWKLAPRY
FT                   GFLSDFFDRDKNDDKDLVQLNKYHINVVQFYDWMYRHHELLPPTNSFADPLGRNLSIDV
FT                   VKQKIDYAHKFGMMAIAYGAVYGCEKEFYEEHKVWALYKNDGTVFDLINLIYIMDISKK
FT                   CGWHDHIISEFLKAIKFGFDGIHMDQYGFPKEALSVTDQVKKIRKLRDEFTVLINDTRE
FT                   YIEKNGYKPALIFNAVNNWPIDTVASAKQDVVYIEVWPPNDTYQDLYNLITNAKKYAPD
FT                   KQVILAAYMEPFSKRSNIPIEYAENATIMVMATIFASGGFHLLLGELNGILTEAYYPNY
FT                   TTIDSERFIRELRDYYDFIVRYEEFLYDFNIVDNTMTYTGGINTEYVFKGTKFSPKAEK
FT                   NSVWTLVKEKEGYKIIHLVNFTGVQSMKWNEGKEIRPKIINNIEATVLVAESVKGVYLA
FT                   SPDIDSGKPKKLDYEYVPHEHGKAIRFVIPELRVWDMVYIVCES"
FT   gene            300115..300390
FT                   /locus_tag="Thebr_0274"
FT   CDS_pept        300115..300390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0274"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   tpd:Teth39_0267 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78897"
FT                   /db_xref="GOA:E8UUG0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUG0"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADV78897.1"
FT                   /translation="MPRGQRKYNDEFKNTIVELYNHGKSLSELSSEYGISKSTISGWLK
FT                   KAKPINIDNKGTTITVEEYQAMLKKMARLEEENEILKKAMAIFEKE"
FT   gene            300480..300953
FT                   /pseudo
FT                   /locus_tag="Thebr_0275"
FT   gene            complement(301365..302582)
FT                   /locus_tag="Thebr_0276"
FT   CDS_pept        complement(301365..302582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0276"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG:
FT                   tpd:Teth39_2032 transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78898"
FT                   /db_xref="GOA:E8UUG1"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUG1"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADV78898.1"
FT                   /translation="MSLLTKEQLRNFISENNIQSIPDLYTSLKNLFKDTIQEMLEAELS
FT                   TELGYERYDKKDKDTQNSRNGYTQKTVKTQFGEMEIDIPRDRQGEFEPKIVPKYKRDIS
FT                   GIEEKVIALYARGMSTRDIHDQIKDLYGIELSAEMVSKITERIVPEIKEWQSRPLEKIY
FT                   TFIFMDAIHYKVRTDGHIINRAAYVVLGVTIEGIKDVLGIWIGENESSRFWLGVLNELK
FT                   NRGVEDVIVFSVDGLTGIKEAIQAAFPKSEIQRCIIHQLRNCFKYVSYKHLKEFSKDFK
FT                   AVYQSANEEIARDEFEKLKNKWQNLYPYAIKSWENNWDVLSPFYKFPEEVRKIMYTTNI
FT                   IEGFHRQLRKVTKSKTIFPSDEALEKMLYLVTMNVLKKWTVRYKNWDIVLNQLIIMYPG
FT                   RLEKYL"
FT   gene            complement(302671..303085)
FT                   /pseudo
FT                   /locus_tag="Thebr_0277"
FT   gene            complement(303154..303438)
FT                   /locus_tag="Thebr_0278"
FT   CDS_pept        complement(303154..303438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0278"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: tpd:Teth39_0272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78899"
FT                   /db_xref="GOA:E8UUG2"
FT                   /db_xref="InterPro:IPR025553"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUG2"
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /protein_id="ADV78899.1"
FT                   /translation="MFGGYMMGGLGRWFGGYYPCGYGTWFGGGLTNILFLILIGVVIYL
FT                   LVKQIRNVNFFKKHDTDPNNEALEIAKLRYVRGEITLDEYTEIVKMLKK"
FT   gene            complement(303470..303661)
FT                   /locus_tag="Thebr_0279"
FT   CDS_pept        complement(303470..303661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0279"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: tpd:Teth39_0273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78900"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUG3"
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /protein_id="ADV78900.1"
FT                   /translation="MGLILILAIGFYLYKTGNLQRMINNLHENKNYQTNEAKRILDIRL
FT                   AKGEITEEEEYNKLKSIL"
FT   gene            303920..304615
FT                   /locus_tag="Thebr_0280"
FT   CDS_pept        303920..304615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0280"
FT                   /product="response regulator receiver"
FT                   /note="KEGG: tpd:Teth39_0274 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78901"
FT                   /db_xref="GOA:E8UUG4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUG4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADV78901.1"
FT                   /translation="MGKKIFVVDDEIKILEVVKSYLEHEGFSVITETNGNNVLNTFKKE
FT                   KPDLVILDLMLPGISGEELCKRIRQFSNVPILMLTAKVQESDKINGFSIGADDYLTKPF
FT                   SPRELVMRVKAILRRTSDDVPLAEVMSFNNDDLVVDFKAHTVKKKGVVVNLTPNEFKIL
FT                   KFLIRNPNRVFTREELIEKVMGFDYEGYDRTIDAHIKNLRQKIEDDTKNPVYIKTVYGV
FT                   GYKFGDGNV"
FT   gene            304578..305963
FT                   /locus_tag="Thebr_0281"
FT   CDS_pept        304578..305963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0281"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: tpd:Teth39_0275 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78902"
FT                   /db_xref="GOA:E8UUG5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUG5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADV78902.1"
FT                   /translation="MVLDINLVMEMFRNNLRTRTAIVFISIALISIVIVSITTNILIIN
FT                   SFGNYVTKSTDKEFSNIANTLAAVYKSEGGWKSTTGREIGHAAMMEGYGLRLRDKDGKI
FT                   IWDFSSMSYMMNMMGKWNKKNISEKTLPIIVDEKTVGYVDIIYYGPIMMSDLDFKFLYD
FT                   ISRYNVIATVIAIFIALIISIYVSNYITRPLINITEVAKKLEKGDFTAKVYDIPKEEEL
FT                   FKLTAAINHLGESLKYQEILRKQMTSDIAHELRTPLTTLHSHIEAMLDGVWEPTYERLK
FT                   SLNEEVLRLINIVKDLETLNKFESDMLKLNKIKFDASELVKSILTNFEASFAEKEQEVV
FT                   KNIEDNIMLFGDKDRIAQVFVNLISNSNKYTPVGGKIKIDFYKDGDYAVFIVEDNGMGI
FT                   SKDDIPFIFERFYRGEKSRNRETGGSGIGLSIAKAIVLAHGGKINVESEINKGSKFIVK
FT                   IPL"
FT   gene            306038..306286
FT                   /locus_tag="Thebr_0282"
FT   CDS_pept        306038..306286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0282"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: tpd:Teth39_0276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78903"
FT                   /db_xref="GOA:E8UUG6"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUG6"
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /protein_id="ADV78903.1"
FT                   /translation="MMRMMYGWGWGYGIGGFIWSIVWMAIEIGLIVAAIYLIISLFRGT
FT                   KNRNKERDAIEILKERYARGEISEEEYLERKKRLEEK"
FT   gene            306359..306472
FT                   /pseudo
FT                   /locus_tag="Thebr_0283"
FT   gene            complement(306518..306613)
FT                   /pseudo
FT                   /locus_tag="Thebr_0284"
FT   gene            307031..307396
FT                   /locus_tag="Thebr_0285"
FT   CDS_pept        307031..307396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0285"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: tpd:Teth39_0277 ArsR family transcriptional
FT                   regulator; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78904"
FT                   /db_xref="GOA:E8UUG7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUG7"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADV78904.1"
FT                   /translation="MKEKGNKAEACEVTIIHEDIVNKVKEIMPEETKLYDLAELFKVFG
FT                   DTTRIKILCALFESEMCVCDIAALLGMSQSAVSHQLRVLKQNKLVKFKKEGKVVYYSLA
FT                   DDHVKKIFEQGFNHINE"
FT   gene            307417..309516
FT                   /locus_tag="Thebr_0286"
FT   CDS_pept        307417..309516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0286"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: tpd:Teth39_0278 heavy metal translocating
FT                   P-type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; cadmium-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78905"
FT                   /db_xref="GOA:E8UUG8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUG8"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADV78905.1"
FT                   /translation="MQNNNKSFILKGLDCASCAAKIEEGVKRIEGVTYANCDFVNSKLS
FT                   VEIDDSYELEKTIKELKKLVKNIEPNVEIIEYENEKIKDDNELLRRGIRYGISAILFTV
FT                   ALIFNLSVYVKFTLFFISYIIVGGEVILTAGKKILKGQVFDEHFLMSIATIGAFVIGEY
FT                   PESVAVMLFYQIGELLQDIAVDRSKRSIKELMNIRPDYANLKIGYEIKRVSPQEVRPGD
FT                   VIIVKPGEKIPLDGKVIEGESMVDTSALTGESVLKEVYKGADVLSGFINKNGLLTIEVT
FT                   REFAESTVSKILGLIEEASSKKAPTEKFMTKFAKYYTPIVVFLALIIAVIPPLIIPAAT
FT                   FKEFIYRALIFLVISCPCALVLSIPLTFFAGIGAASKNGILVKGSNYLEALSNVETVVF
FT                   DKTGTLTKGVFKVTKIKSVNGMSRDALLEYAAYAESFSNHPIAESILKAYGKEVDRSKI
FT                   KKYEEISGNGVRANIEGKEVLVGNAKLMKMGNIDCVTGDSTGTIIHVAIDNKYCGYILI
FT                   SDEVKEDSPKAIESLRKMGIKRIVMLTGDNKAISDKIAASLRIDEVYSELFPNEKVGIL
FT                   EKLYANNKKGKLIFVGDGINDAPVLARADVGVAMGGIGSDVAIEAADVVLMTDEPSKLV
FT                   TAIKISKKTKLIVWENILLALGVKIVVLALGALGVPTMWEAVFADVGVALLAVLNALRV
FT                   LTGAV"
FT   gene            309687..310625
FT                   /locus_tag="Thebr_0287"
FT   CDS_pept        309687..310625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0287"
FT                   /product="cysteine synthase A"
FT                   /note="KEGG: tpd:Teth39_0279 cysteine synthase A; TIGRFAM:
FT                   cysteine synthase A; cysteine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78906"
FT                   /db_xref="GOA:E8UUG9"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUG9"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ADV78906.1"
FT                   /translation="MSEREDKIYEDITQLIGNTPMIRLNKIVPENAAEVIVKLESFNPG
FT                   GSVKDRIALNMIKRAEEEGRLKPGGTIVEATSGNTGIGLAMVSAVKGYKLILVMPDTMS
FT                   IERRNLLLSYGAELVLTPGAEGMKGAIKKAQEILELNPDYIILDQFKNSANPEIHELTT
FT                   AKEILKDTNGIVDAFVAGVGTGGTISGVGKVLKQYNKDIKIFAVEPEESPVLSGGKPGP
FT                   HKIQGIGAGFIPDTLNLDVIDEIIKVKERDAFEMSMKLAKQEGILCGISSGANVFAAIE
FT                   VANRIGKGKRVVTVLPDTGERYLSMHKFFEY"
FT   gene            310702..311856
FT                   /locus_tag="Thebr_0288"
FT   CDS_pept        310702..311856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0288"
FT                   /product="cysteine desulfurase NifS"
FT                   /note="KEGG: tpd:Teth39_0280 cysteine desulfurase; TIGRFAM:
FT                   cysteine desulfurase NifS; PFAM: aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78907"
FT                   /db_xref="GOA:E8UUH0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUH0"
FT                   /inference="protein motif:TFAM:TIGR03402"
FT                   /protein_id="ADV78907.1"
FT                   /translation="MSTIYLDNAATTPVDKRVLEAMLPYYSDVFGNPSSLHSHGQEAKK
FT                   AIEEAREKVAKALGADSEEIYFTSGGSESDNWALKGVAYALKEKGNHIITTEIEHHAVL
FT                   HTCRYLEKEGFKVTYLPVDEYGLVKPEDLKKAITDKTILVSIMFANNEIGTIEPIEELV
FT                   KIAHEKNIYFHTDAVQAVGNVPIDVKKLDVDLLSLSAHKIYGPKGVGALYIKKGVKIHS
FT                   LIQGGTQEKNRRAGTENVPGIVGLGEAIELITKNLDSHINKLTFLRDKLINGILEKIPY
FT                   TRLNGHPTKRLPGNVNVSFEFIDGESLILNLDMAGICASSGSACTSGSLEPSHVLLAIG
FT                   LSKELARGSLRLTIGKDNTEEDIDKVLEALPQIVKRLRSISQIV"
FT   gene            311853..312983
FT                   /locus_tag="Thebr_0289"
FT   CDS_pept        311853..312983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0289"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   KEGG: tpd:Teth39_0281 tRNA-specific 2-thiouridylase MnmA"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78908"
FT                   /db_xref="GOA:E8UUH1"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUH1"
FT                   /inference="protein motif:TFAM:TIGR00420"
FT                   /protein_id="ADV78908.1"
FT                   /translation="MRESTRRLENFFMKKNNRVVVGMSGGVDSSVSAYLLKEQGFDVIG
FT                   VTMQIWQDKDEEAVRVEGGCCSLSAVNDARRVANKIGIKYYVMNFKDVFKEKVIDYFVD
FT                   EYLKGRTPNPCIACNKYIKFEELLKRAWMIDAYYVATGHYAIKEYDEERGRYLLKKSVD
FT                   TSKDQTYVLYNLTQTQLEHILFPLGKYKKDEVRELAKNLGLPVASKPDSQEICFVTDND
FT                   YGKFIRENAKEEIKPGEFRDTRGRFLGYHKGIIHYTIGQRKGLGISVGKPLYVVDIDAE
FT                   NNVVVLGYGDEVFGDELISYNNNFISIDKLEREMRVKAKIRYNAKEQDAVIRPLEDGKV
FT                   FVKFDNPQRAITPGQSVVFYEGDIVVGGGTIERKVR"
FT   gene            313054..315447
FT                   /locus_tag="Thebr_0290"
FT   CDS_pept        313054..315447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0290"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="KEGG: tpd:Teth39_0282 copper-translocating P-type
FT                   ATPase; TIGRFAM: copper-translocating P-type ATPase; copper
FT                   ion binding protein; heavy metal translocating P-type
FT                   ATPase; ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC; PFAM: E1-E2 ATPase-associated domain protein;
FT                   Heavy metal transport/detoxification protein; Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78909"
FT                   /db_xref="GOA:E8UUH2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUH2"
FT                   /inference="protein motif:TFAM:TIGR01511"
FT                   /protein_id="ADV78909.1"
FT                   /translation="MAEKANLKITGMSCAACATKIEKGLKSLDGVLDANVNLAIEKATV
FT                   IYDPDKINICDMEKKIEDIGYGVIKDKVELALMGMSCASCAAKIEKTLKNLPGVSNASV
FT                   NFATETATVEYDSNEIDTEKMIKAIKDIGYDAKEKTGVGIDTEKEIKEREINTLRKLVI
FT                   YSAILTVPLVLSMFLVMFKVPGGILENPWLQVFLSSPVQFIVGLRYYKGAWNNLKNMTA
FT                   NMDTLVAMGTSAAYFYSLYNVFTKPSHEIHNYLYFEASAVIITLVTLGKLLEATAKGKT
FT                   SEAIKNLMGLQAKTARVIRDGQELDIPIEEVKVGDIVVVRPGEKIPVDGKIVEGSSTID
FT                   ESMITGESIPVEKGVGDEVIGATINKTGTFKFEATKVGKDTVLSQIIKMVEDAQGSKAP
FT                   IQQIADKISGIFVPTVMGIAATTFLIWYFGYGDFNAGIINAVSVLVIACPCALGLAVPT
FT                   SVMVGTGKGAENGILIKGGEHLQRAGKITTIVLDKTGTITKGEPEVTDIEAFGNFTEEE
FT                   ILKIAGIAEKNSEHPLGQAIVNKAKEKFKILEVPEKFEAIPGYGICITINEKEFYIGNR
FT                   RLMDRQNIDITPIEDKLVNLEIQGKTSMILASKDCVYGIIAVADTVKSDSAKAIKELQA
FT                   MGIEVYMITGDNKRTAEAIAKQVGIKNVLAEVLPEDKAEEVAKLQKMGKVVAMVGDGIN
FT                   DAPALATADVGIAIGTGTDVAIETSDITLISGNLMGIVTAIKLSKATMRNIYQNLFWAF
FT                   IYNTIGIPFAAMGFLTPAIAGGAMAFSSVSVVLNALRLRRFREG"
FT   gene            complement(315531..315808)
FT                   /pseudo
FT                   /locus_tag="Thebr_0291"
FT   gene            complement(315798..316433)
FT                   /locus_tag="Thebr_0292"
FT   CDS_pept        complement(315798..316433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0292"
FT                   /product="EAL domain protein"
FT                   /note="KEGG: tpd:Teth39_0283 diguanylate phosphodiesterase;
FT                   PFAM: EAL domain protein; SMART: EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78910"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUH3"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADV78910.1"
FT                   /translation="MLQILLLSRYHDRVHLSGVCLIKEFGIFIIEDIFKQIKDWRNKGI
FT                   ELKVNINVSPLQLRDDEFFFKFDELISKYNIPSNLIGIEFTETQILDIKEQRVNKIDEF
FT                   LRRGIKISLDDFGVGYSSLINMIEFPISTIKMDKSLIDRIDENKVKTLIKGILYISKEM
FT                   NYEVVAEGVETEEQLSMLKEWGCDKIQGYYISRPKTSKEIELMFNYAY"
FT   gene            316530..317240
FT                   /locus_tag="Thebr_0293"
FT   CDS_pept        316530..317240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0293"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="KEGG: tpd:Teth39_0284 cell wall hydrolase/autolysin;
FT                   PFAM: cell wall hydrolase/autolysin; SMART: cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78911"
FT                   /db_xref="GOA:E8UUH4"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUH4"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ADV78911.1"
FT                   /translation="MIMIEEFTKFILMVVSEVLIAIDPGHGGKDPGAVVENYKEKDLNL
FT                   DIALKLREILLDKNISVIMTRDKDETVDLQQRCDIANKNKVDYFISIHCNSFKDPTANG
FT                   TETYAYPGSIVGQNLAQYVQNEIVEMLKTANRGVKYATFYVLKHTVMPAILVETAFMSN
FT                   PQNLDLLLHRPDIFAQAISNGIIKFLESINYQQTDDIKKLRRKGIINEHYDPKSFVTWG
FT                   EFASVIIKILGGTK"
FT   gene            317237..317575
FT                   /locus_tag="Thebr_0294"
FT   CDS_pept        317237..317575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0294"
FT                   /product="phage holin, LL-H family"
FT                   /note="KEGG: tpd:Teth39_0285 phage holin; TIGRFAM: phage
FT                   holin, LL-H family; PFAM: holin LL-H"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78912"
FT                   /db_xref="GOA:E8UUH5"
FT                   /db_xref="InterPro:IPR010026"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUH5"
FT                   /inference="protein motif:TFAM:TIGR01673"
FT                   /protein_id="ADV78912.1"
FT                   /translation="MRDLIMTILTAGVQLGIMVVLGYLIDYLNTKIGMEKMKRYYEIAK
FT                   TFVQAVEQQIGPGKGPDKKTEVFNLLKKVIGNKLTDEEIDKLIEAAVFEMNYILKLKGL
FT                   EKQAEVNK"
FT   gene            317825..319726
FT                   /locus_tag="Thebr_0295"
FT   CDS_pept        317825..319726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78913"
FT                   /db_xref="InterPro:IPR032583"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUH6"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0286"
FT                   /protein_id="ADV78913.1"
FT                   /translation="MDFSLITNKETMEIISKMSLPEEVEEILKKCPKITIPESRQHLLE
FT                   ISVGGNNDFFEVFYDVPGKGKVLEATVARCKNGLAVNYPEPYMRRREPDCLVVADNGET
FT                   DKPRFMERYKYDFEELRQKTFEWLKDQNLIVMPFMAGGEEYGYPSLLLAPENAGFFATA
FT                   LADIQGFIPKKEIPEGFTPKAIVYSAPPFRHTHFNGKQVVVHNRLENLYELFSYNLYPG
FT                   PSAKKGIYGVLLTMGEKEGWITAHASAVRIITPYDNILTIMHEGASGGGKSEMLEQIHR
FT                   EPDGSIKVGRNLVTGDEIYVELKEACELQPVTDDMALCHPKLQQGKKLVIKDAEKGWFI
FT                   RVDHMNEYGTDPHFEKLCIYPKEPLIFLNIDGVPKSTCLIWEHIMDAPGKPCPNPRVVM
FT                   PKRFMPNVVDEPVEVDVRSFGVRTPPSSKEKPSYGIIGMLHLLPPALAWLWRLVAPRGH
FT                   ANPSIVETEGLQSEGVGSYWPFATGKRVTHANLLLQQIINTPGTRYILVPNQHIGVWKV
FT                   GFMPEWIAREYLARRGSVRFRPDQITPARSSLLGYALNTLKINGSFIPRELLQVNKQPE
FT                   VGDEGYDKGAEMLNEFFKRELKQFLVPELDPLGRKIIETCLENGTLEDYIKLLGDYR"
FT   gene            complement(320024..321211)
FT                   /locus_tag="Thebr_0296"
FT   CDS_pept        complement(320024..321211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0296"
FT                   /product="pyridoxal phosphate-dependent acyltransferase"
FT                   /EC_number="2.3.1.29"
FT                   /note="TIGRFAM: pyridoxal phosphate-dependent
FT                   acyltransferase ; 8-amino-7-oxononanoate synthase; KEGG:
FT                   tpd:Teth39_0287 pyridoxal phosphate-dependent
FT                   acyltransferase, putative; PFAM: aminotransferase class I
FT                   and II"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78914"
FT                   /db_xref="GOA:E8UUH7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010962"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUH7"
FT                   /inference="protein motif:TFAM:TIGR01825"
FT                   /protein_id="ADV78914.1"
FT                   /translation="MSSIHDLDFIKEKLEELKKAGVYRKLTVLESPSGPRSIIDGKEVI
FT                   NLSSNNYLGLANHPRLKKAAIEAIEKWGVGAGAVRTIIGNMTIHEELERKLAEFKREEA
FT                   VLTFQSGFTANMGVIQAVVDKGDVIISDELNHASIIDGCRLSRADVVIYKHSDMEDLER
FT                   VLKEVKDKYRVKMIITDGVFSMDGDIAKLPEIVKLAEKYSAITYVDDAHASGVLGESGR
FT                   GSADHFNLHGRIDIQIGTLSKAIGVVGGYVAGKRELIEWLNHRGRPFLFSTALPPAAVA
FT                   ASIEAINILSESDALTRKLWDNAKYFKEKLKSLGFDTGKSETPITPVIIGEETKALEFS
FT                   RKLFEEGVFAQGIVYPTVPKNKARVRTIVTAAHTKEDLDAALKAFEKVGKQLNII"
FT   gene            complement(321231..322277)
FT                   /locus_tag="Thebr_0297"
FT   CDS_pept        complement(321231..322277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0297"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /note="KEGG: tpd:Teth39_0288 L-threonine 3-dehydrogenase;
FT                   TIGRFAM: L-threonine 3-dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78915"
FT                   /db_xref="GOA:E8UUH8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUH8"
FT                   /inference="protein motif:TFAM:TIGR00692"
FT                   /protein_id="ADV78915.1"
FT                   /translation="MVEGYMTAVVKQHTTEGADIIKKEIPIIGPDEVLIKVKATSICGT
FT                   DVHIYVWNEWAKSRIKPPKTMGHEFVGEVVEIGKNVTSVKVGDLVSAETHIVCGKCKAC
FT                   RTGNAHICENTLILGVDTDGAFAEYIKVPESNVWLNDKDIPLELLSIQEPLGNAVHTVF
FT                   SGEVVGKTVAVVGCGPIGMMAIPLLKTTGASAVFAIEPVEYRRELAHKLGATRVINPLK
FT                   EDVVSIIKSETEGYGADVVLDFSGSSIAIRQGLKYIAKGGRMSILGLPDNEVPIDITND
FT                   VIFKGITIHGITGRRMYDTWYQVKGLLRSGLKDALKPIITHTFPLTEYQKGMELMIKGQ
FT                   CGKVVLYP"
FT   gene            322424..326017
FT                   /locus_tag="Thebr_0298"
FT   CDS_pept        322424..326017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0298"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="KEGG: tpd:Teth39_0289 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain-containing protein; TIGRFAM: pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; PFAM: pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein;
FT                   Pyruvate/ketoisovalerate oxidoreductase, catalytic domain;
FT                   Pyruvate-flavodoxin oxidoreductase, EKR domain; thiamine
FT                   pyrophosphate TPP-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78916"
FT                   /db_xref="GOA:E8UUH9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUH9"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ADV78916.1"
FT                   /translation="MYDNPFLSNNISEYMNTNLKLVRRKLMKKSMKTMDGNTAAAYASY
FT                   AFTEVAAIYPITPSSPMAENVDEWAAHGKKNIFGQPVKVVEMQSEAGAAGAVHGSLTAG
FT                   ALTTTYTASQGLLLMIPNMYKIAGELLPGVFHVSARAISAHALSIFGDHQDVMAVRQTG
FT                   FALLSSSNVQEAMDMGFIAHLCAIKSRVPFLHFFDGFRTSHEMQKIEVVEYEDIAKLLD
FT                   LKAVKEFRDRALNPEHPVVRGTAQNPDIYFQGREVANKFYEKVPEIVEDYMKKFKELTG
FT                   REYHPFDYYGAKDAEYIIVAMGSVCDTIEETIDYLMKKGEKVGLIKVHLYRPFSEKHFF
FT                   NVLPGTVKKIAVLDRTKEPGSIGEPLYLDLVKAFYHKDKKPVIVGGRYGLGSKDTTPSQ
FT                   IIAVYDNLKKDYPKDRFTIGIVDDVTYTSLEEGEFVETTPEGTVSCKFWGLGSDGTVGA
FT                   NKSAIKIIGDNTDLYVQAYFQYDSKKSGGTTISHLRFGKKPIKSSYLVNHADYIACHNK
FT                   SFIYNYDVLKGLKKGGTFVLNCPWSKEELDDKLPASMKRYIAENSINFYIIDAVSIAQE
FT                   VGLGGRINMIMQTVFFKLINIIPFEEAVKYLKDSIQKAYGKKGQDIVEMNLRAVDKSIE
FT                   ALVKVEVPEEWKNAKEGQKIIKPEPDFVKNIQRPIERNEGDLLPVSAFVGMEDGTFPTG
FT                   TTAYEKRGIAVLIPEWQIDNCIQCNQCSFVCPHAVIRPFLLTEKEVKKAPPTFNVKKAI
FT                   GRGLEGLWYRIQVSPLDCTGCGNCADVCPAPTKALIMKPAEEQIEKEARNWEYAVTLDV
FT                   KDNLVDKTTLKGSQFAKPLFEFSGACPGCGETPYIKLLTQLFGDRMMIANATGCSSIYG
FT                   ASAPSIPYTTNKEGKGPAWANSLFEDNAEFGYGMFLANKQIRERLRDLMKEAINMTIDD
FT                   ELKAAFQEWIDGMEDGDKSKLASQKILNIINKGSYTNNEIIKEILDKKDFLVKKSQWII
FT                   GGDGWAYDIGFGGLDHVIASGEDVNILVLDTEVYSNTGGQSSKSTPLGAIAKFAAAGKR
FT                   TSKKDLGLMAMSYGYVYVAQIAMGANMNQMIKAFVEAEKYKGPSLIIAYAPCINHGIKS
FT                   GMGTSIMEEKKAVESGYWHLYRFNPELKKEGKNPFVLDFKEPTKSFREFIEGEIRYSSL
FT                   KNVFPDIAEKLYQMAEETAKERFKRYKKLAE"
FT   gene            complement(326044..326205)
FT                   /locus_tag="Thebr_0299"
FT   CDS_pept        complement(326044..326205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78917"
FT                   /db_xref="InterPro:IPR024209"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUI0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0290"
FT                   /protein_id="ADV78917.1"
FT                   /translation="MTKKPKKPHKMPIENHKTASWANIQNVKEESNVPIPSENEVINAK
FT                   EWVEENKK"
FT   gene            326362..326769
FT                   /locus_tag="Thebr_0300"
FT   CDS_pept        326362..326769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0300"
FT                   /product="protein of unknown function DUF1284"
FT                   /note="PFAM: protein of unknown function DUF1284; KEGG:
FT                   tpd:Teth39_0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78918"
FT                   /db_xref="InterPro:IPR009702"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUI1"
FT                   /inference="protein motif:PFAM:PF06935"
FT                   /protein_id="ADV78918.1"
FT                   /translation="MEIRGHHFLCMLGFRGLGYDEKFVKNMDEIIRKLNNEQDMLIKVV
FT                   DNVDNICAMCPNNVDGECKIENYPGSVREKDRAILEVLGIEVGEILSYKKIINRIREKM
FT                   TEEKMRDICRDCEWFSLGYCLEGLKKLKGGV"
FT   gene            complement(326776..327636)
FT                   /locus_tag="Thebr_0301"
FT   CDS_pept        complement(326776..327636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78919"
FT                   /db_xref="GOA:E8UUI2"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUI2"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0292"
FT                   /protein_id="ADV78919.1"
FT                   /translation="MITIIKYTFKEMLKKRAFLLVSLLSLLYLSIYAFGLSKIFERPND
FT                   SIYDIIFQSQILSAGLFFANFIVAFLVVLTSVNAISGEIESGTIYAVLSKPIKRYELVL
FT                   GKFIGLGTMIVIYSSIMFLSVVGLNIFMGAKITFEASNILRGLFFFDLGPIVFLALIIA
FT                   SSSIFSTVNTGIIAIMAYGIALVGGVLEQIGTAMQQSQVGTFGLKSGESLINAGIITSL
FT                   ILPTDVIYRKMTAELLTQSSGISFMTQGLFGGMSQPSIYMFIYIFFYVVFLLYYGAKRF
FT                   SQRDL"
FT   sig_peptide     complement(327529..327636)
FT                   /locus_tag="Thebr_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.658 at
FT                   residue 36"
FT   gene            complement(327633..328535)
FT                   /locus_tag="Thebr_0302"
FT   CDS_pept        complement(327633..328535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0302"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_0293 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78920"
FT                   /db_xref="GOA:E8UUI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUI3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADV78920.1"
FT                   /translation="MVLETRNLTKQFNGKGGFKEVTLSVEKGQVFGFLGPNGAGKSTFV
FT                   KTMVGLLHPASGFAWILGKPIGTPKSREKIGFLPENFRYHDWMTGRELLTFHAELHKIK
FT                   NPNKKIDSLFELVKLKGHENKKIKNYSKGMQQRIGLAIALLNDPEIVFLDEPTSALDPV
FT                   GRIDVREIIKELKSQGKTVFLNSHLLGEVEMVCDEVAIINHGRIIAEGKLEELLKEHTH
FT                   VEMIVSDYTSELIEKISRLSKEFQFEEGKLSFKVEDREKIPVIAKMVIEAGAKLYQLNT
FT                   QTSSLEDLFINLIGKDEVS"
FT   gene            complement(328540..329700)
FT                   /locus_tag="Thebr_0303"
FT   CDS_pept        complement(328540..329700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0303"
FT                   /product="Protein of unknown function DUF2275,
FT                   transmembrane"
FT                   /note="PFAM: Protein of unknown function DUF2275,
FT                   transmembrane; KEGG: tpd:Teth39_0294 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78921"
FT                   /db_xref="GOA:E8UUI4"
FT                   /db_xref="InterPro:IPR018734"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUI4"
FT                   /inference="protein motif:PFAM:PF10039"
FT                   /protein_id="ADV78921.1"
FT                   /translation="MCYDEGTLQAYIDNELDEITAKNVEEHLKTCDVCREKLEELKSIN
FT                   EFTSKALETTNIDLNEAWASFNEKLSENNKKGGIFAMFTKYKKAIAAAIVIAFIAASVF
FT                   FPPLKNVEAKLLNLLRLNKMQVITITPDDMRQIQNEFYRRDIKNIDLKEYGEILKNGGP
FT                   EGYDVSPNEIDKLKSMVDYEIKLPTDSNFEIEHIYVGKDQGFEFVLNIDKINELIKTFG
FT                   GTHLFPSELNKKPVILNIGKTVNISMKDKNASENYRGIHISINNAPEVIVPEGVDVDKV
FT                   IDALANLPFLPDHLKKQIADVNNWKETLPIPITEAQSVQEINIRGNKAFLITSKYSPDT
FT                   VTLAWNENGVMYALSMFGTSSSPEKTDPQIRDVNINTLIQIANSMR"
FT   gene            complement(329703..330204)
FT                   /pseudo
FT                   /locus_tag="Thebr_0304"
FT   gene            330402..331343
FT                   /locus_tag="Thebr_0305"
FT   CDS_pept        330402..331343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0305"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: tpd:Teth39_0296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78922"
FT                   /db_xref="GOA:E8UUI5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUI5"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADV78922.1"
FT                   /translation="MERIKSYYPYLAGIGMASIFGFSFMFTSMGLDVASPMELIAYRFL
FT                   LAAFMITLLWVFGIIKLNYRGKNLWPLFLLSLSEPVVYFIFETYGVKYTSSSLSGLMIA
FT                   LIPVAVTALAAVFLKERPSLYQLFFILLSVTGVAFIIFMTGVESRNTSIIGFVYLLGAV
FT                   LSAAFYSILARKSSLEFSPIEITFVMMWFAAISFNLLNLIDRLAKGYPISDYFRDLTDY
FT                   RVLIPVLYLGVLSSVVAYFLNNYALSKLPASQASVFANLTTVISVIAGITIRREAFYWY
FT                   HIIGAIMILIGVWGTNYFGKVSQPIISSEETH"
FT   sig_peptide     330402..330494
FT                   /locus_tag="Thebr_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.561 at
FT                   residue 31"
FT   gene            331610..331900
FT                   /pseudo
FT                   /locus_tag="Thebr_0306"
FT   gene            331969..332043
FT                   /locus_tag="Thebr_R0007"
FT                   /note="tRNA-Glu1"
FT   tRNA            331969..332043
FT                   /locus_tag="Thebr_R0007"
FT                   /product="tRNA-Glu"
FT   gene            332188..334533
FT                   /locus_tag="Thebr_0307"
FT   CDS_pept        332188..334533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0307"
FT                   /product="stage II sporulation protein E"
FT                   /EC_number="3.1.3.16"
FT                   /note="SMART: protein phosphatase 2C domain protein;
FT                   TIGRFAM: stage II sporulation protein E; KEGG:
FT                   tpd:Teth39_0298 stage II sporulation protein E, protein
FT                   serine/threonine phosphatase; PFAM: Stage II sporulation
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78923"
FT                   /db_xref="GOA:E8UUI6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUI6"
FT                   /inference="protein motif:TFAM:TIGR02865"
FT                   /protein_id="ADV78923.1"
FT                   /translation="MQNINILPYKRVIKTPFTENTQKNLYKNIQQIILLSIISFFIGRA
FT                   VIFNSLLPFGIAFFATLLMYKKRYLLTGIGVWLGILTLPNVNSFKYLLVLILIFLLEGL
FT                   LKVKPQNIIKTSFITFISLFSTGLIFSYIYGFLLFDIIMSLYESVTAMLMVFIFNHAVS
FT                   FILNVNRKIVSNEELISLSIFIVLFILGMNHLNVWKFTLNGILGIFIILLASYIGGVGV
FT                   GASIGTTMGLIGSLSFFQMPVSIGLFGFAGLLAGSLKKLHRIGVIIGFLTAIFIITFYV
FT                   TSSVDMLVNPYDIVLASLMFAALPKKYIVKAEEIVKGNKNLNNRNYNEKLKEVVTDRLK
FT                   EYSQVFEELSKSFKQVNEKVLDHKDISYLFEEIANKTCTQCVMYKTCWDKEFYNTYKSM
FT                   FELIEHLERNSSIEDNKLYRKCIRFSELISTTKYYLGIYKISMQWRERLKDAKGLIATQ
FT                   LKGVADAISNMASDISMNVTFKDELEQMMMIELDKKGIPVEDVLIYDTGDGNVNVKIYK
FT                   KVCFAKECDKKIAPIVSEIMGERYERKSRLCSIDHNGRCVLTLTKAESLQVLTGISRVS
FT                   KSKNKISGDTYSFMDLEDGKYMAALSDGMGIGYKAAAESSTTISLLEKFIEAGFDKYLV
FT                   IQTLNSILALRSAEEMFSTVDIMFLDKFTGETEFIKIGSCATFIKRGNEVEIIESSSLP
FT                   IGILEDIEADIHERKLKDGDFVILVTDGVLECFEKDKEVEFSRLISEINTRNPQDMAEV
FT                   LMKKCLELCNNTPKDDMTILVSKVWKKI"
FT   gene            334695..336071
FT                   /locus_tag="Thebr_0308"
FT   CDS_pept        334695..336071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0308"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: tpd:Teth39_0299 tRNA(Ile)-lysidine synthetase;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   domain protein; Protein of unkown function DUF1946 PP-loop
FT                   ATpase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78924"
FT                   /db_xref="GOA:E8UUI7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUI7"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADV78924.1"
FT                   /translation="MIDKVVSTIKRYKMIETNDKIVMGVSGGPDSLCMLDILYNLKDLF
FT                   NLKLYIVHVNHMIRGEAAKRDAQFVEDMCRKLKLPFFLFEKDVKKIAKEMGYSEEEAGR
FT                   YVRYQAFEEVLKEVKGNKIAVAHNKNDVVETVFLNLIRGSGMAGLIGIKPVNGNIIRPL
FT                   IEIEREEIEKYLKEKDLKPAIDFTNYEDLYKRNKVRLKLIPFINETFEVDIIENIYRMA
FT                   KIILEENDYLEKECEKIFNEVCYFNQEEIFADIKKLKTQHPAIQRRLVRLMYQKLKGDI
FT                   YGLEYIHVEDVLSLLDKPTSSKIDLPFEIEALKSYNNLIMRKVKEKEVKTFWAKLNIPG
FT                   ITKICGIGQFKTAVLAIDEVKKLNIGKYTKFFDYDKIQGDVIVRNRQAGDIFSPLNLGG
FT                   SKKLKEFFIDEKIPREIRDSIPLLAIDNEIVWVVGYRMSDKFKVDENTKKVLVIEYTKG
FT                   "
FT   gene            336097..336642
FT                   /locus_tag="Thebr_0309"
FT   CDS_pept        336097..336642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0309"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: tpd:Teth39_0300 hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78925"
FT                   /db_xref="GOA:E8UUI8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUI8"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADV78925.1"
FT                   /translation="MSSPTQDIQEILITEEQLKEKVKELGQIITKDYQGKDLVLLGVLK
FT                   GAIMFMADLSRAIDLPLSIDFMAVSSYGSSTQSSGIVKIIKDHDINIEGKDVLIVEDII
FT                   DSGLTLSYLRKTLLERKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDFD
FT                   EKYRNLPFIGVLKPELYK"
FT   gene            336714..338549
FT                   /locus_tag="Thebr_0310"
FT   CDS_pept        336714..338549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0310"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: tpd:Teth39_0301 ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78926"
FT                   /db_xref="GOA:E8UUI9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUI9"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADV78926.1"
FT                   /translation="MNDNNKIIRSMVLYLLIFIAIYAMVQLYSQSTEPITDIDYGQLIK
FT                   YIDANQVKSITLVGNDVKGVLKNGTEFKSRVPDVTNFMSFVNPYILQGKLDFKSEPQVG
FT                   PPWWVQMLPSLFLIVIFIIFWYIFMQQAQGGGGSKVMSFGKSRARMITDKDKRVTFNDV
FT                   AGADEEKEELQEIVEFLKYPKKFLELGARIPKGVLLVGPPGTGKTLLAKAVAGEAGVPF
FT                   FSISGSDFVEMFVGVGAARVRDLFDQAKKNAPCIVFIDEIDAVGRQRGAGLGGGHDERE
FT                   QTLNQLLVEMDGFSVNEGIIVIAATNRPDILDPALLRPGRFDRHITVGIPDIKGREEIL
FT                   KIHSRNKPLAPDVSLQVLARRTPGFTGADLENLMNEAALLAARRGLKQITMAELEEAIT
FT                   RVIAGPEKRSRIMSEKDKKLVAYHEAGHAVVAKLLPNTPPVHEVTIIPRGRAGGYTMLL
FT                   PEEDKYYMSKSEMMDEIVHLLGGRVAESLVLNDISTGAQNDIERATNIARKMVTEYGMS
FT                   ERLGPMTFGTKSEEVFLGRDLGRTRNYSEEVAAEIDREIKRIIEEAYKRAESLLKENID
FT                   KLHRVAKALIEKEKLNGEEFEKVFNGEDIEGVQFA"
FT   gene            338723..340105
FT                   /locus_tag="Thebr_0311"
FT   CDS_pept        338723..340105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0311"
FT                   /product="PAS sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: tpd:Teth39_0302 PAS/PAC sensor signal
FT                   transduction histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78927"
FT                   /db_xref="GOA:E8UUJ0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUJ0"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADV78927.1"
FT                   /translation="MKVNKAFATDKNSLQWICNLLDNSHDFFVLKDLNGKVVHVNKRLL
FT                   ETLGYTVDELDNYDYFFYHILKYKEVGPYEDGLIIELTAKYNIRMSFSIKFSPIANSVG
FT                   DKIAFLGFVKLRSYCKEKPEDYFNFFKHPNDVMDMTEEGVVIVDNRFNVVYVNNRTCEL
FT                   FGIKYTKFINAKFMDIIKKYKPDASENNLINGEKIVIPLKGSFDEIVLLLKYGKLNSGH
FT                   WKTIIVKNITEDLKYQKLIEQTEKYTIAGEFAATTIHEIKNSLTSIKGFIQLLQAKHKE
FT                   SSTYYETILDEVDRILALIKNYLGIVRSNEEGETEIDINGVINQYLLLFEAEAVRKKIK
FT                   IEKRFGDVPPIKMDKNHLKQLILNVVQNSLHAIGENGKIILDTRYYTLKKRVVIRIVDN
FT                   GGGIEKKYLKKVIEPLFTTKREGTGLGLAICKSIVELYNGDIKIFSKKGKGTLVKIILG
FT                   ER"
FT   gene            340131..341798
FT                   /locus_tag="Thebr_0312"
FT   CDS_pept        340131..341798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0312"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="KEGG: tpd:Teth39_0303 formate--tetrahydrofolate
FT                   ligase; PFAM: formate-tetrahydrofolate ligase FTHFS"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78928"
FT                   /db_xref="GOA:E8UUJ1"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUJ1"
FT                   /inference="protein motif:PRIAM:6.3.4.3"
FT                   /protein_id="ADV78928.1"
FT                   /translation="MKSDIEIAQEAKMLHIREVAKKLDIEEDYLEYYGKYKAKISPALS
FT                   EKIKDRKDGKLILVTAITPTPAGEGKTTLTVGLGQALAKIGKKAMIALREPSLGPCMGI
FT                   KGGAAGGGYSQVVPMEDINLHFTGDLHAITAAHNLLAAMIDNHIHHGNELNIDIRAITW
FT                   KRAMDMNDRALREIIVGLGGKANGFPRQDGFIITVASEVMAILCLAQDLMDLKRRIGDI
FT                   IVAYDKDGNPVTARDLKADGAMTVLLKDAIKPNLVQTIENVPAFVHGGPFANIAHGCNS
FT                   LIATKYGLKLADYLVTEAGFGADLGAEKFFDIKSRFGGLTPNAAVIVATVKALKMHGGV
FT                   KKEHLQKEDVEAVRRGIENLEKQVENVRKFGVPVVVALNRFVFDTEREIEEVRKACEEM
FT                   GVDMAVAEVWEKGGEGGIELAEKVVKACETPSNFHVLYDETLPIKDKLHIIATEIYGAD
FT                   GVEYTASALKDIANLERLGFDKMPIVVAKTQYSLSDDPKLLGRPRGFKITVRELRVSRG
FT                   AGFIVALTGDIMTMPGLPKHPAAENIDIDENGRITGLF"
FT   gene            341809..342174
FT                   /locus_tag="Thebr_0313"
FT   CDS_pept        341809..342174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78929"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUJ2"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0304"
FT                   /protein_id="ADV78929.1"
FT                   /translation="MKKEILDIQNLSQAKKELSQIKAEEISIDIMAPKAVFRVVKLFDV
FT                   HPAAANIIKQEMLAIGGEAAVARGCVNMSVEKSDVIIMGTLRQYQRLLAKLKMQKGYFG
FT                   LNEVVEELKSVIEEMSR"
FT   gene            342295..342390
FT                   /locus_tag="Thebr_0314"
FT   CDS_pept        342295..342390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78930"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADV78930.1"
FT                   /translation="MVDKEELESTFGTLSKGLNLLCIWEVCGILF"
FT   gene            342452..344002
FT                   /locus_tag="Thebr_0315"
FT   CDS_pept        342452..344002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0315"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: tpd:Teth39_0305
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78931"
FT                   /db_xref="GOA:E8UUJ4"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUJ4"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ADV78931.1"
FT                   /translation="MSVHDMIEELKRRREKVLEGGGAKRIAAQHEKGKLTARERIHKLL
FT                   DKDSFVEIDPFVEHRCYDFGMEKQKYPGEGVVTGYGTIDGRLVYVYAQDFTVLGGSLGE
FT                   YHAKKITKVMDMAMKMGAPIIGLNDSGGARIQEGVDALSGYGNIFYRNTLASGVIPQIS
FT                   VIMGPSAGGAVYSPALTDFIFMVDKTSQMFITGPQVIKAVTGEEVTPEELGGSITHNRL
FT                   SGVAHFRGPNDEEVLKMVRNLLSYLPSNNLEDPPQYETGDNPNRVSQRLMEIIPDNPNK
FT                   PYDMKELIREIVDNGEFLESQEMYAENIITAFARLNGKTIGIVANQPRVLAGVLDINAS
FT                   DKAARFIRFCDAFNIPILSIVDVPGFLPGTNQEYGGIIRHGAKMLYAYSEATVPKVTLI
FT                   VRKAYGGAYLAMCSKDLGADMVFAWPTAEIAVMGPEGAANIVFKNEINEAENPAEVRQQ
FT                   KINEYRDNFANPYRAAARGYVDDVILPSETRPRLISAFDMLSSKRESRPPKKHGNIPL"
FT   gene            344015..344272
FT                   /locus_tag="Thebr_0316"
FT   CDS_pept        344015..344272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0316"
FT                   /product="sodium pump decarboxylase gamma subunit"
FT                   /note="PFAM: sodium pump decarboxylase gamma subunit; KEGG:
FT                   tpd:Teth39_0306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78932"
FT                   /db_xref="GOA:E8UUJ5"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUJ5"
FT                   /inference="protein motif:PFAM:PF04277"
FT                   /protein_id="ADV78932.1"
FT                   /translation="MEGFLEFLKKIFNNKEEEKVKKEEKIDKNGENEEETELVAAITAA
FT                   VALYLQADVSSFYVKSIVRLPETAPVWAKVGRQEQMRTRL"
FT   gene            344290..344688
FT                   /locus_tag="Thebr_0317"
FT   CDS_pept        344290..344688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0317"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: tpd:Teth39_0307 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78933"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUJ6"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ADV78933.1"
FT                   /translation="MKKFKVTVNGKVYEVEVEEIKDKDEISNIIQTATVSQPKVTATQA
FT                   TFQPVSKAEAPSSADKGSKIISAPMPGTILDVKVKEGDRVKRGDVVVILEAMKMENEIM
FT                   APEEGVIASIHVSKGSSVNTGDVLVTMN"
FT   gene            344825..345352
FT                   /locus_tag="Thebr_0318"
FT   CDS_pept        344825..345352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0318"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: tpd:Teth39_0308 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78934"
FT                   /db_xref="GOA:E8UUJ7"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUJ7"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0308"
FT                   /protein_id="ADV78934.1"
FT                   /translation="MQIKATREGKAAKISLRQITVAGMLAAISIVLSTTILGYIPLGIA
FT                   NATTMHIPAIIGGVLEGPIVGAFIGLIFGLTSFIRQNTPLFADPVIAILPRIFIGVVAY
FT                   YSYKLTKNVGIAAAAGTLTNTIGVLGLAVLLKYLPLKVALFVALKNGIFEIIVAVILTT
FT                   MIVKSLKKVYDK"
FT   gene            345400..346167
FT                   /locus_tag="Thebr_0319"
FT   CDS_pept        345400..346167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0319"
FT                   /product="transcriptional activator, Baf family"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   KEGG: tpd:Teth39_0309 pantothenate kinase; PFAM: Bvg
FT                   accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78935"
FT                   /db_xref="GOA:E8UUJ8"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUJ8"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADV78935.1"
FT                   /translation="MLLVFDVGNTNIVMGIYKGKKLLHSFRISTEKSKTSDEYGMLINQ
FT                   LFEYNGLKLKDVDAVIISSVVPPIMHTLESMTIKYCNTKPLIVGPGIKTGINIKYDNPK
FT                   EVGADRIVNAVAAYEIYGGPVIVIDFGTATTFCAISKNCEYLGGIIAPGLAISADALFQ
FT                   RTAKLPKIELTKPSTVICKNTVSSMQSGIIYGHVGMVDYIVSRMKEEFAPNAYVVATGG
FT                   FARMIAEESKTINTVNDMLTLEGLRIIYERNAD"
FT   gene            complement(346174..347283)
FT                   /locus_tag="Thebr_0320"
FT   CDS_pept        complement(346174..347283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0320"
FT                   /product="spore germination protein"
FT                   /note="KEGG: tpd:Teth39_0310 spore germination protein;
FT                   TIGRFAM: spore germination protein; PFAM: Spore germination
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78936"
FT                   /db_xref="GOA:E8UUJ9"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUJ9"
FT                   /inference="protein motif:TFAM:TIGR00912"
FT                   /protein_id="ADV78936.1"
FT                   /translation="MFKETGQYERTSEKKISTKQMIFLLVTTVLSTADVFLPSFVALAA
FT                   KQDSWISVVISFVTSSIVFVFYYKLAMVFKEEMLFSYVDKITGKFIGKIIASLYLLFIL
FT                   HGISLVMRELIEIMVNAFMPHTPPMVFYVVLIISVMYTVSKGFLAIVKLNELLFPFGML
FT                   LLAFVITLALPKVKMANFLPILENGIKPPIIGSILITSYMLETVIILFIFPHISKKEKA
FT                   LKGGIISLGILALSMMLGVLAIGIFGAKTASNFQFTALEMVRNIRISDYIQRFDSLVMA
FT                   MWLMGIYLKIVIFTYLFAKGLAETIKTPDYRFILLPLATLLIPLAENVSENLDGLYTYI
FT                   QRCFPFEAFWFEVFFPIVLYIIAKIRKIK"
FT   gene            347380..348915
FT                   /locus_tag="Thebr_0321"
FT   CDS_pept        347380..348915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0321"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   tpd:Teth39_0311 GerA spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78937"
FT                   /db_xref="GOA:E8UUK0"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUK0"
FT                   /inference="protein motif:PFAM:PF03323"
FT                   /protein_id="ADV78937.1"
FT                   /translation="MPHKLPDPQYVKENYQYMTLSKKLEENIYIFQVLLKGNNDIVFRQ
FT                   ISIGDKKVKAFLVYVDGMVDKLLITRNILEPIMIETRKLNKIIYTNDQLFNYINEYFIT
FT                   TSEVNVKDKIGDIIDDLLSGETILLIDGVEKALIISTKGWEGRNITESTTESYVRGPKE
FT                   SFVETLRINTSMLRRRIKHPDFVIENIKIGKYSKTDVSIAYVKSIADDTVVQEVKKRLK
FT                   KVQIDGVIDSGYLEEFIEDNPFSPFPQIAHSEKPDKVTAEILEGKVAILVDGSPFVLIV
FT                   PAVFVQFFQAAEDYYERYFLSSALRILRIAAMFIALLFPSIYIAETTFHQEMIPTQLAI
FT                   SIAAQREGVPFPALLEALFMEITFEILREAGIRLPMQVGQAVSIVGGLVVGQAAVQAGL
FT                   VSPAMVIVVAMTGIASFSIPAYNVAITFRLLRFIIMIAAGTLGFFGIIMVVMMILAHMA
FT                   SLESFGVPYLSPLTPSRTQELSDVLIRIPWWAKILRPRTVQRKNIMRQEDTRG"
FT   gene            348917..350101
FT                   /locus_tag="Thebr_0322"
FT   CDS_pept        348917..350101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0322"
FT                   /product="germination protein, Ger(x)C family"
FT                   /note="KEGG: tpd:Teth39_0312 spore germination B3 GerAC
FT                   family protein; TIGRFAM: germination protein, Ger(x)C
FT                   family; PFAM: spore germination B3 GerAC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78938"
FT                   /db_xref="GOA:E8UUK1"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUK1"
FT                   /inference="protein motif:TFAM:TIGR02887"
FT                   /protein_id="ADV78938.1"
FT                   /translation="MKRLVILILVGAILLTGCWDKREINQLAFVQGLGIEKGKDDMIHL
FT                   IVQILKPGLLATGGGGAGGTGGGSAVGKPYAVFQASGVDFAKAFSNLNDELPRSLFLQY
FT                   NEIIFLDEKFARSGIYKTLDFMTRNPEFRRTAYILVVTGGNLQELFDLPSNEQLERYPY
FT                   REVLGMIQNQQNTSSSYVCDLNEFIETLEIPKKAPITGRLEIVKKDGKAIGLRMVGSAV
FT                   FNNDKLVGFLEEQDTKAVMTLKNKLKRSTLTLDKGLKSEKAHISFVVTKAHTDIIPKVK
FT                   GKDISFDIKVNIETHMNEQESKYDLTEPKNLEKLQLLINDKIKQGIEHALFVLQKKYNA
FT                   DVVGFINILHQRNPKLWKEVEKDWDKIYPEVKFNVTVKSIVRRTGLTSKPIYPR"
FT   gene            350106..350330
FT                   /locus_tag="Thebr_0323"
FT   CDS_pept        350106..350330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78939"
FT                   /db_xref="GOA:E8UUK2"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUK2"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0313"
FT                   /protein_id="ADV78939.1"
FT                   /translation="MIKILVLTLIFVIISLVEVPGLVRQKKIKEVILFFVFLIVGYILN
FT                   LLYLLNIQITPTNKIIQSLLKPIEKFWGQ"
FT   gene            350446..350970
FT                   /locus_tag="Thebr_0324"
FT   CDS_pept        350446..350970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0324"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78940"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUK3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0314"
FT                   /protein_id="ADV78940.1"
FT                   /translation="MKFIKIGDKTINLEKLHGIIDKMIEMRQNGFSQQEVASRFKVDRS
FT                   FVSRLESLGEVRKGGNIAVVGFPIKNKEELEMLFREWGVNFTLLLSEKERLNLAENMSG
FT                   VELFNMVMDLIAKIQSHDVIIFLGSDKRSQLVEAIFDRDIITINIGHSPLTEDVYVDPQ
FT                   IVKEILNSLKG"
FT   gene            350975..351883
FT                   /locus_tag="Thebr_0325"
FT   CDS_pept        350975..351883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0325"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78941"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUK4"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0315"
FT                   /protein_id="ADV78941.1"
FT                   /translation="MKKVVSISIGSSTRNKTAEVEILGEKFVIERIGTDGDLKKAIELI
FT                   KELDGKVDAFGMGGIDLYLSAGKKRYVIKDALPLKNAAKITPIVDGSGLKNTLERKVIK
FT                   YIQEKGIVDLKDKKVLIVSAMDRFGMAQTFSEEGAKLIIGDLIFALGIPIPLHSLKLLY
FT                   GLAAILAPIIVKLPFEMLYPTGEKQLSIDSKKYERFYKEAEIIAGDYLFIKKYMPERLD
FT                   GKIIVTNTVTQEDVEMMKEKGVKMLITTTPNINGRSFGTNVMEGVLVAVAGKKQEEMTP
FT                   QDYDELLDKIGFEPRIEYLQK"
FT   gene            351897..352985
FT                   /locus_tag="Thebr_0326"
FT   CDS_pept        351897..352985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0326"
FT                   /product="Shikimate/quinate 5-dehydrogenase"
FT                   /note="PFAM: Shikimate/quinate 5-dehydrogenase; KEGG:
FT                   tpd:Teth39_0316 shikimate/quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78942"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR035015"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUK5"
FT                   /inference="protein motif:PFAM:PF01488"
FT                   /protein_id="ADV78942.1"
FT                   /translation="MHKFGFIIHPIEYEDVSRKFKIMEKFPKRVVEGFTRLLPPMKVSE
FT                   ITGVKSEYAETEGWFVAVPLTSEQMLKLPEGYVLNKIIKAVKIAENLGAEVVGLGAMTS
FT                   VVGDAGITIAKNSNIAVTTGNSYTVATAVEGAVKAAEMMGKDVRDSHVAVIGATGSIGK
FT                   VCAEILSRDAKYMTLVARNKEKLQNFRDYLLTKTGMSAHITSDIKEALEDADIIITVTS
FT                   AVDTVIKPEYLKPGAVVCDVARPRDVSKEVADKRDDVLVIEGGVVQVPGDVDFHFNFGF
FT                   PPKTSYACMAETMILAMEGRIENYSLGRDLTVEQVDEISKLAKKHGFKLAGFRSFEREV
FT                   TMEKIESVRKNAKKRLQEWKFA"
FT   gene            353150..353623
FT                   /locus_tag="Thebr_0327"
FT   CDS_pept        353150..353623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0327"
FT                   /product="transcription elongation factor GreA"
FT                   /note="KEGG: tpd:Teth39_0317 transcription elongation
FT                   factor GreA; TIGRFAM: transcription elongation factor GreA;
FT                   PFAM: transcription elongation factor GreA/GreB
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78943"
FT                   /db_xref="GOA:E8UUK6"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUK6"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ADV78943.1"
FT                   /translation="MSKPVILTYEGLKKLEEELEYLKTVKRAEVAEKIKQARAFGDLSE
FT                   NSEYDEAKNEQAFIEGRIATLEAMLKNAKVIDEEDIKLDQVSIGCTVKVYDESYNEEVE
FT                   YTIVGSAEADPMNNKISDESPIGKALLGKKVGDVVSVEVPAGIIKLKILEIRK"
FT   gene            353643..355142
FT                   /locus_tag="Thebr_0328"
FT   CDS_pept        353643..355142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0328"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="KEGG: tpd:Teth39_0318 lysyl-tRNA synthetase;
FT                   TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA synthetase class
FT                   II (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78944"
FT                   /db_xref="GOA:E8UUK7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUK7"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADV78944.1"
FT                   /translation="MSNSNDNIWNNTEELNELLRIRREKLNILRSMGIEPYGIDRFERT
FT                   NLSSDIKNDYENFEGKVVTLAGRIMSKRSHGKASFADIQDRDGRIQIYVKYDTVGEKNY
FT                   EIFKILDIGDIIGVTGEVFKSKTGEITIRVTDFKLLSKSLQILPEKWHGLKDPDLRYRQ
FT                   RYTDLIINPEVKEVFLKRTKIIKAIREFLDNRGFLEVETPILHTIAGGAAARPFITHHN
FT                   ALDIDMYLRIALELHLKRLIVGGLEKVYEMGRVFRNEGMDIRHNPEFTLLELYEAYTDY
FT                   YGMMELTEQLFAYVAQKVNGITKIVYQGTEIDLTPPWKRITMVDAIKEYVGVDFNEVKT
FT                   DEEAIEIAKKLNLETKEGMKKGEVIALVFDELVEQHLIQPTFVMDYPVEISPLAKRKHD
FT                   NPAFTSRFEAFIYGREVANAFSELNDPIDQKERFLEQLKQREAGDEEAHMMDEDFINAL
FT                   EVGMPPTGGLGIGVDRLVMFMTDAYSIRDVILFPTMKPKND"
FT   gene            355535..356101
FT                   /locus_tag="Thebr_0329"
FT   CDS_pept        355535..356101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0329"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="TIGRFAM: GTP cyclohydrolase I; KEGG: tpd:Teth39_0319
FT                   GTP cyclohydrolase I; PFAM: GTP cyclohydrolase I/Nitrile
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78945"
FT                   /db_xref="GOA:E8UUK8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUK8"
FT                   /inference="protein motif:TFAM:TIGR00063"
FT                   /protein_id="ADV78945.1"
FT                   /translation="MIDKEKIKKAVRDILEAIGEDPDREGLLETPDRVARMYEEIFAGL
FT                   HTDVKDVIKIFQEDEHQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKGRILGLSKL
FT                   ARIVDILAKRPQLQERLTSEIADTIMEAVNPLGVAVVIEAEHLCMTMRGIKKPGAKTVT
FT                   SALRGIFRTDEKSRAEVMSLINSKK"
FT   gene            356114..356926
FT                   /locus_tag="Thebr_0330"
FT   CDS_pept        356114..356926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0330"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   tpd:Teth39_0320 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78946"
FT                   /db_xref="GOA:E8UUK9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUK9"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADV78946.1"
FT                   /translation="MLFRCRDKSLEIGKKTYIMGILNMTPDSFSDGGKYNTLEKGIERA
FT                   LQMIEEGADIIDVGGESTRPGHTPVDEEEEMRRVIPVIEKLSKISNVIISVDTMKSNVA
FT                   LRALEAGAHIVNDVWGLQRDPKMAEVVAKYNAGVIMMHNSNVAEYEDVVQDIIKFLQKS
FT                   IEIGEKAGIDKSQMVVDPGIGFGKTLDHNLEVMNRLEELKVLGLPVLLGTSRKSMIGKV
FT                   LNLEVEDRLEGTAATVAVGIVKGVDIVRVHDVKQMLRVAKMTDAMVRR"
FT   gene            356923..357423
FT                   /locus_tag="Thebr_0331"
FT   CDS_pept        356923..357423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0331"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; KEGG: tpd:Teth39_0321
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78947"
FT                   /db_xref="GOA:E8UUL0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUL0"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADV78947.1"
FT                   /translation="MSEVYLSLGSNLGDREENLKRAVFELEHWEGIILKKLSPIYETKP
FT                   VGYLNQDMFLNIAVEVETNIGPYDLLKVVNEIEKKLKRERLIRWGPRTIDIDILLYDDI
FT                   ELKDEVLSIPHPRIWERAFVLIPLSDINPFIKKGDVYIKDLIAELPDKEGVKLYKENWY
FT                   NGV"
FT   gene            357427..357795
FT                   /locus_tag="Thebr_0332"
FT   CDS_pept        357427..357795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0332"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: tpd:Teth39_0322 putative
FT                   6-pyruvoyl tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78948"
FT                   /db_xref="GOA:E8UUL1"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUL1"
FT                   /inference="protein motif:PFAM:PF01242"
FT                   /protein_id="ADV78948.1"
FT                   /translation="MKVTKIFTFDSAHNLINYNGKCEELHGHTYKLEVTVEGKPDGEGM
FT                   VIDFVKLKEIVNEKVVKKLDHKYLNEVLGFNTTCENILLWIWKELEPVFKGDNYHLYKL
FT                   RLWETPTSFAEITEKDLV"
FT   gene            357806..358498
FT                   /locus_tag="Thebr_0333"
FT   CDS_pept        357806..358498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0333"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="KEGG: tpd:Teth39_0323 sugar fermentation stimulation
FT                   protein A; TIGRFAM: sugar fermentation stimulation protein;
FT                   PFAM: sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78949"
FT                   /db_xref="GOA:E8UUL2"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUL2"
FT                   /inference="protein motif:TFAM:TIGR00230"
FT                   /protein_id="ADV78949.1"
FT                   /translation="MVITNPIVYGKFIKRINRFEAYVELNSGEKTLVHVPNTGRCKEIF
FT                   VPGAEVILEVRDRQGRKTPYELAFAYKGKRLISIDSQVPNKVVLESIKMGLIEEFKGYD
FT                   IVEKEKTFGNSKFDIKLTKGKEICYVEVKGVTLEVEGVAKFPDAPTERGRKHLKELIKV
FT                   KKEGMRAAVIFLIQMDDIKYFTPNDEQDPEFGKFLREAVGKGVEAYAYTCDVGENYVFL
FT                   KDRVEVVL"
FT   gene            358602..360599
FT                   /locus_tag="Thebr_0334"
FT   CDS_pept        358602..360599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0334"
FT                   /product="peptidase S9 prolyl oligopeptidase"
FT                   /note="KEGG: tpd:Teth39_0324 peptidase S9 prolyl
FT                   oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78950"
FT                   /db_xref="GOA:E8UUL3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUL3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0324"
FT                   /protein_id="ADV78950.1"
FT                   /translation="MEKLQLEDFTKFKFLSGLKYSPNGDYAAFAVHRMDVEENKYLSNI
FT                   WLLDIKSRKYFQLTSFNEERGFVWLDNENILFSGSRNPKDKEKVESGEEFTRYYKINIH
FT                   GGEALEAFVIPKKVMNIEPIDENTFLLTARYNVNEKELEGLSEEEKQKELKKRKEEKDY
FT                   KVLDEIPYWVNGAGFINKDRERLYLYRANENKLQPITDEYTDVSLFKLNRDKSKAVFIG
FT                   RTYKDKMDLVSDVYIYDVASNEVKKINRDEDFSYRYADFLGDKIICTGTDMKKYGINEN
FT                   GKFYLLDIDSGEKKCITPDLDMSLGNSVGSDSRYGSGYSFKVEGDYLYFISTERYNAYL
FT                   NRIDVNGKIEKVIASDGSVDMFDVKGENILFIGFRGLKLLELYEYKNGEEKQLTDFNEW
FT                   VQKERKLSKPERVEVETRPGHFIDGWVIKPIDYEEGKKYPAILDIHGGPKTVYGEIYFH
FT                   EMQYWAAEGYFVFFCNPKGSDGRGNEFADIRGKYGTIDYEDIMKFTDYVLENYKDIDPS
FT                   RVGVTGGSYGGFMTNWIIGHTDRFKAAVSQRSISNWTTEFGTTDIGYYFVPDQIGGTPW
FT                   DNFEKYWEHSPLKYADRVKTPTLFLHSDEDYRCWMAEALQMFSALKYFGVESKLVLFHG
FT                   ENHELSRSGKPKHRIRRLREITEWFNKYLK"
FT   gene            complement(360640..361278)
FT                   /locus_tag="Thebr_0335"
FT   CDS_pept        complement(360640..361278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0335"
FT                   /product="protein of unknown function DUF1614"
FT                   /note="PFAM: protein of unknown function DUF1614; KEGG:
FT                   tpd:Teth39_0325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78951"
FT                   /db_xref="GOA:E8UUL4"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUL4"
FT                   /inference="protein motif:PFAM:PF07758"
FT                   /protein_id="ADV78951.1"
FT                   /translation="MPLIWILSLILLFPFLIFTFFVQATTFSFAKLGLSPQMAVFVFSL
FT                   SLIGSVINIPISRKKIIVHEEERYFSPFLFYYPPRVQEQVIAVNVGGAVVPVILSLYLL
FT                   PRAPLLPTIIATIIVTIVAKALAKPVPGVGITLPAFIPPLVAAASAILLSPHNAAPVAY
FT                   ISGVLGTLIGADLLNLPHFKDLNSHAISIGGAGIFDGIFLVGVVAALLA"
FT   sig_peptide     complement(361204..361278)
FT                   /locus_tag="Thebr_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.943 at
FT                   residue 25"
FT   gene            361425..361652
FT                   /locus_tag="Thebr_0336"
FT   CDS_pept        361425..361652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0336"
FT                   /product="protein of unknown function DUF896"
FT                   /note="PFAM: protein of unknown function DUF896; KEGG:
FT                   tpd:Teth39_0326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78952"
FT                   /db_xref="GOA:E8UUL5"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUL5"
FT                   /inference="protein motif:PFAM:PF05979"
FT                   /protein_id="ADV78952.1"
FT                   /translation="MITREMIDRINFLYHKSQTEGLTEEEKEEQKRLRQEYVKEIKERV
FT                   RRELESIKYANNSCEHCGHDHHHHHHHHRH"
FT   gene            361673..363100
FT                   /locus_tag="Thebr_0337"
FT   CDS_pept        361673..363100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0337"
FT                   /product="Acetylornithine transaminase"
FT                   /EC_number="2.6.1.11"
FT                   /note="KEGG: tpd:Teth39_0327 aminotransferase class-III;
FT                   PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78953"
FT                   /db_xref="GOA:E8UUL6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUL6"
FT                   /inference="protein motif:PRIAM:2.6.1.11"
FT                   /protein_id="ADV78953.1"
FT                   /translation="MYEVTKGKVKDDIPEYITLEEALTLNKNQVRENYKEYINSVFVSM
FT                   LSMLQFDKLFVRAKGVSVWDNEGNEYYDFLGGYGALNLGHNPDEVIEAVEKVKYMPNIL
FT                   QAAIGNLPGVLAHNLAKVTPGNLKRSFFCNSGAEAVEGALKLAKIASGKQKIVYCQNSF
FT                   HGKSMGALSVTGREKYQKYFKPLVPETVPIPFGDEKALEEALKGRDVAAFIVEPIQGEG
FT                   GVIVPPEGYLKKVRELCTKYDAYLILDEVQTGFGRTGKMFACEHEGVVPDIMCLAKSLG
FT                   GGVMPIGAYITTEEIWQKAYGTMEKALLHTSTFGGNTYACAAAIASIQAIIEKKLPDAA
FT                   KEKGGYFLGRLKELKEKHPKLIKDVRGKGLLIGVEFNQPEGGLLDKISGGAISKFSSEY
FT                   LGSLIAGELQNKHRIITAYTLNNPNVIRLEPPLIVTKEQIDKVVDALDEILTRNSSFLG
FT                   ITVSGAKTVLGSLFKRQ"
FT   gene            363122..363607
FT                   /locus_tag="Thebr_0338"
FT   CDS_pept        363122..363607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUL7"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0328"
FT                   /protein_id="ADV78954.1"
FT                   /translation="MRELFEKGITFEEFVKESEEYIARRIKERYEKTVLDEDLIEKIKF
FT                   KDEINILAFAESWCPDSQVNVPIVAKIASYNKNFKLRILKREGNEEHMKPYYIDGKAKI
FT                   PTFVFMDKDFKEIGYWIERPEIVKELAKSGEGEWKRDYLKGKYDKNIIEEIVNILSR"
FT   gene            363786..366098
FT                   /locus_tag="Thebr_0339"
FT   CDS_pept        363786..366098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0339"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /EC_number="1.17.4.1"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; KEGG: tpd:Teth39_0329
FT                   ribonucleotide-diphosphate reductase subunit alpha; PFAM:
FT                   ribonucleotide reductase large subunit; Ribonucleotide
FT                   reductase large subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78955"
FT                   /db_xref="GOA:E8UUL8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUL8"
FT                   /inference="protein motif:TFAM:TIGR02504"
FT                   /protein_id="ADV78955.1"
FT                   /translation="MKITENARKVLEKRYLAKDENGKPIETVEEMFERVAKTIAEVDLI
FT                   YDQNADVEAVKKRFYDMMVDLDFLPNSPTLMNAGRPLGQLSACFVLPVGDSMEEIFDAV
FT                   KYAAIIHKSGGGTGFSFSRLRPKGATVRSTGGVASGPVSFMKVFNAATEAVKQGGTRRG
FT                   ANMGILRVDHPDILEFIQCKKDNNEITNFNISVAITEEFMKAVEEDREYDLIDPHTGKV
FT                   VNRLRAREVFDLIVEMAWRNGEPGIVFLDRINEKNPTPEVGEIESTNPCGEQPLLPYES
FT                   CNLGSINLENMLKKVEGRYVIDYDKLRETVYDAVHFLDNVIDANKYPLPQIEEMTKGTR
FT                   KIGLGVMGFANMLLRLGIPYDSDEAVKLGEELMEFIDETSKEASIKLAEQRGTFGFYDK
FT                   SIYKKMGIKIRNATTTTIAPTGTISIIAGTSSGIEPVFAIAMTRNVMDNTELVEVNPVF
FT                   KEVAIERGFYSEELMREIARRGSLKDIKGIPEDVKRVFVIAHDIDHEWHVKMQAAFQKH
FT                   VDNAVSKTVNFRNEATVEDVRRTYLLAYKLGCKGVTIYRDGSRESQVLNLGIKEKKEEA
FT                   KPKEEQTKNEPLRPRPRPPVTRGITEKVRIGCGNLYITVNYDDQGICEVFTNLGRAGGC
FT                   PSQSEATSRLISIALRSGIDAKTIVEQLKGIRCHSTLRQMATNKEIKVLSCPDAIGKVI
FT                   EKVMKIRVEEEQQFAPIDVPIYENNHNGDEDDPKEEVALSEADLLDEEKFCPECGSPIE
FT                   HEGGCVVCKNCGYSKCG"
FT   gene            366313..367977
FT                   /locus_tag="Thebr_0340"
FT   CDS_pept        366313..367977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0340"
FT                   /product="diguanylate cyclase"
FT                   /note="SMART: GGDEF domain containing protein; GAF domain
FT                   protein; TIGRFAM: diguanylate cyclase; KEGG:
FT                   tpd:Teth39_0330 diguanylate cyclase with GAF sensor; PFAM:
FT                   GGDEF domain containing protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78956"
FT                   /db_xref="GOA:E8UUL9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUL9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADV78956.1"
FT                   /translation="MGKYRELVFNITLITIGSILFVWALYRCGIGIDWRVFLILLAFAI
FT                   ILDNIGIMYTDIKLSLSPTIGITTFLIFGTVGAATLMVSSVMFDTIVVRKKIKNGLLNG
FT                   GMFSIAYLVAGWFYEFIGGKIGIVSFSQVKYILSYVIISFLLNNFILYYALKVQGKILF
FT                   KEYWNESVLLELGTYIVMIPVSLLLAYIYFKHSLLFFVLSLTPLIFIAYAFRMIRDLIK
FT                   ANKRLNAIYEMVKMINSKLELEQILDTIIEVISQVVSVSAAAIYLTDSNGVAALVKSIG
FT                   NREGEEGFKENYFKDEGIIGKCISSNKTIAIKDLKQDKRFLKEQFLNNYGSVVVAPLRF
FT                   SGSVIGCLMVLHVETNVFDEDSVKIIEIIVDQASVAITNAKRYYEVTKKSITDPLTKTY
FT                   NRRYFNDALMENIMRADETSEPVSLIMFDLDNFKLINDTYGHLVGDEVLKEVAKRIKNN
FT                   VRSDDIVARFGGEEFAVILPKLTAEQAYMIAERIRNEVSSRPIRTDKGDIYVTITGGVA
FT                   DYPEKADSAEKLISHADRALYAGGKSKGRNKIAIYEV"
FT   gene            368198..370156
FT                   /locus_tag="Thebr_0341"
FT   CDS_pept        368198..370156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0341"
FT                   /product="Protein-N(pi)-phosphohistidine--sugar
FT                   phosphotransferase"
FT                   /EC_number="2.7.1.69"
FT                   /note="KEGG: tpd:Teth39_0331 transcriptional
FT                   antiterminator, BglG; PFAM: PRD domain protein;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78957"
FT                   /db_xref="GOA:E8UUM0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUM0"
FT                   /inference="protein motif:PRIAM:2.7.1.69"
FT                   /protein_id="ADV78957.1"
FT                   /translation="MDRILEIINMLLNSEQPLTVDYIANTLKVSNKTIRNDLKKAEEFV
FT                   QQKGVKIIKKPRVGIVLEGPRNKKLELVDEIKKSLDFEEPFSPEARKNYILKRLFMSKG
FT                   SVTTKELAEELYVSRVTIHKDLQSVEKWLNKFNLKLLKKPNYGIEVVGDEENWRNAVAS
FT                   LIVSTKEQKELKEFLYNDYTGRIDYRTLMQLRELFDIDYKQLEKIVSNAESKLKFRFSD
FT                   EAFISLVIHVAISIERLKHKKDVKLSKAVLNNLKQKDEYVIAQQMAKEIEAKFNVVLPE
FT                   SEIGYIVLHIIGTKMQQNKIEDVNLELEDEESIELAVIMSKEIINIAERALSLDLSNDK
FT                   QLLNGLILHLRPTINRLKYGLTLRNPLLNDIKENYPEIYGVAWMTSVVFEKYLGKKVAE
FT                   EEIGYIALHLGAAVERAKKPLKALVVCTTGIGTAQLLAARLEKSFKQIEIKDIVSSVSL
FT                   HESILNDIDIVISTVPIEINKPFINISPLLTQNDIKRLDEFIQALNKRSNLIDTQLLDV
FT                   DGIYLKKEDLLNKVCMELHKKGYVKEEYIQDVITREKIASTAIGNGIAIPHGLPEHVNK
FT                   SVFTVVRLKNPIAWDEEKVDMLFMISLTQSDIAKSRYIFRKLYNKLESPEFVENIKKAK
FT                   SREEIIKLLEVVYNADK"
FT   gene            370143..370592
FT                   /locus_tag="Thebr_0342"
FT   CDS_pept        370143..370592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0342"
FT                   /product="PTS system, fructose subfamily, IIA subunit"
FT                   /note="KEGG: tpd:Teth39_0332 putative PTS IIA-like
FT                   nitrogen-regulatory protein PtsN; TIGRFAM: PTS system,
FT                   fructose subfamily, IIA subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78958"
FT                   /db_xref="GOA:E8UUM1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUM1"
FT                   /inference="protein motif:TFAM:TIGR00848"
FT                   /protein_id="ADV78958.1"
FT                   /translation="MLINKNLVTLNLEAKNKEEAIIKLAELAQKEGKITSVEEYARSVL
FT                   DREKAYTTGVGNGIAIPHGKSKAVKEAMIVFGKTTDGIEWDSLDGKPVNLIFLLGVPEE
FT                   NVDNVHLKILSQLSRKLMNDSFIEMLKKAVTVEEILNALSDIQVS"
FT   gene            370634..371679
FT                   /pseudo
FT                   /locus_tag="Thebr_0343"
FT   gene            371744..372055
FT                   /locus_tag="Thebr_0344"
FT   CDS_pept        371744..372055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0344"
FT                   /product="PTS system, fructose-specific, IIB subunnit"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; KEGG: tpd:Teth39_0334 PTS system,
FT                   fructose-specific, IIB subunnit"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78959"
FT                   /db_xref="GOA:E8UUM2"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUM2"
FT                   /inference="protein motif:TFAM:TIGR00829"
FT                   /protein_id="ADV78959.1"
FT                   /translation="MKIVAVTACPTGIAHTYMAAEALENAAKKLGHKIKVETQGSIGIE
FT                   NKITQKEVDEADLVIFAADVAVKEESRFKDKPIYKVEAQKAIKNAKAVIEEALKLVNK"
FT   sig_peptide     371744..371803
FT                   /locus_tag="Thebr_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.790 at
FT                   residue 20"
FT   gene            372236..373957
FT                   /locus_tag="Thebr_0345"
FT   CDS_pept        372236..373957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0345"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="KEGG: tpd:Teth39_0335 phosphoenolpyruvate-protein
FT                   phosphotransferase; TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein domain protein; PEP-utilising protein
FT                   mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78960"
FT                   /db_xref="GOA:E8UUM3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUM3"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADV78960.1"
FT                   /translation="MLKGVAASPGIAIGKVFLYTKEKAEINMKNIDESKVEYEIERFKK
FT                   ALEVTKEQIQKIKEDALKEFGKDKAEIFEAHLMLASDPELIEGVENMIKTELITADNAV
FT                   NKVIEQNASVMESLDDEYLKERAADLRDVGSRIINNLLGVKNTSLSELDEQVIIIAKDL
FT                   TPSDTATMKKEMVLGFATDIGGRTSHTAIMARSLEIPAVVGLGNVTTQVNNGNTVIVDG
FT                   LEGVVIVNPDESTMNEYKTKKENYDKKVEKLKKLKDLPAITPDGKKVMLAANIGTPKDV
FT                   KSALANGAEGVGLFRTEFLYMDRTTLPTEEEQFEAYKEVAEKMEGRPVTIRTLDIGGDK
FT                   ELPYLDMPKEMNPFLGYRAIRLCLDKTDIFKTQLRAILRASAYGNIHIMYPMISSIEDV
FT                   RKANIVLNEVKAELDKEGIKYDKNIKVGIMVEIPSAAVTADILAKEVDFFSIGTNDLCQ
FT                   YTLAVDRMNEHVKDYYQPFNPAILRLIKFVIDAAHKEGKFAAMCGEMAGDPLATVILLG
FT                   LGLDEFSMSATSIPTVKNIIRNVEYERAKEIAERVLNIAEAEKIQKMMEDIIKDIE"
FT   gene            374077..376116
FT                   /locus_tag="Thebr_0346"
FT   CDS_pept        374077..376116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0346"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: tpd:Teth39_0336 elongation factor G; TIGRFAM:
FT                   translation elongation factor G; small GTP-binding protein;
FT                   PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   elongation factor G domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78961"
FT                   /db_xref="GOA:E8UUM4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUM4"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADV78961.1"
FT                   /translation="MKDYKTNQIRNVGLVSHGGAGKTTLTEAFLFNTKVIDRMGRVENG
FT                   TTVSDYDPEEIARQISISTSVIPVEWRECKINILDMPGYFDFFGEVVSGLRVVDSVIIP
FT                   VCAASGVEVGTEKVFNMAKKNKLPIIFFINKMDRENADYFKTLNQLMEKFGNKVIPLTF
FT                   PIGSEQSFKGYVDVLTQKAYVYDEKGVKETEVPADLMDKVLSAKEELIENIAENDETLM
FT                   EKYFGGEEFTQEEMKEGIKNSIRIGELMPVLCGSSLKNIGTDKLLDAIVEFLPSPLDIE
FT                   REKASENGPVAAFVFKTIADPYVGRLSIFKVVSGTLTSDSTLLNSNKQMQEKISQLYIL
FT                   RGKKQMPVSKLVAGDIGAVAKLQYTMTGDTLCDPSKLVTLAPIDFPQPTLSLAIEPKSK
FT                   GDEEKISNGLQRLQEEDPTFKVEKNLETGQMIVYGMGEQHIEVISKKLMNKFGVECTLT
FT                   DPIVPYRETIKGKVKVEGKHKKQTGGHGQYGHVWIEFEPNPNSEFEFEDKIFGGAVPKQ
FT                   YIPAVEKGLRESMKEGVLARYPVVNIKATLVDGSYHPVDSSEMAFKIAASLAFKKGMEQ
FT                   ANPVLLEPIMRVEVVVPEEYMGDIIGDLNKRRGRILGMESKDNLEVITAEVPLAEMNRY
FT                   ATDLRSLTQARGDFKMTFARYEEAPPNVAQKIIEERKKLKEKEE"
FT   gene            376223..377434
FT                   /locus_tag="Thebr_0347"
FT   CDS_pept        376223..377434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0347"
FT                   /product="malic protein NAD-binding protein"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: tpd:Teth39_0337 malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78962"
FT                   /db_xref="GOA:E8UUM5"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUM5"
FT                   /inference="protein motif:PFAM:PF03949"
FT                   /protein_id="ADV78962.1"
FT                   /translation="MNIREETLKLHKENRGKLEIISKVEVKNDKDLALAYTPGVAEPCK
FT                   EIHKNSDLVYEYTTKSHMIAVVTDGSAVLGLGNIGPYAALPVMEGKAVLFKEFGGVDAV
FT                   PICLATQDVEEIIKTVVNISPAFGGINLEDISAPRCFEIERKLDEILDIPVFHDDQHGT
FT                   AVVTLAALINALKIVEKELKEVTAVVNGAGAAGIAIAKFLIKADIKDVIVCDRSGIIYE
FT                   GREDEDFSKKEIAKISNKGRLKGLLKDALKGADVFIGVSAPNVLNKEMIKTMAKKPIVF
FT                   ALANPVPEIYPDEAKEAGAYVVGTGRSDFPNQINNVLAFPGIFRGALEVRATTINEEMK
FT                   ISAAYSIAQTISENELTPEYIIPKPFDKRVLKNVAIAVAKAAIDTDVARINVDLKEIEK
FT                   SLSE"
FT   gene            377460..377651
FT                   /locus_tag="Thebr_0348"
FT   CDS_pept        377460..377651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78963"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUM6"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0338"
FT                   /protein_id="ADV78963.1"
FT                   /translation="MNKNQKFFKGKLYKSIRGNFFEEDTYESTERKNLKGKSNFSSLIN
FT                   QQEPQELADEEEENYENE"
FT   gene            377761..378282
FT                   /locus_tag="Thebr_0349"
FT   CDS_pept        377761..378282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0349"
FT                   /product="Firmicute transcriptional repressor of class III
FT                   stress genes"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: tpd:Teth39_0339 transcriptional
FT                   repressor, CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78964"
FT                   /db_xref="GOA:E8UUU9"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUU9"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ADV78964.1"
FT                   /translation="MQKYIRRSKKVKVKVRDVVMAMARLSDLIENFIKELMEEAGKHYV
FT                   EIQRNELANVFNCAPSQINYVLETRFTIDRGYIIESKRGGGGYIKIYKTSISNNWINKI
FT                   IENIGDNISESKARYYIDALLDHNIITSREAALMKAVVNDKILSFSQEDKNMLRALLLK
FT                   AMLMEIARNK"
FT   gene            378297..378812
FT                   /locus_tag="Thebr_0350"
FT   CDS_pept        378297..378812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0350"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: tpd:Teth39_0340
FT                   UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78965"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUV0"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ADV78965.1"
FT                   /translation="MMCDKCKIRPATVHYTKIVNGVKTEMHLCDQCAAEEGILNTEVFS
FT                   TFTPFSVQNLLSGLMDFLPGVDDFTKKTLKCSHCGMTYEDFKKIGRLGCSFCYDAFAEE
FT                   LNPLMRRIHGSTEHRGKIPKKAGGKMRVKREIEELKYQLEKAIKEEAYEKAAELRDKIR
FT                   ELEKELGK"
FT   gene            378822..379841
FT                   /locus_tag="Thebr_0351"
FT   CDS_pept        378822..379841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0351"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   tpd:Teth39_0341 ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78966"
FT                   /db_xref="GOA:E8UUV1"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUV1"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ADV78966.1"
FT                   /translation="MLQYDKDVVLSSRIRLARNIKDIPFPTIMTEEQGRKVIDLVRKAI
FT                   LGSNTILSTQFVEYDMKKLTPIDRQSLVEKHLISPDLSQNTKSGYALIKDDNTVSIMVN
FT                   EEDHLRIQCILEGLRLNESWDTADKIDDLIEETIDYAYDEKIGYLTSCPTNVGTGIRAS
FT                   VMVHLPALTITGQISNILNSVSKIGMAVRGIYGEGTQALGDIYQISNQVTLGQSEREII
FT                   ENIQGVARQIISSERKAREDLYKKQRIQIEDRVGRAFGILSHAKVMSTKEYMTLMSDVR
FT                   LGAILGILDVDINKIDVLTTHIQPANLQKIYGIQLDPYERDVKRAEYVVSQINKKDNL"
FT   gene            379854..382304
FT                   /locus_tag="Thebr_0352"
FT   CDS_pept        379854..382304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0352"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: tpd:Teth39_0342 ATPase; PFAM: ATPase AAA-2
FT                   domain protein; Clp domain protein; AAA ATPase central
FT                   domain protein; UvrB/UvrC protein; Clp ATPase-like; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78967"
FT                   /db_xref="GOA:E8UUV2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUV2"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADV78967.1"
FT                   /translation="MAMFGRFTERAQKALYLAQEEARSFYHNYVGTEHILLGLLKEDEG
FT                   IAARVLKKLGVTYETTREKVLSLIGMGNIPGDVVGYTPRAKRVLELSLSEARRFNTSYV
FT                   GTEHILLGLLREGEGVAVRILMEQGIDFNRVREEIVKMLNEEPAGGPAKAAKVKNTNTP
FT                   TLNQFGRDLTELARDGKLDPVIGREKEIERVIQILSRRTKNNPVLIGEPGVGKTAIVEG
FT                   LAQKIVEGEIPEILKDKRVVTLDMASMVAGTKYRGEFEDRLKTVLNEVIKAGNVILFID
FT                   EMHTLIGAGAAEGAIDASNILKPALARGEIQVVGATTLDEYRKYVERDPALERRFQPII
FT                   VDEPTVEETIEILKGLRDKYEAHHRVKITDEALEAAARLSHRYIADRFLPDKAIDLIDE
FT                   AASRVRLKTVTAPPEIKELEDKINDLIKEKEEAIRTQEYEKAAKIRDEEQKLREELEKL
FT                   KAKWQQNSLSNEKSVGPEEIAQVVSLWTGIPVKKLAEEESERLLHLEEVLHERVIGQDE
FT                   AVEAVARAIRRARVGLKDPKRPIGSFIFLGPTGVGKTELTKALAEALFGDENAMIRLDM
FT                   SEYMERHTVSKLIGSPPGYVGFEEGGQLTEKVRRKPYSVILLDEIEKAHPDVFNILLQI
FT                   LEDGRLTDSKGRTVDFKNTVIIMTSNVGAELLKKQSTLGFMPQEKEDKASYDKIKETLM
FT                   AELRKTFRPEFLNRVDEIIVFHQLSKEDIEKIADIMIKELNDRLKENDIKLDFTPEAKE
FT                   EIIKQGYDPNYGARPLRRVIQRIVENQLSELMLQGEVKPGDELIVTAKDGKIEFVKKDA
FT                   IKKA"
FT   gene            382368..383759
FT                   /locus_tag="Thebr_0353"
FT   CDS_pept        382368..383759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0353"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: tpd:Teth39_0343 DNA
FT                   repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78968"
FT                   /db_xref="GOA:E8UUV3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUV3"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADV78968.1"
FT                   /translation="MKDGGGMAKSTTKFVCRECGFESSKWMGRCPNCDSWNSFEEEAIE
FT                   SSKNFRKTKDRSQIYLLEDVTFSEEERIRTGIEEFDRVLGGGIVKGSLVLIGGDPGIGK
FT                   STLLLQVAGNISDSRKVLYVSGEESVQQIKLRADRILKEKQRIYLLCETNIEEIERKID
FT                   ENKPDFVIIDSIQTIYTEESETIPGSVSQIRQVTQKLMEIAKQKDISIFLIGHVTKEGA
FT                   IAGPKVLEHMVDTVLYFEGDRTQSFRILRAVKNRFGATHEIGVFDMEEDGLCEISNPSE
FT                   FILSNKPKDVSGTAVVSSIQGTRPILMEVQSLICKTTFGVPRRMATGFDYNRFILLLAV
FT                   IEKRLGINLSQFDAYVNVAGGMKIQEPAADLGIIASSLSGYFNIPIPEDVCFIGEVGLT
FT                   GEVRGVSNIDKRIGEAQKMGFSQVFIPEMKTKEIKKFGNIKVTKIKDIKDIMDFLRERE
FT                   QKASS"
FT   gene            complement(384065..384460)
FT                   /locus_tag="Thebr_0354"
FT   CDS_pept        complement(384065..384460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78969"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUV4"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0344"
FT                   /protein_id="ADV78969.1"
FT                   /translation="MKDIIVDDLQNTVDEYLLRHRSIMDIMTKIQESSARINRAVAKSV
FT                   TECGCIRINASKQETPPDATLEEAHKYFKTHLEGQLCENCKEVIEAEIGNNVFYIIALC
FT                   NVLGLNFYDILLKKHKELNTLGIFNML"
FT   gene            384744..385847
FT                   /locus_tag="Thebr_0355"
FT   CDS_pept        384744..385847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0355"
FT                   /product="PilT protein domain protein"
FT                   /note="KEGG: tpd:Teth39_0345 PilT domain-containing
FT                   protein; PFAM: PilT protein domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Nucleotide
FT                   binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78970"
FT                   /db_xref="GOA:E8UUV5"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUV5"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADV78970.1"
FT                   /translation="MLYKIIRGGIGLLGMAAGFELTKLLLDLVKDQNFVPIQLNYFSTV
FT                   IAYIIGTLIGGIIFYVISPKFIKWGKDFEQWLEAKLQNMPIDEILIGAFGLIVGLIVAN
FT                   LLSAPLYPILVVGKVVPILLNLFLGYLGIRISLKKKDDILNVFSFMKKLGPQKTVKNEY
FT                   SGIPKILDTSVIIDGRIFDICKTGFIEGPLIIPAFVLEELRHIADSSDSLKRNRGRRGL
FT                   DVLNKIQNELNIKVEIVDKEIDAAEVDTKLLKLAQMLKGKIITNDYNLNKVAEFHRVPV
FT                   LNINELSNAVKPIVLPGEEMVVQVIKDGKEAGQGVAYLDDGTMIVVDGGKKFIGNTIEV
FT                   LVTSVLQTAAGRMIFAKPKQAEQEKAI"
FT   gene            385929..386612
FT                   /locus_tag="Thebr_0356"
FT   CDS_pept        385929..386612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0356"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: tpd:Teth39_0346 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78971"
FT                   /db_xref="GOA:E8UUV6"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUV6"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADV78971.1"
FT                   /translation="MNVSAVIVAAGKGIRMGHTVNKVYLTIAGKPVLYYSLKAFDEIDW
FT                   IKEIVVVVSKEEMEYCQENVVKKYIFKKPIKLVEGGSERQYSVYNGITNTKEDCEIIAI
FT                   HDGARPLVEKETVIKALKEAYLHKAVALGVPVKDTIKVVDGKNFILNTPDRKYLWAIQT
FT                   PQVFERNLIIKAHQKALEDGFLGTDDTVLVERLGYKVKVVEGDYRNIKITTPEDLIVAE
FT                   AFLKK"
FT   gene            386679..387923
FT                   /locus_tag="Thebr_0357"
FT   CDS_pept        386679..387923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0357"
FT                   /product="PGAP1 family protein"
FT                   /note="PFAM: Lecithin:cholesterol acyltransferase; KEGG:
FT                   tpd:Teth39_0347 PGAP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78972"
FT                   /db_xref="GOA:E8UUV7"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUV7"
FT                   /inference="protein motif:PFAM:PF02450"
FT                   /protein_id="ADV78972.1"
FT                   /translation="MDNPVVFVHGMFGSIFTPTPLGKIWSFGPAAYAYNPFIENLGKLG
FT                   LVEGKNLFICYYEWWKSVPDSVDTLKLTIEEAKAKTGSHKVDLICHSMGGLLARSYIES
FT                   DKYQFDVARLIFLATPHFGAANAYYGWEGGTVAPEDDDFINMLFKGFLWIFSKIKGETD
FT                   AITVIRKYIPSVKDLMPSKEYGNYLFMYPTRYNKILFKNIEYMKVINEFLNSLNKQVGV
FT                   LYDRVKKIYVFSGDGIYTNKFIQVGKPVSDIVWPDGKPVGVIRDNKGDGTVLKKSALGV
FT                   EGEKFIVKTGHIGILNDSIPYLQQILGIKEKPQVSILEKVVSYLSMITDKKIVVLDRSK
FT                   NVISYDIFGKFVWHLNLKPEGEYRISVREPFVSEVYIETNKGNFVKKIKSSRFARGVSM
FT                   SLEVDKEGNFSVKDD"
FT   gene            387925..388413
FT                   /locus_tag="Thebr_0358"
FT   CDS_pept        387925..388413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0358"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="KEGG: tpd:Teth39_0348 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78973"
FT                   /db_xref="GOA:E8UUV8"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUV8"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADV78973.1"
FT                   /translation="MKVGLGYDVHKFEKGRKLILGGVEIPYDKGLAGHSDADVLIHALI
FT                   DAILGAAGLGDIGEHFPDTEIAYKDIDSSLLLKKVLAIIENKFRVNNVDCIIVAQRPKL
FT                   SPYKEQIRIKLSELLKIEKKRINVKAKTEEGLGFTGRQEGIKAYVIVSLEELGVDIKK"
FT   gene            388458..390170
FT                   /locus_tag="Thebr_0359"
FT   CDS_pept        388458..390170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0359"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="KEGG: tpd:Teth39_0349 prolyl-tRNA synthetase;
FT                   TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); YbaK/prolyl-tRNA synthetase
FT                   associated region; Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78974"
FT                   /db_xref="GOA:E8UUV9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUV9"
FT                   /inference="protein motif:TFAM:TIGR00409"
FT                   /protein_id="ADV78974.1"
FT                   /translation="MRLSQLLVPTLREIPAEAEIPSHILMLKAALMRKLASGVYIYLPL
FT                   GQRVLRKVEQIVREEMDRAGSQEVLMSALIPAELLKESGRWDVFGPEMFKLKDRNERDF
FT                   CLGPTHEEVFTDLIRNEVKSYRQLPLILYQIQTKFRDERRPRFGVMRSREFIMKDAYSF
FT                   DMDWEGLDKSFNKMYEAYCRIFDRCGLKYLVVEADSGAMGGKDSKEFMVISGVGEAVIA
FT                   YCDNCGYAANEEKAECLINQEIVEEMLPKEEVYTPNVRTIEELVNFLGITPNKFVKTLI
FT                   YKAKDNVVAALVRGDRDLNETKLLNILGIREEELELADASIVEKVTGAKVGFAGPIGLK
FT                   GEVMIIVDNEIPQMRNFIVGANETDYHIKNVNYGRDFKADVVADIKNVIEGDKCPRCGS
FT                   PLKIDRGIEVGHIFKLGTKYSDALGAKYVDEEGNEKPIIMGCYGIGINRTVAAIIEQHH
FT                   DEKGIIWPMSVAPYHVIIVPVNVSNEAQNRVAEDIYAALQKEGIEVLIDDRDLRAGVKF
FT                   NDADLLGIPIRITVGKKVDDGIVEIKLRENEEAEEVKISDVVEKVKNIIKEKM"
FT   gene            390264..390503
FT                   /locus_tag="Thebr_0360"
FT   CDS_pept        390264..390503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78975"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUW0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0350"
FT                   /protein_id="ADV78975.1"
FT                   /translation="MNIYIMGISVEKRSEFGPKVQEVLTKYGDQIIARFGIHDSQNGSG
FT                   LITLNVRGEQKFMEEFEEELSAIPTVKVKYMNLK"
FT   gene            390837..392294
FT                   /locus_tag="Thebr_0361"
FT   CDS_pept        390837..392294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0361"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="KEGG: tpd:Teth39_0351 glutamyl-tRNA synthetase;
FT                   TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78976"
FT                   /db_xref="GOA:E8UUW1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUW1"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADV78976.1"
FT                   /translation="MNNLRVRFAPSPTGAIHIGNIRTALFNYLFSRSEGATFVLRIEDT
FT                   DLERSSKEFEELIFKELEWLGIEWDEGPDKPGPYGPYRQSERLEIYHKFAQKLIEEKKA
FT                   YRCYCTPEELEEDRRKAVERGDIPCYSGRCRYLTKEQEEAFIREGRKPVIRFIIPDDEV
FT                   IEFEDMIKGKITIKSDTLGGDMVIVKSDGMPTYNFAVVIDDALMKITHVIRGEDHIYNT
FT                   PKQILIYKALGFEIPKFAHAPLILGPDRTKLSKRHGNTYIGQYRELGYLPEAMFNFLSL
FT                   LSWSPEDNVEIMSKEEIIKKFNFRRIHSANPVFDIEKLNWMNQQYIQKSSIERIVDLAI
FT                   PHLRRAGYIDGIDDMVYNWLKDVISLYKDGLQYVAQITEKAKMFFVEEVEYSDETVKIL
FT                   NSPNSKIVLEVVKKVIEEADEITEEYVKDLLKKLQKETKVKGKEFFMPIRVAITGEDHG
FT                   PELVKIIPLLGKDKVINRLKKAINLIK"
FT   gene            392543..393208
FT                   /locus_tag="Thebr_0362"
FT   CDS_pept        392543..393208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0362"
FT                   /product="serine O-acetyltransferase"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   tpd:Teth39_0352 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78977"
FT                   /db_xref="GOA:E8UUW2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUW2"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADV78977.1"
FT                   /translation="MFKTLKEDIQVIFERDPAAKSVLEVILCYPGLHAIILHRIAHYLY
FT                   KKGLILIPRLISQFNRFLTGIEIHPGAKIGRRFFIDHGMGVVIGETTEIGDNVTIYQGV
FT                   TLGGTGKEKGKRHPTIKNNVVIGSGAKVLGPIVVGENSKIGAGAVVLKDVPPNSTVVGV
FT                   PARCVKKDNIRIASPYVVDLEHGKLPDPVEEELQKLRKRIERLEQILIERKGEKDEAV"
FT   gene            393195..394595
FT                   /locus_tag="Thebr_0363"
FT   CDS_pept        393195..394595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0363"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   tpd:Teth39_0353 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia ; Cysteinyl-tRNA
FT                   synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78978"
FT                   /db_xref="GOA:E8UUW3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUW3"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADV78978.1"
FT                   /translation="MKLYNTLSRTKEEFEPLNDKIVNMYVCGPTVYNYIHIGNARAFIV
FT                   FDTVRRYLEYKGYKVNYVQNFTDIDDKIIKRAQEENVTTKEVAEKYIEEYFIDADNLGI
FT                   KRATVHPKATEHIEDIIEFIKILIDKGYAYVVNGNVYFETAKFKDYGKLSHKNIEELQA
FT                   GARIEINEEKKNPLDFVLWKAQKPGEPAWDSPWGKGRPGWHIECSVMSTKYLGKTLDIH
FT                   AGGPDLVFPHHENEIAQSEAAYGQPFSKYWMHIGYLNINNEKMSKSKGNFFTVREITEK
FT                   YNPEVLRLFMLMAHYRSPINFSLDLMEQAKSAYERLLNAVANLKHLLTVCKDRELNEEE
FT                   KRIKEKFEEYKKEFEDAMDDDFNTADAISVLFEMSKTANTNISGNSSKKLVEYILDIFL
FT                   KLSEILGLSYRGVETELNDEEILALIEERQKARKEKNWKLADEIRDRLREKGIILEDTP
FT                   EGVRWKRV"
FT   gene            394580..395008
FT                   /locus_tag="Thebr_0364"
FT   CDS_pept        394580..395008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0364"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: ribonuclease III; KEGG: tpd:Teth39_0354
FT                   ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78979"
FT                   /db_xref="GOA:E8UUW4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUW4"
FT                   /inference="protein motif:PFAM:PF00636"
FT                   /protein_id="ADV78979.1"
FT                   /translation="MEKSMMGFLENTELLTKEGVLSLSPLVLAFIGDAVYSLYIRTKIV
FT                   AQKNQPVNFLHKETVKYVKAKAQAESVKRIYDLLSEEEKDIVRRGRNMKSNTTPKGVEV
FT                   QAYRYATGFEALLGYLYLAGEFERLKNILELSVQVIEE"
FT   gene            395018..395761
FT                   /locus_tag="Thebr_0365"
FT   CDS_pept        395018..395761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0365"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: tpd:Teth39_0355 RNA methyltransferase;
FT                   TIGRFAM: RNA methyltransferase, TrmH family, group 3; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78980"
FT                   /db_xref="GOA:E8UUW5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUW5"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADV78980.1"
FT                   /translation="MEEQNVIFGRNPVIEAIKSGKEIEKIYVSKTAGGNISKIINFAKE
FT                   AGIVVSTTDNDTLSKLAGSQNHQGVVALSAVYKYFEVDDLLEYAEQKKEKPFLLILDEI
FT                   TDPHNLGAIIRSAEAFGVHGIIIPKRRAVGVNATVVKTSAGAVEHMRIAKVSNINNTIR
FT                   DLKERGLWIVGTDVNAEKSFEELNYDFPVAFVIGNEGKGVSKLVLQNCDFVVKIPMKGK
FT                   INSLNASVAASILIYQVVSKRKDKA"
FT   gene            395761..396267
FT                   /locus_tag="Thebr_0366"
FT   CDS_pept        395761..396267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0366"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   tpd:Teth39_0356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78981"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUW6"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ADV78981.1"
FT                   /translation="MSLYMLVDGYNVINNWQILKEEAQKNLEDARDKLIDMLADFKGYS
FT                   GINIILVFDAMYVKGSLEKHEEISGIEVVYTREGESADHFIELKVVELAKKEQVIVVSS
FT                   DWTVQQVVLAHGAIRMSARELYEEMNKYIESHKKSYVNTIYKDNLEERLDNEIVKKLRK
FT                   MAENS"
FT   gene            396348..396992
FT                   /locus_tag="Thebr_0367"
FT   CDS_pept        396348..396992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0367"
FT                   /product="RNA polymerase sigma-H factor"
FT                   /note="KEGG: tpd:Teth39_0357 RNA polymerase factor
FT                   sigma-70; TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78982"
FT                   /db_xref="GOA:E8UUW7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUW7"
FT                   /inference="protein motif:TFAM:TIGR02859"
FT                   /protein_id="ADV78982.1"
FT                   /translation="MKSGAQQDYYQPYDQMEEEEVVFRAQKGDEIALEYLIERYKSFVK
FT                   AKARAYFLVGADKEDIIQEGMIGLYKAIRDYKSDKLTSFKAFAELCVTRQIITAIKTAT
FT                   RQKHIPLNSYVSLNKPIFDEESDRTLMDVVSTQCIADPEELIISKEEYVNIESKMEELL
FT                   SGLEWEVLVSYLDGKSYQEIAEDLNRHVKSVDNALQRVKRKLERYLEMRNS"
FT   gene            397054..397129
FT                   /locus_tag="Thebr_R0008"
FT                   /note="tRNA-Thr1"
FT   tRNA            397054..397129
FT                   /locus_tag="Thebr_R0008"
FT                   /product="tRNA-Thr"
FT   gene            397263..398465
FT                   /locus_tag="Thebr_0368"
FT   CDS_pept        397263..398465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0368"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: tpd:Teth39_0358 elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain-containing protein; elongation
FT                   factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78983"
FT                   /db_xref="GOA:E8UUW8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUW8"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADV78983.1"
FT                   /translation="MAKQKFERKKPHVNVGTIGHVDHGKTTLTAAITMVLSKAGMAEAK
FT                   GYDEIDKAPEERARGITINTTHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDPELIELVEMEVRELLNEYEF
FT                   PGDDTPIVVGSALKALECGCGKRECEWCGKIWQLMDVVDEYIPTPERDIDKPFLMPVED
FT                   VFTITGRGTVATGRVERGKVKVGDEVEIIGLTTESRKTVVTGVEMFRKTLDEAQAGDNI
FT                   GVLLRGVQRDEVERGQVLAKPGTIKPHTKFEAQVYVLTKEEGGRHTPFFNGYRPQFYFR
FT                   TTDVTGVINLPDGVEMVMPGDHVTIKVELITPIAMEEGLKFAIREGGRTVGAGVVSAII
FT                   E"
FT   gene            398649..398798
FT                   /locus_tag="Thebr_0369"
FT   CDS_pept        398649..398798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0369"
FT                   /product="ribosomal protein L33"
FT                   /note="manually curated; TIGRFAM: ribosomal protein L33;
FT                   KEGG: tit:Thit_1990 ribosomal protein L33; PFAM: ribosomal
FT                   protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78984"
FT                   /db_xref="GOA:E8UUW9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUW9"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ADV78984.1"
FT                   /translation="MRVKITLACTECKNRNYHTTKNKKNDPDRLELMKYCKFCKKHTLH
FT                   RETK"
FT   gene            398828..399025
FT                   /locus_tag="Thebr_0370"
FT   CDS_pept        398828..399025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0370"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="KEGG: tpd:Teth39_0360 preprotein translocase, SecE
FT                   subunit; TIGRFAM: preprotein translocase, SecE subunit;
FT                   PFAM: protein secE/sec61-gamma protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78985"
FT                   /db_xref="GOA:E8UUX0"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUX0"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ADV78985.1"
FT                   /translation="MAGEGRKIVKFFKDIRAEMKKVTWPSRKTVITYTEIVLIVVALFT
FT                   VFIFLIDSVFSYLLKLIIKV"
FT   gene            399058..399582
FT                   /locus_tag="Thebr_0371"
FT   CDS_pept        399058..399582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0371"
FT                   /product="transcription termination/antitermination factor
FT                   NusG"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain-containing protein; KOW
FT                   domain protein; KEGG: tpd:Teth39_0361 transcription
FT                   antitermination protein NusG; SMART: NGN domain-containing
FT                   protein; KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78986"
FT                   /db_xref="GOA:E8UUX1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUX1"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADV78986.1"
FT                   /translation="MPEKENAKWYVVHTYSGYENKVKANLEKIVENRNLQHLIHQIIVP
FT                   TEKVVEIKDGKKKTVERKIFPGYVLVKMVMTDDTWYVVRNTRGVTGFVGPGSKPVPLTE
FT                   AEVRALGIKEIPTAVDLNVKDTVRVISGPFENFIGVVQEIYPERQKAKVLISMFGRETP
FT                   VEFDLVQLQKI"
FT   gene            399629..400051
FT                   /locus_tag="Thebr_0372"
FT   CDS_pept        399629..400051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0372"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: Ribosomal
FT                   protein L11-like; KEGG: tpd:Teth39_0362 50S ribosomal
FT                   protein L11; SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78987"
FT                   /db_xref="GOA:E8UUX2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUX2"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADV78987.1"
FT                   /translation="MAKKVAAVVKIQLPAGKATPAPPVGTALGPHGVNIMAFCKEFNER
FT                   TAKDAGLIIPVVITIYADRSFSFITKTPPAAVLLKKAAGIESGSPQPNKQKVGKITREQ
FT                   LREIAEIKMKDLNASDIEAAMRMIAGTARSMGIEIV"
FT   gene            400098..400790
FT                   /locus_tag="Thebr_0373"
FT   CDS_pept        400098..400790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0373"
FT                   /product="ribosomal protein L1"
FT                   /note="KEGG: tpd:Teth39_0363 50S ribosomal protein L1;
FT                   TIGRFAM: ribosomal protein L1; PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78988"
FT                   /db_xref="GOA:E8UUX3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUX3"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADV78988.1"
FT                   /translation="MKRGKKYLESLKLYDKTQQYSSDEAIDIVLKTAKANFDETIDLAV
FT                   RLGVDPRHADQQVRGTVVLPHGTGKSVKVLVFAKGEKAKEAEAAGADYVGAEELVAKIQ
FT                   NENWFDYDVVVATPDMMGAVGRLGKILGPKGLMPNPKSGTVTFDLEKAIKEIKAGKIEY
FT                   RVDKAGIIHVPIGKKSFGKEKLLENFRAVMDAIIKSKPAAAKGQYIKSLVLSSTMGPGV
FT                   KVNPLKIF"
FT   gene            400974..401507
FT                   /locus_tag="Thebr_0374"
FT   CDS_pept        400974..401507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0374"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: tpd:Teth39_0364
FT                   50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78989"
FT                   /db_xref="GOA:E8UUX4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUX4"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ADV78989.1"
FT                   /translation="MGTAKEKKQQIVAEFKDKLSQAQTVIFSNFSGLTVEDDTILRRKF
FT                   REANSEYKVYKNTLMTIAAKELGYGDDLIKYFEGPTSVAFGYDDPVAPAKVLVEFMKDH
FT                   KGIELKAGLVNGKLVTVEEIKALAELPSREELVAKALGSMKAPITNLVFVLSGTLRSLL
FT                   YALNAVKEKKQAEA"
FT   gene            401545..401922
FT                   /locus_tag="Thebr_0375"
FT   CDS_pept        401545..401922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0375"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: tpd:Teth39_0365 50S ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78990"
FT                   /db_xref="GOA:E8UUX5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUX5"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADV78990.1"
FT                   /translation="MNKEEILEAIKNMTVLELAELVKALEEEFGVSAAAPVAVAAAPAA
FT                   GAPAAAPAEEKTEFDVILQEVGSDKIKVIKVVREVTGLGLKEAKDLVESAPKPVKEGVS
FT                   KDEANQIKAKFEEVGAKVEIK"
FT   gene            402149..405865
FT                   /locus_tag="Thebr_0376"
FT   CDS_pept        402149..405865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0376"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="KEGG: tpd:Teth39_0366 DNA-directed RNA polymerase
FT                   subunit beta; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2 domain 2; RNA polymerase
FT                   Rpb2 domain 3; DNA-directed RNA polymerase, beta subunit,
FT                   external 1 domain; RNA polymerase Rpb2 domain 7"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78991"
FT                   /db_xref="GOA:E8UUX6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUX6"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADV78991.1"
FT                   /translation="MVRPVQVGNKTRMSFAKIDEVLEMPDLIEVQKKSYKWFLEEGLRE
FT                   VFREISPIESFTGNLALEFVDYRLENNPKYSVEECKDRDTTYAVPMKVKVRLTNRETGE
FT                   IKESEVFMGDFPLMTEKGTFIINGAERVIVSQLVRSPGVYYEQQFDKFGKKLISATVIP
FT                   NRGAWLEYEEDSNDIVYVRIDRTRKVPITVLLRALGYSTDIQILDLLGEEEKLKATLDK
FT                   DTTKSEEEALIEIYKRLRPGEPPTVESAKSLLYALFFDAKRYDLAKVGRYKFNKKLALK
FT                   TRIANLKSAKKIVNPVTGEILVEEGEKISKEKAEEIQNCGINVVEVLVEGKVVKVIGNN
FT                   TVDINKYPMPYDVSSLNIKEAVNLSVLKEILDNFSDEEAVINEIKNRMDELVPKHITKD
FT                   DIIATISYQLNLTHGIGSIDDIDHLGNRRLRSVGELLQNQFRIGLARLERVVKERMTIQ
FT                   DVNEITPQNLINIRPVVAAIREFFGSSQLSQFMDQTNPLAELTHKRRVSALGPGGLSRE
FT                   RAGFEVRDVHYSHYGRICPIETPEGPNIGLIGSLTTYARVNEYGFIEAPYRRVDKTTGT
FT                   VTDEIVYMTADEEDEYIIAQANEPLDENNRFINEKVVCRLKEEIIAVPPTEVDFMDVSP
FT                   KQIVSVATSMIPFLENDDANRALMGSNMQRQAVPLIKPEAPIIGTGIEYKAAVDSGVVV
FT                   LAKNDGVVEKVAADKVVIRTKDGRRDEYNLLKFKRSNQGTCINQRPIVNEGDEVKKGQV
FT                   ICDGPSTDYGELALGKNVLVGFMPWEGYNYEDAILISEELVRDDSLTSIHIEEYDAEAR
FT                   DTKLGPEEITREIPNVGEDALKDLDERGIIRIGAEVTAGDILVGKVTPKGETELTAEER
FT                   LLRAIFGEKAREVRDTSLRVPHGESGIVVDVKVYSRENGDELPPGVNQMVRVFVAQKRK
FT                   ISVGDKMAGRHGNKGVISRILPVEDMPFLPDGTPLQICLNPLGVPSRMNIGQVLEVHLG
FT                   LVAKALGWQIATPVFDGATEEDIQELLAKSGFSPDGKVQLYDGRTGEPFDNKVTVGYMY
FT                   MLKLHHLVDDKMHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEI
FT                   LTVKSDDVSGRVKTYEAIVKGENIPEPGIPESFKVLVKELQSLALDVKVITEDNQEIPL
FT                   KEFEDDDDSDVPDATLNINIEGREDTPPEEVYEESYEEGFEEEIEELPEDIDFEPDSFD
FT                   IENDDLDLEDFDI"
FT   gene            405908..409462
FT                   /locus_tag="Thebr_0377"
FT   CDS_pept        405908..409462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0377"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase alpha
FT                   subunit; RNA polymerase Rpb1 domain 3; RNA polymerase Rpb1
FT                   domain 4; RNA polymerase Rpb1 domain 5; KEGG:
FT                   tpd:Teth39_0367 DNA-directed RNA polymerase subunit beta';
FT                   SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78992"
FT                   /db_xref="GOA:E8UUX7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUX7"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ADV78992.1"
FT                   /translation="MFQLRNFEAIKIGLASPEKIREWSRGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVAHI
FT                   WYVKGIPSRMGLLLDMSPRALEKVLYFVSYVVIDPGDTPLTKKQLLSEKEYRDYLDKYG
FT                   NRFRAGMGAEAIKELLQEIDLEKLSKELRAEIRESTGQKRVRAIRRLEVVQAFIDSGNR
FT                   PEWMILDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDIIV
FT                   RNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPELKVYQCGLPKEMALELFKPFVMKKLVDEGLAQHIKSAKRMVEKVKPEVWD
FT                   VLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRAIKLHPLVCTAYNADFDGDQMAVH
FT                   VPLSMEAQAEARFLMLAANNILKPQDGKPVMTPTQDMVLGCYYLTADEEGVPGEGKYFS
FT                   SPEEAIMAYQLGYIHIHAKIKVKMTKEIDGVKKSKIIETTVGKIIFNEAIPQDLGYVDR
FT                   TNPETAFDLEINDLVDKSKLGKILDRVYRLHGPTKTAETLDKIKELGFRYSTKAAITVS
FT                   VSDMVIPKEKEKLLKEADEMVSKIESQFRRGLISEEERYESVIRTWNMTTEKVTEALMA
FT                   SLDKFNPIFMMAHSGARGSKNQIRQLAGMRGLMADPSGRIIELPIRSNFREGLNVLEFF
FT                   ISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREDDCGADEGIYVEEIREGNEII
FT                   EKLADRIIGRVAAEDVIDNEGNIIVRRNELINEEEAEKIEKAGITKVRIRSLLTCKSRH
FT                   GVCRMCYGRDLATGELVNIGEAVGIIAAQAIGEPGTQLTMRTFHTGGVAGADITQGLPR
FT                   VEELFEARKPKGLAVISEISGVVRINESKKRREVIVTDEENNISKTYLIPYGSRLKVHD
FT                   GQVIQAGDELTEGSVNPHDLLKIKGIFAVQTYLLQEVQKVYRLQGVEINDKHIEVIIRQ
FT                   MMRKVKVEDPGDTSMLPGELIDMFKFEDENKKAIEKGLRPATGRRALLGITKAALATDS
FT                   FLSAASFQETTRVLTDAAIKGKVDPLLGLKENVIIGKLIPAGTGLSRYRNISVVKKVND
FT                   QQERQDKEKEETEVKASN"
FT   gene            409558..409812
FT                   /locus_tag="Thebr_0378"
FT   CDS_pept        409558..409812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0378"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   tpd:Teth39_0368 putative L7Ae-like ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78993"
FT                   /db_xref="GOA:E8UUX8"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUX8"
FT                   /inference="protein motif:PFAM:PF01248"
FT                   /protein_id="ADV78993.1"
FT                   /translation="MAGQDCPSKRVVGAKQTLKAIMNCNVLQVYIAKDAEEHVTKKIKE
FT                   LCEEKSIRIVYVDTMKELGVMCGIDVNAAAAADIIGEKK"
FT   gene            409867..410241
FT                   /locus_tag="Thebr_0379"
FT   CDS_pept        409867..410241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0379"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: tpd:Teth39_0369 30S ribosomal protein S12;
FT                   TIGRFAM: ribosomal protein S12; PFAM: ribosomal protein
FT                   S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78994"
FT                   /db_xref="GOA:E8UUX9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUX9"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADV78994.1"
FT                   /translation="MPTINQLVRQGRKPVKYKSAAPALEGNPQKRGVCVVVKTTTPKKP
FT                   NSALRKIARVRLTNGTEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDA
FT                   AGVANRKQARSRYGAKKPKK"
FT   gene            410320..410790
FT                   /locus_tag="Thebr_0380"
FT   CDS_pept        410320..410790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0380"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: tpd:Teth39_0370 30S ribosomal protein S7;
FT                   TIGRFAM: ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78995"
FT                   /db_xref="GOA:E8UUY0"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUY0"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADV78995.1"
FT                   /translation="MPRKGHVERREVLPDPVYNSKKVSKLINKVMWDGKKSLAQKICYG
FT                   AFDIIREKTGRDPLEVFEEALNNVMPVLEVRPRRVGGATYQVPVEVRPERRLSLGIRWL
FT                   VEYARQRSGKSMMEKLAAEIMDAANNTGGSVKKKEDTHKMAEANKAFAHYRW"
FT   gene            410842..412911
FT                   /locus_tag="Thebr_0381"
FT   CDS_pept        410842..412911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0381"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: tpd:Teth39_0371 elongation factor G; TIGRFAM:
FT                   translation elongation factor G; small GTP-binding protein;
FT                   PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   elongation factor G domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78996"
FT                   /db_xref="GOA:E8UUY1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUY1"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADV78996.1"
FT                   /translation="MPRDYSLDKVRNIGIMAHIDAGKTTTTERILFYTGKVHKLGEVHE
FT                   GTATMDWMVQEQERGITITSAATTCYWKGHKINIIDTPGHVDFTVEVERSLRILDGAVA
FT                   VFSAKEGVEPQSETVWRQADKYHVPRIAYVNKMDIIGADFFNVIKMIKERLGANPVAIQ
FT                   IPIGKEDTFRGIVDLIKMEAIIYEDDLGTVMDETEIPDDLKDLAEEYREKLLEAVSEQD
FT                   ETILEKYLEGEEITEEEIHKALRKGTINGELVPVVCGSSYKNKGIQPMLDAIVRYLPSP
FT                   LDLPPVKGMALATGEEIERKADDSEPFSALAFKIMADPYVGKLAFFRVYSGTLNAGSYV
FT                   LNSTKGKKERISRILQMHANHRQEMEAVYTGDIAAAVGLKDTTTGDTLCDENHPILLES
FT                   MDFPEPVISVAIEPKTKAAQEKMTTALLKLAEEDPTFKTYTDQETGQTIIAGMGELHLE
FT                   IIVDRLRREFNVDCNVGKPQVAYKETITKPVKIEGKFIRQSGGRGQYGHVWLEMEPAPR
FT                   GEGYTFENRIVGGVIPKEYIPAVDAGVQEAMQNGVLGGYPVIDVKVALVDGSYHEVDSS
FT                   DMAFKIAGSIAFKEGMKKANPVLLEPIMKVEVVVPEEYMGDIIGDINARRGRVEGMEAR
FT                   AGAQVIRAFVPLAEMFGYATDLRSKTQGRGTYTMQFHHYEEVPKNIADQILEKK"
FT   gene            412926..414128
FT                   /locus_tag="Thebr_0382"
FT   CDS_pept        412926..414128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0382"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: tpd:Teth39_0372 elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain-containing protein; elongation
FT                   factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78997"
FT                   /db_xref="GOA:E8UUY2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUY2"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADV78997.1"
FT                   /translation="MAKQKFERKKPHVNVGTIGHVDHGKTTLTAAITMVLSKAGMAEAK
FT                   GYDEIDKAPEERARGITINTTHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDPELIELVEMEVRELLNEYEF
FT                   PGDDTPIVVGSALKALECGCGKRECEWCGKIWQLMDVVDEYIPTPERDIDKPFLMPVED
FT                   VFTITGRGTVATGRVERGKVKVGDEVEIIGLTTESRKTVVTGVEMFRKTMDEAQAGDNI
FT                   GVLLRGVQRDEVERGQVLAKPGTIKPHTKFEAQVYVLTKEEGGRHTPFFNGYRPQFYFR
FT                   TTDVTGVINLPDGVEMVMPGDHVTIKVELITPIAMEEGLKFAIREGGRTVGAGVVSAII
FT                   E"
FT   gene            414320..414628
FT                   /locus_tag="Thebr_0383"
FT   CDS_pept        414320..414628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0383"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: tpd:Teth39_0373 30S ribosomal protein S10;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78998"
FT                   /db_xref="GOA:E8UUY3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUY3"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADV78998.1"
FT                   /translation="MPKQKIRIRLKAFDHAILDQSAQKIVETAKRTGAEVSGPIPLPTE
FT                   KDIITILRAPHKYKDSREQFEIRTHKRLIDILNPTPKTVDALMRLDLPSGVDIEIKL"
FT   gene            414713..415345
FT                   /locus_tag="Thebr_0384"
FT   CDS_pept        414713..415345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0384"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: tpd:Teth39_0374 50S ribosomal protein L3;
FT                   TIGRFAM: 50S ribosomal protein L3; PFAM: ribosomal protein
FT                   L3"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADV78999"
FT                   /db_xref="GOA:E8UUY4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUY4"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADV78999.1"
FT                   /translation="MKKGILGRKHGMTQIFDEKGEVIPVTVIEAGPCVVVQKKTVETDG
FT                   YNAIQVGFGDVKEKRLTKPLIGHFKKAGVPFKRYLREFRLDDISGYEVGSEIKVDIFKP
FT                   GDRVDVTGISKGKGFAGVVKRYGANRGPMSHGSKYHRRVGSMGATTDPGRTFKGKIMPG
FT                   HMGHERVTIQNLEVVKVDPELNLLLVKGSVPGPKGSLLIIKDSVKSK"
FT   gene            415363..415983
FT                   /locus_tag="Thebr_0385"
FT   CDS_pept        415363..415983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0385"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG:
FT                   tpd:Teth39_0375 50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79000"
FT                   /db_xref="GOA:E8UUY5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUY5"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADV79000.1"
FT                   /translation="MPKVAVYNVKGEQVGEIELKDSVFGVPVNVPVMHEAVLNYLANQR
FT                   QGTHSTKTRGEVRGGGRKPWRQKGTGRARQGSIRAPQWIKGGIVFGPKPRDYSYKLPKK
FT                   VKRLALKSALSSKVRDNEIIVLDEFKLDQPKTKKVVELLKNFNVDSALIVVPEGEKNVE
FT                   LSARNIPGVKTLYANYLNTYDILKYDKFIITKDAVGIVEEVYA"
FT   gene            415983..416276
FT                   /locus_tag="Thebr_0386"
FT   CDS_pept        415983..416276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0386"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG:
FT                   tpd:Teth39_0376 50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79001"
FT                   /db_xref="GOA:E8UUY6"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUY6"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADV79001.1"
FT                   /translation="MEARDIIIRPVITEKSMNLMSERKYTFIVDKRANKIQIKKAVEDI
FT                   FGVKVDKVYTMNYKGKPKRMGKYEGRTEAYKKAIVKLTPDSKGIEFFEGLQA"
FT   gene            416300..417127
FT                   /locus_tag="Thebr_0387"
FT   CDS_pept        416300..417127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0387"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: tpd:Teth39_0377 50S ribosomal protein L2;
FT                   TIGRFAM: ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79002"
FT                   /db_xref="GOA:E8UUY7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUY7"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADV79002.1"
FT                   /translation="MGIKSFKPTSPGRRQMTVLTFEEVTKDKPEKSLVVTLTKTGGRNV
FT                   YGRITVRHRGGGHKRKYRIIDFKRDKDGIPGKVAAIEYDPNRTAYIALIHYLDGEKRYI
FT                   IAPYGLKVGDIIESGENVDIKVGNALPLRNIPVGTIIHNIELIPGKGGQLVRAAGTAAQ
FT                   LMAKEGDYVQVRMPSGEIRLIKADCRATIGQVSNLDHENVKIGKAGRSRWLGIRPTVRG
FT                   SAMNPVDHPHGGGEGKAPIGHPGPLTPWGKPALGYKTRKKGKASDKFIIRRRK"
FT   gene            417150..417431
FT                   /locus_tag="Thebr_0388"
FT   CDS_pept        417150..417431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0388"
FT                   /product="ribosomal protein S19"
FT                   /note="KEGG: tmt:Tmath_1929 ribosomal protein S19; TIGRFAM:
FT                   ribosomal protein S19; PFAM: ribosomal protein S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79003"
FT                   /db_xref="GOA:E8UUY8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUY8"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADV79003.1"
FT                   /translation="MSRSVKKGPYVDPKLLKKIVEMNKKNEKKVIKTWSRSSTIVPEMV
FT                   GHTIAVHDGRKHVPVYITEAMVGHKLGEFAPTRTFHGHADTEKTSKVK"
FT   gene            417449..417784
FT                   /locus_tag="Thebr_0389"
FT   CDS_pept        417449..417784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0389"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: tpd:Teth39_0379 50S ribosomal protein L22;
FT                   TIGRFAM: ribosomal protein L22; PFAM: ribosomal protein
FT                   L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79004"
FT                   /db_xref="GOA:E8UUY9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUY9"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADV79004.1"
FT                   /translation="MEARAIARYVRISPRKVRLVLNLIRGKHVDEALTILRFTPKRASG
FT                   IVAKVLKSAIANAENNHGMNRDNLYVAKAVADEGPTMKRVFPRAMGRADIMRKRTSHIT
FT                   IVVKEKE"
FT   gene            417798..418463
FT                   /locus_tag="Thebr_0390"
FT   CDS_pept        417798..418463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0390"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; Ribosomal protein S3 domain; KH
FT                   type 2 domain protein; KEGG: tpd:Teth39_0380 30S ribosomal
FT                   protein S3; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79005"
FT                   /db_xref="GOA:E8UUZ0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUZ0"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADV79005.1"
FT                   /translation="MGQKVHPYGLRVGVTQDWLTKWYADDKDFSKLLIEDIKIRNYIKE
FT                   KLYAAGIPKIVIERASNRIKIDIHAAKPGMVIGKGGAGIDKLREELEKMTNKTVILNIV
FT                   EVKTPELSAQLVAENIAAQIEKRISYRRAMKQAIARAMKLGAKGIKIACSGRLAGAEIA
FT                   RTERYHEGVVPLQTLRADIDYGFAEANTTYGKIGVKVWINKGEILPQPKKQVTAEGGK"
FT   gene            418467..418901
FT                   /locus_tag="Thebr_0391"
FT   CDS_pept        418467..418901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0391"
FT                   /product="ribosomal protein L16"
FT                   /note="KEGG: tpd:Teth39_0381 50S ribosomal protein L16;
FT                   TIGRFAM: ribosomal protein L16; PFAM: Ribosomal protein
FT                   L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79006"
FT                   /db_xref="GOA:E8UUZ1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUZ1"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADV79006.1"
FT                   /translation="MLMPKRVKYRKQQRGRIKGNATRGNTLTYGEYGLQALEPGWITAT
FT                   QIEAARVAMTRFIKRGGKVWIKIFPDKPVTKKPAETRMGSGKGSPEFWVAVVKPGRVLF
FT                   EIAGVSEEVAKEALRLAMHKLPIKTKFLKREELGGEDNEG"
FT   gene            418891..419100
FT                   /locus_tag="Thebr_0392"
FT   CDS_pept        418891..419100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0392"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: tpd:Teth39_0382 50S ribosomal protein L29;
FT                   TIGRFAM: ribosomal protein L29; PFAM: ribosomal protein
FT                   L29"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79007"
FT                   /db_xref="GOA:E8UUZ2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUZ2"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADV79007.1"
FT                   /translation="MKAREIRELTNEELLQKLSDLKAELFNLRFQLATGQLDNPMRIRD
FT                   VRKTIARIKTILRERELGIRQNKA"
FT   gene            419118..419372
FT                   /locus_tag="Thebr_0393"
FT   CDS_pept        419118..419372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0393"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: tpd:Teth39_0383 30S ribosomal protein S17;
FT                   TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal protein
FT                   S17"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79008"
FT                   /db_xref="GOA:E8UUZ3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUZ3"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADV79008.1"
FT                   /translation="MERGYRKVRIGTVVSNKMQKTIVVAVEDRVRHPLYGKTIKRTKKF
FT                   KVHDENNVCNVGDIVKIMETRPLSKEKRWRLVEIVKRAE"
FT   gene            419394..419762
FT                   /locus_tag="Thebr_0394"
FT   CDS_pept        419394..419762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0394"
FT                   /product="ribosomal protein L14"
FT                   /note="KEGG: tpd:Teth39_0384 50S ribosomal protein L14;
FT                   TIGRFAM: ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79009"
FT                   /db_xref="GOA:E8UUZ4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUZ4"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADV79009.1"
FT                   /translation="MIQPQTRLKVADNTGAKEIMCIRLEGGSNRKFSNVGDVIVASVKS
FT                   ATPGGVVKKGEVVKAVIVRTKKGIARKDGTYIRFDDNAAVIIRDDKQPRGTRIFGPVAR
FT                   ELREKDFMKIISLAPEVL"
FT   gene            419775..420098
FT                   /locus_tag="Thebr_0395"
FT   CDS_pept        419775..420098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0395"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: tpd:Teth39_0385 50S ribosomal protein L24;
FT                   SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79010"
FT                   /db_xref="GOA:E8UUZ5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUZ5"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADV79010.1"
FT                   /translation="MAQNKLHVKKGDMVVVISGKDKGKKGKVLQAFPKEGKVIVEGVNI
FT                   VTKHRKATSPQKPGGIIHQEAPIYSSKVMLYCENCGRGVRYGVKVLENGEKIRYCKRCN
FT                   ETL"
FT   gene            420122..420661
FT                   /locus_tag="Thebr_0396"
FT   CDS_pept        420122..420661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0396"
FT                   /product="50S ribosomal protein L5"
FT                   /note="KEGG: tpd:Teth39_0386 50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79011"
FT                   /db_xref="GOA:E8UUZ6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUZ6"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0386"
FT                   /protein_id="ADV79011.1"
FT                   /translation="MSRLREKYEKEVVPALMERFGYKNIMQVPKVEKVVINIGVGEAKE
FT                   NPKALEAAVDDLTMIAGQKPVITRAKRSIANFKIRKGMPIGVKVTLRGERMYEFMDKLF
FT                   NIALPRVRDFKGVSPNSFDGRGNYALGIKEQLIFPEIDYDKIDKIRGMDIIIVTTAKTD
FT                   EEAKGLLELLGMPFAK"
FT   gene            420678..420863
FT                   /locus_tag="Thebr_0397"
FT   CDS_pept        420678..420863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0397"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: tpd:Teth39_0387
FT                   30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79012"
FT                   /db_xref="GOA:E8UUZ7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUZ7"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ADV79012.1"
FT                   /translation="MARKALIVKQQKPQKYKTREYNRCKICGRPHAYLRKFGMCRICFR
FT                   KYAHQGMIPGVKKASW"
FT   gene            420882..421280
FT                   /locus_tag="Thebr_0398"
FT   CDS_pept        420882..421280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0398"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: tpd:Teth39_0388
FT                   30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79013"
FT                   /db_xref="GOA:E8UUZ8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUZ8"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADV79013.1"
FT                   /translation="MVMTDPIADMLTRIRNANIARHETVEIPASNMKRAIAMIMLKEGF
FT                   IKSVEEIDDGKGGILKLTLKYGPNKERVISGLKRISKPGLRVYARHDELPRVLGGLGIA
FT                   IISTSKGIMTDKEARKAGVGGEVICYIW"
FT   gene            421303..421845
FT                   /locus_tag="Thebr_0399"
FT   CDS_pept        421303..421845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0399"
FT                   /product="ribosomal protein L6"
FT                   /note="KEGG: tpd:Teth39_0389 50S ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79014"
FT                   /db_xref="GOA:E8UUZ9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E8UUZ9"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ADV79014.1"
FT                   /translation="MSRIGRLPIEIPKGVEVKVSPDNVVTVKGTKCTLEKKFPPIVNIE
FT                   VKDNQVIVTRNGDDKEERAMHGTTRAIIANMVKGVTQGFEKTLEIVGIGYRAAKQGKKL
FT                   VLNVGYSHPVEIEEEPGIEIVVEGNNKIIVRGADKEKVGQVAANIRRVREPDAYQGKGI
FT                   RYAGEVVRLKEGKTGKK"
FT   gene            421854..422222
FT                   /locus_tag="Thebr_0400"
FT   CDS_pept        421854..422222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0400"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: tpd:Teth39_0390 50S ribosomal protein L18;
FT                   TIGRFAM: ribosomal protein L18; PFAM: ribosomal protein
FT                   L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79015"
FT                   /db_xref="GOA:E8UV00"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV00"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADV79015.1"
FT                   /translation="MMITKPNRNELRKRRHLRVRKKVFGTPERPRLNVFRSLKHIYAQI
FT                   IDDTKGHTLVHASTLDPELRGIAKGANKQSAKLVGELIAKRALEKGIKDVVFDRGGYIY
FT                   HGVVKELADAARQAGLNF"
FT   gene            422239..422742
FT                   /locus_tag="Thebr_0401"
FT   CDS_pept        422239..422742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0401"
FT                   /product="ribosomal protein S5"
FT                   /note="KEGG: tpd:Teth39_0391 30S ribosomal protein S5;
FT                   TIGRFAM: ribosomal protein S5; PFAM: ribosomal protein S5
FT                   domain protein; Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79016"
FT                   /db_xref="GOA:E8UV01"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV01"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADV79016.1"
FT                   /translation="MARVDWTKLDLKERVVSINRVSKVVKGGKNFRFSVTVVVGDAERG
FT                   YVGVGRGKAAEIPDAIRKAIEDAKKHLIKVPIVGTTIPHEVIGEFGAGKVLLKPAREGT
FT                   GVIAGGPVRAVLESAGIKDVLTKSLGSSNATNMVYATIEGLKRLRTAEDVAKLRGIPVS
FT                   QLFE"
FT   gene            422770..423213
FT                   /locus_tag="Thebr_0402"
FT   CDS_pept        422770..423213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0402"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; KEGG:
FT                   tpd:Teth39_0392 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79017"
FT                   /db_xref="GOA:E8UV02"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV02"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADV79017.1"
FT                   /translation="MRLHDLKPAEGARRERKRVGRGIGSGHGKTSGRGQKGQKARSGGG
FT                   VRPGFEGGQMPLTRRLPKRGFTNIFKKEYAIVNVGTLEERFEDGAVITPEALIESGIIK
FT                   DVKDGVKILGDGDLNKKFTVRAHKFSQSAIEKIQAVGGKAEVI"
FT   gene            423215..424471
FT                   /locus_tag="Thebr_0403"
FT   CDS_pept        423215..424471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0403"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="KEGG: tpd:Teth39_0393 preprotein translocase subunit
FT                   SecY; TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79018"
FT                   /db_xref="GOA:E8UV03"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV03"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ADV79018.1"
FT                   /translation="MFQTLVNAWNVDDVRKRILYTLGMLVIFRVGSHIPVPGIDPKVIA
FT                   NILGQGQLFGFFDIISGGAFSNFTIFAMSITPYINASIIMQLLTIAIPSLEQLAKEGEE
FT                   GRKKIAQYTRYLTVVLALIQAIGMTIGLKSAVINPTFFNLTVIVITLTAGTAFLMWLGE
FT                   KITENGIGNGSSLIIFAGIISRIPNMIYLTSQYIQAGTANIFGAIAFVVAELIMIVLII
FT                   LATEGQRRIPVQYAKRVVGRKVYGGQSTHIPIRINMAGVIPIIFALSLLQFPQQLATFF
FT                   PRSSFYNFVQKWLSTSGLIYNILDILLIIGFTYFYTAVIFNPVDVSDNLKKYGGFIPGI
FT                   RPGKPTTDFLTRVLNRVTFVGALFLAFIATMPVILMNITGLQLYFGGTALLIAVGVALD
FT                   TMKQIEGHLIMRNYQGFLK"
FT   gene            424486..425139
FT                   /locus_tag="Thebr_0404"
FT   CDS_pept        424486..425139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0404"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: tpd:Teth39_0394 adenylate kinase; TIGRFAM:
FT                   adenylate kinase; PFAM: adenylate kinase; adenylate kinase
FT                   lid domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79019"
FT                   /db_xref="GOA:E8UV04"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV04"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADV79019.1"
FT                   /translation="MRVILLGPPGAGKGTQAVKIAKEFDIPHISTGDIFRQNLRDNTDL
FT                   GKLAKEYMDKGLLVPDEVTNKIVEDRLEKDDCQKGFLLDGYPRNVAQAEELDRFLHDKG
FT                   IHLDCVLNIEVDREALIERITGRRVCPNCGATYHIKTSPPAVDNVCDKCGAQLIQRSDD
FT                   KLESVVKRLEVYESQTKPLIEYYTKKNTLVNIDGNKSVEEVFEDIKKALGDRGK"
FT   gene            425136..425882
FT                   /locus_tag="Thebr_0405"
FT   CDS_pept        425136..425882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0405"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: tpd:Teth39_0395 methionine aminopeptidase,
FT                   type I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79020"
FT                   /db_xref="GOA:E8UV05"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV05"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADV79020.1"
FT                   /translation="MIYIKSKNEIDLMRTAGKVIANLFEVLERAIKPGVTTLELDRIAE
FT                   EFIIKNGCKPAFKGLYGFPASICTSINEEVVHGIPSLRKLKEGDIISIDLGATYKGYNA
FT                   DAARTFLVGEISEEAQKLIEVTKNSFFEGIKYAKEGNRLSDISYAIQTYVESHGFSVVR
FT                   EYVGHGIGIKMHEDPQIPNFGPPGRGPRLKRGMCLAIEPMVNAGHYAVRTLEDNWTVVT
FT                   VDGSLSAHYENTIVITEGDPEILTIL"
FT   gene            425898..426164
FT                   /locus_tag="Thebr_0406"
FT   CDS_pept        425898..426164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79021"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV06"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0396"
FT                   /protein_id="ADV79021.1"
FT                   /translation="MEDLQIGQVVRSKAGRDKGRVFVVVGKFDDQHVLVADGDLRKIEK
FT                   PKKKKFKHLQRYNDVIWQIKEKILRGDKITNEEIRKFLEPYKS"
FT   gene            426189..426407
FT                   /locus_tag="Thebr_0407"
FT   CDS_pept        426189..426407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0407"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: tpd:Teth39_0397 translation initiation factor
FT                   IF-1; TIGRFAM: translation initiation factor IF-1; PFAM: S1
FT                   IF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79022"
FT                   /db_xref="GOA:E8UV07"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV07"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ADV79022.1"
FT                   /translation="MAKEDVIEVEGTVIEALPNAMFQVQLDNGHKVLAHVSGKLRMNFI
FT                   RILPGDRVTVELSPYDLSRGRIVWRGK"
FT   gene            426424..426537
FT                   /locus_tag="Thebr_0408"
FT   CDS_pept        426424..426537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0408"
FT                   /product="ribosomal protein L36"
FT                   /note="KEGG: tpd:Teth39_0398 50S ribosomal protein L36;
FT                   TIGRFAM: ribosomal protein L36; PFAM: ribosomal protein
FT                   L36"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79023"
FT                   /db_xref="GOA:E8UV08"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV08"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ADV79023.1"
FT                   /translation="MKVRPSVKPICEKCKVIKRKGRVMVICENPKHKQKQG"
FT   gene            426549..426917
FT                   /locus_tag="Thebr_0409"
FT   CDS_pept        426549..426917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0409"
FT                   /product="30S ribosomal protein S13"
FT                   /note="KEGG: tmt:Tmath_1908 30S ribosomal protein S13;
FT                   TIGRFAM: 30S ribosomal protein S13; PFAM: ribosomal protein
FT                   S13"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79024"
FT                   /db_xref="GOA:E8UV09"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV09"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ADV79024.1"
FT                   /translation="MARIAGVDLPRDKRVEIALTYIYGIGRSRSNEILAKAGVNPDTRV
FT                   KDLTEEEVSRLREIIDKEYKVEGDLRKEVAMNIKRLMDIGCYRGIRHKRGLPVRGQRTR
FT                   TNARTRKGPRKTVAKKKK"
FT   gene            426936..427328
FT                   /locus_tag="Thebr_0410"
FT   CDS_pept        426936..427328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0410"
FT                   /product="30S ribosomal protein S11"
FT                   /note="KEGG: tpd:Teth39_0400 30S ribosomal protein S11;
FT                   TIGRFAM: 30S ribosomal protein S11; PFAM: ribosomal protein
FT                   S11"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79025"
FT                   /db_xref="GOA:E8UV10"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV10"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ADV79025.1"
FT                   /translation="MAKRVKRAGRKREKKHVERGIAHIHSTFNNTIVTITDPAGNTISW
FT                   ASAGTIGFKGSRKSTPFAAQMAAESAAKSAMEHGMKTVDVYVKGPGAGREAAIRALQAA
FT                   GLEVSLIKDVTPIPHNGCRPPKRRRV"
FT   gene            427341..427961
FT                   /locus_tag="Thebr_0411"
FT   CDS_pept        427341..427961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0411"
FT                   /product="ribosomal protein S4"
FT                   /note="TIGRFAM: ribosomal protein S4; PFAM: RNA-binding S4
FT                   domain protein; ribosomal protein S4; KEGG: tpd:Teth39_0401
FT                   30S ribosomal protein S4; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79026"
FT                   /db_xref="GOA:E8UV11"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV11"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ADV79026.1"
FT                   /translation="MGRYTGPTCRLCRREGMKLYLKGDKCYTDKCPFARRGYAPGQHGQ
FT                   EKKKLTNYGMQLREKQKLKRYYGVLERQFERLYEEAERMKGITGENLLQLLERRLDNVV
FT                   FRLGFAASRPQARQLVSHGHIEVNGKKVDIPSFLVKPGDVISVREKSRSMELIKNNLEV
FT                   SRNVPDWLELNKDAFEGRVVSLPRREHIDLPIQEHLIVELYSK"
FT   gene            428010..428957
FT                   /locus_tag="Thebr_0412"
FT   CDS_pept        428010..428957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0412"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase dimerisation;
FT                   RNA polymerase alpha subunit domain protein; KEGG:
FT                   tpd:Teth39_0402 DNA-directed RNA polymerase subunit alpha;
FT                   SMART: RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79027"
FT                   /db_xref="GOA:E8UV12"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV12"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ADV79027.1"
FT                   /translation="MFEMIEPKIEIIEQSEDGTYGKFVVEPLERGYGITLGNSLRRVLL
FT                   SSLPGAAPKSVKIDGVLHEFSTLPGVKEDVVEIILNLKEVAVKLHSDEPVVGRIDVEGR
FT                   GEVTAGHIKGSADIEILNPDHHIATLSDDGKLHMEIVFVKGKGYVPSDKNKEPNQPIGV
FT                   IPVDSIFTPVKRVSYNVENTRVGHVTDYDKLTLEVWTNGAVTPKEAISMASDMLIKYFQ
FT                   KFISFTGEYKSSDIFVDKPEKKVEKPLDMTIEELDLSVRSYNCLKRAGINTVQELTQKT
FT                   EEEMMKVRNLGKKSLEEVKQKLEALGLSLKKADE"
FT   gene            428971..429309
FT                   /locus_tag="Thebr_0413"
FT   CDS_pept        428971..429309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0413"
FT                   /product="ribosomal protein L17"
FT                   /note="KEGG: tit:Thit_1943 ribosomal protein L17; TIGRFAM:
FT                   ribosomal protein L17; PFAM: ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79028"
FT                   /db_xref="GOA:E8UV13"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV13"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADV79028.1"
FT                   /translation="MGYRKLGRPSDQRRAMLRNLVTDFLKYGRITTTEARAKEVRSISE
FT                   KMITLGKRGDLHARRQALAYILDESVVKKLFDEIAPKYKDRQGGYTRILKLGPRRGDGA
FT                   PLVIIELV"
FT   gene            429392..430225
FT                   /locus_tag="Thebr_0414"
FT   CDS_pept        429392..430225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0414"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_0404 cobalt transporter ATP-binding
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79029"
FT                   /db_xref="GOA:E8UV14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV14"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADV79029.1"
FT                   /translation="MEHVINTQNLSFEYHAEEQTRHLVLKDINLQFEKGQFIGIIGHNG
FT                   SGKSTLAKHFNALLLPTEGKVYVKGMDTKDTNHLWDIRQAAGLVFQNPDNQIVAAIVEE
FT                   DVAFGPENLGIPPDEIRERVEYALKAVGMWEYKDYPPHMLSGGQKQRVAIAGIIAMKPE
FT                   CIILDEPTAMLDPIGRREVISTIKKLNKEDGITVILITHFMEEVVDADRVIVMDDGKVV
FT                   LDGTPKEVFKEVTLLKKIGLSVPQVTELAHQLKREGFDVPLDILTVEEMVEFLCR"
FT   gene            430216..431076
FT                   /locus_tag="Thebr_0415"
FT   CDS_pept        430216..431076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0415"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_0405 cobalt transporter ATP-binding
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79030"
FT                   /db_xref="GOA:E8UV15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV15"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADV79030.1"
FT                   /translation="MPIKVENLSFVYNEGTPYATVALNNVTFEIQDEEFVGIIGHTGSG
FT                   KSTLIQHLNGLLKPTSGKIYINGVDITDKKVSLKDVRKEVGLVFQYPEYQLFEETIFKD
FT                   IAFGPTNLGLSEEEIEKRVYEAMDIVGISRELADKSPFEVSGGQKRRIAIAGILAMKPK
FT                   ILILDEPTAGLDPKGKEEILNKIKEIHDKYKMITILVSHSMEDIARFADKIIVMNKGRI
FT                   EVIGTPREVFREAEKLEKIGLGVPQITSLARELQKKGVAIPEDILTIEEAKEYIVRYLR
FT                   GTKNV"
FT   gene            431069..431875
FT                   /locus_tag="Thebr_0416"
FT   CDS_pept        431069..431875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0416"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG:
FT                   tpd:Teth39_0406 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79031"
FT                   /db_xref="GOA:E8UV16"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV16"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADV79031.1"
FT                   /translation="MFRNITIGQYIPGDSVVHKLDPRIKIIITFIFIVATFLINKLSGY
FT                   LFAVFYLYLIITISKIPFSYILKGLRPVIIILLLTVSLNMFFTPGGTILYTLGPLKITT
FT                   TGLRLAVFMGLRLIFLIIGTSLLTLTTSPISLTDGIEHILKPFSRIGVPAHELAMMMTI
FT                   ALRFIPTLIEEAEKIMKAQMARGADFESGNIVKRAKGLVPLLVPLFISAFRRADELAVA
FT                   MESRCYRGGQNRTRMKQLKIQPRDYQALAVTLIMVLLIVWNRVWTW"
FT   gene            431878..432612
FT                   /locus_tag="Thebr_0417"
FT   CDS_pept        431878..432612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0417"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="KEGG: tpd:Teth39_0407 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: Pseudouridine
FT                   synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79032"
FT                   /db_xref="GOA:E8UV17"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV17"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADV79032.1"
FT                   /translation="MRNVMIVVEYDGTNYHGWQYQKNAVTVQEVLQKAIKKVTGEEVNL
FT                   IGASRTDTGVHALYQVANFKTNTKIPAEKLPYALNSVLPDDIVVVQAKDVEDSFHARYS
FT                   AKRKRYKYIILNRKFQMPTMRNYCWHISYPLNIEEMKKAASYLIGTHDFSAFKASGSSK
FT                   TSTIRTVYDLTIEKNEDFINIEIEANGFLYNMVRIIVGTLSYVGLGKIKEDEVYDILKS
FT                   KDRTKAGITAPPQGLYLIKIIY"
FT   gene            432701..433132
FT                   /locus_tag="Thebr_0418"
FT   CDS_pept        432701..433132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0418"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: tpd:Teth39_0408 50S ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79033"
FT                   /db_xref="GOA:E8UV18"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV18"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADV79033.1"
FT                   /translation="MKSYMAKPEEVKRKWFVIDAEGKVLGRLASQIAKILMGKHKPTYT
FT                   PHVDTGDFVIVLNAEKIVLTGNKLEDKYYKYYTGYPGGLKEVQYKKLMQTKPEFVIYHA
FT                   VKGMLPKNRLGRRMIKRLKVYRGSEHKHQAQKPEKLDIE"
FT   gene            433147..433539
FT                   /locus_tag="Thebr_0419"
FT   CDS_pept        433147..433539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0419"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: tpd:Teth39_0409
FT                   30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79034"
FT                   /db_xref="GOA:E8UV19"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV19"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADV79034.1"
FT                   /translation="MATVQYYGTGRRKEAVARVRLMPGKGNIIINNRPLEEYFTLDTLK
FT                   YTVKQPLILTETIDKFDVYAKVSGGGLTGQAGAVRLGIARALVKVDSELRPILKKAGFL
FT                   TRDPRMKERRKYGLKKARKAPQFSKR"
FT   gene            433871..435471
FT                   /locus_tag="Thebr_R0009"
FT   rRNA            433871..435471
FT                   /locus_tag="Thebr_R0009"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            435539..435614
FT                   /locus_tag="Thebr_R0010"
FT                   /note="tRNA-Ala1"
FT   tRNA            435539..435614
FT                   /locus_tag="Thebr_R0010"
FT                   /product="tRNA-Ala"
FT   gene            435616..435692
FT                   /locus_tag="Thebr_R0011"
FT                   /note="tRNA-Ile1"
FT   tRNA            435616..435692
FT                   /locus_tag="Thebr_R0011"
FT                   /product="tRNA-Ile"
FT   gene            435760..439106
FT                   /locus_tag="Thebr_R0012"
FT   rRNA            435760..439106
FT                   /locus_tag="Thebr_R0012"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            439300..439374
FT                   /locus_tag="Thebr_R0013"
FT                   /note="tRNA-Asn1"
FT   tRNA            439300..439374
FT                   /locus_tag="Thebr_R0013"
FT                   /product="tRNA-Asn"
FT   gene            439381..439455
FT                   /locus_tag="Thebr_R0014"
FT                   /note="tRNA-Glu2"
FT   tRNA            439381..439455
FT                   /locus_tag="Thebr_R0014"
FT                   /product="tRNA-Glu"
FT   gene            439465..439540
FT                   /locus_tag="Thebr_R0015"
FT                   /note="tRNA-Met3"
FT   tRNA            439465..439540
FT                   /locus_tag="Thebr_R0015"
FT                   /product="tRNA-Met"
FT   gene            439566..439642
FT                   /locus_tag="Thebr_R0016"
FT                   /note="tRNA-Asp1"
FT   tRNA            439566..439642
FT                   /locus_tag="Thebr_R0016"
FT                   /product="tRNA-Asp"
FT   gene            439652..439727
FT                   /locus_tag="Thebr_R0017"
FT                   /note="tRNA-Phe1"
FT   tRNA            439652..439727
FT                   /locus_tag="Thebr_R0017"
FT                   /product="tRNA-Phe"
FT   gene            439757..439831
FT                   /locus_tag="Thebr_R0018"
FT                   /note="tRNA-Thr2"
FT   tRNA            439757..439831
FT                   /locus_tag="Thebr_R0018"
FT                   /product="tRNA-Thr"
FT   gene            440086..441372
FT                   /locus_tag="Thebr_0420"
FT   CDS_pept        440086..441372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0420"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: tpd:Teth39_0411 helix-turn-helix
FT                   domain-containing protein; PFAM: helix-turn-helix domain
FT                   protein; Tetratricopeptide TPR_1 repeat-containing protein;
FT                   SMART: helix-turn-helix domain protein; Tetratricopeptide
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79035"
FT                   /db_xref="GOA:E8UV92"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV92"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADV79035.1"
FT                   /translation="MEFLTPGERVKKIRKMLKMKQRELKSENITRGFISMIESGRSTMS
FT                   KETASIIADKFNKRAQELGIDLNIDGNYLLMTPAEEAEYYCIQKLEEIRSLEDLNELKE
FT                   IFEIADKYKIKRVTALAYVKIGDIMYSSCNYQDAFTNYYKALDILLLNNIKDQLPYTYN
FT                   MLGACKVNMLEFSEAIIYFDKAIEYADEINAIDIKNKAIYNSALCYRCIGQPIIAIDYI
FT                   DKYLSTGDKEKDFVHYIYANSIKANCYRDMGNYEKALEIFKRLVGEIVDEEHHLLGYLY
FT                   TNIGEIYMEKNNFKESLEYFNKAERIRRKKDENLLGHTLIEKANLYIKMKLYDEARSLL
FT                   EEGLEISYRNSDIEYVVKGSYLLIEVYKQLGSKQAIIEIYKKMIDVLQGTSNKKEVLKV
FT                   YIELSLLYIEDNDITNSSYYLQKAREIIK"
FT   gene            441472..441723
FT                   /locus_tag="Thebr_0421"
FT   CDS_pept        441472..441723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tit:Thit_0939 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79036"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV93"
FT                   /inference="similar to AA sequence:KEGG:Thit_0939"
FT                   /protein_id="ADV79036.1"
FT                   /translation="MIKKLKALLTLVIGIILFTYMAVVIPFENPPVWVICLSCELLPLC
FT                   GGGCPGLIFDRYGTLQEVDPRCCRRKNNETPNNRQKCQ"
FT   sig_peptide     441472..441540
FT                   /locus_tag="Thebr_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.792 at
FT                   residue 23"
FT   gene            441689..442675
FT                   /locus_tag="Thebr_0422"
FT   CDS_pept        441689..442675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0422"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_0412 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79037"
FT                   /db_xref="GOA:E8UV94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV94"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADV79037.1"
FT                   /translation="MKPQIIVKNVSKTYKVYIKENGMINAVKSFFNRKYKYIQAVKDIS
FT                   FTVNQGEILGLIGLNGAGKTTTIKLVSGIIKADKGIIRVLGKDPFLRSKEYRNKVSLVM
FT                   GQKGQLDPDLSIIDSVKLFASIYSIDKKEAISRTKSMAEELNLSEIDLQKQVRTLSLGQ
FT                   RMKGELILSFIHLPVIVFLDEPTLGLDFITQRAIRNYLKNYKKKYNASIILTSHYITDI
FT                   EDLCDNIYILHKGHELYYGTIDKLKSMVPNIRKVRFNASNCAIERISKYYKVEKADEEQ
FT                   EYFIRFNPHETINVMKILSNEIEVSNINFHDDTLDIIIESLYKGAEK"
FT   gene            442672..443466
FT                   /locus_tag="Thebr_0423"
FT   CDS_pept        442672..443466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0423"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   tpd:Teth39_0413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79038"
FT                   /db_xref="GOA:E8UV95"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV95"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADV79038.1"
FT                   /translation="MKTLYTFMGYFEYSIKKLLMYRIYIIGELLSSLIVPVIISFFLWR
FT                   ALIETNPINYSLKEMMIYIIISNIILLFTQIHAEHDIERDIKTYRLGQKLLLPIDYLTS
FT                   ISYSYLTSSLAKFTIVYLPIIVIISIWAKIEIPANRLLYLPITLTFGFLLNALFSFIIG
FT                   LLSFWLTEIWGIAAVRNLLTGLFSGAIFPLDLLPKKVESFMLLTPFPYMTFIPAKLISD
FT                   DSFDIKIVNKGLFISLIWVLILGLIVFLLVKNGLKKYTSHGA"
FT   gene            443456..444232
FT                   /locus_tag="Thebr_0424"
FT   CDS_pept        443456..444232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0424"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   tpd:Teth39_0414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79039"
FT                   /db_xref="GOA:E8UV96"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV96"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADV79039.1"
FT                   /translation="MGRENMLIESVKFSIKKAIQYRANLISWFLADLSLYTAIFLGYYL
FT                   LTQRITVFGDYRREQILFYITCFFLVNNIYAIFFAEAVSKFGQSVLTGYFDFDLLKPQP
FT                   LIKYIVLKNLNFPAALSTPLLIFLNIYCLKLCGIKLTIPYIISIFSASILMGLLFFIVY
FT                   SFTLLGLRSEAISAIVLQLLTMAEKPDTVFPKILRNLLIYAIPIFLFSAIPARIALGKS
FT                   SIYENIWCYLSPLLYYLVLKIILCQGLKKYQSGGEL"
FT   gene            444229..445428
FT                   /locus_tag="Thebr_0425"
FT   CDS_pept        444229..445428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0425"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: tpd:Teth39_0415 radical SAM domain-containing
FT                   protein; PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79040"
FT                   /db_xref="GOA:E8UV97"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV97"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADV79040.1"
FT                   /translation="MNKILEYLKYCKHSNIILTGGMKIFDTITEYYIEKGIQPSYPLYL
FT                   SLSVTSMCNGQCLLCSSESKKFWSGEIDKANPLLKKRLVELSENNPPVVFILSGGEPLL
FT                   FPTRCKEYLEIFYDTSVIFGLFSNLALDLDYKRLKIVEILEERPFSFIQTSIDSIDKNE
FT                   HELLRKGTNLAVILSNIKYLKRKNIKIKVNTTISPYNYKSIMDIVKYVFNEGIESLHIN
FT                   PVLPFGRAKDKIDERLCIEIVDALIKVVSSREFNNIKEHSITFPSELIPLSYIGSKYED
FT                   ILEVYDNSKKMKNKFLSHQFVCGISHENCTCGIGWFPEIYISLEDKKIEEAFRIALSYG
FT                   KKYYYATCEKCYQYYNCDFESSYTGKCLMMELYNKIEYILNYNTPLSEEESIRRKCLMN
FT                   "
FT   gene            445446..446429
FT                   /locus_tag="Thebr_0426"
FT   CDS_pept        445446..446429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0426"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   tpd:Teth39_0416 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79041"
FT                   /db_xref="GOA:E8UV98"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV98"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADV79041.1"
FT                   /translation="MFEVIIGMTRECNGNCNFCQVGGPQRDINKRFDYKQLVRFLKGNN
FT                   YHIQITGGEPLIRKKELAPLIQDLKEDGHMITLLTNLVLIDKKFIELLKESFSILDVVQ
FT                   VSIYAHNPQLHEIISGRNDWSKLNALITELINNGIQLRANLTLTKENVRYIKEIYNFYK
FT                   SLGVKQISISSLIKKGRAFHLVDEKYIYDYIYYMYEFLEKNNPKFITISIPIELLKTYS
FT                   NIKSNFGHYVKNDNLIVLEKDKLYIHYDGNVYSLLTGKLICEISANNAKNIVIPPLKRN
FT                   LSKSECARCHAFYLCKGREDFELIRAKYGNLNFSQCDLELENINVL"
FT   gene            446999..447241
FT                   /pseudo
FT                   /locus_tag="Thebr_0427"
FT   gene            447258..447524
FT                   /pseudo
FT                   /locus_tag="Thebr_0428"
FT   gene            447662..448441
FT                   /locus_tag="Thebr_0429"
FT   CDS_pept        447662..448441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0429"
FT                   /product="transcriptional activator of acetoin/glycerol
FT                   metabolism-like protein"
FT                   /note="KEGG: tpd:Teth39_0419 transcriptional activator of
FT                   acetoin/glycerol metabolism-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79042"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E8UV99"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0419"
FT                   /protein_id="ADV79042.1"
FT                   /translation="MEYLCSQEELISFYEQCNKIGLPFSINKPLVCLNIQDLEVKIQKN
FT                   QKLTDTFRCCAEKNWVRGKYLFLLADVEGYLLEVKCSIEEEKYVKDSGFRPGVSFKEES
FT                   CGTNAISMAMRLKRVVYIRAYEHYCDIFKKWYCIASHITTKNGEIVGYVDISIINEKIA
FT                   DEITIVIKLLAEKIANKYENRVKEEELKDFKIKLNDKQIKILTLEAKGYKELAIAELIF
FT                   KDSGQILMSKLINKAVKNPVRRKSSSNIEATKYKDER"
FT   gene            complement(448443..448594)
FT                   /pseudo
FT                   /locus_tag="Thebr_0430"
FT   gene            448576..448869
FT                   /locus_tag="Thebr_0431"
FT   CDS_pept        448576..448869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0431"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: tpd:Teth39_0420 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79043"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVA0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0420"
FT                   /protein_id="ADV79043.1"
FT                   /translation="MKTGQDSRMEGEKILLSKYVIKIPVDNKETLLYNSITKSLISLPT
FT                   SKEDVEIFIKKLNQEELQYLSKELYLQFDEINEEKLVDLCQYGSEKYFVYLD"
FT   gene            complement(449074..453511)
FT                   /pseudo
FT                   /locus_tag="Thebr_0432"
FT   gene            complement(449945..450745)
FT                   /locus_tag="Thebr_0433"
FT   CDS_pept        complement(449945..450745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0433"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: tpd:Teth39_2047 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79044"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UT84"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADV79044.1"
FT                   /translation="MFTQYFGMKFNPFSKEISVNDLYISEDIAELNARLKYLQETRGIG
FT                   LIVGEAGSGKSTALRRYAESLNRSTFKPCYFALSTLTVREFYQALAMILGETPSYKKVT
FT                   LFHQIQRAITELYYSQKITPVIILDEIQLVSNDVLEDLRIIFNFNMDSQNPYILILSGQ
FT                   PHIRNKLALNVNSALRQRISIKYVMQGLKKEEIQDYIKTRMKIAGVMDDIFTPSAYEAI
FT                   YSLTKGLPRIINNLVTASLLYAYSKRLREIDEEVIYQAQNEISL"
FT   gene            complement(450762..452087)
FT                   /locus_tag="Thebr_0434"
FT   CDS_pept        complement(450762..452087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0434"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; Transposase-like
FT                   Mu; KEGG: tpd:Teth39_2048 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79045"
FT                   /db_xref="GOA:E8UVA2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVA2"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADV79045.1"
FT                   /translation="MLDEKAREAIALKRFSLISPVLNGQVKNQKEYFDALSDKPIEIPY
FT                   LGMRRYTPKTLRGWLYQYLRGGIEALKPGYRSDRGKYRKINFELSEKIKQKKLEHPEMP
FT                   NKLLYETLIGEGIISPDKVSLSTFYRFLKNIPVKSLDKEKEGKTKRFSHEFINELWQTD
FT                   VMYGPYIKEGKTKRQTYLIAYIDDASRLCTYARFYYTQNFLALRDSFKEAVLRRGIPKM
FT                   LYTDNGKIYRSTQFEYICASLGTSLIHAEPFSPHSKGKIERFFHTVRMRFLSTIDPTSI
FT                   KSIDELNMMFFKWLEDDYNRKEHSSIGMSPLDFFMSQISRVNMCGDIDMLNECFLIRVN
FT                   RKVNKDATLKVENILYETEEKFKGMRLEVRYDPQWLKDNTPLLLFHEGKKVGEAYKVNF
FT                   HENAKIPVEYIEDRKVVSENEDTVDFAAKPNPPVISFNDIID"
FT   gene            complement(452224..452805)
FT                   /locus_tag="Thebr_0435"
FT   CDS_pept        complement(452224..452805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79046"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVA3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0424"
FT                   /protein_id="ADV79046.1"
FT                   /translation="MQIVFHVDNIEEYLRKGKDYNFPAPPDRCPYPDCKCRVKLKKHGF
FT                   YYRYYLDGPNCIKIAIRRYICPVCKRTLSYLPDFCLPHFQYSFNMIVKSLKETLTREKT
FT                   LSSFISDLKRNFPTILFSRQHIYFYTKRIMNNLSFIIYGLRQIDPYIKLSETDSQRERA
FT                   REILDIISIVPLFSQRFYAHCQKSFLASLT"
FT   gene            complement(453602..454390)
FT                   /locus_tag="Thebr_0436"
FT   CDS_pept        complement(453602..454390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0436"
FT                   /product="Integrase catalytic region"
FT                   /note="KEGG: tpd:Teth39_0426 integrase catalytic subunit;
FT                   manually curated; PFAM: Integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79047"
FT                   /db_xref="GOA:E8UVA4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVA4"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADV79047.1"
FT                   /translation="MFEFIEENKKYHDVKLMCEVLKVSRSSYYKYLHKTESKRSRENRM
FT                   YEEEIMKIYEESKKRYGAPKIHKMLVNKGYNISLKRVQRLMNKLGIKSIIIKKFKPYSS
FT                   SNRVEERENILNRDFSTTTINQKWVTDITYIYTVKDKWCYLATVIDLYTKKVIGYAFSK
FT                   TMDTELAIRAVENAYNTQKPQGELILHSDLGSQYTSTKFQEYILSKGNIKHSFSHKGCP
FT                   YDNACIESFHASLKKEEVNLATYHDFDTARLAIFEYIESW"
FT   gene            complement(454396..454671)
FT                   /locus_tag="Thebr_0437"
FT   CDS_pept        complement(454396..454671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0437"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   tpd:Teth39_0427 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79048"
FT                   /db_xref="GOA:E8UVA5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVA5"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADV79048.1"
FT                   /translation="MPRGQRKYNDEFKNTIVELYNHGKSLAELSSEYGISKSTISGWLK
FT                   KAKPINIDNKGTTITAAEYQAMLKKMARLEEENEILKKAMAIFVKE"
FT   gene            complement(454728..454862)
FT                   /locus_tag="Thebr_0438"
FT   CDS_pept        complement(454728..454862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0438"
FT                   /product="transposase, putative"
FT                   /note="KEGG: isc:IscW_ISCW000571 transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79049"
FT                   /db_xref="GOA:E8UVA6"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVA6"
FT                   /inference="similar to AA sequence:KEGG:IscW_ISCW000571"
FT                   /protein_id="ADV79049.1"
FT                   /translation="MASHKNFTIEEKLAILAEAESSSTTKIAVCRKYGISKAGVSILL"
FT   gene            454942..455082
FT                   /pseudo
FT                   /locus_tag="Thebr_0439"
FT   gene            455436..455930
FT                   /locus_tag="Thebr_0440"
FT   CDS_pept        455436..455930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0440"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   tpd:Teth39_0428 ferritin, Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79050"
FT                   /db_xref="GOA:E8UVA7"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="InterPro:IPR033921"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVA7"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADV79050.1"
FT                   /translation="MGTKGREIVGKEVDKIIEFLNKALADEWLAYYQYWIGAKVVRGPM
FT                   SGAVAAELSEHAGEELSHAEKLAERIIQLGGTPILKPEDWYKLTNCGYDTPDNPEVKVI
FT                   LEQNIKGEQCAIEVYNKMLSELKDVDPVTYHLILEILEDEIEHEEDLENLKEDMDMMNK
FT                   K"
FT   gene            455952..456326
FT                   /locus_tag="Thebr_0441"
FT   CDS_pept        455952..456326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0441"
FT                   /product="Superoxide reductase"
FT                   /EC_number="1.15.1.2"
FT                   /note="KEGG: tpd:Teth39_0429 desulfoferrodoxin, ferrous
FT                   iron-binding region; PFAM: Desulfoferrodoxin ferrous
FT                   iron-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79051"
FT                   /db_xref="GOA:E8UVA8"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVA8"
FT                   /inference="protein motif:PRIAM:1.15.1.2"
FT                   /protein_id="ADV79051.1"
FT                   /translation="MEKFGSLYQSGDWKGEKHVPVIHISDKVKKEEVVELRVNIGEEIP
FT                   HPNTLEHHIKWIKVYFHGEGDKFPVEIGNYNFTSHGEYGVFTEPDLTIKFKVEKSGTIY
FT                   AASYCNIHGLWENSKKIEVE"
FT   gene            456543..456628
FT                   /locus_tag="Thebr_R0019"
FT                   /note="tRNA-Tyr1"
FT   tRNA            456543..456628
FT                   /locus_tag="Thebr_R0019"
FT                   /product="tRNA-Tyr"
FT   gene            456632..456707
FT                   /locus_tag="Thebr_R0020"
FT                   /note="tRNA-Lys1"
FT   tRNA            456632..456707
FT                   /locus_tag="Thebr_R0020"
FT                   /product="tRNA-Lys"
FT   gene            457033..457545
FT                   /locus_tag="Thebr_0442"
FT   CDS_pept        457033..457545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79052"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVA9"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0430"
FT                   /protein_id="ADV79052.1"
FT                   /translation="MVKEEYLDLLEKKHSVYYDVYRDYELNGRFLDIYAEFHMRNERYF
FT                   LIDVLDAYETHEYRLVKYYENLKLDDAAEFGTWLKEQVEVLIKPHTEHMCTILTGVMVT
FT                   DRGINRNVEKFIKDYRYTRYFTFGIKGWGEIRLVGVDIASNRVVANRKGREVIKDFMIP
FT                   MPKPNYK"
FT   gene            457564..459204
FT                   /locus_tag="Thebr_0443"
FT   CDS_pept        457564..459204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0443"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   tpd:Teth39_0431 carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79053"
FT                   /db_xref="GOA:E8UVB0"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVB0"
FT                   /inference="protein motif:PFAM:PF02554"
FT                   /protein_id="ADV79053.1"
FT                   /translation="MSAIILLISAIILFVLAYIFYGGWLAKQWGLQPDNNTPAHTMYDG
FT                   VDYVPAKAPVLLGHHFASIAGAGPINGPIQAAIFGWVPATLWILLGGIFLGGAHDFGSL
FT                   LASLRHKGKSIGDIIQANVGLTAKRLFLLFSWSTLVLIVAAFTNIVADTFVSTPQAATA
FT                   SLLFILFAVVFGFAVYRRNAPLGLSTVLGVAALALSIWIGYIAPLSLPKTTWIIILAVY
FT                   IVAASVMPVWILLQPRDYLNSFLLYGMMIGGVVGILLYNPRIQLPAFTSFKVGTQYLFP
FT                   ILFITIACGAISGFHSLVASGTTAKQLDKEGDAKLIGYGSMLIESTLAIISIITAAYLT
FT                   QDKFAELIKFGPTNVFADGLGTFMASFGINQVVGKTFAALAVSAFAMTTLDTATRLGRF
FT                   AFQEFFENISESGETVASSNPVAKFFSDRYVASVITVVISIVLAFTSWKAIWPIFGAAN
FT                   QLLAAVALLAVAAWLANAGRNNKMLIIPMIFMFIVTLTALVLLIQSNIASGNYILVLFA
FT                   VLLFILAILLILQTYGVLTGKNRREGVAK"
FT   gene            459555..460919
FT                   /locus_tag="Thebr_0444"
FT   CDS_pept        459555..460919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0444"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: tpd:Teth39_0432 amino acid carrier protein;
FT                   TIGRFAM: amino acid carrier protein; PFAM: sodium:alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79054"
FT                   /db_xref="GOA:E8UVB1"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVB1"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ADV79054.1"
FT                   /translation="MDKLLEINSTVNGIVWGPPMLILIVGTGLILTIGLGFIQIRKFPY
FT                   VMKNTLFKMFEKSQKGEGEITPFQALATALAATVGTGNIAGVATAIALGGPGAIFWMLI
FT                   AALVGMATKFSEVVLAVHFRDRKPDGSFAGGPMYYLEKGLKQKWLAVLFALFGALAAFG
FT                   IGNMVQANSVAASLETTFGVPKLYTGVALAILTALVILGGLKRLAAVTEKLVPFMAAFY
FT                   IIGALIIILLNISKLPSAIGMIINQAFTGSAAAGGFAGATVMMGMRYGVARGIFSNEAG
FT                   LGSAPIAHAAATTDHPVRQGLWGIFEVFMDTIVICSLTALAILTTGVWAEVDAAGKQLT
FT                   GAALTTAAFNKGLPGPGGIIVAIGILLFAFSTLLSWSYYGEKSAEYLFGVGVKIIYRII
FT                   WIPFVVIGAVGGLEPLWDLADTLNGLMAVPNLIGLIGLSGTVFKLTREFFKKEGA"
FT   gene            461322..461822
FT                   /locus_tag="Thebr_0445"
FT   CDS_pept        461322..461822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0445"
FT                   /product="cation antiporter"
FT                   /note="PFAM: cation antiporter; KEGG: tpd:Teth39_0433
FT                   cation antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79055"
FT                   /db_xref="GOA:E8UVB2"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVB2"
FT                   /inference="protein motif:PFAM:PF01899"
FT                   /protein_id="ADV79055.1"
FT                   /translation="MTNLIYFYTVLFIFWFASSGKTDFINLSLGFLASIFAMEVYKKFF
FT                   YISKMKEINLIKFLLSFFNYIVNLIKNILMAGIQVTRIVLSREMKISPRIIKVRKKFKT
FT                   NFGRVIAATTITLTPGTLTIDFYNDTFIIHALNSQNAEEMLEWPLEKVILELEDVFYGN
FT                   GNT"
FT   gene            461803..462078
FT                   /locus_tag="Thebr_0446"
FT   CDS_pept        461803..462078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0446"
FT                   /product="multiple resistance and pH regulation protein F"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: tex:Teth514_0912 multiple resistance and pH
FT                   regulation protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79056"
FT                   /db_xref="GOA:E8UVB3"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVB3"
FT                   /inference="protein motif:PFAM:PF04066"
FT                   /protein_id="ADV79056.1"
FT                   /translation="MEMEILKTLGGIILCITIIISILASINRKGVLEKVVITNIVNTKT
FT                   VALIFILSYIRNKPVFLDVAVVYALINFIAAIAVSKFFDGYHKQGD"
FT   gene            462080..462397
FT                   /locus_tag="Thebr_0447"
FT   CDS_pept        462080..462397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0447"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_0434 monovalent cation/proton
FT                   antiporter, MnhG/PhaG subunit; TIGRFAM: monovalent
FT                   cation/proton antiporter, MnhG/PhaG subunit; PFAM: Na+/H+
FT                   antiporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79057"
FT                   /db_xref="GOA:E8UVB4"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVB4"
FT                   /inference="protein motif:TFAM:TIGR01300"
FT                   /protein_id="ADV79057.1"
FT                   /translation="MVILSYITFYMGIFFFVVSTVGVVRLPDLYSRLHAATICDTLGLG
FT                   LVALSLTMMYGISIESLKLLFIVVLIWIANPVAAHLVSKAAYINKLPTVQGKFVIEEGE
FT                   K"
FT   gene            462399..462650
FT                   /locus_tag="Thebr_0448"
FT   CDS_pept        462399..462650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79058"
FT                   /db_xref="GOA:E8UVB5"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVB5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0435"
FT                   /protein_id="ADV79058.1"
FT                   /translation="MRWLEEAFNLLLLVILILCSLVVYIKKEIISAVVIFSIYSFVMAI
FT                   VWLELKAPDLAITEAAVGAGITTILFVIAIKRMGGRWD"
FT   gene            462652..463377
FT                   /locus_tag="Thebr_0449"
FT   CDS_pept        462652..463377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0449"
FT                   /product="Na+/H+ antiporter MnhB subunit-related protein"
FT                   /note="PFAM: Na+/H+ antiporter MnhB subunit-related
FT                   protein; KEGG: tpd:Teth39_0436 Na+/H+ antiporter MnhB
FT                   subunit-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79059"
FT                   /db_xref="GOA:E8UVB6"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVB6"
FT                   /inference="protein motif:PFAM:PF04039"
FT                   /protein_id="ADV79059.1"
FT                   /translation="MKKYIYFIISVSLFILLLFVNSELPPFGSGENTSYLNNYVVKKYV
FT                   DDVLDDTGVLSSIAAILYDYRGFDTLGEATVLYTSVLAVSVMLKNEKKYYFRHTESTYL
FT                   KTVSKLIFPFIFVYGIYITLYGHISPGGAFSGGVVIAAGFILIMLSYGKKYCEYFLDYY
FT                   RASMIESLSMLWYITVGLFSVLAGYQFLSNKIAGIPTGVAGSVFSGGSIFLLNAAVAMK
FT                   VFGTIYILFYFIALEEVER"
FT   sig_peptide     462652..462720
FT                   /locus_tag="Thebr_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.602) with cleavage site probability 0.588 at
FT                   residue 23"
FT   gene            463374..463739
FT                   /locus_tag="Thebr_0450"
FT   CDS_pept        463374..463739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0450"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   tpd:Teth39_0437 NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79060"
FT                   /db_xref="GOA:E8UVB7"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVB7"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADV79060.1"
FT                   /translation="MKVLYGILNNYYYLAAFVLFCIGFYIILASPNLIKKVIGMNIMDT
FT                   SVFLFIVASGYIKDGKVPIMSTSTPGPTVYVNPLTTAFVLTGIVIAVSKTAYALTLITK
FT                   IHDFYGSIDIDNIYKSG"
FT   gene            463736..465208
FT                   /locus_tag="Thebr_0451"
FT   CDS_pept        463736..465208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0451"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: tpd:Teth39_0438 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79061"
FT                   /db_xref="GOA:E8UVB8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVB8"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADV79061.1"
FT                   /translation="MKMVMNHIPIVLIISLFSHAFLTPLLKKKFRSLYIFSLALYSLLL
FT                   FLTGKTFFYVESMGPIRYWIGGWIPPIGIELYADKLSVFMATLFLSCALLILVSFESFK
FT                   YEIGEEKAAYYFMLVSILIGAMLGIIFTRDLFNLYVFVEITTIAACGIISIKNEKKAVE
FT                   AALKYFILSSIASTSILLGLILIYNIGGYLHYDTLKSVLLESKDVFPKIISGSLVLIIS
FT                   GFSLKSALFPLHIWLPDAHSAAPTTSSALLSGLVIKVYVFAIIRLLNDVFGLMYTYTSI
FT                   LLEVLLALGNVGVFSGAVLAGFQNDIKRRLAYSSVSQMGYVFLGLGFNNQYGFEGALLQ
FT                   VLNHALAKSGLFLAAGWMVKFTGTRDIKGLEKISDKLPLTALCFSVCAMSLVGMPFTLG
FT                   FLSKWHLAMAAIESGRPLQLIFIILSALLTLSYYFPIIVKAFTGDKSFERKLEFEKIKG
FT                   GSLISILIFTFVIMFLGIYPKFLLKYLLQNMF"
FT   gene            465223..466902
FT                   /locus_tag="Thebr_0452"
FT   CDS_pept        465223..466902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0452"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: tpd:Teth39_0439 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79062"
FT                   /db_xref="GOA:E8UVB9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVB9"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADV79062.1"
FT                   /translation="MSSLSLLFILVLPIIGTLVIWPASKKNDKMGEIFVALICGICVLF
FT                   AAFTPAGDFLSINTGFHSIRFTLGDINRIFLLFSTSIWCLVALFLTGYVHHMENRARFW
FT                   GFFMLTLWSVIFVFLAGDLLTFYFFFELMALFSYFLIIHQESTEALSSGNLYIFTTFVG
FT                   GLAVLGAILIIYNNVGTFEFEKLNLVIEHGGLKGYLALVLLFVGFGIKAGCLPFHFWLP
FT                   RAHPVAPAPASALLSGVLVKSGVFGILQILRYTNSHYLGLVLIILGILSTLYGGFMALC
FT                   DNYPKRLLAYGTISQIGYIFVSISATILAGAHSLVAPYLHIYAHGLSKTALFLAVGYIY
FT                   LKTYEMKQLKNLTLVPLAAIALAGLNLAGFPGFIGYTAKILTKDLLLCLSTQGMFFHWV
FT                   EVIFRLSGILTAAYLTKIFFCFYESYLKHRVKNPLSNQKEFNIMIFVLFLLVFMTIILG
FT                   FLPIAASDVEINLYSPAKIIASIFDIITGIIVYLKFKGHIKRPVLIPQPSYRNTVFKLT
FT                   GYFGNLVQRYIHLPISIDLSIALFGISIPLLYLLLILYLKPY"
FT   gene            466932..467594
FT                   /locus_tag="Thebr_0453"
FT   CDS_pept        466932..467594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79063"
FT                   /db_xref="GOA:E8UVC0"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVC0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0440"
FT                   /protein_id="ADV79063.1"
FT                   /translation="MLNFWEKFKWRLPKNFARLVFFLEALLALFIISGVAISFLDLIRY
FT                   LNLIISQPPLQTYEILRTFLGHILLLVIGLELVIMLVRHTPSSVVEVLLYAIARKIIME
FT                   AKTTLDVLIGVVALGGLFLLIKIYTPERLHAEKGAIVSSSMPIWEVNEIANVNIPENMA
FT                   NTIGGLISILASNEGKNIAIGQVFRINDAEISIYSMEGNLVRSVFVKRSEEANEVHC"
FT   gene            467753..469273
FT                   /locus_tag="Thebr_0454"
FT   CDS_pept        467753..469273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0454"
FT                   /product="thymidylate synthase complementing protein ThyX"
FT                   /note="PFAM: thymidylate synthase complementing protein
FT                   ThyX; KEGG: tpd:Teth39_0441 thymidylate synthase
FT                   complementing protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79064"
FT                   /db_xref="GOA:E8UVC1"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVC1"
FT                   /inference="protein motif:PFAM:PF02511"
FT                   /protein_id="ADV79064.1"
FT                   /translation="MKMRKLTLEEERLLENFVTDVYGPVYFIHSLPEFIIPPINSKVSR
FT                   RDTSWRLNILESLTDGDLNITDYIPKHNIPLEKAIQKAKEFHEKWVERFGHSSIAEQHL
FT                   MHLCVEDVSRLLSGDIELMNRRPAFIEWSQRYQKPTRDKVVIPQELEEKPDLKEKFLKV
FT                   WNNSYDAYEKLVEVLTEYLARAEEKKEGESEERFYNRISKIAFEDARYALLLATKTSFA
FT                   VALNALDLQDIVRKLFVHPTKEAKLLAERIVEQGEKIAPSMLRHTAPTVYQLKVHDRLK
FT                   NLASVVKEDELSDSNEDVILIDYTGKDSEYSPVDIVIMHILFTYSGKNFEAVRKTVKNM
FT                   SEEEKSKILQQAVEDIGEFDHLIEAFKSIRFKFQLKISEANWHQLLRHRTIVFDYSEPT
FT                   IENGFVIPPNIEKANASEILIEAIKASEELFIELKEKLPEVSPYVVTNAHKRLVLMNAD
FT                   LWAFDHFANLRCTNEAQWDIRNVSFKMLDLIKEVAPQLTTFMARRKKA"
FT   gene            469291..469605
FT                   /locus_tag="Thebr_0455"
FT   CDS_pept        469291..469605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0455"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase; KEGG:
FT                   tpd:Teth39_0442 MazG nucleotide pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79065"
FT                   /db_xref="GOA:E8UVC2"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVC2"
FT                   /inference="protein motif:PFAM:PF03819"
FT                   /protein_id="ADV79065.1"
FT                   /translation="MKTSFKEISLPKLNNLTPSLESTALKLMEEAGELAQAIGKFRGLN
FT                   GENVTLSEKEIMEKISEELLDVAQVAVSMMFVLEEKYNINIEEKLKEHIEKLKRKGYIK
FT                   "
FT   gene            469684..469866
FT                   /locus_tag="Thebr_0456"
FT   CDS_pept        469684..469866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79066"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVC3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0443"
FT                   /protein_id="ADV79066.1"
FT                   /translation="MQLSTKELLYLDDILSLQQNMTKTLNDYASRCQDPQLKALCQNLA
FT                   DRCQNNFNSLLKHLS"
FT   gene            469882..470157
FT                   /locus_tag="Thebr_0457"
FT   CDS_pept        469882..470157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0457"
FT                   /product="Coat F domain protein"
FT                   /note="PFAM: Coat F domain protein; KEGG: tpd:Teth39_0444
FT                   coat F domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79067"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVC4"
FT                   /inference="protein motif:PFAM:PF07875"
FT                   /protein_id="ADV79067.1"
FT                   /translation="MYGNTQISDKDIMMNVLGSYKLAIEMFSHAAVESANESIRREYIN
FT                   LLNSTLEDQRTVWNAVNQRGWYPVKPAPPQDIQEARNKFRQPVGMM"
FT   gene            470247..471161
FT                   /locus_tag="Thebr_0458"
FT   CDS_pept        470247..471161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0458"
FT                   /product="thioredoxin reductase"
FT                   /note="KEGG: tpd:Teth39_0445 thioredoxin reductase;
FT                   TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79068"
FT                   /db_xref="GOA:E8UVC5"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVC5"
FT                   /inference="protein motif:TFAM:TIGR01292"
FT                   /protein_id="ADV79068.1"
FT                   /translation="MYDLIILGGGPAGLTAGLYAARSRLKTVLIEKTYLGGQIVNTYQL
FT                   ENYPGYEEISGADLIAKMEAQVRKHGLEIVNEDVESLDITGDVKKVKTSNKTYEAKAII
FT                   LAMGATPKKLGVPNEDRFIGAGISFCATCDGAFYRDATVAVIGGGNTAVEDALYLTKFA
FT                   KKVYIIHRRNELRATKIEQEKAFANEKIEFIWDTVVVDVEGEYGVERLKLKNVKTGEES
FT                   TLNVDGVFVAIGYAPNTELVKGIVDLDEYGYIMTDDDMRTNIPGVFAAGDIRHKSLRQV
FT                   ITAAGDGAIAAYVAEKYIDSLKK"
FT   gene            complement(471190..472173)
FT                   /locus_tag="Thebr_0459"
FT   CDS_pept        complement(471190..472173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0459"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="KEGG: tpd:Teth39_0446 peptidoglycan binding
FT                   domain-containing protein; PFAM: Peptidoglycan-binding
FT                   domain 1 protein; Peptidoglycan-binding lysin domain;
FT                   SMART: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79069"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVC6"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADV79069.1"
FT                   /translation="MVTLEFTYVVQPGDTIFSIAKKFNTSVDAIITRNNIINPSLIYPG
FT                   QRLVIPVQGSYYTVQPGDTLYLIAQKFNVPYEAIIYTNNLTYPYTIYPGQKLFIPGAKI
FT                   IAPQPPLPSPPPAQKPCPTYYTVQPGDTLWTIAQKFGVSLEELIKANYLINPNMIYPGQ
FT                   TLIIPCPTSPPIEYPTLKIGDKGPFVVNLQARLKSLGFDPGPIDGIFGRKTEEAVKAYQ
FT                   QSRGLPVTGIVDNVTWNALLFGTPPVTTPTPPGKVYIVKPGDTLWNIAKTFNTTVDVIL
FT                   KANPDIKDPNLIYPGQRIIIPTSSQEIVYNQEVQEINAEQEQEQEE"
FT   gene            472279..472959
FT                   /locus_tag="Thebr_0460"
FT   CDS_pept        472279..472959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0460"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /EC_number="3.5.1.28"
FT                   /note="SMART: cell wall hydrolase/autolysin; TIGRFAM:
FT                   N-acetylmuramoyl-L-alanine amidase CwlD; KEGG:
FT                   tmt:Tmath_1888 N-acetylmuramoyl-L-alanine amidase CwlD;
FT                   PFAM: cell wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79070"
FT                   /db_xref="GOA:E8UVC7"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVC7"
FT                   /inference="protein motif:TFAM:TIGR02883"
FT                   /protein_id="ADV79070.1"
FT                   /translation="MVFKRWMMFLLIVSLIVGLYSFKKGYYIAAFKTVPIMNKVIVIDA
FT                   GHGGPDPGKPGKYGKDEDELNLEIAQKLRELIEESGGIVVMTREDDTLSDSSLSKDLKN
FT                   RVVKANEVIADVLISIHLNSFSQSKYKGAQVFYQNNSEKGKLLAELIQQELRNTLDPNN
FT                   DRMAKSSNSYYLLRNAKMPAVIVECGFMSNPEEEKLLNDENYQYKIAWAIYKGLIHYFQ
FT                   KVSE"
FT   gene            473043..473675
FT                   /locus_tag="Thebr_0461"
FT   CDS_pept        473043..473675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0461"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="KEGG: tpd:Teth39_0448 HAD family hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79071"
FT                   /db_xref="GOA:E8UVC8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVC8"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADV79071.1"
FT                   /translation="MGIKTVLFDLDGTIIDTNELIIESFKYTIERHLGYTVKPEDVTPY
FT                   FGEPLPITLKRFSQDKWELMLDTYRQYNEFNHDKYTKIRKDVKEALEFMHKKGIKMGIV
FT                   TSKRRELAIRGLRLFDLEKYFKVIVALEDTEKHKPNPEPILKALELLNANKEETLMVGD
FT                   SPYDILCASNAGVKSVAVKWTILPFNLLEEAKPDYVINDMLEILKII"
FT   gene            473737..474138
FT                   /pseudo
FT                   /locus_tag="Thebr_0462"
FT   gene            474140..475576
FT                   /locus_tag="Thebr_0463"
FT   CDS_pept        474140..475576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0463"
FT                   /product="transposase"
FT                   /note="KEGG: tpd:Teth39_0450 transposase, putative;
FT                   TIGRFAM: transposase ; transposase, IS605 OrfB family;
FT                   PFAM: transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79072"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVC9"
FT                   /inference="protein motif:TFAM:TIGR01765"
FT                   /protein_id="ADV79072.1"
FT                   /translation="MIVIQAKLIFLSQDDKQIVLDLMRRWSSCMRFAYKRLLEGYDRNT
FT                   LKRELQGIFNLNSRYVDDAIMKARSTLESSKELGNNPKKVIFGGKDLFKKLQKRHINGK
FT                   EYKKLKTKWQERRKGNLYSRGDKSKKGNLNTRIEVKENGTFLRINVGERKYLYARIEAG
FT                   YKKNKSRGKLLQEIAQSNIPYSVEVKLKNGNIYAYFAIEKEYPEIKITKEKGVIGIDVN
FT                   AYPDNISWAETDEKGNLISYGNMPMTELASGSKDKKEYFRWQYAHEIVNIAKEKGKAIV
FT                   IEGLDIKNKGKRGDFSGRKSRRIRHNFSYRALLSKIKTLAKREGIEVIEVNPSYTSIIG
FT                   MLKYSPQYMITKDIAAAYVIARRGLGKEEKMPNNYMKFLNALTVDELEELKEHVKKTVR
FT                   NKHINKKHLKEIDKAIKFLQSLESKPGRVLEPLNGTSFSAYNFWQVLKVAVVTPLSPEK
FT                   VPRDFSALRELLIQGKWGDP"
FT   gene            475722..476666
FT                   /locus_tag="Thebr_0464"
FT   CDS_pept        475722..476666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0464"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; KEGG: tpd:Teth39_0451 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79073"
FT                   /db_xref="GOA:E8UVD0"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVD0"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADV79073.1"
FT                   /translation="MDNIAVEKIIENIERVIIGKRKVIELVVIALLAEGHVLIEDVPGV
FT                   GKTSLVKALAKSVNLKFKRIQFTPDLLPSDVIVITIYNQLKNEFEFKAGPIMSQIVLAD
FT                   EINRTSPKTQSSLLEAMEERQITVDGVTYSLPKPFMVLATQNPIEYEGTFRLPEAQLDR
FT                   FMIKIEIGYPDEYQEMRILKNFEKEDPLESLSPVADAEDIKEMQMKVKSVYVDDLVRNY
FT                   IVTLVANTRKSKAIRLGASPRATVNLMRAAQAKAFCEGRNYVLPDDVKELAVPVLSHRI
FT                   ILKNEERFEGLDEKMFIKNIVDTTKVPVIKRYA"
FT   gene            476659..477518
FT                   /pseudo
FT                   /locus_tag="Thebr_0465"
FT   gene            477651..478064
FT                   /locus_tag="Thebr_0466"
FT   CDS_pept        477651..478064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0466"
FT                   /product="UspA domain-containing protein"
FT                   /note="PFAM: UspA domain-containing protein; KEGG:
FT                   tpd:Teth39_0454 osmosensitive K+ channel histidine
FT                   kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79074"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVD1"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADV79074.1"
FT                   /translation="MVLSYEPGVKSRIMVCVTPQKSCRRLVERGAERAKETNGEFCVVY
FT                   VNKNNDISNDLKQNKVLLELFDLAQKMGGRVSILVGKKISKTLAEFAKENNITEIIVGK
FT                   SLRSALDVILHGDVINPLKKEVEKNDIRVEVIE"
FT   gene            complement(478074..478469)
FT                   /locus_tag="Thebr_0467"
FT   CDS_pept        complement(478074..478469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0467"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG: tpd:Teth39_0455
FT                   transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79075"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVD2"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ADV79075.1"
FT                   /translation="MNKDKIIEKNIREKLEKEMVSYGVDINVRCINGHVTLYGIVDNLS
FT                   EKNHAQKIAESVEGVEKDVSLVNLVVQKLSRYDLSLPDLVITANNGTVTLSGYVNNLKE
FT                   KELANEAAQSVNGVKKVINHIKIREKS"
FT   gene            478950..480209
FT                   /locus_tag="Thebr_0468"
FT   CDS_pept        478950..480209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0468"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: tpd:Teth39_1510 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79076"
FT                   /db_xref="GOA:E8UTL8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E8UTL8"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADV79076.1"
FT                   /translation="MNKLFVGMDVSLNDVKVHILDQEGNDASSRFSVENNPHGCDVIVS
FT                   RILECCNKYNIQKVFIGLESTSVYGWHLQYYLADHSALKPYQPSITTFNANIINAFKKS
FT                   LGNLPKNDWIDAFAIAEKLRFGRLPKSCSVDFRYLALQRLTRHRFHIVNSIVREKNYLL
FT                   SNLFLKFSGLCQNKVFSNNFGATATEIFNEFFTLDDIAARPLDELAGFLVDKSKDRFDD
FT                   PEATAKLLQEAVRKSYRINATVDDSLNFVIKSCFDNLQSLEKQKKAVEKAIINEVKGFN
FT                   NEFLCLTSVKGIGPTIAAGLISEIGGISRFDNDNALAKFSGLYWSEYQSADFKAEDTYL
FT                   KRTGNEYLRYYFIQAADQLRKYLPEFSQYYARKFKESKTHKHKRALVLTARKTVRLVFA
FT                   LLREEKLYKSPIMKGDDCIS"
FT   gene            480483..481316
FT                   /locus_tag="Thebr_0469"
FT   CDS_pept        480483..481316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0469"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   tpd:Teth39_0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79077"
FT                   /db_xref="GOA:E8UVD4"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVD4"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADV79077.1"
FT                   /translation="MFNGLIDIIKTMRINDVIDILIIAYVLYRLILVIHKTRVEQLLKG
FT                   LAVLIVITKVSEWLQIRTVNYILRNAMTVGVIALLIVFQPELRRGLESLGRSGFLGKNF
FT                   FFFNEEEKDMSEVLGEICDAVQFLSRSKIGALIVLERETGLNELIETGIAMDSKISSEL
FT                   LINTFIPNTPLHDGAVIIRGDRIMAAGCFLPLTDNQNLSSELGTRHRAGIGVTEISDAV
FT                   AIIVSEETGTISLAQNGRLSRHLDAKTLKEVLSSIFEVKENKKPVWKKWGNKHAD"
FT   gene            481306..482496
FT                   /locus_tag="Thebr_0470"
FT   CDS_pept        481306..482496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0470"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: tpd:Teth39_0458
FT                   YbbR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79078"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVD5"
FT                   /inference="protein motif:PFAM:PF07949"
FT                   /protein_id="ADV79078.1"
FT                   /translation="MLTKDFTIKLLSLVLAFLLWLYVMGEENPEIPYEINDVPVKLINS
FT                   DTLEKKGLIVLDEKNYTVNVKVRGRRSDVLNIAAQNISVFADLSRVNSKGTNVIPVTVE
FT                   GLPRNVSLVSINPPEIKVEIDKIAKTQMPVTVKIIGNVMDGYAMQPAVSTPGEVLVIGP
FT                   ESKINLIKNVIAGVNVSYKKEDIKISVPVVAVDREGKEIKGVTITPNLVEVYIPVNKSI
FT                   RVPVVPKIFGKPMEGYMISSVNVLPEYVYITGDATILNTIKSISTKQIDISGKNEPVTE
FT                   SVPLDLPDGVKLVKSDINAKVYVDIQKISTKEITINNIDIKGADNKNVVIQNPELLITV
FT                   SGPENVVNGAKASDFTAYIDVTNLPTGIHSLAVNISTDLNLQIIRIKPDKVTVNIQ"
FT   sig_peptide     481306..481383
FT                   /locus_tag="Thebr_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.949 at
FT                   residue 26"
FT   gene            482692..483762
FT                   /locus_tag="Thebr_0471"
FT   CDS_pept        482692..483762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0471"
FT                   /product="butyrate kinase"
FT                   /note="KEGG: tpd:Teth39_0459 butyrate kinase; TIGRFAM:
FT                   butyrate kinase; PFAM: acetate and butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79079"
FT                   /db_xref="GOA:E8UVD6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVD6"
FT                   /inference="protein motif:TFAM:TIGR02707"
FT                   /protein_id="ADV79079.1"
FT                   /translation="MNLLKVLVINPGSTSTKVALYEEEREIVKTEIAHDIEALKKYKSI
FT                   IEQFDLRLNAINDWIEQNNINLKEIFAIVVRGGLIKPVQSGTYLVNDIMLEDLRKGVGG
FT                   EHASNLGGLIGRAIGDKYNIPVYTLDPVAVDEMEDVARISGLPELPRKSQSHALNIKAC
FT                   VHRYARENSINEENLNLVVAHMGGGISVAAIKGGKIVDVNNANQMGPFSPERTGSLPSM
FT                   KVVDLCYSGKYSFDEMKKKVVGMGGMVAHLRTNDAKEIERRIQNGDKKAKLVFEAMAYQ
FT                   IAKEIGRMAAVLKGDVKSIILTGGLAYSKRLIEIIIDMTSFIAPITLYPGGDEMEALRD
FT                   GALRVLRNIEKPKIYS"
FT   gene            483776..484672
FT                   /locus_tag="Thebr_0472"
FT   CDS_pept        483776..484672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0472"
FT                   /product="phosphate butyryltransferase"
FT                   /note="KEGG: tpd:Teth39_0460 phosphate butyryltransferase;
FT                   TIGRFAM: phosphate butyryltransferase; PFAM: phosphate
FT                   acetyl/butaryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79080"
FT                   /db_xref="GOA:E8UVD7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR014079"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVD7"
FT                   /inference="protein motif:TFAM:TIGR02706"
FT                   /protein_id="ADV79080.1"
FT                   /translation="MRTFEEMYNYVKDLPPKTIAVAQAADEDVLEAIKEAHERGIVKAI
FT                   LVGDKEKIERIASSILMPLKEHEIIDTKNNLEACREAVKIVSEGKADILMKGLVQTAEI
FT                   LRVVLDKEIGLRTGRTLSHVAVFESPYNRLILLTDAAMNIAPDLKVKIDIILNAVDVAR
FT                   QIGIDAPRVAVLGAVETVNPDMQATLDAAILSKMSERGQIKGAIIDGPLALDNALSVEA
FT                   ARHKGIISPVAGNADILLVPDIEAGNMLYKAITYIAERRIAGIIMGAKRPIVLTSRADS
FT                   SEAKFNSIMLASLASNV"
FT   gene            484698..485765
FT                   /locus_tag="Thebr_0473"
FT   CDS_pept        484698..485765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0473"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase dimerization
FT                   region"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region; Glu/Leu/Phe/Val dehydrogenase; KEGG:
FT                   tpd:Teth39_0461 Glu/Leu/Phe/Val dehydrogenase, dimerisation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79081"
FT                   /db_xref="GOA:E8UVD8"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVD8"
FT                   /inference="protein motif:PFAM:PF02812"
FT                   /protein_id="ADV79081.1"
FT                   /translation="MKIFDIMETKDYENVILCHDKTSGLKAIIAIHDTTLGPALGGCRM
FT                   WTYDSEEDAINDALRLARGMTYKNAAAGLNLGGGKTVVIGNPRKDKSEALFRSLGRYIE
FT                   SLKGRYITAEDVGTNLKDMEYIRYETKYVAGLAETSGDPSPFTAYGVFRGIQAACEEVF
FT                   GTSDLKGLRIAIQGVGNVGYNLAKYLYGAGAKLIVTDIFEDNVKRVVEEVKAEYVKPDE
FT                   IYGVECDIFAPCALGAIINDETIPQLKCKIVAGSANNQLKEERHGDILQEKGILYVPDY
FT                   IINAGGVINVADELNPSGYNRDRAMRKVSMIFDTVKKVIQKSKEENIPTYVAADRVAEE
FT                   RIKTIAAVKDNYIVK"
FT   gene            485892..486959
FT                   /locus_tag="Thebr_0474"
FT   CDS_pept        485892..486959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0474"
FT                   /product="butyrate kinase"
FT                   /note="KEGG: tpd:Teth39_0462 butyrate kinase; TIGRFAM:
FT                   butyrate kinase; PFAM: acetate and butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79082"
FT                   /db_xref="GOA:E8UVD9"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVD9"
FT                   /inference="protein motif:TFAM:TIGR02707"
FT                   /protein_id="ADV79082.1"
FT                   /translation="MFLILVINPGSTSTKVAVFRDKEPVFTETLRHSTEELSKYKSIID
FT                   QFEFRTQAILNMLKEKGISLSEIDAIVGRGGLLKPIESGTYIVNEKMIEDLKKAERGEH
FT                   ASNLGGIIAYTLAKEHNIPAYIVDPVVVDELEDIARITGMPEIEKSSIFHALNQKAIAR
FT                   RLAADLNKKYEEVNLIIAHLGGGISIGAHKHGRVVDVNDALNGEGPFSPERAGGLPVLD
FT                   LVKLCYSGKYTYQEMKKKLIGQGGIVAHLGTNDVREVYKKIEEGDKKAELVLEAMAYQT
FT                   AKEIGAMAVVLKGHVDAIGITGGIAYNEDFVKRISERVKFIAPVYVYPGEDEMLALAQG
FT                   AYRVLSGEEKAKMYS"
FT   gene            486974..487648
FT                   /locus_tag="Thebr_0475"
FT   CDS_pept        486974..487648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVE0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0463"
FT                   /protein_id="ADV79083.1"
FT                   /translation="MDFKRLTIVVGHYGTGKTEIAINYAKLIRESGKEVEIVDLDIVNP
FT                   YFRSREVRKELFDKWGIRVAGVEEKYMNADVPAISRNIYGALYSKDKYAVFDVGGDDVG
FT                   ATPLGQYRHIIKDQDVEVLFVINVNRPLTKDVKSVIEYLKSIEEAAKIKVTHLVNNTHL
FT                   SYETTVEDILKGQKVVEEVSKITGIPIKMVTVKRELLNQVPDLGYPIFPIDLYMKTPWD
FT                   KM"
FT   gene            487663..487875
FT                   /locus_tag="Thebr_0476"
FT   CDS_pept        487663..487875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0476"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /note="KEGG: tpd:Teth39_0464 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79084"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVE1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0464"
FT                   /protein_id="ADV79084.1"
FT                   /translation="MAKVIFNEELCKGCELCVNACPKNIIEMDLSKINVKGYHPATVKP
FT                   ENMDKCIGCAFCAMMCPDTVITVIK"
FT   gene            487891..488958
FT                   /locus_tag="Thebr_0477"
FT   CDS_pept        487891..488958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0477"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain-containing protein;
FT                   KEGG: tpd:Teth39_0465 2-ketoisovalerate ferredoxin
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79085"
FT                   /db_xref="GOA:E8UVE2"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVE2"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ADV79085.1"
FT                   /translation="MAKVLMKGNEALAEAAIQAGCRHYFGYPITPQNEVTAYMAKRMPE
FT                   VGGVFLQAESEVSAINMVYGAGGAGARVMTSTSSPGLSLMQEGISYLAGAQIPCVIVNI
FT                   MRGGPGLGDIQGAQGDYFQSTKGGGHGDYRLIVLAPSTIQEMADLVQEAFDIADEYRNP
FT                   VVILGDGMLGQMMEPVDFDNIQKKTRNIPEKMWATTGRGNREHRNIINSLYIDPPVLEK
FT                   YNYELFEKYAKAEKNEVRYEMINCEDADIILVAYGTIARVAKNVMNIARREGYKVGLIR
FT                   PISLWPFPKEPFEKTVNTAKAYLTVEMSMGQMVEDVKLAVQFKKPVYFYGRPGGMIPEP
FT                   AVMLEQIKKIAGGVK"
FT   gene            488958..489707
FT                   /locus_tag="Thebr_0478"
FT   CDS_pept        488958..489707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0478"
FT                   /product="thiamine pyrophosphate TPP-binding
FT                   domain-containing protein"
FT                   /note="PFAM: thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; KEGG: tpd:Teth39_0466 thiamine
FT                   pyrophosphate binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79086"
FT                   /db_xref="GOA:E8UVE3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVE3"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADV79086.1"
FT                   /translation="MAVVFQKTKGLTDTPFHYCPGCTHGIIHRLVAEVMEELDVLDKAI
FT                   GVAPVGCAVFAYEYFNCDMQEAAHGRAPAVATGIKRVHPDKIVFTYQGDGDLAAIGTAE
FT                   IVHAAARGENITVIFVNNANYGMTGGQMAPTTLIGQETTTTPYGRKPEINGYPIRVSEM
FT                   LATLEGTAYIERVAVYDVKHVMQAKKAIKNAFLAQIQKKGFAMVEVLSSCPTNWGMTPI
FT                   EALNWIKDHMEPYYPLGVYKNTLEEVK"
FT   gene            489710..490267
FT                   /locus_tag="Thebr_0479"
FT   CDS_pept        489710..490267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0479"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_0467 pyruvate/ketoisovalerate
FT                   oxidoreductase, gamma subunit; TIGRFAM:
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate/ketoisovalerate oxidoreductase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79087"
FT                   /db_xref="GOA:E8UVE4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVE4"
FT                   /inference="protein motif:TFAM:TIGR02175"
FT                   /protein_id="ADV79087.1"
FT                   /translation="MEERIIFAGFGGQGVLSMGLIITYAGMFEGKNVSWTPSYGPEMRG
FT                   GTAYCNVTVSDEEVGSPVITEATSVIVMNRPSLDKYESYVIPGGKLFINTSLVDRKAER
FT                   KDIEVYEIPANDIANELGNLKIANMVMLGAFIEATKVVKLETVLKALPEVFGKGKEHLI
FT                   PINEKALNKGAELVKNLITTKK"
FT   gene            490306..491196
FT                   /locus_tag="Thebr_0480"
FT   CDS_pept        490306..491196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0480"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="KEGG: tpd:Teth39_0468 phosphate butyryltransferase;
FT                   PFAM: phosphate acetyl/butaryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79088"
FT                   /db_xref="GOA:E8UVE5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVE5"
FT                   /inference="protein motif:PRIAM:2.3.1.19"
FT                   /protein_id="ADV79088.1"
FT                   /translation="MKKLSEIVERAKGVNKKFTVAGAEDSEVLLACEAAKKEGIGQPVL
FT                   IGSKEKIETLSKELNINIEDYEIIDEAEEVQKCKKAVIEVKEGRASFVMKGLVPTATLL
FT                   KAVLDSEYGIRGEGLLSHVMVYEIPNYHKLLLLTDGGMNISPTLEEKVQILRNAIKVAK
FT                   AIEIENPKVACLSAVEVVNPKMPSTVEAAKLKEMNQRGEIEGIVDGPLAFDLAISKEAA
FT                   IHKGVKSEVAGDADILLVPFIEVGNALGKSFTYFAKARSAGIVVGAKAPIVLVSRADSH
FT                   EDKFNSIAFACAVSV"
FT   gene            491273..491546
FT                   /pseudo
FT                   /locus_tag="Thebr_0481"
FT   gene            491668..492267
FT                   /locus_tag="Thebr_0482"
FT   CDS_pept        491668..492267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0482"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: tpd:Teth39_0470 phospholipid/glycerol
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79089"
FT                   /db_xref="GOA:E8UVE6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVE6"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADV79089.1"
FT                   /translation="MLYRIFRLIAKLILKIFYSFEVKYEKNLPEGACIFVANHQSLLDP
FT                   VVVACSVKRPVIFLASSELYKRRFLKYFLKIDKAIPIKKNSPDLNAIKQALSRLEEGHT
FT                   IGLFPEGRISPTGKVEKMYEGAMYLAYKSGKPIVPVAIKGTREILPFGKYFPKFRGKIE
FT                   LKIGEPIYPNLNIDIKMEIVELRDKVMQNILTMLEK"
FT   gene            492336..493679
FT                   /locus_tag="Thebr_0483"
FT   CDS_pept        492336..493679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0483"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: tpd:Teth39_0471 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79090"
FT                   /db_xref="GOA:E8UVE7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVE7"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADV79090.1"
FT                   /translation="MARLFGTDGVRGIANYDLTPQLAFELGRAGAYVLTHGTHRPKVVV
FT                   GKDSRISGDMLECALTAGLTSVGAEVISVGIIPTPAVAYLTRLYQADAGVMISASHNPV
FT                   EYNGIKFFDKDGYKLPDEVEDRIENIIKEKIELPSPIGTGIGTRKEYTNSHRDYIEFLK
FT                   STIDGDLKEMKIVIDCAYGASSTIAPILFKELGAEVILHGAEPIGEKINVNCGSTHPEK
FT                   LQQLVIENGADIGLAFDGDADRLIAVDEKGNVVDGDHIMAICAIDLKKKGRLKNNTVVA
FT                   TVMSNIGFEIALKEQGINLIRTKVGDRYVLEEMTKGGYSIGGEQSGHIIFLDDNTTGDG
FT                   EITALKLCSISKESGKKLSELAACMITYPQVLINAKVKNELKNAYLEDEEIKREIENLE
FT                   REMRGEGRVLIRPSGTEPLVRVMVEGKDYDKISQMAKELAELIERKLN"
FT   gene            493940..495766
FT                   /locus_tag="Thebr_0484"
FT   CDS_pept        493940..495766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0484"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: tpd:Teth39_0472
FT                   glucosamine--fructose-6-phosphate aminotransferase;
FT                   TIGRFAM: glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; PFAM: glutamine amidotransferase class-II;
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79091"
FT                   /db_xref="GOA:E8UVE8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVE8"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADV79091.1"
FT                   /translation="MCGIVGYIGDKQATPILLEGLTKLEYRGYDSAGIAILNDGNINIK
FT                   KAKGRLNVLKELVEKDNMVGTIGIGHTRWATHGEPSDTNSHPHLSQSGLIAVVHNGIIE
FT                   NYLPLKKWLLEEGYTFKSETDTEVVANLLEYYYNGDIVEAVKKVLDRIEGSYALGVLCK
FT                   NNPDMIVAARKEAPLIVGIGNGENFIASDIPAILKHTRSVYFLDDHEIAIIKKDSVEFI
FT                   DMFGRQVEKSLFEVKWDVEAAEKGGYEHFMIKEIHEQPSAIKDTLRGRIIDDSEIVLDD
FT                   VKITKEDLEKIDKIFIVACGTAYHAGVVGKYVIENLARIPVEVDVASEFRYRNPLVNER
FT                   TLTIVISQSGETADTIAALKEAKKKGSRVIAITNVVGSSVSREADDVLYTWAGPEIAVA
FT                   STKAYTTQLIALYLIAMDLAIKRGIITKTKVMELCTELKKLPEKVQYLLDNKDVIQKFA
FT                   SEHYNAKDVFYIGRGLDYAVAMEGSLKLKEISYIHSEAYPAGELKHGTLALVEEGTLVI
FT                   ALATQDDLFEKMLSNIKEVKARGGFLVAFAKQGNLQLEGVVDKVIYIPETLKELTPVLT
FT                   VVPLQLLAYYMAVEKGCDVDKPRNLAKSVTVE"
FT   gene            496108..496524
FT                   /locus_tag="Thebr_0485"
FT   CDS_pept        496108..496524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0485"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: tpd:Teth39_0473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79092"
FT                   /db_xref="GOA:E8UVE9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVE9"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADV79092.1"
FT                   /translation="MWKLFAILSALFAALTSILAKIGIKGVDSNLATAIRTTVIIFLAW
FT                   GIVFTTGGQYGIKSLTKQNWIFLILSGLATGLSWLFYYKAISIGEVSKVALIDKSSIVL
FT                   TLTLSFFILNEQFTAKTLVASVLITAGIFMMIWK"
FT   sig_peptide     496108..496170
FT                   /locus_tag="Thebr_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.963 at
FT                   residue 21"
FT   gene            496630..497019
FT                   /locus_tag="Thebr_0486"
FT   CDS_pept        496630..497019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0486"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   tpd:Teth39_0474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79093"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVF0"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADV79093.1"
FT                   /translation="MVVLEINTPTREVMVDITDMVMQEIKKSGVVDGLCVIFVPHTTAG
FT                   ITINENADPTVREDIMAALEKIIPNMRFKHMEGNSDAHIKASLMGSSVTLIIENGRPLL
FT                   GTWQGIYLCEFDGPRRRRVYIKFLK"
FT   gene            complement(497022..497945)
FT                   /locus_tag="Thebr_0487"
FT   CDS_pept        complement(497022..497945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0487"
FT                   /product="DNA polymerase LigD, ligase domain protein"
FT                   /note="manually curated; TIGRFAM: DNA polymerase LigD,
FT                   ligase domain protein; KEGG: tpd:Teth39_0475 ATP dependent
FT                   DNA ligase; PFAM: ATP dependent DNA ligase; ATP dependent
FT                   DNA ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79094"
FT                   /db_xref="GOA:E8UVF1"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVF1"
FT                   /inference="protein motif:TFAM:TIGR02779"
FT                   /protein_id="ADV79094.1"
FT                   /translation="MSMIEEKISPMLASSSDPFDSPEWIYEIKWDGSRTIAFLSNKTRL
FT                   QDRRLVDITHQFPDLALLYKQIKAKEAILDGELVVLKNGKPSYKSIMSRKHQQNLVKIN
FT                   LLSKIMPVIFITWDILYLNGKSLVELPLIERKDILRKTVKENEIIKISDFIFEHGKMLF
FT                   EETGKKGLEGIVAKKADSKYLIGKRSKLWLKSKHFIVINAVIIGYRTDKTALILGLYDE
FT                   ENNLINIGSCESGLSQKELKAFYEVAKEIKAPDNYYNFKEKNVQWLKPLLTCKVRFMEW
FT                   SENMKMRAPSFIQFEYNVKPEECRFE"
FT   gene            complement(497959..498771)
FT                   /locus_tag="Thebr_0488"
FT   CDS_pept        complement(497959..498771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0488"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   tpd:Teth39_0476 Ku domain-containing protein; SMART: Ku
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79095"
FT                   /db_xref="GOA:E8UVF2"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVF2"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ADV79095.1"
FT                   /translation="MRSMWKGAISFGLVSIPIKLYTATEDHAIHFRQLHKECKSPIKYE
FT                   KICPVCNRPVSDEEIVRGYEYEPGKFVIIDDEDLERIPMPTVKTIDIVDFTDIGQIDPI
FT                   YYDKTYFIVPEDIGTKPYVLLRDSMKETKRVAIAKVVIRSKQNLACIRVYEEKYMVMET
FT                   MHFPDEIKNTNQLPPLREVSLQENEIKMAKQLIDTLTSDFKPEKYDDSYRKTLIEMIES
FT                   KIQDKDIEIPQKAPEADNVLDLVSALKASIESVKNEEKAKKGRKRKGA"
FT   gene            498904..500172
FT                   /locus_tag="Thebr_0489"
FT   CDS_pept        498904..500172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0489"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="KEGG: tpd:Teth39_0477 peptidoglycan binding
FT                   domain-containing protein; PFAM: Peptidoglycan-binding
FT                   domain 1 protein; Peptidoglycan-binding lysin domain;
FT                   SMART: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79096"
FT                   /db_xref="GOA:E8UVF3"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVF3"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADV79096.1"
FT                   /translation="MGGIKLKNIKKILSWILIIAIVVLIPIFSYARNLPKFTFGSRLLY
FT                   SGTYGTDVEELQAMLNKAGFDTGTVDGIFGKMTLNGVLDFQRSKNLVPDGIVGPKTYAA
FT                   LETVSWADPIVYSVKPGDNLYFIAKRHGTNVQNIIDANGLNDGDSLYVGQKILIPHPPV
FT                   EVPQQLNNATNYQELKNNIQALISQYPGKYGVYFIDLNTGQTFEINGYDSFIAASTYKV
FT                   PLNFYLYTLITDGKIDPNMKVQYTQADYEGGAGSIQADPVGSYYTIRELSRRSIEESDN
FT                   IASNMIMRIVGRDNYIKFMEKLGAYVIPYSNNVTSPRDMSMYMKNLLDYVNAHPDTAGE
FT                   LMYYLKNTIYNDRISYPIPDGIEVAHKIGNLSNVVNDAAIVFHPTRPYILTVLANNVDG
FT                   SDDSYAYTVIRQISKMVYDFQNR"
FT   sig_peptide     498904..498999
FT                   /locus_tag="Thebr_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.769) with cleavage site probability 0.767 at
FT                   residue 32"
FT   gene            complement(500266..500895)
FT                   /locus_tag="Thebr_0490"
FT   CDS_pept        complement(500266..500895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0490"
FT                   /product="sporulation protein YtaF"
FT                   /note="KEGG: tpd:Teth39_0478 hypothetical protein; TIGRFAM:
FT                   sporulation protein YtaF; PFAM: protein of unknown function
FT                   DUF204"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79097"
FT                   /db_xref="GOA:E8UVF4"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVF4"
FT                   /inference="protein motif:TFAM:TIGR02840"
FT                   /protein_id="ADV79097.1"
FT                   /translation="MKWLIILGFAISSSIDNFGVGISYGIRNIRISLFSNTIIAVISFL
FT                   FSISGIFFGKWLNKILPGSLPIIVGAFLLFIIGLRIILLAIPRKSFTKNIQQVSSKTTS
FT                   IKEILENPEIVDLDKSGEINLWEAILLGIALSANALTNGLGAGLLGFSPFAISFTTSIG
FT                   SFVSVWTGVQLGTKVANIRIGSFTIGQFGTIISGVILLIIAYKALF"
FT   gene            501033..501320
FT                   /locus_tag="Thebr_0491"
FT   CDS_pept        501033..501320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0491"
FT                   /product="protein of unknown function DUF503"
FT                   /note="PFAM: protein of unknown function DUF503; KEGG:
FT                   tpd:Teth39_0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79098"
FT                   /db_xref="InterPro:IPR007546"
FT                   /db_xref="InterPro:IPR036746"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVF5"
FT                   /inference="protein motif:PFAM:PF04456"
FT                   /protein_id="ADV79098.1"
FT                   /translation="MIVSYCKIYLRANWVHSLKEKRMIVKSIVGKVKSHYNVSICEIEN
FT                   QDLHKSIVIGFSVCGSDAVLTNKIVQEVVDYIEENTDAYIENIEMDTINV"
FT   gene            501438..503081
FT                   /locus_tag="Thebr_0492"
FT   CDS_pept        501438..503081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0492"
FT                   /product="hybrid cluster protein"
FT                   /note="KEGG: tpd:Teth39_0480 hydroxylamine reductase;
FT                   TIGRFAM: hybrid cluster protein; PFAM: Prismane"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79099"
FT                   /db_xref="GOA:E8UVF6"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVF6"
FT                   /inference="protein motif:TFAM:TIGR01703"
FT                   /protein_id="ADV79099.1"
FT                   /translation="MSMFCYQCQEASQGIGCTVRGVCGKTDDVANLQDLLIFTLKGISF
FT                   LNLKARETGVNKEKTDRFLFEGLFSTITNVNFDRNFFINKIKEAVALREEIKEDLKKAG
FT                   IEVDESCEAIHWVYDTDEDIEAIAAEVGVLSTKDEDIRSLRELITYGVKGMAAYAYHAY
FT                   QLGYKDDNIFRFMEKALAKVLDDSLTADDYVALALEAGKYGVDTMALLDKANTSTYGHP
FT                   EITKVNIGVRNNPGILISGHDLKDLEQLLEQTAGTGVDVYTHGEMLPAHYYPAFKKYPH
FT                   FVGNYGNAWWQQDREFELFNGPILMTTNCLVPPKDSYKDRVYTTGVVGFEGVKYIPEGP
FT                   DGKKDFSEIIEHAKRCKPPVEIERGEIIGGFAHNQVLELADKIVEAVKTGAIKRFFVMA
FT                   GCDGRMKSRTYYTEFAKALPKDTVILTAGCAKYRYNKLNLGDINGIPRVLDAGQCNDSY
FT                   SLAVIAMKLKEVFGLNDINKLPISYNIAWYEQKAVIVLLALLYLGVKNIHLGPTLPAFL
FT                   SPNVTKVLVDKFGIGGITNVEDDMKMFMGE"
FT   gene            complement(503152..503550)
FT                   /locus_tag="Thebr_0493"
FT   CDS_pept        complement(503152..503550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0493"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: tpd:Teth39_0481 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79100"
FT                   /db_xref="GOA:E8UVF7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVF7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADV79100.1"
FT                   /translation="MDTVGERIKYARKKNNLTITALSKLTGLSVGNLSDLENNKSMPSS
FT                   NALIKLKNALNVSIDWLLTGQQIEYVKEEEEKYLSREEFESISEKDKIIFKAFETLPEE
FT                   RKRDIEGYIKVSLNTTDLEEFIKKEKKV"
FT   gene            503728..503913
FT                   /locus_tag="Thebr_0494"
FT   CDS_pept        503728..503913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79101"
FT                   /db_xref="GOA:E8UVF8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVF8"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0482"
FT                   /protein_id="ADV79101.1"
FT                   /translation="MKKRKLTDFGKLVNDRLAELNMTQKELSRLIGTSEPYLSMILHGE
FT                   RSGKKYMDKIKEILKL"
FT   gene            504212..504577
FT                   /locus_tag="Thebr_0495"
FT   CDS_pept        504212..504577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79102"
FT                   /db_xref="InterPro:IPR017016"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVF9"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0483"
FT                   /protein_id="ADV79102.1"
FT                   /translation="MYYRKVSEYISTREEERRNITTHYTVVMSEISVFNGKEEVKLPSY
FT                   GIKILQEIFDGEKEKIEIIEEKVTNISPYFEKVDKLAQFFKEMTVSPVHLYEVIDDMCE
FT                   DYISDYDRQAKLCKVAI"
FT   gene            504673..505089
FT                   /locus_tag="Thebr_0496"
FT   CDS_pept        504673..505089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0496"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="KEGG: tpd:Teth39_0484 4'-phosphopantetheinyl
FT                   transferase; TIGRFAM: holo-acyl-carrier-protein synthase;
FT                   PFAM: 4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79103"
FT                   /db_xref="GOA:E8UVG0"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVG0"
FT                   /inference="protein motif:TFAM:TIGR00516"
FT                   /protein_id="ADV79103.1"
FT                   /translation="MELFVGTDIVEVERIKKAFDANSKFLERLFTQKEIEYFNSKRMKL
FT                   PHIAGFFSAKESISKVLGTGISGFSWKDIEICHDEKGAPAVILKGKAKNIADKKGIRDI
FT                   KLSISHTKTYAISCAIAIGGEKNDSADLKTDERS"
FT   gene            505052..506584
FT                   /locus_tag="Thebr_0497"
FT   CDS_pept        505052..506584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0497"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="KEGG: tex:Teth514_0962 carbohydrate kinase, YjeF
FT                   related protein; TIGRFAM: carbohydrate kinase, YjeF related
FT                   protein; PFAM: protein of unknown function UPF0031;
FT                   YjeF-family domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79104"
FT                   /db_xref="GOA:E8UVM3"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVM3"
FT                   /inference="protein motif:TFAM:TIGR00197"
FT                   /protein_id="ADV79104.1"
FT                   /translation="MIVLTSKQMREVEKIAIEKIGIPSIGLMENAGRETALEVKKILEE
FT                   ENLNSVIVISGKGNNGGDGYVVARNLYNWGVDVKVFLTTSLGAISGDAKVNLDAILNMG
FT                   IYVAEITQREHLKFLEKTIKDSDVIVDAIYGIGLKGEISGITKEIIEMINQANKIVVSV
FT                   DIPSGLNADTGKIEGCAVRATKTVTMQFLKPGLLVYPGVDYAGEVRVAEIGIPYRLAAE
FT                   VGYNYNLVTSEDVKLPKRHGNTHKGDYGKALIIAGSKNMTGAAYLCAKSAIKAGCGLVK
FT                   LAVPQSVQSVIQGGLYEVITYGLEEQNGILSHNALSSVLELIEESDVIAIGPGLTHDRD
FT                   ISQLVYDIVKNTDKPVVLDADALNALVGRLEVIQGKKIILTPHYGEMSRLTGLKIDEIK
FT                   NNLFEVAKTFIDRYKVTLVLKGAKTVIATKEGSIYINSTGNPGMATAGSGDVLAGMITA
FT                   FLAQGFSEEKAAIYGIFYHGKAGDIAKEYVGEYGMTAMDILENIPEALKCSL"
FT   gene            506596..507606
FT                   /locus_tag="Thebr_0498"
FT   CDS_pept        506596..507606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0498"
FT                   /product="outer membrane lipoprotein-sorting protein-like
FT                   protein"
FT                   /note="KEGG: tpd:Teth39_0486 outer membrane
FT                   lipoprotein-sorting protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79105"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVM4"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0486"
FT                   /protein_id="ADV79105.1"
FT                   /translation="MLKKSFFVIVFVLIFLLSGCGIKAKKVKDPFISIKEQLDKLESYT
FT                   ATAIVELYNNKIGNKFSVVQFYKKGKFRLEVLEESGSPDKIIVYDGKRSYVYFAKVNQV
FT                   FVAENTEEIPLYSLITSFIKNYINSGGEIEKREMDKFYLITVPILDKNIFMYKEQMAFS
FT                   KEDLTPKELTIFDINNEIFSKITYKDYKYNPEINDKLFTKDSVTTLAGNLLDSPVIEID
FT                   AKEVYKYCGINPVMPVYLPQGFKLLNVLVNVNENNGVTFVYTLGKNLMEIFETVVDQNE
FT                   IVNEKGFLLSEGVYYKEKDNGEKEYTTMVNGIQIKITVTGDLSEEEILKVIKSLR"
FT   gene            507628..508794
FT                   /locus_tag="Thebr_0499"
FT   CDS_pept        507628..508794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0499"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; KEGG: tpd:Teth39_0487
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79106"
FT                   /db_xref="GOA:E8UVM5"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVM5"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADV79106.1"
FT                   /translation="MFDNIRPTRAEIYLDNIVHNLSEVKRWVGKKVKIMGVVKANAYGH
FT                   GACQVAKVLIENGVSYLGVATIEEALELRECGINIPILVFGYTPLPQAKELIVHNITQT
FT                   VFDINYVKDLERIALNVGKKAKVHVKVDTGMGRIGYTDLNVAEKEIEKMMEMEGVEVEG
FT                   IFSHFATSDEKDKTYAEQQFDMFKKLLESLKQKEINIPLKHIANSGAIIDLKYTYLDMV
FT                   RPGIVLYGSYPSENVERPLDLRQTMGFKTKIVYIKEVPEGTSISYGRTFITKRKSKIAT
FT                   LPVGYADGFNRLLSNNHHVLVKGKYAPVIGRICMDQTMLDVTDIEGVEVGDDVTIFGNQ
FT                   DGEKITAEEIAKKLNTIPYEVYCGISRRVPRIYIYKGEVIEVKNYLKI"
FT   gene            508884..509159
FT                   /locus_tag="Thebr_0500"
FT   CDS_pept        508884..509159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0500"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="KEGG: tmt:Tmath_1830 putative transcriptional
FT                   regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79107"
FT                   /db_xref="GOA:E8UVM6"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVM6"
FT                   /inference="similar to AA sequence:KEGG:Tmath_1830"
FT                   /protein_id="ADV79107.1"
FT                   /translation="MGETKRILVSLPQSLLEEVDVLAAMENRNRSEFIREAMKLYIREK
FT                   KKIQIRESMKKGYLEMAAINSELAEMGLTAENECFTGYEMKLKKCD"
FT   gene            509162..509512
FT                   /locus_tag="Thebr_0501"
FT   CDS_pept        509162..509512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0501"
FT                   /product="PemK family protein"
FT                   /note="PFAM: PemK family protein; KEGG: tmt:Tmath_1829
FT                   transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79108"
FT                   /db_xref="GOA:E8UVM7"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVM7"
FT                   /inference="protein motif:PFAM:PF02452"
FT                   /protein_id="ADV79108.1"
FT                   /translation="MVIKRGDIFYADLSPVIGSEQGGIRPVLIIQNDIGNKYSPTVIVA
FT                   AITSQINKAKLPTHVEINGAEYGLNKDSVVLLEQIRTIDKKRLREKIGHFDQEMMEKVN
FT                   EALQISLGLIDF"
FT   gene            509667..509765
FT                   /pseudo
FT                   /locus_tag="Thebr_0502"
FT   gene            509840..510685
FT                   /locus_tag="Thebr_0503"
FT   CDS_pept        509840..510685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0503"
FT                   /product="Protein of unknown function DUF2179"
FT                   /note="PFAM: Protein of unknown function DUF2179; protein
FT                   of unknown function DUF161; KEGG: tpd:Teth39_0490
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79109"
FT                   /db_xref="GOA:E8UVM8"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVM8"
FT                   /inference="protein motif:PFAM:PF10035"
FT                   /protein_id="ADV79109.1"
FT                   /translation="MKITAKKIIIDFFGVSVGTLLVALSLDLFLAPNKIAPGGVSGLAV
FT                   VLQHLFGWPIGAVTLAINIPLFIISTKALGTGFGAKTLYSTILLGVSIDALAFLKPLTH
FT                   DTILAAVYGGIIMGVGIGIVIKYGATTGGTDMAAMTLHKYIHFLSVGRILLIIDFVIIT
FT                   LAGIVFSPELALYALATEFISIKVIDLIQEGSGDERIAIIISDRYEEISKSILEEMERG
FT                   VTELKGRGGYSKKDKNVLLCVVTRREVTTLRSLVKRIDPNAFMILSTAHEVLGEGFKNM
FT                   "
FT   gene            510701..511522
FT                   /locus_tag="Thebr_0504"
FT   CDS_pept        510701..511522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0504"
FT                   /product="Transketolase domain-containing protein"
FT                   /note="PFAM: Transketolase domain-containing protein; KEGG:
FT                   tpd:Teth39_0491 transketolase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79110"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVM9"
FT                   /inference="protein motif:PFAM:PF00456"
FT                   /protein_id="ADV79110.1"
FT                   /translation="MDKEFLKQKAKEVRIDIINMLAEAGSGHPGGSLSCADILTLLYFD
FT                   KMNVKPDNPKWEDRDRLVLSKGHAAPALYAVLAEKGFFPKEELKTLRKLGSILQGHPDM
FT                   KSTPGLDMTTGSLGQGLSAANGMALAGKLDKKGYRVYVILGDGELQEGQIWEAAMTAAH
FT                   YKLDNLTAILDFNGLQIDGPNREVKNIEPVNEKFNAFGWHVIEIDGHDFDQIDKAIEEA
FT                   KATKGKPTLIIAHTIKGKGVSFMENQVGWHGSAPNEEQRQKAIQELEGSGV"
FT   gene            511523..512443
FT                   /locus_tag="Thebr_0505"
FT   CDS_pept        511523..512443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0505"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain-containing protein; KEGG: tpd:Teth39_0492
FT                   transketolase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79111"
FT                   /db_xref="GOA:E8UVN0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVN0"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ADV79111.1"
FT                   /translation="MAMATREAYGKALVELGAKNKNVVVLDADLSKSTKTADFQKVYPD
FT                   RFFNMGISEQDMMVTAAGLATCGKIPFASTFAIFATGRAYEQVRNSIGYPHLNVKIAAT
FT                   HAGITVGEDGATHQSIEDISLMRGIPGMVVINPADAEEARQAIFAAAEHYGPVYIRLGR
FT                   MAVPDIHDQNYKFELGKGEVIREGKDVAIIATGVMVAIAIEAADKLKEEGIEATVVNIH
FT                   TIKPIDKDLIVEVAKKTGKVITAEEHSIIGGLGSAVAEVLSEEYPVKIKRIGIRDEFGQ
FT                   SGSPKELLKHYGLTAEDIVKAAKSF"
FT   gene            complement(512472..512987)
FT                   /locus_tag="Thebr_0506"
FT   CDS_pept        complement(512472..512987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0506"
FT                   /product="Protein of unknown function DUF2148"
FT                   /note="PFAM: Protein of unknown function DUF2148; KEGG:
FT                   tpd:Teth39_0493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79112"
FT                   /db_xref="InterPro:IPR019224"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVN1"
FT                   /inference="protein motif:PFAM:PF09918"
FT                   /protein_id="ADV79112.1"
FT                   /translation="MDVIELAAHLMALSARTAPKATGKDFIETKVITGEDLIRLKEDMM
FT                   KYGEESGKKNFDRDAKNVANSSAVLLISLNKPEKVGLNCGACGYNLCTSLRDFREGTEF
FT                   AGPICAWRLIDLGIAVGSAVKTASLLNVDNRVMYRIGVSARRLKLIEGEIVVGIPLSAT
FT                   GKNIYFDR"
FT   gene            513171..514415
FT                   /locus_tag="Thebr_0507"
FT   CDS_pept        513171..514415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0507"
FT                   /product="phosphofructokinase"
FT                   /note="PFAM: phosphofructokinase; KEGG: tpd:Teth39_0494
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79113"
FT                   /db_xref="GOA:E8UVN2"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVN2"
FT                   /inference="protein motif:PFAM:PF00365"
FT                   /protein_id="ADV79113.1"
FT                   /translation="MYTKSNCLIAQSGGPTAVINSSLYGAIMEASRSEKIDKVYGGING
FT                   IEGIIKGNIIDIFDIPYERIKQMRFSPAAALGSCRYRLKDYLEDEEEYKKLIEIFKKYN
FT                   IKYFFYIGGNDSMDAVDKISKYAREIGFEINVIGIPKTIDNDLMFTDHSPGFGSAAKYI
FT                   ATTTLELALDAEVYETKTINVLEVMGRNAGWLTASSALVKERLPHLKQLIYLPEIPFNE
FT                   ERFLEDVNKAYKEYGNVFITVSEGLMDEKGNYIGRKENAYHKDAFGHPQLGGVGDYIEK
FT                   LVKEKIYKRVKMTRLGVTQRCAMHLASKVDFEEAEMLGKEAVKYALFGETGKMISLVRE
FT                   RNYPYTVKTDIVDVDKVCNKEKKMPLNWINEEGNYVTEEFFDYARPLIQGEVKVPMAEG
FT                   LPYYINLKYAIKKQE"
FT   gene            complement(514428..515792)
FT                   /locus_tag="Thebr_0508"
FT   CDS_pept        complement(514428..515792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0508"
FT                   /product="Na+/H+ antiporter NhaC-like protein"
FT                   /note="PFAM: Na+/H+ antiporter NhaC-like; KEGG:
FT                   tpd:Teth39_0495 Na+/H+ antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79114"
FT                   /db_xref="GOA:E8UVN3"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVN3"
FT                   /inference="protein motif:PFAM:PF03553"
FT                   /protein_id="ADV79114.1"
FT                   /translation="MENKFRISLITFLLILAITMTMVLVFHQPPYIPLFISYIITFAIV
FT                   LINGFSPQELVNMSIDGFKKGINVMIILLLIGALVALWKQNGTLPALVYYASHFLKPQG
FT                   FLLLSFITTSIISMILGTAVGTASTIGIVIMGLAHGFGYPLPIVAGAVISGSFIGDRTS
FT                   PLAGNVILLSDMGEIEQYNVLKSLFKTAIPTYILTGLLYYLLSLHINISSPYTFDNLAA
FT                   IILKNYKINFFLFLAPIMIITLAFFRIPTKINLSIAVLLSYFVSLLNGYNLIDSLKVIM
FT                   MGNVSNIPEFKSFFSGGGMVSIFPMIGVVTFATALSGILEGTGIIKAVFKKAQKIKNPK
FT                   IAYLVTMLLSTLMAVITCNQALSVILPSRIMLEVFRNLNVKSDMMVRAIADSGMILAGI
FT                   IPWNLAAMFLSAVLGVKVIDYLPYAYLNLLFPILSILIVFIESNKQYSNVLMEEF"
FT   gene            complement(515823..516962)
FT                   /locus_tag="Thebr_0509"
FT   CDS_pept        complement(515823..516962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0509"
FT                   /product="Osmosensitive K channel His kinase sensor"
FT                   /note="PFAM: Osmosensitive K channel His kinase sensor;
FT                   UspA domain-containing protein; KEGG: tpd:Teth39_0496
FT                   osmosensitive K+ channel histidine kinase sensor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79115"
FT                   /db_xref="GOA:E8UVN4"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVN4"
FT                   /inference="protein motif:PFAM:PF02702"
FT                   /protein_id="ADV79115.1"
FT                   /translation="MSEGFRRLTPEEALEIIKKQQRGKLKIFLGYAPGVGKTYAMLNEG
FT                   NRRLKRGQDVVIGYVETHGRKETEAQIGNLEIIPRKKIEYHGMILEEMDTDAIIARKPE
FT                   VVLIDELAHTNAPGSKHKKRYEDVEEILRHGINVITTLNIQHLESLNDVIQQITGVAVR
FT                   ETIPDSIVDNADEIVAVDLTPDALLNRLKRGDIYPVSKVDECLSNFFRKGNLNALRELM
FT                   LRLTAEEVDIELEEYMKEHGITDTWETNEKIMVCITPNPLSKKLIRRGARRARRFKCDW
FT                   VVVYVNCTHFLAPKLTEKDKEVLESHFMLAKQLGAEVYTLTGKSVSDELLKFAKQMHIT
FT                   QIIIGHSQRSRLQTFFRGSTVIKLIKKAKNIEIHVIPYK"
FT   gene            complement(517080..517238)
FT                   /locus_tag="Thebr_0510"
FT   CDS_pept        complement(517080..517238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0510"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   tpd:Teth39_0497 rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79116"
FT                   /db_xref="GOA:E8UVN5"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVN5"
FT                   /inference="protein motif:PFAM:PF00301"
FT                   /protein_id="ADV79116.1"
FT                   /translation="MEKWQCTVCGYIYDPEEGDPSQGIEPGTPFEELPDDWVCPDCGVG
FT                   KDMFEKM"
FT   gene            complement(517324..518622)
FT                   /locus_tag="Thebr_0511"
FT   CDS_pept        complement(517324..518622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0511"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="KEGG: tpd:Teth39_0498 thiamine biosynthesis protein
FT                   ThiC; TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79117"
FT                   /db_xref="GOA:E8UVN6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVN6"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ADV79117.1"
FT                   /translation="MTQLEYALSGIVTKEMKIVAEYEGVDEEFILEGVKKGEIVIPSNI
FT                   NHKNLIPKGIGRGLSTKVNANIGTSDAYPEIEKEIEKLNVAVKAGADAVMDLSTGGDIN
FT                   QSCRKILENSPVPVGTVPMYQAAVESISKYGSIVAMPEEFIFEVIEEQAKDGVDFITVH
FT                   CGLTFESLKKLKDNGRVMDIVSRGGSFTIAWMLHNNKENPLYKHFDRLLDIAKKYDITL
FT                   SLGDGLRPGCLEDATDAAQIQELIILGELVKKSREAGVQVMVEGPGHVPIDQIEANVKL
FT                   QKQLCHNAPFYVLGPIVTDIAPGYDHITSAIGGAIAAASGADFLCYVTPAEHLGLPDKE
FT                   DVKEGVIAAKIAAHAADIAKGVKGAKEKDLTMARARKALNWDEQIKLSIDPDKAFKYRV
FT                   NKNISTAKTCSMCGKFCAMKIVSEYLGTSTMTC"
FT   misc_binding    complement(518668..518775)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 80.87"
FT   gene            518976..520019
FT                   /locus_tag="Thebr_0512"
FT   CDS_pept        518976..520019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0512"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   tit:Thit_2281 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79118"
FT                   /db_xref="GOA:E8UR59"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8UR59"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADV79118.1"
FT                   /translation="MVHNNDTTKKRSFKHLSSYERGEIYALLKEGRSIRYIAKKLNRSP
FT                   STISREIKRGTTTQLRSDLSSYTSYFPETGQAIYEKNRSNCGAKFKVAKAEDFLKYAEN
FT                   KILNEKWSPDAVVGYCKKDPSWNNKTIVCTKTLYNYIDRGLLKVKNIDLPLKLRLKPRK
FT                   KQNRKNKRIMGKSIDFRPKEVESREVFGHWEIDTLIGKKSNDKVLLTLIERKTRHEIIF
FT                   LLDAKDNKSVKDALSKLKDMFGDNLSKVFKTITSDNGTEFSDLESALLEYGVEVYYTHP
FT                   YSSWERATNERHNGLIRRFIPKGKSIKDLSIDTIKRVENWLNNLPRKLLNYKTPKEYFY
FT                   EELAKIC"
FT   gene            520498..521790
FT                   /locus_tag="Thebr_0513"
FT   CDS_pept        520498..521790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0513"
FT                   /product="homoserine dehydrogenase"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; KEGG: tpd:Teth39_0500 homoserine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79119"
FT                   /db_xref="GOA:E8UVN8"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVN8"
FT                   /inference="protein motif:PFAM:PF00742"
FT                   /protein_id="ADV79119.1"
FT                   /translation="MKIKIGLLGLGTVGTGVYKLITSRGGHIRESTGVYPEIKKILVKN
FT                   LNKPRKVKVEGLLTQNAEEILKDKEIKIVIEAIGGISPAYEYVKEALSSGKHVITANKE
FT                   LMAKHGEDLNETAKKNGVFLKCEASVGGAIPILHQIDRLKITDEIDFVGGIVNGTTNYI
FT                   LTQMSTKGKSYEEALKEAQQLGYAEANPDYDVKGFDSLYKLIILMRKVFNVNVPVNSIR
FT                   RSGIDGIAREDLDYITEWGYKLKLFAWGKKIENGVFAGVEPVLVEESNILSRVNDVNNA
FT                   VILKGDSFGEYVFVGKGAGELPTGDAVVADLIDILLNYNIKDNDAAKLLPVRQGSFTDT
FT                   FYIRLKMHKGDILNLQKILNFFKREEALILESSYENDTFAAVIKLKTNIDVFVEKLNDK
FT                   KIGELKAIFKVLQEDIDELQLKEFEDLVGVI"
FT   gene            521830..523113
FT                   /locus_tag="Thebr_0514"
FT   CDS_pept        521830..523113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0514"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /EC_number="2.5.1.47"
FT                   /note="TIGRFAM: O-acetylhomoserine/O-acetylserine
FT                   sulfhydrylase; KEGG: tpd:Teth39_0501
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79120"
FT                   /db_xref="GOA:E8UVN9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVN9"
FT                   /inference="protein motif:TFAM:TIGR01326"
FT                   /protein_id="ADV79120.1"
FT                   /translation="MSKKYGFSTLAIHEGWEPDPTTGAVALPIYQTSSFAFKSTEHAAD
FT                   LFALKEEGYIYTRMMNPTVDVFEKRIAALEGGVGALAVSSGQAAITLAVTNIAGVGDEI
FT                   VSSTNLYGGTYNLFATTLKKFGINFKFVDPSNPENFKSQITDNTKALYVETIGNPKIDV
FT                   ADIEKIAEIAHTAGIPLIVDNTFATPYLARPIEFGADIVVHSATKFIGGHGTSIGGVIV
FT                   DSGKFNWDNGKFPELTEPDPSYHGIRYVKDVGEAAYIVKARVQLLRDLGTALSPFNAFL
FT                   FAQGLETLSLRMERHSQNALKVAEFLASHPYVSWVNYPGLKSSPYYALAQKYLPRGQGG
FT                   VLTFGIKGGLKAGIKFIESLKLFTHLANIGDAKSLVIHPASTTHQQLSKEEQLASGVTE
FT                   DMIRLSVGLEDIEDILEDLDNALYASQK"
FT   gene            523134..524234
FT                   /locus_tag="Thebr_0515"
FT   CDS_pept        523134..524234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0515"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="TIGRFAM: homoserine O-acetyltransferase; KEGG:
FT                   tpd:Teth39_0502 homoserine O-acetyltransferase; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79121"
FT                   /db_xref="GOA:E8UVP0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVP0"
FT                   /inference="protein motif:TFAM:TIGR01392"
FT                   /protein_id="ADV79121.1"
FT                   /translation="MIVEEKKVTLKGKNIFTTESGYSFDELTIVYETYGKLNKEKNNVI
FT                   LVEHALSGSAHAAGMHPGKNNVGWWDPLIGPGKYIDTDKYFVICSNFLGSCYGTTGPSS
FT                   IDPRTGKPYGLRFPKINIRDMVRVQKLLLDYLGIDRIKVAIGGSMGGMQALEWAVTYPD
FT                   LVDKSIVIAADYKLTPLNIAYNHVGIQCILNDPHFYGGDYYDKPHKPDKGLSTARMLGM
FT                   ITYKSGDLFDYRFDRLRDENNFEVENYLNYHGLSFINRFDANSYLYILWAMNEHDITKP
FT                   YGSLKMALKRIKAEILMIGIDTDMIFPSKYMRDFIKKLNASGGCGKIEEISSMQGHDSF
FT                   LVDIDKIGPIISDFIEETYNKEMVCV"
FT   gene            524333..525469
FT                   /locus_tag="Thebr_0516"
FT   CDS_pept        524333..525469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0516"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: tpd:Teth39_0503 oxidoreductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79122"
FT                   /db_xref="GOA:E8UVP1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVP1"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADV79122.1"
FT                   /translation="MSKKEIKLGFVGLGFIGTIHSIACFSMPLIFKNLPFEVKLGPVYK
FT                   NNIEDIPHFFEKGVKSIEEMLEEGGLDAVDICTPNYLHYEQAMKVIEKGIPLYLEKPIG
FT                   VNGKEAYEIMEKAKEKRIIHQTALMYRFMPAVNQARDMIKNGEIGEILNFKALMLHSGY
FT                   MDPKRPMSWKMKKATSGGGAIVDMGIHLVDAVRFMMGEIKSLRSNSKTYFKKRPVSKGS
FT                   EIYEEVDVDDWTNVEVEMKNGGWGSIEASRISADLEEETRFEIYGTKGSIKISTKHPRY
FT                   AVLYKKQENVQIIGDYDTKSKFSEYVESIYPTEKYSLGWMVDLHMASLINFFTNIVEDK
FT                   IVFSETPTFEEAYKDQVILDKILLSAENNGKVISNLKD"
FT   gene            525514..526896
FT                   /locus_tag="Thebr_0517"
FT   CDS_pept        525514..526896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0517"
FT                   /product="RNA methylase, NOL1/NOP2/sun family"
FT                   /note="TIGRFAM: RNA methylase, NOL1/NOP2/sun family; KEGG:
FT                   tpd:Teth39_0504 NOL1/NOP2/sun family RNA methylase; PFAM:
FT                   Fmu (Sun) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79123"
FT                   /db_xref="GOA:E8UVP2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR027391"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031340"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVP2"
FT                   /inference="protein motif:TFAM:TIGR00446"
FT                   /protein_id="ADV79123.1"
FT                   /translation="MKITVKKEFLKRMEQLLKEEYEDFLKEYDKKPQKGLRVNTLKIGV
FT                   EEFKKIVPFEITPIPWCPTGFYYDKEEKAGNHLYHILGLYYIQEPTAMAVVEVLDPKPG
FT                   EKILDVSAAPGGKTTHIATKIGDEGIIVANEIDKKRIKALVENVERMGIRNIVITNETP
FT                   EKLATAFEGYFDKILVDAPCSGEGMFRKDPTARKIWSLNNVMSCSITQRNILRSVAPLL
FT                   KKGGILVYSTCTFAPEEDEGVIKKFLEEHPEFEIEESEISKFFDRGHPEWVEGPEDLKK
FT                   CMRLWPHKVRGEGHFIAKLRKKEEEEPDSRFKKAKGRKKQKELQLFYDFADKYLNLDLD
FT                   NLNIEVHNDFVYHVPEGLPDLSNIKVYRYGWQLGELKKNRFEPSHWLAMGIKTFQAKRL
FT                   LELEREQREKYLKGETFELDLEDGWIFFTIEGFPAGWGRIAKGVVKNYYPKWLRDIKVW
FT                   EE"
FT   gene            527005..535668
FT                   /locus_tag="Thebr_0518"
FT   CDS_pept        527005..535668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0518"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: glycosyltransferase 36; carbohydrate binding;
FT                   glycosyltransferase 36 associated; KEGG: tpd:Teth39_0505
FT                   glycosyltransferase 36 associated"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79124"
FT                   /db_xref="GOA:E8UVP3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="InterPro:IPR021478"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037820"
FT                   /db_xref="InterPro:IPR037824"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVP3"
FT                   /inference="protein motif:PFAM:PF06165"
FT                   /protein_id="ADV79124.1"
FT                   /translation="MWYIVALVLLLIATSIVHISKNQRLSREDSIRDFDDIILNSEEME
FT                   KHAAEIAQNHNIMKRTKLSYLLIPRMNKNYNYIKNVYRNLNSILKEEDVYISQEEEWLL
FT                   DNFYIIEEQVKEIRKSLSKSYYSGLPGLKNGLFKGYPRIYAIAFELVLHTDGKIDEKAI
FT                   INFIKAYQTKALLSSSELWALSLMIRIALVEKIKKICEKIVETRHQREKAEKILTLLLE
FT                   KEMKYEEVKKLIRNNINVADRFPLQFIEHLVSRLRKEGSNSVNVIQSIEKILMEYDTSI
FT                   NDVAEKAHQIQAKRQISIGNAITSLKTVSSLDWAQIFESLSSVEQVLRQDPDGTYPKMD
FT                   FESRDYYRHEIEKIAKYYNTSETYVAKKAIECAKEVTEQEGKLGYINHVGFYLVGKGRS
FT                   ILENKLSNKSKRTISWKKIAKKSPETLYVGLILIFLLVEEFFALKYIANFSNKWGLLFI
FT                   SGVILLIPFSEMSVQLVNWILVHIFKPVVLPKIELKEGIPEDAKTMVVISSLLPDEKRT
FT                   KELIENLEVYYHANREKNLYFGLLGDFKDAPFEVMSEDEKIVKCALEQIEKLNEKYSKN
FT                   GEKIFYYFHRKRKYNQMQKSWMGWERKRGALVEFNELLRGKEDTSFYVVSGDVAKLNIK
FT                   YVITLDADTNLPIDTAKKLVGTMLHPLNKAVIDRDYGVVVEGYGLLQPRIGIDIESANA
FT                   TLFSKIYAGEGGIDPYTTAVSDVYQDLFGEGIYTGKGIYDVDVFRELLRDTIPDNSILS
FT                   HDLLEGSFVRTGLVSDIELIDGYPAKYNSYIMRLHRWVRGDWQLLPYLKSKIKNRKGEM
FT                   VKNPLSLITKWKIIDNLRRSVVSVALMLMLFLGFSLLPGSSFLWLGVAILTVFFPILPA
FT                   LVDTIFKGQFRHYWEKRHKAVITSIEAAFYQSLLNFAFLPYQAYMMADAIVRTLTRLYI
FT                   TRKNLLEWVTAADMEKRLRNDFASFFKRMWIVLVEGLALVALVMYFKPQDLIGAIVLFF
FT                   LWAISPYIAFYISQPIISKEKTVSQEEMEELRLIARKTWRFFEDFVTESQNYLPPDNFQ
FT                   EDPPNGIAERTSPTNIGLYLVSVVGARDLGYITTTEMVERIKKTLTTIGKMEKWNGHLY
FT                   NWYNTRTLEPLRPYYVSTVDSGNLVGYLITVKEAIGEFLNKPLIDIELAKGLKDTIKML
FT                   NIEGITEDIFRNILNKKTLMPSDWEVFLSKISEKLSSTEDEVGNIERLKNIIGALKREM
FT                   KEFLAWTEFDERQKEQEIFKRYKEVFEEHSSPKELEKVYKNYLLEIEEVFKKATEEEKA
FT                   LLKSQKDKVAQALEKIKKLEAEIENIKSTIENLVEKTEFRHLYDEKRQLFSIGYNVEEE
FT                   KLTKSYYDLLASEARQASFIAIAKREIDKKHWFKLGRMLAIENRYKGLVSWSGTMFEYF
FT                   MPLLIMKNYQNTLLDETYAFAVRVQKNYAKELGIPWGISESGFYAFDINLNYQYKAFGV
FT                   PSLGLKRGLSHDKVVAPYGSLLAIGVDVEGVLQNIRFLKKEGVEGKYGFYEAIDYTPER
FT                   FPFGKKSAIVKSFMAHHQGMAFVALDNFINNNIMQKRFHKDPSIKAIQILLQEKMPMYL
FT                   DITREEREEARKIQKVRKEDGDFVRVLGESKTWLPEVHILSSGRYFVMLTEKGTGYSKN
FT                   NKGIFLTRWRKDLAQDFGTFIFVQNINSNTVWSATYAPFYEKGQNYRVVFSADKAEYFK
FT                   RVGNIDTHLEIVVSPEDDVEIRRLTLKNHSKHPRILEITSFGEISLIDLPTDVAHPAFN
FT                   KLFVKTEFLKEEDAILVCRKPREQGKNKLWAVHKVAVLSGEIVGDTQFETDRAKFIGRG
FT                   RSLKNPIALEADQPLSNTEGAVLDPIVSLRKRVKVMPGEVAKVVYISAITETKEKAIKI
FT                   AAKYKEENVVERDFEMSWTRSRVELDYLNLKPRELGLLQRMLAHILFVSPQRRYREEMI
FT                   LKNVKGQSGLWAYGISGDLPIVLVEIEKMEEIEMVKWFLKAYEYWKMKGINIDLVILNK
FT                   DKSGYLQPLHDKIKELINTTFSYDIFGKYGGVYLLQQNNLKEEDVYLLNTVVALKFEGG
FT                   NESIYDQIMIKETKNAPKLKNWVKKVQNFEEIKLEELPLDYYNGFGGFSYDGKEYIIKW
FT                   EGKSTPAPWINVISNPSFGFQVSETGAGYTWAENSREYKLTPWYNDPVLDPHGEVIYLT
FT                   DEETGDRWSITPLPAGKAKVHYIKHGFGYTSFETICCGLSQHLKMFVAKEDSIKINLVT
FT                   IKNLGNENRKLTVSYYIRPVLGVTDEITFPYLFTKYDEKIGALMIKNVYNEDFANRLAF
FT                   LSASEKINSFTGDRAEFIGVASSLTLPQALEYETLSNSTGISLDPCAAIQFHVEVKAKE
FT                   EKQFTILLGHGKNEEEVKRLILKYTNVENCQNELQRVQEFWQELLRRIQIKTPDKSMDL
FT                   LVNGWLPYQTIACRLWARSAFYQSGGAYGFRDQLQDAMNMVYLEPEFTKNQIVNACQHQ
FT                   FVEGDVQHWWHPVLNKGIRTKFADDLLWLPYVTADYIEKTGDWPILDIEVNYLEDLRLK
FT                   EEEEERYSTPRISETKGTVYEHCIRAIDYSLKFGEHGLPLMGAGDWNDGMNKVGNKGKG
FT                   ESVWLGWFLYTILQKFSPICQTKKDEEHAKKYQEIANKLIKAIEENAWDGSWYRRAYFD
FT                   DGTPLGSVDNSECKIDSISQSWSVISKAGKEVRVKEAMKAVVNYLVNEEEGIIKLLTPP
FT                   FDNGDLNPGYIKGYVPGVRENGGQYTHAAAWVILAFAELGEGDRAWQLYNMINPINHTR
FT                   TPIECMKYKVEPYVMAADVYAVEPHVGRGGWTWYTGAAGWMYRIAIENLLGLKKYGEKL
FT                   IIDPCIPKNWDKYVIEYNYKNTKYLIEVRNPEGVNKGVKEVYIDGELVTDKTIDLTKEG
FT                   NGHQVLVIMG"
FT   gene            535845..535963
FT                   /pseudo
FT                   /locus_tag="Thebr_0519"
FT   gene            536109..537086
FT                   /locus_tag="Thebr_0520"
FT   CDS_pept        536109..537086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0520"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_0506 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79125"
FT                   /db_xref="GOA:E8UVP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVP4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADV79125.1"
FT                   /translation="MMIELKNVTKVYGTRKAVDNISFSVDKGEIVGFLGPNGAGKTTTM
FT                   KMITGYMPPTSGTIKIAGYDIVEQPIEAKKHIGYLPEVPPLYLDMTVEAYLHFVGGIKG
FT                   VPPKKRREDVERIIHEVGLTDVRKRLIKNLSKGYKQRVGLAQAIIGDPDVLVLDEPTVG
FT                   LDPKQIKEIRDIIKELGKKHTIILSTHILPEVSMVCDRVIIINKGKIVAIDKTENLSTA
FT                   LQNSRRYFIKVEGPYEEVVNSVKEIEGVTNVEAEVDSDNTIKLTVESSADKDVRKDMFF
FT                   AFAKKGFPILELKMLNYSLEEVFLELTTEEESYDENVGNTKEGA"
FT   gene            537052..537759
FT                   /locus_tag="Thebr_0521"
FT   CDS_pept        537052..537759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0521"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tpd:Teth39_0507
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79126"
FT                   /db_xref="GOA:E8UVP5"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVP5"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADV79126.1"
FT                   /translation="MKMWEILKRELKSYFFSPLAYVLLGFYLLISGYFFTTYVLSTHYA
FT                   ILTPILGSMVTVFMFISPILTMRLISEDMKTGTDQLLLTSPVTVTDIVIGKFFSTVFVY
FT                   LVALVITFLYPIYLKLYSSPDMGSIIAGYIGVFLIGVTFISIGLFASSLTENQMIAGVI
FT                   GFALILVLWLISWLGDVFSGKAKTIFQNLSFFDRLNNFLNGLVNLSDVVFFISVIIFFI
FT                   FLTIRVVDKRRWS"
FT   gene            537771..539159
FT                   /locus_tag="Thebr_0522"
FT   CDS_pept        537771..539159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0522"
FT                   /product="ABC-type uncharacterized transport system"
FT                   /note="PFAM: ABC-type uncharacterised transport system;
FT                   KEGG: tpd:Teth39_0508 ABC-type uncharacterized transport
FT                   system auxiliary component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79127"
FT                   /db_xref="GOA:E8UVP6"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR039975"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVP6"
FT                   /inference="protein motif:PFAM:PF09822"
FT                   /protein_id="ADV79127.1"
FT                   /translation="MNNIRLKYGTNAFIMTALLLAILILANVIVTQKPVKWDLTKNKQY
FT                   TLSDQTKQVLKSLKTDVTVYAFFKEGTTSRDMVKSLLDQYRNVSKRIIVHFVDPDKEPA
FT                   TAQRYGITDYDTVLFIAGSGANEKRQIVNSYDIFGMGSQPNTATFNGEEQFTQAIIDVT
FT                   QPKKLNAYILQGHDELNSIDYLVTFKNALRGEGYNVEDLNIGQAGGIPKNTDLLVIVNP
FT                   RRDFTDKEMAALKEYFDKGGKAIIAMGAEYGPLTQKSVNELLSTWGVKFDNDVVVDPGR
FT                   NYFMDPLSPVPQYKFHTITNKLDLSNLYVVMPMSRSISYPDKPTENITIEQLLSTSDKA
FT                   WGKTDFNSKDANFQKGDIKGPLSLGLAISDSKTGMKIVAIGSSMMFTDKIITLEANRDF
FT                   LMNSANWLADKTTQISIRPKSLEFNQIFLTGKQAAILFYTTVVTIPLVMWIIGGYMWYR
FT                   RKTL"
FT   gene            539156..540058
FT                   /locus_tag="Thebr_0523"
FT   CDS_pept        539156..540058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79128"
FT                   /db_xref="GOA:E8UVP7"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVP7"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0509"
FT                   /protein_id="ADV79128.1"
FT                   /translation="MKIFKTTIVLLVIFAVLFGYYFYESKTNKPVKEDNKIFTFKNNDV
FT                   NSIKIEKEGKTLIDFKKEGDTWFIKEPIDYKADSIYVDELLDSLTSLTFDRTLEGDLST
FT                   YGLDKPSYAIKVSLKNGKSYSLFIGNKSPVKENYQEGYYAKTDGDKIYRVNASSLENFF
FT                   LTDDYVYKYMEKFVVSIPKNEITKLVFYQDRKEYQIQKGEKDNWQIDGKAIKADDVDNL
FT                   LDGIVLLQISGLDEGKNISQGETPFAFDVYGKDKVEKISFAKRDAENKYVLINGHCIGQ
FT                   YVTLKDIKNLQDTFDKLIK"
FT   gene            complement(540158..540310)
FT                   /pseudo
FT                   /locus_tag="Thebr_0524"
FT   gene            complement(540428..540838)
FT                   /locus_tag="Thebr_0525"
FT   CDS_pept        complement(540428..540838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0525"
FT                   /product="HEPN domain protein"
FT                   /note="KEGG: tpd:Teth39_0511 HEPN domain-containing
FT                   protein; PFAM: HEPN domain protein; SMART: HEPN domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79129"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVP8"
FT                   /inference="protein motif:PFAM:PF05168"
FT                   /protein_id="ADV79129.1"
FT                   /translation="MTEVHKYSQWLDYANDDLMAAKELLKTDLHNIVCFHSQQAVEKAL
FT                   KAYLVFNNVNPPKVHNLITLLELCINLDKEFEILRDDMEFLDSYYIPTRYPSAPIGYLP
FT                   GGKPNKDNATKAFEKAENSVKYIIKLIEDKKK"
FT   gene            complement(540822..541169)
FT                   /locus_tag="Thebr_0526"
FT   CDS_pept        complement(540822..541169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0526"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: tpd:Teth39_0512 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79130"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVP9"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADV79130.1"
FT                   /translation="MIEATELLKYSLEDELKRITNIIIEKCNPERIILFGSMANGTAKE
FT                   WSDIDLVVIMDTDLRFADRTLYLMRLTHPRVGVDFLVYTPEEEELFKKNRDLFYTEEVL
FT                   KKGVILHDRSS"
FT   gene            541214..541306
FT                   /pseudo
FT                   /locus_tag="Thebr_0527"
FT   gene            complement(541519..541959)
FT                   /locus_tag="Thebr_0528"
FT   CDS_pept        complement(541519..541959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0528"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   tpd:Teth39_0513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79131"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVQ0"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADV79131.1"
FT                   /translation="MGQLFYQFFDYLKDKSCEVYMAPFDVRFPDGNEKDEKNIKTVVQP
FT                   DIVVVCDESKLDEKGCTGAPDLIIEIISPSTAQKDKLHKFNLYEKYGVKEYWIVEPENK
FT                   ILSVFILQDNERYGRPDIYTQDDKVKVSIFEDLVIDLKTVLI"
FT   gene            542183..543325
FT                   /locus_tag="Thebr_0529"
FT   CDS_pept        542183..543325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0529"
FT                   /product="histidyl-tRNA synthetase 2"
FT                   /EC_number="6.1.1.21"
FT                   /note="TIGRFAM: histidyl-tRNA synthetase 2; KEGG:
FT                   tpd:Teth39_0514 histidine--tRNA ligase; PFAM: tRNA
FT                   synthetase class II (G H P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79132"
FT                   /db_xref="GOA:E8UVQ1"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVQ1"
FT                   /inference="protein motif:TFAM:TIGR00443"
FT                   /protein_id="ADV79132.1"
FT                   /translation="MIYLPDGVQDFLPEEYKFKRKIEEKFREVFIKFGYQEIMPPTFEY
FT                   SDNFSVLFDENNLYRFFDKKGNILALRPDVTTQIARIVSTKLKGSFPLKLCYVANVYRY
FT                   DDPQVGKMREFTQAGIELIGTNHEESDAEIIAVAIEALKSVGIKDFKVDVGQVEFFKRV
FT                   VEDLELQNEEINLLREFLQQKNQSAIEEFINDKGIRGKKAKFLSELPLLFGGEEVLKRA
FT                   KELYDTPKLGETIDYLERVYRILKDFGMEEYISFDLGMVQNLNYYTGIIFRCFVKGIGY
FT                   AICTGGRYDGLLGIFGEHIPATGFAISVERSMLALQKQKKDIIDKSWRVLIKYKENLRS
FT                   NAYKKATLLRGEGKIVEMYSYEKAKHVDENSFDEIIDMEE"
FT   gene            543327..543968
FT                   /locus_tag="Thebr_0530"
FT   CDS_pept        543327..543968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0530"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; KEGG:
FT                   tpd:Teth39_0515 ATP phosphoribosyltransferase catalytic
FT                   subunit; PFAM: ATP phosphoribosyltransferase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79133"
FT                   /db_xref="GOA:E8UVQ2"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVQ2"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ADV79133.1"
FT                   /translation="MENISIALPKGRMADSAITLFEKAGIAENILKDISRKLVVNDHKN
FT                   LMKFMLVKPMDVPTYVEHGAADLGICGKDILLEQKKDCYEVLDLKFGFCKMVVAGPKEA
FT                   KDSFLTNKRVATKFPNIAEEFFRQKGENVEIIKLNGSVELAPIVGLSEVIVDIVETGNT
FT                   LRENGLIVIEEIFPSSARLIVNKASLKTKSQRIKEIIIKLKEVVETFKEV"
FT   gene            543970..545253
FT                   /locus_tag="Thebr_0531"
FT   CDS_pept        543970..545253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0531"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="TIGRFAM: histidinol dehydrogenase; KEGG:
FT                   tpd:Teth39_0516 histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79134"
FT                   /db_xref="GOA:E8UVQ3"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVQ3"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADV79134.1"
FT                   /translation="MIEIFDFRKGIDNGILQKLHNRSKLENKEIAKKVEEIISNVRERK
FT                   DKALFEYTYMFDGINLDKSTVKVTKEEIKNAYKEVEGEFLKAIDKAIKNITEFHEKQKQ
FT                   STWMDFKEGIVYGQIIRPLSQVGIYVPGGTASYPSSVLMNGIPAKVAGVEKIVMVSPAG
FT                   KKGVNPYVLVAADKIGIEDIYKVGGAQAVAALAFGTESIPKVDKIVGPGNIFVALAKRA
FT                   LYGHVDIDMVAGPSEVLVIADETANPKYVAADLLSQAEHDVMASSILVTTSLEVAQQVK
FT                   IEIERQMEYLERKEIIEKSLKNFGAIIVVNNLKEAIGIANDIAPEHLELNISNAFEIIG
FT                   EIKNAGAVFVGEYSPEPLGDYLAGPNHVLPTSGTARFFSPLSVTDFIKKMNILYYSKDS
FT                   LREVKEDVITLANSEGLTAHANSIKVRF"
FT   gene            545255..546310
FT                   /locus_tag="Thebr_0532"
FT   CDS_pept        545255..546310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0532"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="KEGG: tpd:Teth39_0517 histidinol-phosphate
FT                   aminotransferase; TIGRFAM: histidinol-phosphate
FT                   aminotransferase; PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79135"
FT                   /db_xref="GOA:E8UVQ4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVQ4"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ADV79135.1"
FT                   /translation="MIENLVREEIKGFKNYEVHSIPYRYKMDANETPFELPEEVIKNIQ
FT                   EIVKSSQVNVYPDPTAEKLKEELARYCGVVPTNIFVGNGSDEIIHLIMLAFINKGDVVA
FT                   YPHPSFAMYSVYSKIAGAVEIPVRLREDYNYDVDSFIKVIEKYQPKLVFLCNPNNPTGS
FT                   VIEREDIIKIIQKSNGIVVVDEAYFEFYGNTIVDVINEFENLIVLRTLSKAFGLAGLRV
FT                   GYAVANENILKYLNLVKSPYNINSLSQVIALKVLRTGVLKERVNFILKERERLIKELSK
FT                   IPGIKVYPSKTNFILVKFKDADYVYQGLLERGILVRDFSKVEGLEGALRITVSSCEAND
FT                   YLINGLKELLL"
FT   gene            546307..546891
FT                   /locus_tag="Thebr_0533"
FT   CDS_pept        546307..546891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0533"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="KEGG: tpd:Teth39_0518 imidazoleglycerol-phosphate
FT                   dehydratase; PFAM: imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79136"
FT                   /db_xref="GOA:E8UVQ5"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVQ5"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ADV79136.1"
FT                   /translation="MRKAEVKRKTRETDIYVELNIDGKGNYDIATGIGFFDHMLSLFAK
FT                   HGLFDLKVVAKGDLEVDTHHTVEDVGIVLGNAFLKAAGDKKSIKRFSTFYVPMDEALVR
FT                   VSVDISGRPFLYCDLPLKAERVGNFETENVEEFLRAFAYNFGITLHVELLHGSNSHHII
FT                   EATFKALGRALDEALRIDERVEGIPSTKGIL"
FT   gene            546953..547564
FT                   /locus_tag="Thebr_0534"
FT   CDS_pept        546953..547564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0534"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="KEGG: tpd:Teth39_0519 imidazole glycerol phosphate
FT                   synthase subunit HisH; TIGRFAM: imidazole glycerol
FT                   phosphate synthase, glutamine amidotransferase subunit;
FT                   PFAM: glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79137"
FT                   /db_xref="GOA:E8UVQ6"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVQ6"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ADV79137.1"
FT                   /translation="MIGIIDYGMGNLRSVEKAFKYVGYEAKIIKDVASVKEAHALVLPG
FT                   VGAFPDAMDTLIKTGMFEEIKRQIDKGKLFLGICLGMQLLFEKGFEIEETEGFKIFKGQ
FT                   VIELPKHNKIPHMGWNSLEIKKETPLLKGVENGDYAYFVHSYYVANNEEKYVYAVTDYG
FT                   VQIPAVIIKDNVFSCQFHPEKSGKVGLKILKNFGEMAKWF"
FT   gene            547555..548262
FT                   /locus_tag="Thebr_0535"
FT   CDS_pept        547555..548262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0535"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; KEGG: tpd:Teth39_0520
FT                   1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase; PFAM: histidine
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79138"
FT                   /db_xref="GOA:E8UVQ7"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVQ7"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ADV79138.1"
FT                   /translation="MVLIPAIDIMEEKCVRLTKGDFNTKEVYYENPVDVAKMWEELGAK
FT                   RIHVVDLDGAKQGHLVNGNVIEQITKNCKAEIEVGGGIRNRETIDYLFSVGVKYVILGS
FT                   AAIYDKDLLLYSLSNYGERTIVGIDSKNGEVAVSGWLEKTKIKDMELAKKMKEIGVKTI
FT                   IFTDISKDGTLNGPNFKALENILKTGVQVIASGGISSIEDLKKLKEMGAYGAIIGKALY
FT                   IGKINFKSALEVI"
FT   gene            548263..549024
FT                   /locus_tag="Thebr_0536"
FT   CDS_pept        548263..549024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0536"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="KEGG: tit:Thit_1814 imidazoleglycerol phosphate
FT                   synthase, cyclase subunit; TIGRFAM: imidazoleglycerol
FT                   phosphate synthase, cyclase subunit; PFAM: histidine
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79139"
FT                   /db_xref="GOA:E8UVQ8"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020021"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVQ8"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ADV79139.1"
FT                   /translation="MLAKRIIPCLDVKDGRVVKGVNFLNLKDAGDPVQIASEYNELGAD
FT                   ELVFLDITASYEKRKIMIEVVKRTSEKVFIPLTVGGGISDLDDIKDILRAGADKVSINT
FT                   QAVKQPTLIRQAAVRFGSQCVVVAIDAKRRSDGSGFDVYINGGRVNTGLDVIEWAKKVE
FT                   SLGAGEILLTSMDKDGTKDGYDIELTRMVSEAVNIPVIASGGAGNKEHFKEVFTEGKAD
FT                   AALAASVFHYRELEIKEVKRYLKEEGIPVRI"
FT   gene            549047..549706
FT                   /locus_tag="Thebr_0537"
FT   CDS_pept        549047..549706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0537"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="KEGG: tpd:Teth39_0522 bifunctional
FT                   phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP
FT                   pyrophosphatase protein; TIGRFAM: phosphoribosyl-ATP
FT                   diphosphatase; PFAM: phosphoribosyl-AMP cyclohydrolase;
FT                   Phosphoribosyl-ATP pyrophosphohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79140"
FT                   /db_xref="GOA:E8UVQ9"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVQ9"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ADV79140.1"
FT                   /translation="MIDIEELKFDEKGLIPAIVQDYNTKQVLMLAYMNEESLKLSLEKG
FT                   ETYFFSRSRKEIWHKGETSGNTQKIKNIFYDCDGDALLIEVEPKGPACHTGNVSCFYRS
FT                   FLGEVENYDMEILKMLYERVKDRKTNPAEGSYTNYLFEKGIDKILKKIGEETTEVVIAS
FT                   KNDSKEEIVYEVSDLLYHLIVLLVDKGIKLEDVYGELGRRYYKPKEFKEEHEERKK"
FT   gene            550158..551570
FT                   /locus_tag="Thebr_0538"
FT   CDS_pept        550158..551570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0538"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: tpd:Teth39_0523 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79141"
FT                   /db_xref="GOA:E8UVR0"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVR0"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADV79141.1"
FT                   /translation="MDSKDMQRLQTTQQRGYPLNREMEFQKTTEVHSISSASKDRRNDV
FT                   QRYTSKMLEMIVERGNMRAAYKRVVANKGSHGVDGMGVDELLPYLKENWATIKQQLLEG
FT                   KYKPQPVRRVEIPKPDGGKRLLGIPTALDRLIQQAIAQILNRVYNHTFSDSSYGFRPGR
FT                   SAKDAIKAAEAYINEGYTWVVDMDLEKFFDRVNHDIIMSKLEKRIGDKRVLKLIRRYLE
FT                   SGVMINGIKVSTEEGTPQGGPLSPLLANIMLDELDKELEKRGHKFCRYADDCNIYVKSR
FT                   SAGDRVMKSIKKFIESKLKLKVNEAKSAVDRPWRRKFLGFSFYTKENEVRIRIHEKSIK
FT                   RFKEKVREITNRNKGISMENRIKRLNQITTGWVNYFGLADAKSIMKTLDEWIRRRLRAC
FT                   IWKQWKKIKTKHDNLVKLGVEEQKAWEYANTRKGYWRISNSPILNKTLTNKYFESIGYK
FT                   SLSQRYLIVHNS"
FT   gene            complement(551651..552892)
FT                   /locus_tag="Thebr_0539"
FT   CDS_pept        complement(551651..552892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0539"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="KEGG: tit:Thit_1812 glycine
FT                   hydroxymethyltransferase; PFAM: glycine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79142"
FT                   /db_xref="GOA:E8UVR1"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVR1"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ADV79142.1"
FT                   /translation="MDIEIIRKTDPEIADAIEKELIRQRNKIELIASENFVSRAVMEAM
FT                   GSPLTNKYAEGYPNKRYYGGCEYVDIAEELARERLKKLFGAEHANVQPHSGAQANMAAY
FT                   FALIKPGDTVLGMDLAHGGHLTHGSKVNFSGQIYNFVSYGVREDTGYIDYDEVERVAKK
FT                   HKPKLIVAGASAYPRIIDFKRFREIADKVGAYLMVDMAHIAGLVAAGLHPNPVPYADVV
FT                   TTTTHKTLRGPRGGAILCKEEYAKAIDKALFPGTQGGPLMHIIAAKAVCFKEALTDEFK
FT                   EYQKRIVENAKALANALMERGINLVSGGTDNHLMLLDLRNTGITGKELETRLDEVNITC
FT                   NKNAIPFDPLGPNVTSGVRLGTPAVTTRGMKPEDMVEIADIIVNVIRDENYKEKAKERV
FT                   ANLLKKYPLYEDLI"
FT   gene            complement(553221..554162)
FT                   /locus_tag="Thebr_0540"
FT   CDS_pept        complement(553221..554162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0540"
FT                   /product="Membrane dipeptidase"
FT                   /EC_number="3.4.13.19"
FT                   /note="KEGG: tpd:Teth39_0525 membrane dipeptidase; PFAM:
FT                   peptidase M19 renal dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79143"
FT                   /db_xref="GOA:E8UVR2"
FT                   /db_xref="InterPro:IPR000180"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVR2"
FT                   /inference="protein motif:PRIAM:3.4.13.19"
FT                   /protein_id="ADV79143.1"
FT                   /translation="MNMFVDFHCDTLYRLVDKKIDFTERSKEGHVDLQRMKEGKVHLQV
FT                   FAVFVDPKQMRKNAATMALKMIDKMHEVIEETKEFRLILKGEDIDKAKEEEKIGALLSI
FT                   EGGEALEGEISLLRMFYKLGVRALTLTWSLRNDLGDGVDGVKEAGLTSFGREVVKEMNR
FT                   LGMIVDVSHLNEKGIWDVVELSEKPIIASHSNAKTLCSHRRNLTDEQIKAIAQKGGVIG
FT                   INFAPQFLRDEGQATLEDVLNHINYICELVGEDYVGFGSDFDGISSTPEGLKDISYFPA
FT                   ILEGLRKRGYTQEQIDKISHRNFENLIKKILI"
FT   gene            554294..555703
FT                   /locus_tag="Thebr_0541"
FT   CDS_pept        554294..555703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0541"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: tpd:Teth39_0526
FT                   LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79144"
FT                   /db_xref="GOA:E8UVR3"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVR3"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ADV79144.1"
FT                   /translation="MINKRTIYFSLFIALLIGISYIMNWEMAIANFAEKGTLPTFDDPG
FT                   QRILIIVPHPDDETLGMAGIIQRAVELKRPIKVVIVTSGESYKKAAMSFCGKTNPTPQD
FT                   FYRFGLARQQESIVAMRVLGLPRQDLIFLGFADGSTRFLWSQYWDNGRPRVSGGIHVAY
FT                   APYDTVYKPGIPYTGQNLVNELTEIIKDFKPTDIYYPLADDMHPDHWAVSNFVRYTITA
FT                   VNINVREHMFLVHHPQWPVPWMAEKNRPMLPPVDMKDSNTEWQSFDLTPKEIDLKQVAI
FT                   KQYRTQIDVMEPFLMAFVRKTELFATKPVITIPVVDSKPDLQSRALPHTLLKVYTGGML
FT                   NEEIYRSAALTRLGAFYYDNKLYIGLESARPISKKVIYHVEMRLFYKDQNDIKRIDLGI
FT                   VNGKLYQYKRAENSLTDVIAAKPIINGNKMWVEVKIPQVNNLRYIFMGADSIYRNRLID
FT                   KIPWNMYKIGE"
FT   gene            complement(555716..556801)
FT                   /locus_tag="Thebr_0542"
FT   CDS_pept        complement(555716..556801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0542"
FT                   /product="spore germination protein"
FT                   /note="KEGG: tit:Thit_1809 spore germination protein;
FT                   TIGRFAM: spore germination protein; PFAM: Spore germination
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79145"
FT                   /db_xref="GOA:E8UVR4"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVR4"
FT                   /inference="protein motif:TFAM:TIGR00912"
FT                   /protein_id="ADV79145.1"
FT                   /translation="MNKRLEVSDLLFLMITFEIGTSVLFCLGIKAKQDCWLSILIAMLI
FT                   SLPITLMYVSSFEKSQKNLPQLLEFVYGKYIGKTLSLIYALYFLYIASRNVRDYVELSV
FT                   NTIYSRTPTYIFSSFMLILVMYYLLFDICVLARVAKILLPLILAIMAFQTTMIMMGDNF
FT                   SFSRLLPILENGIVPVIKAAIPLIVTFPFGELIAFTTVFDKVKQKEKIKKIMLITTVFT
FT                   GLLLSFNNIIIISSLGADEASRENFPLYQVIRLINLGNLKNLDTLYVFIMIIGVFFKIS
FT                   VFTYAGLTMIKNALELKSYKYLLFPVLSMIFAASFIIADSYQTHILIGLKFTPFYIHVP
FT                   LQIILPMITFLFLNIKEKRKP"
FT   gene            complement(556856..557782)
FT                   /locus_tag="Thebr_0543"
FT   CDS_pept        complement(556856..557782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0543"
FT                   /product="Na+/Picotransporter"
FT                   /note="PFAM: Na+/Picotransporter; KEGG: tpd:Teth39_0528
FT                   Na+/Pi-cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79146"
FT                   /db_xref="GOA:E8UVR5"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVR5"
FT                   /inference="protein motif:PFAM:PF02690"
FT                   /protein_id="ADV79146.1"
FT                   /translation="MIISLIYFAAGIGVFIWGIFTLTRGLKVFSQQKISQIINNFASNL
FT                   LKSIIIGFFITLIIQSSSMVTVIAVTMAGAELLTLKSAAGIIIGSNIGTTIAVQLYAFN
FT                   LFKIAPYLVFIGSVLHFQNCNTKLKFVGNVFLGFGLVFYGLKIMELATMPLKKNSNFEL
FT                   ISANLSNPFWGILAGIITALILQSSNVGIATLQVLVSSQLITLPQALPIIYGLNIGTCS
FT                   EAIILSFASNKEGKKIALFNIFLNIGGTILFLPFTNFFAEFLKLISPHNPLRQVANAHT
FT                   FFNLFSALLIIPFLKQLFVLIDKLVNK"
FT   gene            557910..560240
FT                   /locus_tag="Thebr_0544"
FT   CDS_pept        557910..560240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0544"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; transferase
FT                   hexapeptide repeat containing protein;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; KEGG: tpd:Teth39_0529 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79147"
FT                   /db_xref="GOA:E8UVR6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVR6"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADV79147.1"
FT                   /translation="MKGIIMAGGEGSRLRPLTADIPKPMVPVANKPAIKHIVEHLHKYG
FT                   IKDLAVTLFYLPQKIKKYLEEEYGDEIKFYIEDKPLGTAGSVKNARDFLNDTFIVMSGD
FT                   VITDVNIKEAYEFHRKKGAKVTLILTRVDVPLEYGVVIVDEEGKIKKFLEKPSWGEVFS
FT                   DTVNTGIYIIEPEILEFIPQDKPFDFSKDLFPMLLKNDIPMYGYITGGYWCDIGNTNQY
FT                   ITSHFDILEGRVDLGYKDKLLKKGKVIGKNVTISPEAKIIPPVIIGDNAIIEANAVVGP
FT                   NVIIGKNNYIKKGSSLKNAVLWDEIIVDKNCELRGCVVCNRVRIGNNVRIFENSVIGES
FT                   CKIKSFAEIKPEVKIWPYKIIDEGSVVAKDVVWGNGRKPLTFGYRGIKGVLNEDITPQI
FT                   AVEIGEVFGNIINSSVLVGHDGDIVSQFISDLISFGLVSGGCEVLKANNTLLPSLRYGI
FT                   KKNKCGGGIYVEEEEGNLRILFLDKEGCDIDRNLEKKIENKLRVYDIERVDGKNLKSIR
FT                   EIDINNDYLNFLFKKRTAYKSFKIKPYDEKTKLLLEAVGKNEFFITQESYDVGVLFYKN
FT                   GEKVKLYDEKGREFDEDELEFIRMLIAKEQGAKNFVLPFDSSKYLTEFAKEFAIETVSS
FT                   KISHKDRMKTIVSKEGVEKDLQINLNFDGFSFLLDLLEYLQHTSQKLSSIKDSFPLRYR
FT                   ITKSIKCDWRDKGKIIRMLFEKADGGAEFLDGLKFNKEDSWVLVVPDYELPACNIYIEA
FT                   PTKERAEELFSMYEKEIKSIVQK"
FT   gene            560405..560683
FT                   /locus_tag="Thebr_0545"
FT   CDS_pept        560405..560683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmt:Tmath_1786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79148"
FT                   /db_xref="GOA:E8UVR7"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVR7"
FT                   /inference="similar to AA sequence:KEGG:Tmath_1786"
FT                   /protein_id="ADV79148.1"
FT                   /translation="MKKEGKYISATEINQFLYCPYQWYYIKKYGFEYINGLREPKEQDL
FT                   QFSNFKKGIEYHEKYYKDIVKVRYKKYAIIFGIIAILLIIAIMRVLK"
FT   gene            560680..561240
FT                   /locus_tag="Thebr_0546"
FT   CDS_pept        560680..561240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0546"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas4; KEGG:
FT                   tpd:Teth39_0531 CRISPR-associated Cas4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79149"
FT                   /db_xref="GOA:E8UVR8"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVR8"
FT                   /inference="protein motif:TFAM:TIGR00372"
FT                   /protein_id="ADV79149.1"
FT                   /translation="MILNIIFLFFTIYLLVQSIIEQRPYYKKMKRSIGFRGGKIIYIDK
FT                   PQEVKKKGVIYGKLLKSDKYGLSGKPDYIYQLGEELIPIELKSSQAEDTPYYKDVMQLV
FT                   AYFLIIEDVYQKRVKRGRVVYKNSMFEVYNRRSLRRELFNILKQMKKMQEGNYLPEVNP
FT                   SYALCKFCPCKETVCEIYKNTSK"
FT   gene            561312..562184
FT                   /locus_tag="Thebr_0547"
FT   CDS_pept        561312..562184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0547"
FT                   /product="delta-lactam-biosynthetic de-N-acetylase"
FT                   /note="KEGG: tpd:Teth39_0532 polysaccharide deacetylase;
FT                   TIGRFAM: delta-lactam-biosynthetic de-N-acetylase; PFAM:
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79150"
FT                   /db_xref="GOA:E8UVR9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVR9"
FT                   /inference="protein motif:TFAM:TIGR02884"
FT                   /protein_id="ADV79150.1"
FT                   /translation="MVRKLFFILIGIFLCFSIVSCGIAKKDITKAERNEALQKPLEKPK
FT                   EKVSNTVNKTVYTNTENLDNTLYGWGVRVLPNHQTPEITPKAMELIKKYDAIFVGDTTK
FT                   KVVYLTFDEGYEAGYTPKILDILKENNVKAAFFVTGPYVKEHADLVKRMVEEGHIVGNH
FT                   TVNHPSLPTLSDEKVKEEITKLGDMFKELTGKKMKYFRPPKGEYSERTLYLTKSLGYRT
FT                   VFWSLAMADWQPLPGGPEESYNTVMKRLHPGAVILLHAVSKDNALALDRIIKSIKAEGY
FT                   EFKTLDDIP"
FT   gene            562181..562336
FT                   /locus_tag="Thebr_0548"
FT   CDS_pept        562181..562336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0548"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79151"
FT                   /db_xref="GOA:E8UVS0"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVS0"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0533"
FT                   /protein_id="ADV79151.1"
FT                   /translation="MKKAKFILPPSKLEIFINIWRFFVYYVYLGILAIGFFMAIKNQEE
FT                   KRMLIK"
FT   gene            562468..563037
FT                   /locus_tag="Thebr_0549"
FT   CDS_pept        562468..563037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0549"
FT                   /product="glycerol-3-phosphate responsive antiterminator"
FT                   /note="PFAM: glycerol-3-phosphate responsive
FT                   antiterminator; KEGG: tpd:Teth39_0534 glycerol-3-phosphate
FT                   responsive antiterminator, GlpP"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79152"
FT                   /db_xref="GOA:E8UVS1"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="InterPro:IPR035928"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVS1"
FT                   /inference="protein motif:PFAM:PF04309"
FT                   /protein_id="ADV79152.1"
FT                   /translation="MREKILDAMRDFPIIAAVREAKDLNTALSSNAQVIFLLTGDIMNI
FT                   SEIVQEVKRHDKIVFVHFDLLEGLGKDNKAVEYLAEKIKPHGIISTRNNILIHAKQFDL
FT                   FCIQRLFILDSQALKTGFASAKQIVPDAIEVMPGIIPSVISEISVDVHQPVIAGGLVKT
FT                   KEEVINALKSGAIAVSTSEKNLWFIE"
FT   gene            563115..563846
FT                   /locus_tag="Thebr_0550"
FT   CDS_pept        563115..563846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0550"
FT                   /product="MIP family channel protein"
FT                   /note="KEGG: tpd:Teth39_0535 MIP family channel protein;
FT                   TIGRFAM: MIP family channel protein; PFAM: major intrinsic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79153"
FT                   /db_xref="GOA:E8UVS2"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVS2"
FT                   /inference="protein motif:TFAM:TIGR00861"
FT                   /protein_id="ADV79153.1"
FT                   /translation="MSDLAKYVAEFFGTMILIWLGDGVVANVVLNKSKGQNSGWIVITA
FT                   GWGFAVMVGAYTVGWISGAHLNPAVTIGLATIGKFSWSLVPGYIIAQVLGAFVGAIIVY
FT                   LMYMDHYAATEDPTAKLGTFATIPAIRKLGKNFMTEAFGTAMLLIGILGITNGNNQLVG
FT                   GLGPLLIGLLIWAIGLSLGGPTGYAINPARDFGPRLAHAVLPIPGKGDSDWGYGLIVPI
FT                   FGPIVGGILGAIVYQLIVNIH"
FT   gene            563919..565412
FT                   /locus_tag="Thebr_0551"
FT   CDS_pept        563919..565412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0551"
FT                   /product="glycerol kinase"
FT                   /note="KEGG: tpd:Teth39_0536 glycerol kinase; TIGRFAM:
FT                   glycerol kinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79154"
FT                   /db_xref="GOA:E8UVS3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVS3"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ADV79154.1"
FT                   /translation="MAKYIMAFDQGTTSSRAIIFDRSGKIIASLNQEFKQIYPKAGWVE
FT                   HDPMEIWGTQIGVAKGVIEKAGINPEDIAAIGITNQRETTVVWDKNTGKPIYNAIVWQC
FT                   RRTAPICDELKNKGFDKKIREKTGLVVDAYFSGTKIKWILDNVEGAREKAEKGELLFGN
FT                   IDTWLIWNLTRGKVHVTDYSNASRTMIFNIHELKWDKEILAELNIPEQMLPEVKPSSYV
FT                   YGYTDKSIFGVEIPIAGDAGDQQAALFGQACFKPGMAKNTYGTGCFMLMNTGEKAVPSN
FT                   TGLLTTIAWGIDGKVEYALEGSIFIAGAAIQWLRDELRIIDNSPQSEEYAMKVEDTNGV
FT                   YVVPAFVGLGAPYWDMYARGTIVGLTRGAKREHIIRATLESIAYQTRDVLEAMQEDSGI
FT                   RLQALKVDGGASANNFLMQFQSDILGVPVDRPQVIETTALGASYLAGLAVGFWNSREEI
FT                   EKNWNVDKHFEPAMDNEKREKLYKGWKKAVERAMKWAEE"
FT   gene            565575..567083
FT                   /locus_tag="Thebr_0552"
FT   CDS_pept        565575..567083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0552"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; KEGG:
FT                   tpd:Teth39_0537 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79155"
FT                   /db_xref="GOA:E8UVS4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVS4"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADV79155.1"
FT                   /translation="MTMKEMYDVLIIGAGVVGCSIARELSKYKLKILVVEKGEDVASEG
FT                   ASKANSAILHAGYDPVPGTLKAMLNVRGNEMYDELCKDLDVPIKRTGSLVVAFSEEEVK
FT                   ELYELFDRGIKNGVKGLSLITKDMVKEIEPHINDTVVAALYAKTAGIICPYGYTIAVAE
FT                   NAAQNGAEFVFNSEVIDIKKNGDFFIVKTHKEEFYSKYVVNAAGLYSDVINNMVGAKPF
FT                   SVHPRKGEYLILDKDQGYLARTVIFQVPTKMGKGILVSPTVDGNLLIGPTSEDIQDKEF
FT                   KATTREGLNKAITVAKRSVDKFDVRKTITQFTGLRATPDTEDKDFIIGESDVKGFINAA
FT                   GIESPGFTAAPAIAEMIRDILKDAGLQLIEKVDFNPKRKPVIRFTELSDEERNKLIKEN
FT                   PAYGRIICRCETVTEGEIIDAIRRPVGAKSLDGVKRRVRAGMGRCQGSFCGPRVVEILA
FT                   RELNISPLEVTKHGRNSNILTAETKKFLLEKASEVLKKEVYENA"
FT   gene            567076..568335
FT                   /locus_tag="Thebr_0553"
FT   CDS_pept        567076..568335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0553"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: tpd:Teth39_0538 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79156"
FT                   /db_xref="GOA:E8UVS5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVS5"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADV79156.1"
FT                   /translation="MLNYDIVIIGGGPAGLGAAVEAYEKGVKNIVIIERDKYLGGILEQ
FT                   CIHNGFGLQEFKEELTGPEYAQRFIDKVEEYDINVMLETMVLEITPDRIVKAVNSKEGV
FT                   FTIKAGAIILAMGCRERPRGAIMIPGTRPAGILTAGTAQRYVNMEGYLPGKEIVILGSG
FT                   DVGLIMARRLTLEGAKVKAVVELMPYSSGLTRNIVQCLEDFNIPLLLSHTVIEIHGKDR
FT                   VEGVTIAKVDENREPIMETAQYISCDTLILSVGLIPENELSQKAGIELDPITGGPIVNE
FT                   MLETSVPGIFACGNVLQVHDLVDNVTAEARLAANSAIRFIREGEFGKSNIAVKAGNGIR
FT                   YVVPQKINVDNIEKRIKFRMRPVNVYNNAMLAVKSGDKYLLRQKRQRLTPGEMIDVNLS
FT                   KDILKNANLEEGIVFLVEEG"
FT   gene            568337..568702
FT                   /locus_tag="Thebr_0554"
FT   CDS_pept        568337..568702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0554"
FT                   /product="protein of unknown function DUF1667"
FT                   /note="PFAM: protein of unknown function DUF1667; KEGG:
FT                   tpd:Teth39_0539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79157"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVS6"
FT                   /inference="protein motif:PFAM:PF07892"
FT                   /protein_id="ADV79157.1"
FT                   /translation="MELKEITCIVCPLGCRIQVEMEGGEIKSVKGYSCSRGLEYAKNEV
FT                   TMPKRTITTSVRAIGGHLPLLSVRTKEPVPKEKIQEIMLELAKVEVKAPVKIGDVVVKN
FT                   ILGTGVDIIATRNLYVK"
FT   gene            568722..570356
FT                   /locus_tag="Thebr_0555"
FT   CDS_pept        568722..570356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0555"
FT                   /product="PAS sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; PAS fold domain
FT                   protein; phosphoryl transfer system HPr; KEGG:
FT                   tmt:Tmath_1777 PAS modulated sigma54 specific
FT                   transcriptional regulator, Fis family; SMART: AAA ATPase;
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79158"
FT                   /db_xref="GOA:E8UVS7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVS7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADV79158.1"
FT                   /translation="MEGRREILRTPVSIHSQIAAHIVQKVSHISRQNNVSIFLRKINDN
FT                   RLIPANSMLSMVTFFASRGEEIEVVVEGANVDNAIKEFKGFFYNELGKEKEEKTTYELL
FT                   KNTSIAYEKIFNSIGSGLIVTDENGAIMIFNKAAESITGINMDQAIGKKIQEVMSDIKI
FT                   ADVLKTGKEEMNKKLKIGTNVVLTNITPIYTGTKIEGAVIVFYDFPQIEYLENELKRDR
FT                   KLDKAFDIIIGNSGKLKDALTIASKAAETDSTVLIRGESGTGKELVANAIHYASKRKDK
FT                   PFIRVNCAAIPVTLLESELFGHERGAFTGAVTQKIGKFELADGGTIFLDEIGDIPPEIQ
FT                   VKLLRVIQEKEFERVGGIKTIKVDVRIIAATNKDLEKAIKEGTFREDLYYRLNVIPVIL
FT                   PPLRERREDIPLLVEHFIEKLNKKLNKNVKKVTRKAMQALIYYDWPGNIRELENIIERC
FT                   ITLSDNDYIDYKDLPHYIRNESAVLSDDDIIYLGENNKLLTMEEYERKIIKAALQRYKS
FT                   FNKAGKVLGLTHKTIAAKARKFGLVDR"
FT   gene            570497..571495
FT                   /locus_tag="Thebr_0556"
FT   CDS_pept        570497..571495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0556"
FT                   /product="dihydroxyacetone kinase, DhaK subunit"
FT                   /EC_number="2.7.1.29"
FT                   /note="TIGRFAM: dihydroxyacetone kinase, DhaK subunit;
FT                   KEGG: tpd:Teth39_0542 dihydroxyacetone kinase subunit DhaK;
FT                   PFAM: Dak kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79159"
FT                   /db_xref="GOA:E8UVS8"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVS8"
FT                   /inference="protein motif:TFAM:TIGR02363"
FT                   /protein_id="ADV79159.1"
FT                   /translation="MKKLINNPNDVVKEMIEGLLAAHPSYLRKLDNIDVIVRKDAPVEG
FT                   KVGLVSGGGSGHEPAHAGYVGYGMLDAACPGAVFTSPTPDQIYEAIKAVDGGKGVLLII
FT                   KNYTGDVMNFEMAREMAQMEGIEVDEVIVNDDVAVENSTWTQGRRGIAGTVFVHKIAGA
FT                   KAQEGASLQEVKRVAEKVIANVRSMGMALTPCIVPAAGKPSFTLAEDEMEIGIGIHGEP
FT                   GTHREKIKPADEIVEHLMEKIINDLPYKENDEVAVMINGLGATPLMELYVANRKVAEIL
FT                   ESKKIKVYKTYVGEFMTSLEMSGFSITLLKLDEELKTLLDAKADTPAFKQL"
FT   gene            571514..572152
FT                   /locus_tag="Thebr_0557"
FT   CDS_pept        571514..572152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0557"
FT                   /product="dihydroxyacetone kinase, L subunit"
FT                   /note="KEGG: tpd:Teth39_0543 dihydroxyacetone kinase, L
FT                   subunit; TIGRFAM: dihydroxyacetone kinase, L subunit; PFAM:
FT                   Dak phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79160"
FT                   /db_xref="GOA:E8UVS9"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVS9"
FT                   /inference="protein motif:TFAM:TIGR02365"
FT                   /protein_id="ADV79160.1"
FT                   /translation="MVITKNDVLKIVDKIVEVIKENKEYLTELDAAIGDADHGINLDRG
FT                   FDAVKQKLTTLPETTDIGTILKTIGMTLVSTVGGASGPLYGTAFMRAGQVVQGKNELSE
FT                   EDIVKIFEAALDGIKQRGKAEAGDKTMIDSIEPAYKALKESLENNIALPEALNRAANAA
FT                   KEGMEYTKNISARKGRASYLGERSIGHLDPGATSAYLMIKSFSDVVNLS"
FT   gene            572167..572559
FT                   /locus_tag="Thebr_0558"
FT   CDS_pept        572167..572559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0558"
FT                   /product="dihydroxyacetone kinase, phosphotransfer subunit"
FT                   /note="KEGG: tpd:Teth39_0544 dihydroxyacetone kinase,
FT                   phosphotransfer subunit; TIGRFAM: dihydroxyacetone kinase,
FT                   phosphotransfer subunit; PFAM: PTS system fructose
FT                   subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79161"
FT                   /db_xref="GOA:E8UVT0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVT0"
FT                   /inference="protein motif:TFAM:TIGR02364"
FT                   /protein_id="ADV79161.1"
FT                   /translation="MVGIVLVSHSRKIVEGIYELASQMTGGKVPIGIAGGTQDGRLGTD
FT                   ATEIMEEIKKVDEGEGVVVLVDIGSAVMSAQMAIELLGEEYEGKVKIADAPLVEGAIAA
FT                   SVEASIGSDFDKVLLVAEEAKKLNKF"
FT   gene            572758..574608
FT                   /locus_tag="Thebr_0559"
FT   CDS_pept        572758..574608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0559"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="KEGG: tpd:Teth39_0545 beta-lactamase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79162"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVT1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0545"
FT                   /protein_id="ADV79162.1"
FT                   /translation="MVKKLDKKLYEYLLLWQIILEIYIGIPEEAKEHFFELKSELEIDE
FT                   HNLALFIKSVILLDLVEESLKTKNLFEALMNYSGEDQWIKFYLLLLSFKNKRRILEVLE
FT                   ELLYMEKKVEDKLLLPKIYGLIAEIYEEIGEIKWHQFLDKAYKLNPQDLYILRLKLKYG
FT                   LISEEEKQNLKLYRLFPEDSKLINEYYHKTRKNFNSIHNFKFFCWGGDNIGASSYLVSY
FT                   EGINILLDAGALIKDKTLYYNSIKNLPIDIKDIDLVIITHAHLDHSAGIVELLRKGLNS
FT                   PIIMSRPTKEILKQIFLRGHTRLEIKIEEEIINFDSQIISFDTEEESSFRIKNKEVKLK
FT                   LFPAGHILGAVAVYLEIEGIKIFYTGDFTLKDVESNKGLRFLPDLKVDILITEATYGYG
FT                   NNFGVQNKYLQDKLILKSIEKLLKDEERILLPVYAIGKGQDILLFFRKTFSYIPFNVYV
FT                   DGDVAYFSKLYENFAGPIYGNGILNVAEDTLYTDRKDFIKKEIALGNCVVLASSNDLKE
FT                   GSASFVYATEMKNFTKGCIMNLDSNNREIAGLKNYQIGMLNHANIVDLLETVIKMAPSA
FT                   VFVIHRGYESKSEITIETILKRIEGIKVFAPKEGEIIELQ"
FT   gene            574619..576198
FT                   /pseudo
FT                   /locus_tag="Thebr_0560"
FT   gene            576188..577765
FT                   /locus_tag="Thebr_0561"
FT   CDS_pept        576188..577765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79163"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVT2"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0547"
FT                   /protein_id="ADV79163.1"
FT                   /translation="MSIDWKELLLENKDFFINVSKEVMDDGMEYLGAKRMKDKDKNFKR
FT                   ELFKYYISETNAKLVGEKIQLLSTLHQSALASLEKDIVELGRNILSEGQNPIEMIVYSA
FT                   KALDLRQEEIFKRMVRILKNISNNSLEARDALITILQEWEWEEQIKLVIQTLREIKEIR
FT                   AYEQLITLLENDNLKEIAAETLIELGEKKCIPYILNMVNSLNGFNSRERHFAFRILTKL
FT                   AGLGDEALKQIIERYLENENSSLNIVYSNVIANLKEKAVENIAELLYEEKYNQKAAITL
FT                   GKMRTSIATEYLLKAYYDPSIENKMNIVIGLGYTKDERCANVMLEILKEENQSLELKAC
FT                   AITSLANLQILEAKPMIKQILKNNYLAINAYSALVQLGEIKYLSNLFYYIVKPGFSVEE
FT                   LLNAIKEIKRLKGLRNSDINRQIAEGIKYIIKNDDGYACVNALKIIETNLDEEIAKELM
FT                   QKLKNTAKEEIQYLIYKILGKNAKGLKNIIDEKIFRDAMESDSARIRYLAQKIIEESYK
FT                   KTDKLIRM"
FT   gene            577778..578728
FT                   /locus_tag="Thebr_0562"
FT   CDS_pept        577778..578728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79164"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVT3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0548"
FT                   /protein_id="ADV79164.1"
FT                   /translation="MLEFKNVTEKKYIDIFLSTLPYDVLIKPFKKNTNLQKKLAGFRLI
FT                   ESASPPKKIIPILREEILKGNIEEEMFIKEWEKIYADLVRQIQPLTLEKIEEKVPELLS
FT                   LYKPEVIFSALLFSKDESYKKILQDLLDVIEGEKEKIEKNIEGQEAIDKSVKINKKLLK
FT                   EIEKLRKKLILQEKKNIMEIERLTEKIKEQEGEILNYKNKISQLEKEKEMLEERIEKIG
FT                   LEFEKRMNKIIENASSKERQAENLKILVNRLLVEIQQQKIDFNNALLEIKEILSNIEEK
FT                   TNFLFDNTVAQVAVTKEEQEYSLVEDLSRMLKIID"
FT   gene            578740..580236
FT                   /locus_tag="Thebr_0563"
FT   CDS_pept        578740..580236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79165"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVT4"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0549"
FT                   /protein_id="ADV79165.1"
FT                   /translation="MQQDEVRELREQLNKTPKTPNEISLLLKRIIKKQKEIVQIISILE
FT                   LFNETVYLYHVLFRKKNVANALAYLDKETQNILEVVKNIANNTKYFSLMEEKMKRNTEK
FT                   TIRKYKEYFENAIDVLYGYYVESRYVNEVVSDRARDFFSEELIDEEEFYENVINFINEV
FT                   EEEKEERIKEIISSIPFAMSKKRFYEYLTKGLEKDYSNYEAFLENVIDIEENFYGKLIE
FT                   GYGEIFPRIAKKIEYLQSLDFKEMTREEVDVYFRKSVELIKSVQSLREISFSVLKIINR
FT                   LLVVFLSENKFETLFKKEPFIGEYIDFYGKLNKNSLDYKEIEKNIKTCDNVISNWYFEL
FT                   YRYNLLLGEIDYSDLEIMEIIDEGILEDIETLSEYENLLNDTSEVVLEDGQIEEEPIDM
FT                   ALIKGEIKNVISLIEDISRNMKNEYRKARMRRLMGIIPVPQNFEKEVLHYIKNSIELDN
FT                   SRSRKLSFMHTVKKKIELYKDLKNQKNFYEAIIKGAKDVI"
FT   gene            580226..580930
FT                   /locus_tag="Thebr_0564"
FT   CDS_pept        580226..580930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0564"
FT                   /product="integral membrane protein TIGR01906"
FT                   /note="KEGG: tpd:Teth39_0550 hypothetical protein; TIGRFAM:
FT                   integral membrane protein TIGR01906; PFAM: Integral
FT                   membrane protein 1906"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79166"
FT                   /db_xref="GOA:E8UVT5"
FT                   /db_xref="InterPro:IPR010178"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVT5"
FT                   /inference="protein motif:TFAM:TIGR01906"
FT                   /protein_id="ADV79166.1"
FT                   /translation="MLFKMVRKIIHTFLISGMVVSLFLAVFLTSLQYVAFNRNFYKEEY
FT                   EKNNVMSVTGMSIDELMKVTQIMQKYLMDKEETLDVMAKINGSMQRMFNDRELAHMKDV
FT                   KDLFQMGFLTRNISIIVFILIFTYFLFEKSFYKAFDYLLKGTIFIIILLLVFALAVTLN
FT                   FDNWFTGFHLVFFDNDLWLLNVETDRLIQMFPLEFFQDAVFVIFRNTFFTFIVILAIVY
FT                   GVVKMTKKPVFK"
FT   sig_peptide     580226..580333
FT                   /locus_tag="Thebr_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.716 at
FT                   residue 36"
FT   gene            complement(580940..582472)
FT                   /locus_tag="Thebr_0565"
FT   CDS_pept        complement(580940..582472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0565"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.1.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: tpd:Teth39_0551 ATP-dependent
FT                   metalloprotease FtsH; PFAM: AAA ATPase central domain
FT                   protein; peptidase M41"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79167"
FT                   /db_xref="GOA:E8UVT6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVT6"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADV79167.1"
FT                   /translation="MKKNLHIIILALSIFINLLFIYIFISEVKPNLNLNLSFILTAAVI
FT                   VVTYLLFKNKFSELMPVNYNNITETKEDTSHRKTNITFKDVAGLDEVIDELKVIIDFMT
FT                   NTEKYNKMGAKIPKGILFYGPPGTGKTLLATALAGETNSTFISASGSEFVEKYVGVGAS
FT                   RIRALFAKAKKSAPSIIFIDEIDAVGTKRNTDNNSEKDQTLNQLLVEMDGFNSNEGIIV
FT                   IGATNRIDMLDEALLRPGRFDRTIHIGAPNMKARLEILKVHTRNKPLDESVSLSELARK
FT                   THGMTGAHLAAMCNEAAILAVMKNKSKIGKEEFEEALERVIAGLKKKNPSVLEKERNIA
FT                   AYHEAGHALIGKILNVNTIEKISIVPRGEALGYVLNFPKEDAFLLTKTELKNKITMLLG
FT                   GRASEEIIFNEISTGAENDLKEATKIAYQMVCNYGMSELGNRVIDLHMLKSTEIVDKEI
FT                   DKIINSCYTLAKKILLENKHKVIAIAEKLLEKESITKEELETLWEEENTLCV"
FT   gene            582607..583590
FT                   /locus_tag="Thebr_0566"
FT   CDS_pept        582607..583590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0566"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /note="KEGG: tpd:Teth39_0552 putative
FT                   CoA-substrate-specific enzyme activase; TIGRFAM:
FT                   CoA-substrate-specific enzyme activase; PFAM: ATPase
FT                   BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79168"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVT7"
FT                   /inference="protein motif:TFAM:TIGR00241"
FT                   /protein_id="ADV79168.1"
FT                   /translation="MKGYMGIDVGSVSTNIAVIDENNRVIDSVYIRTQGQPIKAVQNAL
FT                   REIKNKIGDMVIKGVGTTGSARQLTGLMVGADIVKNEITAHAVAASNVIKDVRTVIEIG
FT                   GQDSKIIILRDGVVVDFAMNTVCAAGTGSFLDQQAYRLNIPIEQFGDIALQSKSPVRIA
FT                   GRCSVFAESDMIHKQQMGYALPDIISGLCDALVRNYLNNVGKGKEIKEPIVFQGGVAAN
FT                   KGIKAAFEKALGMKVYVPEHYGVMGAIGAAILAKEAVKEKGYTSFKGFEVSDFKYRAVG
FT                   FECTACPNRCEVVEFIQGDEVISRWGDKCGRWSNSTSKKVHANTAS"
FT   gene            complement(583628..583708)
FT                   /pseudo
FT                   /locus_tag="Thebr_0567"
FT   gene            583810..585564
FT                   /locus_tag="Thebr_0568"
FT   CDS_pept        583810..585564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0568"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA; KEGG:
FT                   tpd:Teth39_0553 cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79169"
FT                   /db_xref="GOA:E8UVT8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVT8"
FT                   /inference="protein motif:PFAM:PF02491"
FT                   /protein_id="ADV79169.1"
FT                   /translation="MDNRDIIFALDIGTRVVVGIVGIENNGKFQVLAVEQMEHESRAMF
FT                   DGQVHDIDKVANVVEKIKRRLEDSLNIKLTEVCIAAAGRSLKTQFARAEKNIDEEHEIT
FT                   VEDINNLELEALEIAQNSIISQSGVTRYHTVGYTVSNYYLNSFPITNLKGHKGREIAVE
FT                   ILATFLPYDVVEGLYAAVKKAGLEVSYITLEPIAAINVAIPPEIRMLNIALVDIGAGTS
FT                   DIAISKEGNIIAYSMVPYAGDEITESIATHFLTDFNTAEKIKKSTKKEIKFKDVLNIEH
FT                   KITKEEVMEIIAPQVKVLAQKICEEIIKYNGKSPSAVFLVGGSSNLPNLPEEIASILNL
FT                   PINRVSVRDIKSVEILDYKGKTLKGPESITPIGIAYSAMINKKKDFIKVSIDNKTIKIF
FT                   NIKNPTVMDALVAINYDSKNLIVQNGEDLVIKLNGQKVVIKGEEGTPPKIYVNGSLANL
FT                   KTHINDGDKITIVKGQKGQDATITAGELLKQQKGKLIFVNDSKVDKNYVIKNGDEIVIK
FT                   EDLTSFVVTVNGKEVELKGKEEYLFVDVFNFIDLKLDNNKVPEMKVNGRRASYTDILKP
FT                   GDNIEIEI"
FT   gene            585661..586167
FT                   /locus_tag="Thebr_0569"
FT   CDS_pept        585661..586167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79170"
FT                   /db_xref="GOA:E8UVT9"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVT9"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0554"
FT                   /protein_id="ADV79170.1"
FT                   /translation="MDIFIEKLVKKQKTSKDTLFSIGVVVATLIIVFGVIPLIPIVKNF
FT                   LIFFLFLFGYLAHYLIRSRNIEFEYSLTNSELDVDKIIDQKRRKHVISVDCRDFEIMAR
FT                   VNSDRFTQDIKTIKNRIEAVSSMSSPDVYFAVFENGGVKTLLFFEPNEKMLEAIARYIP
FT                   RKLFR"
FT   gene            586186..586542
FT                   /locus_tag="Thebr_0570"
FT   CDS_pept        586186..586542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0570"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: tpd:Teth39_0555 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79171"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVU0"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADV79171.1"
FT                   /translation="MKGELEFLDISKKTGLSVTLLKEIIKVISKYTSVEKAVIFGSRGR
FT                   GDFKKTSDIDICIFGDEVTHTEINLLEFDLRELNTPLDFDVVSFKSITKEELKENILKD
FT                   GVEVYDRKKITSEI"
FT   gene            586511..586918
FT                   /locus_tag="Thebr_0571"
FT   CDS_pept        586511..586918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0571"
FT                   /product="nucleotidyltransferase substrate binding protein,
FT                   HI0074 family"
FT                   /note="KEGG: tpd:Teth39_0556 HI0074 family
FT                   nucleotidyltransferase substrate binding protein; TIGRFAM:
FT                   nucleotidyltransferase substrate binding protein, HI0074
FT                   family; PFAM: Nucleotidyltransferase substrate binding
FT                   protein HI0074"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79172"
FT                   /db_xref="GOA:E8UVU1"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVU1"
FT                   /inference="protein motif:TFAM:TIGR01987"
FT                   /protein_id="ADV79172.1"
FT                   /translation="MIEKRLLQRFEDFKNAFMRLKEAFDIEIENEIIIDGIIQRFEFTF
FT                   ELAWKLMKDYLAYEGIEVNSPRSVIRAAYENHLIDDGEAWIDMLMDRNKTSHIYDKKLS
FT                   LEIYNNIKDKHLKYLEDLKRKLEMIIERENK"
FT   gene            587005..587685
FT                   /locus_tag="Thebr_0572"
FT   CDS_pept        587005..587685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0572"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: tpd:Teth39_0557 HAD family hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79173"
FT                   /db_xref="GOA:E8UVU2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVU2"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADV79173.1"
FT                   /translation="MIKAVIFDMDGVIIDSEPIHIKLEEELFKSLGVEISEDEHLTFVG
FT                   TSSYYMWRKVKEKFNLSQSVEELVEIDRKRYLEHVLKTGEIIPIEGITETVKKLFEKEY
FT                   RLAVASSSPIDVIELVVKKLGIDNCFEVLVSGDYVKNSKPAPDIFLYAADKLKVKPHEC
FT                   VVIEDSYNGVHGAKKAGMKVIGFKNPNSGNQDLSEADFIIDSLGEELLEIIDELNNAED
FT                   VVKN"
FT   gene            complement(587696..587771)
FT                   /locus_tag="Thebr_R0021"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(587696..587771)
FT                   /locus_tag="Thebr_R0021"
FT                   /product="tRNA-Arg"
FT   gene            587889..588494
FT                   /locus_tag="Thebr_0573"
FT   CDS_pept        587889..588494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0573"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: tpd:Teth39_0558 50S ribosomal protein
FT                   L25/general stress protein Ctc; TIGRFAM: ribosomal 5S rRNA
FT                   E-loop binding protein Ctc/L25/TL5; PFAM: Ribosomal protein
FT                   L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79174"
FT                   /db_xref="GOA:E8UVU3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVU3"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADV79174.1"
FT                   /translation="MQSVSIEAIKRDTGKNAARRLKNQGYIPAILYGKGMAESIPLAVE
FT                   YNKLQRLLQKHGRNVLLNVIVDGSTHNAVIKEIQEDTLKGKIIHVDFQRVSMYEEIEAT
FT                   VPLKFEGTGLIESRGGIVQHQLWELTVESLPDKIPQEIVVDLSNLEIGDTLFVKDIQVP
FT                   EGVKVVDDPDEIVVSVLAPRESEEEAEEEATETAKESE"
FT   gene            complement(588525..589862)
FT                   /locus_tag="Thebr_0574"
FT   CDS_pept        complement(588525..589862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0574"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="KEGG: tpd:Teth39_0559 diaminopimelate decarboxylase;
FT                   TIGRFAM: diaminopimelate decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79175"
FT                   /db_xref="GOA:E8UVU4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVU4"
FT                   /inference="protein motif:TFAM:TIGR01048"
FT                   /protein_id="ADV79175.1"
FT                   /translation="MLHGTMKINSKGHLEIGGCDTVTLAKKFGTPLYVIDEELLRQNCR
FT                   AFYNGFKKDYPGNEVIYASKAFMTMAICKIIEEENLGLDVVSGGELYTALKAGFPAEKI
FT                   YFHGNNKSKEELIMALENNIGRIIVDNWYELNMLNDLAKKMNKVPNIYIRVSPGVEAHT
FT                   HQYVKTGQMDSKFGFPLFNGDAMRAIEYALTLENVNLVGLHSHIGSQIFDAESYKAEIE
FT                   IMMNFLKLVKEFLGWEVGELDLGGGFGIAYVEEDDPQPIEQIAQEIMQAVKEYSVALNI
FT                   KMPNIIVEPGRSIIGNAGTTLYTVGAIKDIPGVRKYVAVDGGMSDNIRTALYGAKYDAI
FT                   VANKAKNIKSEKVSIAGKLCESGDMLIWDITLPKIEEGDILAVTCTGAYNYSMASNYNR
FT                   LPRPAAVLVSNGQADIIVARETYEDLIRNDIIPERLTNEKRKIANY"
FT   gene            590316..590771
FT                   /locus_tag="Thebr_0575"
FT   CDS_pept        590316..590771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0575"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79176"
FT                   /db_xref="GOA:E8UVU5"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVU5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0560"
FT                   /protein_id="ADV79176.1"
FT                   /translation="MPWIITFIVSWIIFFLLVDWRYIKYTVWGGLLALSFQLVVDEIAI
FT                   GLNLYDFSNVVIRIFDSSLFFTLGAPFCIGVLYAQTYPKNNILRLIDVIISTALFFIME
FT                   YLLVHIGALKYFHWHYLYSLIIDVAALLALGNLITIFKLSPWMRREK"
FT   gene            591006..592130
FT                   /locus_tag="Thebr_0576"
FT   CDS_pept        591006..592130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0576"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_0561 ABC transporter related; PFAM:
FT                   ABC transporter related; TOBE domain-containing protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79177"
FT                   /db_xref="GOA:E8UVU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVU6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADV79177.1"
FT                   /translation="MADVVLKHVYKVYPGGVTAVKDFNLEIQDKEFIVLVGPSGCGKTT
FT                   TLRMIAGLEEISSGELYIDGKLVNDVPPKDRDIAMVFQNYALYPHMTVYDNMAFGLKLR
FT                   KVPRAEIDRKVKEAARILGLEEYLNRKPKALSGGQRQRVALGRAIVRNPKVFLMDEPLS
FT                   NLDAKLRVQMRTELAKLHDRLQTTFIYVTHDQTEAMTMGTRIVVMKDGVIQQVDKPQTI
FT                   YDYPNNLFVAGFIGSPQMNFIDARLENKNGKVYATFKGFSILVPEGILKRLKDPSYVGK
FT                   EIVLGIRPEDLHDEEVFLEAYPEAVVEAKVDVTELMGPETYLYLDVNGVPLTARVDPRT
FT                   RAKAGDVIKIGFDINKLHMFDKETEMSILNRVIS"
FT   gene            592534..593586
FT                   /locus_tag="Thebr_0577"
FT   CDS_pept        592534..593586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0577"
FT                   /product="helix-turn-helix Fis-type"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG:
FT                   tpd:Teth39_0562 transcriptional regulator, CdaR"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79178"
FT                   /db_xref="GOA:E8UVU7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:E8UVU7"
FT                   /inference="protein motif:PFAM:PF02954"
FT                   /protein_id="ADV79178.1"
FT                   /translation="MIGYDLIKKVAYDIQKNLQMPLYIIDKSGNLIYGNKDFFEKKAGF
FT                   LEIKVEYIDEKDIYEVGEFICYNIFYNNVLFFTIALERKDEQSKKVLYLISLIFEQLLQ
FT                   KYNREEFLIEALTGKLSVNLVSYYAEKYKINKNVKYTVAIVESNNEIDDAIKIITNIFD
FT                   KGNLYTVKFDDKRFVTIFSYKGNNSLIELYKTMKDMIESEGYMKVKIASSSSFVPIENI
FT                   HIAYREAETALLIGQKLEDEKGIYIYEDYSFPEILWGIDIEKVNNFIKKRNIDFGIFKD
FT                   EELIQTLNAFFRNSLNLSETARELYIHRNTLVYRLDKIFKMTGLDAKNFDDAVLLKTIM
FT                   ILTKLYNIPR"
FT   gene            593593..594279
FT                   /locus_tag="Thebr_0578"
FT   CDS_pept        593593..594279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0578"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="TIGRFAM: cell division ATP-binding protein FtsE;
FT                   PFAM: ABC transporter related; KEGG: tpd:Teth39_0563 cell
FT                   division ATP-binding protein FtsE; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79179"
FT                   /db_xref="GOA:E8UW24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW24"
FT                   /inference="protein motif:TFAM:TIGR02673"
FT                   /protein_id="ADV79179.1"
FT                   /translation="MIKFINVSKRYNKDIIALSNISFEIESGEFVFIVGPSGAGKSTLI
FT                   KLLLKEEEPTSGSIMINKKDITKLKKREIPYLRRSMGVVFQDFRLLPNKTVFENVAFAM
FT                   EIVGAHPKEIRRKVPMVLALVGLSDKADKYPRQLSGGEQQRVSLARAIVNEPSILIADE
FT                   PTGNLDPDTSWEIVKLISEINKRGTTVVMATHAKDIVDAMKKRVIALEKGNIVRDEVRG
FT                   AYGYAL"
FT   gene            594263..595156
FT                   /locus_tag="Thebr_0579"
FT   CDS_pept        594263..595156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0579"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   tpd:Teth39_0564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79180"
FT                   /db_xref="GOA:E8UW25"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW25"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADV79180.1"
FT                   /translation="MDMLFRNLKYFLKEGFNNLARNRLMTIASITSVMAAMLILGLFLV
FT                   IILNVNSLTNQVESQLELKVFLKDNISEQEVSQIGNEIKSIHGVTSVVFESKEEALQKF
FT                   KQQLGDKSYLAEGLEKDNPLPQSYIVKVKDANLMKNISNKIKQINGVDKVSYGQDVVDK
FT                   LLGIIKIIRIVGLSIILILFIISIVIISNTIKLGVFARRREINIMKYIGATDWFIRWPF
FT                   LIEGIVLGLVGALLSVVILALIYGYMLDIINNKLMVFKLLPLEKIAGDIIVYFSIIGAI
FT                   IGALGSGLSIKRFLNV"
FT   gene            595180..596319
FT                   /locus_tag="Thebr_0580"
FT   CDS_pept        595180..596319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0580"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: tpd:Teth39_0565 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79181"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW26"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADV79181.1"
FT                   /translation="MRRYRWKWLIFVVIFLFTVLFTSYPKADQLQDAKNKLNQIQKSIT
FT                   ETKKKKEEIINQKNDIAAQIADLDKKLNATQQELANAQKQLSDITAKLNKTRKELEAAK
FT                   QKENTQLQTMKERIRAIYISGEWGYLDVLLGAQNFGDFITRLDIVKRIVDFDSSLFESY
FT                   KQQRELIEQKEKELAQMQREAQNYKNQIVSRQRELQVAMASREGLMRDLERQQKLYEQQ
FT                   EDELLQQSKQLETVIQQLQAKSSIKYGGGKLLWPVPSSNVITSPFGMRLHPVLGVYRMH
FT                   TGIDIAANTGASIVAAADGQVIFSGYYGGYGYTVIIDHGDGISTLYAHNSALLVKEGDT
FT                   VKRGQVIAKAGSTGLSTGPHLHFEVRKNGVPVNPMDWLK"
FT   sig_peptide     595180..595263
FT                   /locus_tag="Thebr_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.951 at
FT                   residue 28"
FT   gene            596407..597603
FT                   /locus_tag="Thebr_0581"
FT   CDS_pept        596407..597603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0581"
FT                   /product="carboxyl-terminal protease"
FT                   /note="TIGRFAM: carboxyl-terminal protease; PFAM: peptidase
FT                   S41; PDZ/DHR/GLGF domain protein; KEGG: tpd:Teth39_0566
FT                   carboxyl-terminal protease; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79182"
FT                   /db_xref="GOA:E8UW27"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW27"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADV79182.1"
FT                   /translation="MAKKRFYILLAMLLIVTNVITFALANVVSVALPNGKVIVSREEYQ
FT                   LIKKYSKLFEIEKTLENRYVDRVNSSILLEGALKGMANSLEDPYTVYMNKKEFSDFMTQ
FT                   TTGTYGGIGIVVAVDKEDHIVVVSPIKNTPGERAGIKSGDIIVEVNNKKVSGKNLDEAV
FT                   AMMRGPQGTEVTLTIMREGKTFTKTITREIIKLETVYDEMLPDKIGYIKITMFDQSTAD
FT                   DFKAALDKLKSQGMKGLILDLRDNPGGLLEETIDISNLILPKGVVVTTKGRVDNKEYYS
FT                   KGPGLGLPLAVLVNKGSASASEILAGAIKDRKVGVLVGSNTFGKGLVQTIVDFGDGTGL
FT                   KYTIARYYTPNGTNIQGKGIEPNYVVELPESYTLQDTPDLKGDTQLIKAFEIVKSEIK"
FT   sig_peptide     596407..596484
FT                   /locus_tag="Thebr_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.845 at
FT                   residue 26"
FT   gene            597613..598857
FT                   /locus_tag="Thebr_0582"
FT   CDS_pept        597613..598857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0582"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="SMART: PDZ/DHR/GLGF domain protein; KEGG:
FT                   tpd:Teth39_0567 PDZ/DHR/GLGF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79183"
FT                   /db_xref="GOA:E8UW28"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW28"
FT                   /inference="protein motif:SMART:SM00228"
FT                   /protein_id="ADV79183.1"
FT                   /translation="MTAFIKVFWWAIETIALSVFNPFFWIVIILIVMQYRNKIAIEREI
FT                   MGQEQEPMKELVLDSVFYGVIAAIIGSFLMIFLGITIENIGLQYVWPLVIVLMLVNPRY
FT                   ICFSYAGGIVSLFSLFFGFPNISVPALMSIVGILHLMESLLIYIDGPRNATPIFVRLKD
FT                   GRVAGGFTMQKFWPIPFAALTIATGITITGQGVNMPDWWPIIKPSGIDLNNVIFLMMPA
FT                   IAALGYGDLALTQLPEKKTRISSLRLFCFSIVLIILAVLGIYIKLFQYLAAIFAPVAHE
FT                   LLILIGQREERENPPLFVAPDTGVMILATAKGSPAREMGIKPGDVILKINDIPINEPDD
FT                   IIRILNERPSVMWITVKDLNGNYTNYEYKDPQGILGLGVLIVPKATSMIYEINGEGIFI
FT                   KKLKEIFKNIFKKNR"
FT   gene            598871..599596
FT                   /locus_tag="Thebr_0583"
FT   CDS_pept        598871..599596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0583"
FT                   /product="2-phosphosulfolactate phosphatase"
FT                   /note="PFAM: 2-phosphosulfolactate phosphatase; KEGG:
FT                   tpd:Teth39_0568 2-phosphosulfolactate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79184"
FT                   /db_xref="GOA:E8UW29"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW29"
FT                   /inference="protein motif:PFAM:PF04029"
FT                   /protein_id="ADV79184.1"
FT                   /translation="MFLQTFETYNSFNERELKNKNVVVIDTLRATSVITTALYNGAKEI
FT                   IPVSEVEEAIELVKSLDKTTYLLGGERNSTKIEGFDLSNSPLEYTREKVENKTIIFTTT
FT                   NGTKALKKVSLADNVILGCLLNASAVAKYIYTSNKDTIIVCAGTEGKFSLDDIITAGVI
FT                   YKKLQDLMEFESDDLSKASYFLYKPYEDNLYEIMKHGFHFKRLKDLGYDEDIEFCLTVD
FT                   KFDIVPKLKDGIIKNSADL"
FT   gene            599757..601742
FT                   /locus_tag="Thebr_0584"
FT   CDS_pept        599757..601742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0584"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase
FT                   domain protein; type III restriction protein res subunit;
FT                   UvrB/UvrC protein; KEGG: tpd:Teth39_0569 excinuclease ABC
FT                   subunit B; SMART: DEAD-like helicase ; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79185"
FT                   /db_xref="GOA:E8UW30"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW30"
FT                   /inference="protein motif:TFAM:TIGR00631"
FT                   /protein_id="ADV79185.1"
FT                   /translation="MSGFKLVSNFKPTGDQPQAIDKLVEGVKKGYRFQTLLGVTGSGKT
FT                   FTMANIIQKLNRPTLVIAHNKTLAAQLYSEFKEFFPDNAVEYFVSYYDYYQPEAYIPQT
FT                   DTYIEKDASINEEIDKLRHSATAALFERRDVIIVASVSCIYGLGDPVDYENLMLSLRPG
FT                   MIKDRDEIIKKLVDIQYERNDVNFTRGKFRVRGDVIEIFPASFSNKAIRVELFGDEIDR
FT                   IAEIDVLTGEVLGLRKHVAIFPASHYATSKDKLERAIKSIREELEQRYKELKDAGKIVE
FT                   AERLRQRTNYDLEMLQEMGYCQGIENYSRHISGRPPGSPPYTLLDYFPKDFLIFIDESH
FT                   VTIPQIRGMYNGDRSRKEALVEYGFRLPSAFDNRPLTFEEFEKRINQVIFVSATPGPYE
FT                   LEHSEQVVEQLIRPTGLIDPEVIVKPVKGQVDDLIGEIRKTVDKGFRVLVTTLTKKMAE
FT                   DLTDYLKDMGIKVKYLHSDIETIERVEIIRDLRLGKFDVLIGINLLREGLDIPEVALVA
FT                   ILDADKEGFLRSETSLIQTIGRAARNAEGRVIMYADTVTNSMKRAIDETNRRRKIQMEY
FT                   NKKHGITPKTVIKGVRDVIEATHVAEEEQKYRRKKVKTYDPEIIKSTIEQLEKEMKEAA
FT                   IELQFEKAAKLRDVIFELKKQLEEVV"
FT   gene            601752..604535
FT                   /locus_tag="Thebr_0585"
FT   CDS_pept        601752..604535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0585"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: tpd:Teth39_0570 excinuclease
FT                   ABC, A subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79186"
FT                   /db_xref="GOA:E8UW31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW31"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADV79186.1"
FT                   /translation="MAKDKIVIKGARVHNLKNVDLEIPRDKLTVITGLSGSGKSSLAFD
FT                   TIYAEGQRRYVESLSAYARQFLGQMDKPDVDYIEGLSPAISIDQKTTNKNPRSTVGTIT
FT                   EIYDYLRLLYARAGIPHCPVCGKEISMQTIDQMVDRVKELPEGTRIQVLAPVIRGRKGE
FT                   YAKLLNDIKKSGYVRVKIDGVMYDVNEEIKLDKNKKHTIEVVVDRVIIKPGIDMRLTDS
FT                   IETALKLADGIVSIDVIDGESFTLSEKYACTECNISIEELSPRMFSFNSPYGVCPVCTG
FT                   LGEFMKVDPELLIQDPKKSLANGLLPGIVASQDSYAYYNILRLIEHFGYTENTPYEKFS
FT                   EDLKNVLLYGKDTKGKSYGFEGIVNNLERRYNNTSSDFIKEEIEKYMRPVTCPACHGAR
FT                   LKPEALAVTVGGLSIKEMTDLSVGELIKFIEELKLTEKQEIIAKPILKEIKARLNFLVD
FT                   VGLDYLTLSRPAATLSGGEAQRIRLASQIGSGLVGVTYILDEPSIGLHQRDNERLINSL
FT                   KKLRDQGNTLIVVEHDEDTIYAADYIVDVGPGAGEHGGEIVIAGTIEDVLKCEKSITGQ
FT                   YLSGKIKIEVPKQRRKPNGKALIVKGAKENNLKNIDVVFPLGVFICVTGVSGSGKSTLI
FT                   NEILYKALAQKIYKSKDKPGMHDAIEGIDNIDKVINIDQSPIGRTPRSNPATYTGVFDY
FT                   IREVFANTPEAKMRGYKPGRFSFNVKGGRCEACGGDGIIKIEMNFLPDVYVPCEVCKGQ
FT                   RYNRETLEVKYKGKNISDVLNMTVEEALEFFENIPRIKNKLMTLYDVGLGYIKLGQPST
FT                   QLSGGEAQRVKLATELSKRPTGKTLYILDEPTTGLHFADVHRLLEVLNRLTDAGNTVIV
FT                   IEHNLDIIKSADYIIDLGPEGGDKGGRVIATGTPEEVAANENSYTGHFLKKVLSQK"
FT   gene            604545..604949
FT                   /locus_tag="Thebr_0586"
FT   CDS_pept        604545..604949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0586"
FT                   /product="Forkhead-associated protein"
FT                   /note="KEGG: tpd:Teth39_0571 FHA domain-containing protein;
FT                   PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79187"
FT                   /db_xref="GOA:E8UW32"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW32"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADV79187.1"
FT                   /translation="MYYAIASQILKYVLIFLIYLFLYRVFKIVYMDIKGVRYERQITAA
FT                   KLSFLNGERTFNLFEVTTIGRSEECDIVIESPYVSARHAIIRKRGKRFYIQDLNSTNGT
FT                   FINGKRIKGIAKIRNNDVITLGDVDLKFIL"
FT   gene            604960..606204
FT                   /locus_tag="Thebr_0587"
FT   CDS_pept        604960..606204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0587"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: tpd:Teth39_0572 cell
FT                   cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79188"
FT                   /db_xref="GOA:E8UW33"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW33"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADV79188.1"
FT                   /translation="MEEYIKTGSKAMKNVFWIFVIAFLLLFIHNKPKGFDTIYFTLAFP
FT                   ILIYIVYYLHVRLFPLGEIQFVILTSFLTEMGLIMIYRVAPNLLVKQIVWIAIGFLLYF
FT                   ISSYIFKHYYLLYKLKYGEAIYIAITIALLALPLIFGREIGGAKNWLTFDGIYVQPAEL
FT                   AKIIYIIFLAKYLCTRRETKDIIMLGLITLVIVGIFVLEKDLGMAFLFYATTVLLIFVS
FT                   TSNLLYTAVGIGLFVLGGIISYFLFWHVRVRIEAWLNPWMDVPGKTYQIVQSLFAIAAG
FT                   GFFGTGLGMGHPEYIPAVATDFIFSAISEEFGFLGAVAIILVYFVIMYRGIKVALNAKD
FT                   EFGVLVATGLISMFSLQVFTIIGGVIKFIPLTGVTLPFVSYGGSSMVTSFVTLGMLNGI
FT                   ALKEEQQDVQLKSQY"
FT   gene            606179..607600
FT                   /locus_tag="Thebr_0588"
FT   CDS_pept        606179..607600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0588"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: tpd:Teth39_0573 peptidoglycan
FT                   glycosyltransferase; PFAM: penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79189"
FT                   /db_xref="GOA:E8UW34"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW34"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADV79189.1"
FT                   /translation="MSNLNRNIKILFWFFSVLFFGLIAYLTYFQIYERDKLITSSYSVY
FT                   NRRLIEQEKKILRGSILDRNGIVLAKSVQVDGLQKREYLDGPAFAHVIGYSRRIYQQGN
FT                   TGIEKAYDRELLGMVGNDPMILLRKLIFGKGQMGNNVYLTIDKTLQDIAYKDMEGKKGA
FT                   VVALNPKTGEILAMVSTPSYDPNTLGENWEEIMTSSEHVVLNRATQGLYPPGSVFKIVT
FT                   TAAVLTYNPELYDKTFYCKGYIIVDGNRINNFGGIAHGIEDFKQAFYRSCNSFFIQAGL
FT                   DLGSENLQTIAYAFGLDKRVPLEIDTTKNQFPPIDGKSDLAETSIGQGKMLVTPLTMAL
FT                   VASAVANDGVIMKPYLMKYVADPISGAVIEKSTPSQYLNPISKKVADAIKQLMIGAVND
FT                   KEGTGKAAQIPGITVAGKTGTAENPHGDPHAWFVGFAPAENPQIVVSVIVENGGEGGKV
FT                   AAPIARDIIRAYLTK"
FT   gene            607618..609465
FT                   /locus_tag="Thebr_0589"
FT   CDS_pept        607618..609465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0589"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   excinuclease ABC C subunit domain protein; Excinuclease ABC
FT                   C subunit domain protein; UvrB/UvrC protein;
FT                   helix-hairpin-helix motif; KEGG: tpd:Teth39_0574
FT                   excinuclease ABC subunit C; SMART: Excinuclease ABC C
FT                   subunit domain protein; Helix-hairpin-helix DNA-binding
FT                   class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79190"
FT                   /db_xref="GOA:E8UW35"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW35"
FT                   /inference="protein motif:TFAM:TIGR00194"
FT                   /protein_id="ADV79190.1"
FT                   /translation="MTIEEKLKLLPEKPGVYIMKDKSGKIIYVGKAVVLKNRVRQYFQN
FT                   KEKQLPKVKVMLSHVEDFEYIVTDTELEALMLECNLIKKYKPKYNVLLKDDKNYPYIKV
FT                   TVNEEYPRIMFTRRIEPDGAKYFGPYSSAFAVRETIKLVRKMFPIRTCNKNIEKDMGKV
FT                   RECLYYHIGLCSAPCTNKINKEDYIKLVDQAVLFLDGKRDWLIQKLKEDMKKAAEELRF
FT                   EEAARIRDQIFAIERTSEKQKVVSVGEDEQDIISMARSADISCIQVFFVRDGKLSGREH
FT                   YYMKNTEGMERGEIISSFIKQFYEGAPYIPKEIITDVELDESELLSEWLSQKRGNKVFI
FT                   TIPVRGKKKELVDMVYQNALEALKNDISIREEISKAQVVLELSNLVGLDYAKRIEAYDI
FT                   SNTRGQDNVGSMVVFVDGKPKKSQYRKFNIKYVEGQDDYESMREVIERRFLHAIEEKEL
FT                   IEKGELEEDKAKFAEMPDLIFVDGGIGHVNAVLQVLSGLGISIPVYGMVKDSKHRTRGL
FT                   VSPQGEIDIPMTSKAFRLIAQIQEEAHRFAITFHKEKQSKRFKSELLNIPGIGEKRAKA
FT                   LYDAFKSIEEIKRASVEDLKKVEGMNEKAAQAVYEYFRK"
FT   gene            complement(609777..610757)
FT                   /locus_tag="Thebr_0590"
FT   CDS_pept        complement(609777..610757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0590"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="KEGG: tpd:Teth39_0575 biotin--acetyl-CoA-carboxylase
FT                   ligase; TIGRFAM: biotin/acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin/lipoate A/B protein ligase; biotin protein
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79191"
FT                   /db_xref="GOA:E8UW36"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW36"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ADV79191.1"
FT                   /translation="MLRSKLLKLLKENKGEYISGQKLSDQLNVSRTAIWKHINELKNEG
FT                   YQIEAHHKLGYMLVSEPDLLIYEEVSPYLTTNFIGKNYIHKLVIDSTNNFAKEMASKVP
FT                   DGTVIIAEEQIAGRGRLGRSWISQKGCGIWMSIILKPNIQPQEALNLTQVAAISVVKAI
FT                   EEVFHVESKIKWPNDIILNNKKVCGILTEMSSEIDKINYVIIGIGVNVNCDNFPEELKG
FT                   KATSLYLETNSKVDRKKLTASILNNLEFYYNAYLQKGFEYIRPICIEKSITIGRQIKVI
FT                   ANEGEIEGKAVTIDNNGSLVVETKEGKRLSIMSGDVSVRGLLDYV"
FT   gene            610904..611821
FT                   /locus_tag="Thebr_0591"
FT   CDS_pept        610904..611821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0591"
FT                   /product="HPr(Ser) kinase/phosphatase"
FT                   /note="KEGG: tpd:Teth39_0576 HPr kinase/phosphorylase;
FT                   TIGRFAM: HPr(Ser) kinase/phosphatase; PFAM: HPr serine
FT                   kinase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79192"
FT                   /db_xref="GOA:E8UW37"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW37"
FT                   /inference="protein motif:TFAM:TIGR00679"
FT                   /protein_id="ADV79192.1"
FT                   /translation="MDKIPVETLIKDLNLEVIVEAKNNKIDITTSDVNRPGLQFSGFYE
FT                   HFAYERVQIIGKVETTFIEQLPDDVLAERADRFFNYPIPCLIVTRDLNIRQEIIDAAQK
FT                   HDRYLLRTKEASTKFINRLINYLDEKLAPQITIHGDLVDVYGIGVLLLGESGIGKSETA
FT                   LELIKRGHRLVADDAVEISKISEDKLQGSSPEIIRHFIEIRGIGILDIKTLYGVGSVRN
FT                   SMNIDLVIQLEEWDEDKYYDRLGLEDDYIKFLDVKVPKLTIPVRPGRNLAIIVEVAAMN
FT                   HRQKQMGYNAAHELNKKLLKQIGN"
FT   gene            611837..612574
FT                   /locus_tag="Thebr_0592"
FT   CDS_pept        611837..612574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0592"
FT                   /product="PHP domain protein"
FT                   /note="KEGG: tpd:Teth39_0577 putative hydrolase; PFAM: PHP
FT                   domain protein; SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79193"
FT                   /db_xref="GOA:E8UW38"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023710"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW38"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADV79193.1"
FT                   /translation="MKLVLDTHTHTISSGHAYSTITENAREAYKKGLQLICMTDHGPKM
FT                   PGAAHLWYFGNLKVLPEKIEGVEILKGVEVNIMDEEGNLDLPEGILKKLDIVIASLHDV
FT                   CFEPSDDIERNTKAIINAIKNPYVDIIGHPGNPIYPIDIEKVLMAAKEYGKFIEINNSS
FT                   FVSSRKGSEENCFLIAKKAKEMGVKIAVGSDAHVSFDVGRFEEALKVIKNAGITEDLVL
FT                   NTDVGKIKEYLKEKKRKIGGEEE"
FT   gene            612571..613509
FT                   /locus_tag="Thebr_0593"
FT   CDS_pept        612571..613509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0593"
FT                   /product="glucokinase, ROK family"
FT                   /note="KEGG: tpd:Teth39_0578 ROK family glucokinase;
FT                   TIGRFAM: glucokinase, ROK family; PFAM: ROK family protein;
FT                   ATPase BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79194"
FT                   /db_xref="GOA:E8UW39"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW39"
FT                   /inference="protein motif:TFAM:TIGR00744"
FT                   /protein_id="ADV79194.1"
FT                   /translation="MRIGVDLGGTNIAVGLVDEEGRIVATGSRPTKPERGYEAVAKDIA
FT                   EIALELINRTNTDIKEIKSMGIGVPGVADSEKGIVIRAVNLFWTKVPLAKEIRKYIDLP
FT                   IYMDNDANVAALAEAVFGAGRGSKSSVTITLGTGVGSGFVLDGKIYNGAHHFAPEIGHI
FT                   VIGNNGVRCNCGKVGCLETYASATALIREGKKAAKKDPNSLILKFANGDIENITAKNVI
FT                   DAAKQYDEEAIKIFNDYVKYLAIGIVNVINMLDPEVIILGGGVANAGDFLIKPLKKEVA
FT                   ENILFKDLPYADIRKAELGNDAGIIGAAILG"
FT   gene            613522..615000
FT                   /locus_tag="Thebr_0594"
FT   CDS_pept        613522..615000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0594"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   tpd:Teth39_0579 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79195"
FT                   /db_xref="GOA:E8UW40"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW40"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADV79195.1"
FT                   /translation="MKIYEIYKNSGVSDNHIAIKFKDKIYTYREVDFLIDKYASFFQSI
FT                   GVKKGDRVALSFPNCPEYIFSFMGASKAGAIVVPLNMMLTLEEIAYIIMESGTSTIVLH
FT                   PVIAQKIDKSQLGRLNIKNVVILDENTIATILKMKVAKPVDVEADEVCAYLYTSGTTGK
FT                   PKGAMLTHNNFLADVKALDEVSDLGPNDNFLALLPLFHSFSWTVNILLGFYLGSTITIK
FT                   ESFMPKDTLETLTNEDVTVFCGVPSMFAVLMRMAEKGQFKALRLAISGGAPLAPEIQRG
FT                   FEEKFNFPLVEGYGLTEAAPVALLNPLEPDAIRKPGSIGLPLPCVEAKIVDENDNELSV
FT                   GEIGELVLKGPNIMVGYHNMPEETAKTLRGGWLHTGDLVKKDEDGYFYIVDRLKDMIIL
FT                   GGFNVYPREVEDALLEHPDVLEVAVIGVGDQLKGEEVKAFVVLKEGAKADKKELQHFLK
FT                   NKLASYKIPKIFEFVPKLPKNAAGKIEKKLLKEM"
FT   gene            615014..615613
FT                   /locus_tag="Thebr_0595"
FT   CDS_pept        615014..615613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0595"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   tpd:Teth39_0580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79196"
FT                   /db_xref="GOA:E8UW41"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW41"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADV79196.1"
FT                   /translation="MRDSKLYDIAYFISDLMILNFLWIVFSLPIVTLFPSTEALLHSMH
FT                   LLRKDEGEGVWREFWKAFKKHFHWMLINFVVTVAVILILYVDVKFFTHQNTAFAYLLAG
FT                   LLLSIGFMFLITLIYTFLTSQYYEGSLFNLWKTSFILGLGHLPQTMLIILTLLAAFILA
FT                   NIIPILVFIILASGSAYIIDMIFEGIIRKYIKKDEE"
FT   gene            615746..617152
FT                   /locus_tag="Thebr_0596"
FT   CDS_pept        615746..617152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thebr_0596"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; Extradiol
FT                   ring-cleavage dioxygenase class III protein subunit B;
FT                   KEGG: tpd:Teth39_0581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thebr_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADV79197"
FT                   /db_xref="GOA:E8UW42"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:E8UW42"
FT                   /inference="protein motif:PFAM:PF01871"
FT                   /protein_id="ADV79197.1"
FT                   /translation="MGTLLSCYLMPHPPIIVPEVGRGEEKKI