(data stored in ACNUC7421 zone)

EMBL: CP002468

ID   CP002468; SV 1; circular; genomic DNA; STD; PRO; 4093599 BP.
XX
AC   CP002468;
XX
PR   Project:PRJNA61191;
XX
DT   26-JAN-2011 (Rel. 107, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Bacillus subtilis BSn5, complete genome.
XX
KW   .
XX
OS   Bacillus subtilis BSn5
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-4093599
RX   DOI; 10.1128/JB.00129-11.
RX   PUBMED; 21317323.
RA   Deng Y., Zhu Y., Wang P., Zhu L., Zheng J., Li R., Ruan L., Peng D.,
RA   Sun M.;
RT   "Complete genome sequence of Bacillus subtilis BSn5, an endophytic
RT   bacterium of Amorphophallus konjac with antimicrobial activity for the
RT   plant pathogen Erwinia carotovora subsp. carotovora";
RL   J. Bacteriol. 193(8):2070-2071(2011).
XX
RN   [2]
RP   1-4093599
RA   Deng Y., Sun M.;
RT   ;
RL   Submitted (18-JAN-2011) to the INSDC.
RL   College of Life Science and Technology, State Key Laboratory of
RL   Agricultural Microbiology, Huazhong Agricultural University, 1 Shizishan
RL   Road, Wuhan, Hubei 430070, P. R. China
XX
DR   MD5; af365bd54e534007818b338786dd2b7a.
DR   BioSample; SAMN02603875.
DR   EnsemblGenomes-Gn; BSn5_r21058.
DR   EnsemblGenomes-Gn; BSn5_r21060.
DR   EnsemblGenomes-Gn; BSn5_r21062.
DR   EnsemblGenomes-Gn; BSn5_r21064.
DR   EnsemblGenomes-Gn; BSn5_r21066.
DR   EnsemblGenomes-Gn; BSn5_r21068.
DR   EnsemblGenomes-Gn; BSn5_r21070.
DR   EnsemblGenomes-Gn; BSn5_r21072.
DR   EnsemblGenomes-Gn; BSn5_r21074.
DR   EnsemblGenomes-Gn; BSn5_r21076.
DR   EnsemblGenomes-Gn; BSn5_r21078.
DR   EnsemblGenomes-Gn; BSn5_r21080.
DR   EnsemblGenomes-Gn; BSn5_r21082.
DR   EnsemblGenomes-Gn; BSn5_r21084.
DR   EnsemblGenomes-Gn; BSn5_r21086.
DR   EnsemblGenomes-Gn; BSn5_r21088.
DR   EnsemblGenomes-Gn; BSn5_r21090.
DR   EnsemblGenomes-Gn; BSn5_r21092.
DR   EnsemblGenomes-Gn; BSn5_r21094.
DR   EnsemblGenomes-Gn; BSn5_r21096.
DR   EnsemblGenomes-Gn; BSn5_r21098.
DR   EnsemblGenomes-Gn; BSn5_r21100.
DR   EnsemblGenomes-Gn; BSn5_r21102.
DR   EnsemblGenomes-Gn; BSn5_r21104.
DR   EnsemblGenomes-Gn; BSn5_r21106.
DR   EnsemblGenomes-Gn; BSn5_r21108.
DR   EnsemblGenomes-Gn; BSn5_r21110.
DR   EnsemblGenomes-Gn; BSn5_r21112.
DR   EnsemblGenomes-Gn; BSn5_r21114.
DR   EnsemblGenomes-Gn; BSn5_r21116.
DR   EnsemblGenomes-Gn; BSn5_t20892.
DR   EnsemblGenomes-Gn; BSn5_t20894.
DR   EnsemblGenomes-Gn; BSn5_t20896.
DR   EnsemblGenomes-Gn; BSn5_t20898.
DR   EnsemblGenomes-Gn; BSn5_t20900.
DR   EnsemblGenomes-Gn; BSn5_t20902.
DR   EnsemblGenomes-Gn; BSn5_t20904.
DR   EnsemblGenomes-Gn; BSn5_t20906.
DR   EnsemblGenomes-Gn; BSn5_t20908.
DR   EnsemblGenomes-Gn; BSn5_t20910.
DR   EnsemblGenomes-Gn; BSn5_t20912.
DR   EnsemblGenomes-Gn; BSn5_t20914.
DR   EnsemblGenomes-Gn; BSn5_t20916.
DR   EnsemblGenomes-Gn; BSn5_t20918.
DR   EnsemblGenomes-Gn; BSn5_t20920.
DR   EnsemblGenomes-Gn; BSn5_t20922.
DR   EnsemblGenomes-Gn; BSn5_t20924.
DR   EnsemblGenomes-Gn; BSn5_t20926.
DR   EnsemblGenomes-Gn; BSn5_t20928.
DR   EnsemblGenomes-Gn; BSn5_t20930.
DR   EnsemblGenomes-Gn; BSn5_t20932.
DR   EnsemblGenomes-Gn; BSn5_t20934.
DR   EnsemblGenomes-Gn; BSn5_t20936.
DR   EnsemblGenomes-Gn; BSn5_t20938.
DR   EnsemblGenomes-Gn; BSn5_t20940.
DR   EnsemblGenomes-Gn; BSn5_t20942.
DR   EnsemblGenomes-Gn; BSn5_t20944.
DR   EnsemblGenomes-Gn; BSn5_t20946.
DR   EnsemblGenomes-Gn; BSn5_t20948.
DR   EnsemblGenomes-Gn; BSn5_t20950.
DR   EnsemblGenomes-Gn; BSn5_t20952.
DR   EnsemblGenomes-Gn; BSn5_t20954.
DR   EnsemblGenomes-Gn; BSn5_t20956.
DR   EnsemblGenomes-Gn; BSn5_t20958.
DR   EnsemblGenomes-Gn; BSn5_t20960.
DR   EnsemblGenomes-Gn; BSn5_t20962.
DR   EnsemblGenomes-Gn; BSn5_t20964.
DR   EnsemblGenomes-Gn; BSn5_t20966.
DR   EnsemblGenomes-Gn; BSn5_t20968.
DR   EnsemblGenomes-Gn; BSn5_t20970.
DR   EnsemblGenomes-Gn; BSn5_t20972.
DR   EnsemblGenomes-Gn; BSn5_t20974.
DR   EnsemblGenomes-Gn; BSn5_t20976.
DR   EnsemblGenomes-Gn; BSn5_t20978.
DR   EnsemblGenomes-Gn; BSn5_t20980.
DR   EnsemblGenomes-Gn; BSn5_t20982.
DR   EnsemblGenomes-Gn; BSn5_t20984.
DR   EnsemblGenomes-Gn; BSn5_t20986.
DR   EnsemblGenomes-Gn; BSn5_t20988.
DR   EnsemblGenomes-Gn; BSn5_t20990.
DR   EnsemblGenomes-Gn; BSn5_t20992.
DR   EnsemblGenomes-Gn; BSn5_t20994.
DR   EnsemblGenomes-Gn; BSn5_t20996.
DR   EnsemblGenomes-Gn; BSn5_t20998.
DR   EnsemblGenomes-Gn; BSn5_t21000.
DR   EnsemblGenomes-Gn; BSn5_t21002.
DR   EnsemblGenomes-Gn; BSn5_t21004.
DR   EnsemblGenomes-Gn; BSn5_t21006.
DR   EnsemblGenomes-Gn; BSn5_t21008.
DR   EnsemblGenomes-Gn; BSn5_t21010.
DR   EnsemblGenomes-Gn; BSn5_t21012.
DR   EnsemblGenomes-Gn; BSn5_t21014.
DR   EnsemblGenomes-Gn; BSn5_t21016.
DR   EnsemblGenomes-Gn; BSn5_t21018.
DR   EnsemblGenomes-Gn; BSn5_t21020.
DR   EnsemblGenomes-Gn; BSn5_t21022.
DR   EnsemblGenomes-Gn; BSn5_t21024.
DR   EnsemblGenomes-Gn; BSn5_t21026.
DR   EnsemblGenomes-Gn; BSn5_t21028.
DR   EnsemblGenomes-Gn; BSn5_t21030.
DR   EnsemblGenomes-Gn; BSn5_t21032.
DR   EnsemblGenomes-Gn; BSn5_t21034.
DR   EnsemblGenomes-Gn; BSn5_t21036.
DR   EnsemblGenomes-Gn; BSn5_t21038.
DR   EnsemblGenomes-Gn; BSn5_t21040.
DR   EnsemblGenomes-Gn; BSn5_t21042.
DR   EnsemblGenomes-Gn; BSn5_t21044.
DR   EnsemblGenomes-Gn; BSn5_t21046.
DR   EnsemblGenomes-Gn; BSn5_t21048.
DR   EnsemblGenomes-Gn; BSn5_t21050.
DR   EnsemblGenomes-Gn; BSn5_t21052.
DR   EnsemblGenomes-Gn; BSn5_t21054.
DR   EnsemblGenomes-Gn; BSn5_t21056.
DR   EnsemblGenomes-Gn; EBG00001100340.
DR   EnsemblGenomes-Gn; EBG00001100341.
DR   EnsemblGenomes-Gn; EBG00001100342.
DR   EnsemblGenomes-Gn; EBG00001100343.
DR   EnsemblGenomes-Gn; EBG00001100344.
DR   EnsemblGenomes-Gn; EBG00001100345.
DR   EnsemblGenomes-Gn; EBG00001100346.
DR   EnsemblGenomes-Gn; EBG00001100347.
DR   EnsemblGenomes-Gn; EBG00001100348.
DR   EnsemblGenomes-Gn; EBG00001100349.
DR   EnsemblGenomes-Gn; EBG00001100350.
DR   EnsemblGenomes-Gn; EBG00001100351.
DR   EnsemblGenomes-Gn; EBG00001100352.
DR   EnsemblGenomes-Gn; EBG00001100353.
DR   EnsemblGenomes-Gn; EBG00001100354.
DR   EnsemblGenomes-Gn; EBG00001100355.
DR   EnsemblGenomes-Gn; EBG00001100356.
DR   EnsemblGenomes-Gn; EBG00001100357.
DR   EnsemblGenomes-Gn; EBG00001100358.
DR   EnsemblGenomes-Gn; EBG00001100359.
DR   EnsemblGenomes-Gn; EBG00001100360.
DR   EnsemblGenomes-Gn; EBG00001100361.
DR   EnsemblGenomes-Gn; EBG00001100362.
DR   EnsemblGenomes-Gn; EBG00001100363.
DR   EnsemblGenomes-Gn; EBG00001100364.
DR   EnsemblGenomes-Gn; EBG00001100365.
DR   EnsemblGenomes-Gn; EBG00001100366.
DR   EnsemblGenomes-Gn; EBG00001100367.
DR   EnsemblGenomes-Gn; EBG00001100368.
DR   EnsemblGenomes-Gn; EBG00001100369.
DR   EnsemblGenomes-Gn; EBG00001100370.
DR   EnsemblGenomes-Gn; EBG00001100371.
DR   EnsemblGenomes-Gn; EBG00001100372.
DR   EnsemblGenomes-Gn; EBG00001100373.
DR   EnsemblGenomes-Gn; EBG00001100374.
DR   EnsemblGenomes-Gn; EBG00001100375.
DR   EnsemblGenomes-Gn; EBG00001100376.
DR   EnsemblGenomes-Gn; EBG00001100377.
DR   EnsemblGenomes-Gn; EBG00001100378.
DR   EnsemblGenomes-Gn; EBG00001100379.
DR   EnsemblGenomes-Gn; EBG00001100380.
DR   EnsemblGenomes-Gn; EBG00001100381.
DR   EnsemblGenomes-Gn; EBG00001100382.
DR   EnsemblGenomes-Gn; EBG00001100383.
DR   EnsemblGenomes-Gn; EBG00001100384.
DR   EnsemblGenomes-Gn; EBG00001100385.
DR   EnsemblGenomes-Gn; EBG00001100386.
DR   EnsemblGenomes-Gn; EBG00001100387.
DR   EnsemblGenomes-Gn; EBG00001100388.
DR   EnsemblGenomes-Gn; EBG00001100389.
DR   EnsemblGenomes-Gn; EBG00001100390.
DR   EnsemblGenomes-Gn; EBG00001100391.
DR   EnsemblGenomes-Gn; EBG00001100392.
DR   EnsemblGenomes-Gn; EBG00001100393.
DR   EnsemblGenomes-Gn; EBG00001100394.
DR   EnsemblGenomes-Gn; EBG00001100395.
DR   EnsemblGenomes-Gn; EBG00001100396.
DR   EnsemblGenomes-Gn; EBG00001100397.
DR   EnsemblGenomes-Gn; EBG00001100398.
DR   EnsemblGenomes-Gn; EBG00001100399.
DR   EnsemblGenomes-Gn; EBG00001100400.
DR   EnsemblGenomes-Gn; EBG00001100401.
DR   EnsemblGenomes-Gn; EBG00001100402.
DR   EnsemblGenomes-Gn; EBG00001100403.
DR   EnsemblGenomes-Gn; EBG00001100404.
DR   EnsemblGenomes-Gn; EBG00001100405.
DR   EnsemblGenomes-Gn; EBG00001100406.
DR   EnsemblGenomes-Gn; EBG00001100407.
DR   EnsemblGenomes-Gn; EBG00001100408.
DR   EnsemblGenomes-Gn; EBG00001100409.
DR   EnsemblGenomes-Gn; EBG00001100410.
DR   EnsemblGenomes-Gn; EBG00001100411.
DR   EnsemblGenomes-Gn; EBG00001100412.
DR   EnsemblGenomes-Gn; EBG00001100413.
DR   EnsemblGenomes-Gn; EBG00001100414.
DR   EnsemblGenomes-Gn; EBG00001100415.
DR   EnsemblGenomes-Gn; EBG00001100416.
DR   EnsemblGenomes-Gn; EBG00001100417.
DR   EnsemblGenomes-Gn; EBG00001100418.
DR   EnsemblGenomes-Gn; EBG00001100419.
DR   EnsemblGenomes-Gn; EBG00001100420.
DR   EnsemblGenomes-Gn; EBG00001100421.
DR   EnsemblGenomes-Gn; EBG00001100422.
DR   EnsemblGenomes-Gn; EBG00001100423.
DR   EnsemblGenomes-Gn; EBG00001100424.
DR   EnsemblGenomes-Gn; EBG00001100425.
DR   EnsemblGenomes-Gn; EBG00001100426.
DR   EnsemblGenomes-Gn; EBG00001100427.
DR   EnsemblGenomes-Gn; EBG00001100428.
DR   EnsemblGenomes-Gn; EBG00001100429.
DR   EnsemblGenomes-Gn; EBG00001100430.
DR   EnsemblGenomes-Gn; EBG00001100431.
DR   EnsemblGenomes-Gn; EBG00001100432.
DR   EnsemblGenomes-Gn; EBG00001100433.
DR   EnsemblGenomes-Gn; EBG00001100434.
DR   EnsemblGenomes-Gn; EBG00001100435.
DR   EnsemblGenomes-Gn; EBG00001100436.
DR   EnsemblGenomes-Gn; EBG00001100437.
DR   EnsemblGenomes-Gn; EBG00001100438.
DR   EnsemblGenomes-Gn; EBG00001100439.
DR   EnsemblGenomes-Gn; EBG00001100440.
DR   EnsemblGenomes-Gn; EBG00001100441.
DR   EnsemblGenomes-Gn; EBG00001100442.
DR   EnsemblGenomes-Gn; EBG00001100443.
DR   EnsemblGenomes-Gn; EBG00001100444.
DR   EnsemblGenomes-Gn; EBG00001100445.
DR   EnsemblGenomes-Gn; EBG00001100446.
DR   EnsemblGenomes-Gn; EBG00001100447.
DR   EnsemblGenomes-Gn; EBG00001100448.
DR   EnsemblGenomes-Gn; EBG00001100449.
DR   EnsemblGenomes-Gn; EBG00001100450.
DR   EnsemblGenomes-Gn; EBG00001100451.
DR   EnsemblGenomes-Gn; EBG00001100452.
DR   EnsemblGenomes-Gn; EBG00001100453.
DR   EnsemblGenomes-Gn; EBG00001100454.
DR   EnsemblGenomes-Gn; EBG00001100455.
DR   EnsemblGenomes-Gn; EBG00001100456.
DR   EnsemblGenomes-Gn; EBG00001100457.
DR   EnsemblGenomes-Gn; EBG00001100458.
DR   EnsemblGenomes-Gn; EBG00001100459.
DR   EnsemblGenomes-Gn; EBG00001100460.
DR   EnsemblGenomes-Gn; EBG00001100461.
DR   EnsemblGenomes-Gn; EBG00001100462.
DR   EnsemblGenomes-Gn; EBG00001100463.
DR   EnsemblGenomes-Gn; EBG00001100464.
DR   EnsemblGenomes-Gn; EBG00001100465.
DR   EnsemblGenomes-Gn; EBG00001100466.
DR   EnsemblGenomes-Gn; EBG00001100467.
DR   EnsemblGenomes-Gn; EBG00001100468.
DR   EnsemblGenomes-Gn; EBG00001100469.
DR   EnsemblGenomes-Gn; EBG00001100470.
DR   EnsemblGenomes-Gn; EBG00001100471.
DR   EnsemblGenomes-Gn; EBG00001100472.
DR   EnsemblGenomes-Gn; EBG00001100473.
DR   EnsemblGenomes-Gn; EBG00001100474.
DR   EnsemblGenomes-Gn; EBG00001100475.
DR   EnsemblGenomes-Gn; EBG00001100476.
DR   EnsemblGenomes-Gn; EBG00001100477.
DR   EnsemblGenomes-Gn; EBG00001100478.
DR   EnsemblGenomes-Gn; EBG00001100479.
DR   EnsemblGenomes-Gn; EBG00001100480.
DR   EnsemblGenomes-Gn; EBG00001100481.
DR   EnsemblGenomes-Gn; EBG00001100482.
DR   EnsemblGenomes-Gn; EBG00001100483.
DR   EnsemblGenomes-Gn; EBG00001100484.
DR   EnsemblGenomes-Gn; EBG00001100485.
DR   EnsemblGenomes-Gn; EBG00001100486.
DR   EnsemblGenomes-Gn; EBG00001100487.
DR   EnsemblGenomes-Gn; EBG00001100488.
DR   EnsemblGenomes-Gn; EBG00001100489.
DR   EnsemblGenomes-Gn; EBG00001100490.
DR   EnsemblGenomes-Gn; EBG00001100491.
DR   EnsemblGenomes-Gn; EBG00001100492.
DR   EnsemblGenomes-Gn; EBG00001100493.
DR   EnsemblGenomes-Gn; EBG00001100494.
DR   EnsemblGenomes-Gn; EBG00001100495.
DR   EnsemblGenomes-Gn; EBG00001100496.
DR   EnsemblGenomes-Gn; EBG00001100497.
DR   EnsemblGenomes-Gn; EBG00001100498.
DR   EnsemblGenomes-Gn; EBG00001100499.
DR   EnsemblGenomes-Gn; EBG00001100500.
DR   EnsemblGenomes-Gn; EBG00001100501.
DR   EnsemblGenomes-Gn; EBG00001100502.
DR   EnsemblGenomes-Gn; EBG00001100503.
DR   EnsemblGenomes-Gn; EBG00001100504.
DR   EnsemblGenomes-Gn; EBG00001100505.
DR   EnsemblGenomes-Gn; EBG00001100506.
DR   EnsemblGenomes-Gn; EBG00001100507.
DR   EnsemblGenomes-Gn; EBG00001100508.
DR   EnsemblGenomes-Gn; EBG00001100509.
DR   EnsemblGenomes-Gn; EBG00001100510.
DR   EnsemblGenomes-Gn; EBG00001100511.
DR   EnsemblGenomes-Gn; EBG00001100512.
DR   EnsemblGenomes-Gn; EBG00001100513.
DR   EnsemblGenomes-Gn; EBG00001100514.
DR   EnsemblGenomes-Gn; EBG00001100515.
DR   EnsemblGenomes-Tr; BSn5_r21058-1.
DR   EnsemblGenomes-Tr; BSn5_r21060-1.
DR   EnsemblGenomes-Tr; BSn5_r21062-1.
DR   EnsemblGenomes-Tr; BSn5_r21064-1.
DR   EnsemblGenomes-Tr; BSn5_r21066-1.
DR   EnsemblGenomes-Tr; BSn5_r21068-1.
DR   EnsemblGenomes-Tr; BSn5_r21070-1.
DR   EnsemblGenomes-Tr; BSn5_r21072-1.
DR   EnsemblGenomes-Tr; BSn5_r21074-1.
DR   EnsemblGenomes-Tr; BSn5_r21076-1.
DR   EnsemblGenomes-Tr; BSn5_r21078-1.
DR   EnsemblGenomes-Tr; BSn5_r21080-1.
DR   EnsemblGenomes-Tr; BSn5_r21082-1.
DR   EnsemblGenomes-Tr; BSn5_r21084-1.
DR   EnsemblGenomes-Tr; BSn5_r21086-1.
DR   EnsemblGenomes-Tr; BSn5_r21088-1.
DR   EnsemblGenomes-Tr; BSn5_r21090-1.
DR   EnsemblGenomes-Tr; BSn5_r21092-1.
DR   EnsemblGenomes-Tr; BSn5_r21094-1.
DR   EnsemblGenomes-Tr; BSn5_r21096-1.
DR   EnsemblGenomes-Tr; BSn5_r21098-1.
DR   EnsemblGenomes-Tr; BSn5_r21100-1.
DR   EnsemblGenomes-Tr; BSn5_r21102-1.
DR   EnsemblGenomes-Tr; BSn5_r21104-1.
DR   EnsemblGenomes-Tr; BSn5_r21106-1.
DR   EnsemblGenomes-Tr; BSn5_r21108-1.
DR   EnsemblGenomes-Tr; BSn5_r21110-1.
DR   EnsemblGenomes-Tr; BSn5_r21112-1.
DR   EnsemblGenomes-Tr; BSn5_r21114-1.
DR   EnsemblGenomes-Tr; BSn5_r21116-1.
DR   EnsemblGenomes-Tr; BSn5_t20892-1.
DR   EnsemblGenomes-Tr; BSn5_t20894-1.
DR   EnsemblGenomes-Tr; BSn5_t20896-1.
DR   EnsemblGenomes-Tr; BSn5_t20898-1.
DR   EnsemblGenomes-Tr; BSn5_t20900-1.
DR   EnsemblGenomes-Tr; BSn5_t20902-1.
DR   EnsemblGenomes-Tr; BSn5_t20904-1.
DR   EnsemblGenomes-Tr; BSn5_t20906-1.
DR   EnsemblGenomes-Tr; BSn5_t20908-1.
DR   EnsemblGenomes-Tr; BSn5_t20910-1.
DR   EnsemblGenomes-Tr; BSn5_t20912-1.
DR   EnsemblGenomes-Tr; BSn5_t20914-1.
DR   EnsemblGenomes-Tr; BSn5_t20916-1.
DR   EnsemblGenomes-Tr; BSn5_t20918-1.
DR   EnsemblGenomes-Tr; BSn5_t20920-1.
DR   EnsemblGenomes-Tr; BSn5_t20922-1.
DR   EnsemblGenomes-Tr; BSn5_t20924-1.
DR   EnsemblGenomes-Tr; BSn5_t20926-1.
DR   EnsemblGenomes-Tr; BSn5_t20928-1.
DR   EnsemblGenomes-Tr; BSn5_t20930-1.
DR   EnsemblGenomes-Tr; BSn5_t20932-1.
DR   EnsemblGenomes-Tr; BSn5_t20934-1.
DR   EnsemblGenomes-Tr; BSn5_t20936-1.
DR   EnsemblGenomes-Tr; BSn5_t20938-1.
DR   EnsemblGenomes-Tr; BSn5_t20940-1.
DR   EnsemblGenomes-Tr; BSn5_t20942-1.
DR   EnsemblGenomes-Tr; BSn5_t20944-1.
DR   EnsemblGenomes-Tr; BSn5_t20946-1.
DR   EnsemblGenomes-Tr; BSn5_t20948-1.
DR   EnsemblGenomes-Tr; BSn5_t20950-1.
DR   EnsemblGenomes-Tr; BSn5_t20952-1.
DR   EnsemblGenomes-Tr; BSn5_t20954-1.
DR   EnsemblGenomes-Tr; BSn5_t20956-1.
DR   EnsemblGenomes-Tr; BSn5_t20958-1.
DR   EnsemblGenomes-Tr; BSn5_t20960-1.
DR   EnsemblGenomes-Tr; BSn5_t20962-1.
DR   EnsemblGenomes-Tr; BSn5_t20964-1.
DR   EnsemblGenomes-Tr; BSn5_t20966-1.
DR   EnsemblGenomes-Tr; BSn5_t20968-1.
DR   EnsemblGenomes-Tr; BSn5_t20970-1.
DR   EnsemblGenomes-Tr; BSn5_t20972-1.
DR   EnsemblGenomes-Tr; BSn5_t20974-1.
DR   EnsemblGenomes-Tr; BSn5_t20976-1.
DR   EnsemblGenomes-Tr; BSn5_t20978-1.
DR   EnsemblGenomes-Tr; BSn5_t20980-1.
DR   EnsemblGenomes-Tr; BSn5_t20982-1.
DR   EnsemblGenomes-Tr; BSn5_t20984-1.
DR   EnsemblGenomes-Tr; BSn5_t20986-1.
DR   EnsemblGenomes-Tr; BSn5_t20988-1.
DR   EnsemblGenomes-Tr; BSn5_t20990-1.
DR   EnsemblGenomes-Tr; BSn5_t20992-1.
DR   EnsemblGenomes-Tr; BSn5_t20994-1.
DR   EnsemblGenomes-Tr; BSn5_t20996-1.
DR   EnsemblGenomes-Tr; BSn5_t20998-1.
DR   EnsemblGenomes-Tr; BSn5_t21000-1.
DR   EnsemblGenomes-Tr; BSn5_t21002-1.
DR   EnsemblGenomes-Tr; BSn5_t21004-1.
DR   EnsemblGenomes-Tr; BSn5_t21006-1.
DR   EnsemblGenomes-Tr; BSn5_t21008-1.
DR   EnsemblGenomes-Tr; BSn5_t21010-1.
DR   EnsemblGenomes-Tr; BSn5_t21012-1.
DR   EnsemblGenomes-Tr; BSn5_t21014-1.
DR   EnsemblGenomes-Tr; BSn5_t21016-1.
DR   EnsemblGenomes-Tr; BSn5_t21018-1.
DR   EnsemblGenomes-Tr; BSn5_t21020-1.
DR   EnsemblGenomes-Tr; BSn5_t21022-1.
DR   EnsemblGenomes-Tr; BSn5_t21024-1.
DR   EnsemblGenomes-Tr; BSn5_t21026-1.
DR   EnsemblGenomes-Tr; BSn5_t21028-1.
DR   EnsemblGenomes-Tr; BSn5_t21030-1.
DR   EnsemblGenomes-Tr; BSn5_t21032-1.
DR   EnsemblGenomes-Tr; BSn5_t21034-1.
DR   EnsemblGenomes-Tr; BSn5_t21036-1.
DR   EnsemblGenomes-Tr; BSn5_t21038-1.
DR   EnsemblGenomes-Tr; BSn5_t21040-1.
DR   EnsemblGenomes-Tr; BSn5_t21042-1.
DR   EnsemblGenomes-Tr; BSn5_t21044-1.
DR   EnsemblGenomes-Tr; BSn5_t21046-1.
DR   EnsemblGenomes-Tr; BSn5_t21048-1.
DR   EnsemblGenomes-Tr; BSn5_t21050-1.
DR   EnsemblGenomes-Tr; BSn5_t21052-1.
DR   EnsemblGenomes-Tr; BSn5_t21054-1.
DR   EnsemblGenomes-Tr; BSn5_t21056-1.
DR   EnsemblGenomes-Tr; EBT00001554323.
DR   EnsemblGenomes-Tr; EBT00001554324.
DR   EnsemblGenomes-Tr; EBT00001554325.
DR   EnsemblGenomes-Tr; EBT00001554326.
DR   EnsemblGenomes-Tr; EBT00001554327.
DR   EnsemblGenomes-Tr; EBT00001554328.
DR   EnsemblGenomes-Tr; EBT00001554329.
DR   EnsemblGenomes-Tr; EBT00001554330.
DR   EnsemblGenomes-Tr; EBT00001554331.
DR   EnsemblGenomes-Tr; EBT00001554332.
DR   EnsemblGenomes-Tr; EBT00001554333.
DR   EnsemblGenomes-Tr; EBT00001554334.
DR   EnsemblGenomes-Tr; EBT00001554335.
DR   EnsemblGenomes-Tr; EBT00001554336.
DR   EnsemblGenomes-Tr; EBT00001554337.
DR   EnsemblGenomes-Tr; EBT00001554338.
DR   EnsemblGenomes-Tr; EBT00001554339.
DR   EnsemblGenomes-Tr; EBT00001554340.
DR   EnsemblGenomes-Tr; EBT00001554341.
DR   EnsemblGenomes-Tr; EBT00001554342.
DR   EnsemblGenomes-Tr; EBT00001554343.
DR   EnsemblGenomes-Tr; EBT00001554344.
DR   EnsemblGenomes-Tr; EBT00001554345.
DR   EnsemblGenomes-Tr; EBT00001554346.
DR   EnsemblGenomes-Tr; EBT00001554347.
DR   EnsemblGenomes-Tr; EBT00001554348.
DR   EnsemblGenomes-Tr; EBT00001554349.
DR   EnsemblGenomes-Tr; EBT00001554350.
DR   EnsemblGenomes-Tr; EBT00001554351.
DR   EnsemblGenomes-Tr; EBT00001554352.
DR   EnsemblGenomes-Tr; EBT00001554353.
DR   EnsemblGenomes-Tr; EBT00001554354.
DR   EnsemblGenomes-Tr; EBT00001554355.
DR   EnsemblGenomes-Tr; EBT00001554356.
DR   EnsemblGenomes-Tr; EBT00001554357.
DR   EnsemblGenomes-Tr; EBT00001554358.
DR   EnsemblGenomes-Tr; EBT00001554359.
DR   EnsemblGenomes-Tr; EBT00001554360.
DR   EnsemblGenomes-Tr; EBT00001554361.
DR   EnsemblGenomes-Tr; EBT00001554362.
DR   EnsemblGenomes-Tr; EBT00001554363.
DR   EnsemblGenomes-Tr; EBT00001554364.
DR   EnsemblGenomes-Tr; EBT00001554366.
DR   EnsemblGenomes-Tr; EBT00001554367.
DR   EnsemblGenomes-Tr; EBT00001554368.
DR   EnsemblGenomes-Tr; EBT00001554369.
DR   EnsemblGenomes-Tr; EBT00001554370.
DR   EnsemblGenomes-Tr; EBT00001554371.
DR   EnsemblGenomes-Tr; EBT00001554372.
DR   EnsemblGenomes-Tr; EBT00001554373.
DR   EnsemblGenomes-Tr; EBT00001554374.
DR   EnsemblGenomes-Tr; EBT00001554375.
DR   EnsemblGenomes-Tr; EBT00001554376.
DR   EnsemblGenomes-Tr; EBT00001554377.
DR   EnsemblGenomes-Tr; EBT00001554378.
DR   EnsemblGenomes-Tr; EBT00001554379.
DR   EnsemblGenomes-Tr; EBT00001554380.
DR   EnsemblGenomes-Tr; EBT00001554381.
DR   EnsemblGenomes-Tr; EBT00001554382.
DR   EnsemblGenomes-Tr; EBT00001554383.
DR   EnsemblGenomes-Tr; EBT00001554384.
DR   EnsemblGenomes-Tr; EBT00001554385.
DR   EnsemblGenomes-Tr; EBT00001554386.
DR   EnsemblGenomes-Tr; EBT00001554387.
DR   EnsemblGenomes-Tr; EBT00001554388.
DR   EnsemblGenomes-Tr; EBT00001554389.
DR   EnsemblGenomes-Tr; EBT00001554390.
DR   EnsemblGenomes-Tr; EBT00001554391.
DR   EnsemblGenomes-Tr; EBT00001554392.
DR   EnsemblGenomes-Tr; EBT00001554393.
DR   EnsemblGenomes-Tr; EBT00001554394.
DR   EnsemblGenomes-Tr; EBT00001554395.
DR   EnsemblGenomes-Tr; EBT00001554396.
DR   EnsemblGenomes-Tr; EBT00001554397.
DR   EnsemblGenomes-Tr; EBT00001554398.
DR   EnsemblGenomes-Tr; EBT00001554399.
DR   EnsemblGenomes-Tr; EBT00001554400.
DR   EnsemblGenomes-Tr; EBT00001554401.
DR   EnsemblGenomes-Tr; EBT00001554402.
DR   EnsemblGenomes-Tr; EBT00001554403.
DR   EnsemblGenomes-Tr; EBT00001554404.
DR   EnsemblGenomes-Tr; EBT00001554405.
DR   EnsemblGenomes-Tr; EBT00001554406.
DR   EnsemblGenomes-Tr; EBT00001554407.
DR   EnsemblGenomes-Tr; EBT00001554408.
DR   EnsemblGenomes-Tr; EBT00001554409.
DR   EnsemblGenomes-Tr; EBT00001554410.
DR   EnsemblGenomes-Tr; EBT00001554411.
DR   EnsemblGenomes-Tr; EBT00001554412.
DR   EnsemblGenomes-Tr; EBT00001554413.
DR   EnsemblGenomes-Tr; EBT00001554414.
DR   EnsemblGenomes-Tr; EBT00001554415.
DR   EnsemblGenomes-Tr; EBT00001554416.
DR   EnsemblGenomes-Tr; EBT00001554417.
DR   EnsemblGenomes-Tr; EBT00001554418.
DR   EnsemblGenomes-Tr; EBT00001554419.
DR   EnsemblGenomes-Tr; EBT00001554420.
DR   EnsemblGenomes-Tr; EBT00001554421.
DR   EnsemblGenomes-Tr; EBT00001554422.
DR   EnsemblGenomes-Tr; EBT00001554423.
DR   EnsemblGenomes-Tr; EBT00001554424.
DR   EnsemblGenomes-Tr; EBT00001554425.
DR   EnsemblGenomes-Tr; EBT00001554426.
DR   EnsemblGenomes-Tr; EBT00001554427.
DR   EnsemblGenomes-Tr; EBT00001554428.
DR   EnsemblGenomes-Tr; EBT00001554429.
DR   EnsemblGenomes-Tr; EBT00001554430.
DR   EnsemblGenomes-Tr; EBT00001554431.
DR   EnsemblGenomes-Tr; EBT00001554432.
DR   EnsemblGenomes-Tr; EBT00001554433.
DR   EnsemblGenomes-Tr; EBT00001554434.
DR   EnsemblGenomes-Tr; EBT00001554435.
DR   EnsemblGenomes-Tr; EBT00001554436.
DR   EnsemblGenomes-Tr; EBT00001554437.
DR   EnsemblGenomes-Tr; EBT00001554438.
DR   EnsemblGenomes-Tr; EBT00001554439.
DR   EnsemblGenomes-Tr; EBT00001554440.
DR   EnsemblGenomes-Tr; EBT00001554441.
DR   EnsemblGenomes-Tr; EBT00001554442.
DR   EnsemblGenomes-Tr; EBT00001554443.
DR   EnsemblGenomes-Tr; EBT00001554444.
DR   EnsemblGenomes-Tr; EBT00001554445.
DR   EnsemblGenomes-Tr; EBT00001554446.
DR   EnsemblGenomes-Tr; EBT00001554447.
DR   EnsemblGenomes-Tr; EBT00001554448.
DR   EnsemblGenomes-Tr; EBT00001554449.
DR   EnsemblGenomes-Tr; EBT00001554450.
DR   EnsemblGenomes-Tr; EBT00001554451.
DR   EnsemblGenomes-Tr; EBT00001554452.
DR   EnsemblGenomes-Tr; EBT00001554453.
DR   EnsemblGenomes-Tr; EBT00001554454.
DR   EnsemblGenomes-Tr; EBT00001554455.
DR   EnsemblGenomes-Tr; EBT00001554456.
DR   EnsemblGenomes-Tr; EBT00001554457.
DR   EnsemblGenomes-Tr; EBT00001554458.
DR   EnsemblGenomes-Tr; EBT00001554459.
DR   EnsemblGenomes-Tr; EBT00001554460.
DR   EnsemblGenomes-Tr; EBT00001554461.
DR   EnsemblGenomes-Tr; EBT00001554462.
DR   EnsemblGenomes-Tr; EBT00001554463.
DR   EnsemblGenomes-Tr; EBT00001554464.
DR   EnsemblGenomes-Tr; EBT00001554465.
DR   EnsemblGenomes-Tr; EBT00001554466.
DR   EnsemblGenomes-Tr; EBT00001554467.
DR   EnsemblGenomes-Tr; EBT00001554468.
DR   EnsemblGenomes-Tr; EBT00001554469.
DR   EnsemblGenomes-Tr; EBT00001554470.
DR   EnsemblGenomes-Tr; EBT00001554472.
DR   EnsemblGenomes-Tr; EBT00001554473.
DR   EnsemblGenomes-Tr; EBT00001554474.
DR   EnsemblGenomes-Tr; EBT00001554475.
DR   EnsemblGenomes-Tr; EBT00001554476.
DR   EnsemblGenomes-Tr; EBT00001554477.
DR   EnsemblGenomes-Tr; EBT00001554478.
DR   EnsemblGenomes-Tr; EBT00001554479.
DR   EnsemblGenomes-Tr; EBT00001554480.
DR   EnsemblGenomes-Tr; EBT00001554481.
DR   EnsemblGenomes-Tr; EBT00001554482.
DR   EnsemblGenomes-Tr; EBT00001554485.
DR   EnsemblGenomes-Tr; EBT00001554487.
DR   EnsemblGenomes-Tr; EBT00001554488.
DR   EnsemblGenomes-Tr; EBT00001554489.
DR   EnsemblGenomes-Tr; EBT00001554490.
DR   EnsemblGenomes-Tr; EBT00001554491.
DR   EnsemblGenomes-Tr; EBT00001554492.
DR   EnsemblGenomes-Tr; EBT00001554493.
DR   EnsemblGenomes-Tr; EBT00001554494.
DR   EnsemblGenomes-Tr; EBT00001554495.
DR   EnsemblGenomes-Tr; EBT00001554496.
DR   EnsemblGenomes-Tr; EBT00001554497.
DR   EnsemblGenomes-Tr; EBT00001554498.
DR   EnsemblGenomes-Tr; EBT00001554499.
DR   EnsemblGenomes-Tr; EBT00001554500.
DR   EnsemblGenomes-Tr; EBT00001554501.
DR   EnsemblGenomes-Tr; EBT00001554502.
DR   EnsemblGenomes-Tr; EBT00001554503.
DR   EuropePMC; PMC3133036; 21317323.
DR   EuropePMC; PMC3156400.
DR   EuropePMC; PMC3193587; 21840319.
DR   EuropePMC; PMC3516659; 24293722.
DR   EuropePMC; PMC4012836; 24808911.
DR   EuropePMC; PMC5169363; 28066362.
DR   EuropePMC; PMC5585990; 28039230.
DR   EuropePMC; PMC5640789; 29062941.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00106; RNAI.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02273; FsrA.
DR   SILVA-LSU; CP002468.
DR   SILVA-SSU; CP002468.
XX
CC   Annotation was added by the NCBI Prokaryotic Genomes Automatic
CC   Annotation Pipeline Group. Information about the Pipeline can be
CC   found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
CC   aware that the annotation is done automatically with little or no
CC   manual curation.
CC   BSn5 strain is available from State Key Laboratory of Agricultural
CC   Microbiology, College of Life Science and Technology, Huazhong
CC   Agricultural University, Wuhan, Hubei 430070, P.R.China, 430070,
CC   professor Ming Sun (m98sun@mail.hzau.edu.cn), tel: 86-27-87283455,
CC   FAX: 86-27-87280670.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4093599
FT                   /organism="Bacillus subtilis BSn5"
FT                   /strain="BSn5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:936156"
FT                   /culture_collection="CCTCC:M207124"
FT   gene            join(4093332..4093599,1..1694)
FT                   /locus_tag="BSn5_00005"
FT   CDS_pept        join(4093341..4093599,1..1694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00005"
FT                   /product="GXT repeat-containing collagen-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92637"
FT                   /protein_id="ADV92637.1"
FT                   /translation="MVPTLQTGPTGATGATGVTGETGATGVTVSTGETGATGATGATGA
FT                   TGATGLTGATGATGLSGATGSSGVTGSTGLTGETGATGVTGPTGETGATGLTGATGATG
FT                   ATGVTGPTGLTGPTGLTGSTGPTGPTGETGATGSTGATGATGETGATGATGVTGATGAT
FT                   GATGETGATGATGATGATGVTGVTGPTGETGATGVAGLTGPTGETGATGVTGATGVTGA
FT                   TGVTGLTGLTGPTGPTGPTGPTGETGATGVTGATGVTGATGVTGLTGLTGPTGPTGPTG
FT                   PTGETGATGSTGLTGPTGLTGSTGPTGPTGETGATGSTGLTGPTGLTGSTGPTGPTGET
FT                   GATGSTGLTGPTGLTGSTGPTGPTGETGATGSTGLTGPTGLTGSTGPTGPTGETGATGS
FT                   TGLTGPTGLTGSTGPTGPTGETGATGSTGLTGPTGLTGSTGPTGPTGETGATGVTGPTG
FT                   ATGATGVTGATGETGATGSTGSTGETGATGSTGATGSTGVTGVTGPTGATGVTGPTGST
FT                   GANPQLFYSEIAGPVPLAINGTETSIGTLSVPTVAGQLIKLDLAISVDVTTTANSNFTF
FT                   QTRIYRNGVLVDTRSVQRNINAAITSRFPIATTYVDATTVTGTTSYEIRIIFTTVSNVS
FT                   GSNALNLDINAIRFP"
FT   gene            complement(1798..2469)
FT                   /locus_tag="BSn5_00010"
FT   CDS_pept        complement(1798..2469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00010"
FT                   /product="glycosyl transferase family protein"
FT                   /note="COG1216 Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92638"
FT                   /protein_id="ADV92638.1"
FT                   /translation="MNQHTNENSISFITCVNDDTLYDLCLRHIQSLSVPPHMKVKLINI
FT                   RDADSMASGYQAAMEDSDSKYKVYLHQDTFIINRSFIYDILHVFQQNDQLGMIGVIGAE
FT                   EVPQSGIWWEASKKAGKVIEYRSTYNYLLFDEIDETVKTVQALDGLLLATQYDVPWRKD
FT                   IFDGWHLYDTSQCFEFRKKGYIVGIPHQKEPWVLHACGNEFDTNQYSYYLKKFLEEYSE
FT                   T"
FT   gene            complement(2466..3173)
FT                   /locus_tag="BSn5_00015"
FT   CDS_pept        complement(2466..3173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00015"
FT                   /product="putative methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92639"
FT                   /protein_id="ADV92639.1"
FT                   /translation="MEINKNSLADSMKEYELKDKEYYKGINWQLFDLIEPHAKTILEVG
FT                   CAEGLFGAAVKKKTNCSYYGIESYPPASEKATHYIDEVITGDIETLKLPFQKNTFDHII
FT                   FGDVLEHLIDPWAVLGNIKPYVKETGSILASIPNIGHISIFESLLSGKWTYIQAGLLDK
FT                   THFRFFTLEEMKKMFHETGYKISQIEPIVFTTHYYEKMISKLAYVRSCMGIHHADLEEE
FT                   ARAYQYVIKAEKR"
FT   gene            complement(3160..4266)
FT                   /locus_tag="BSn5_00020"
FT   CDS_pept        complement(3160..4266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00020"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92640"
FT                   /protein_id="ADV92640.1"
FT                   /translation="MISISLCMIVKNEEAVIGRCLDSVQEIADEINIVDTGSVDKTKDI
FT                   AARYTDRIFDFKWIDDFAAARNFSFQQATSDYILWLDADDVFTKKDQELLLDLKRTLDP
FT                   DIDAVSMKYHLAFDEENNVTSSLRRYRLVKREKSFKWIGAVHEYLEVYGKLHHSDAAVS
FT                   HLPLSRDADRNLRIYEKMVSSGKGFSPRDLFYYANELCDHGKMEQAIEYYLRFLQTKQG
FT                   WVEDNIRACNKLADCYHSLGLKEKELSWVLHTLVYGPPRAETCCRLGYSFLEKNDFQSA
FT                   VYWYEKAIENKGAENLAFQNRACASWLPHLQLAVCYDKLGQHQLAYQHNESALQYRPHD
FT                   SRMLANKKYFEDILKMQNGSGGEHHGNQ"
FT   gene            complement(4263..5636)
FT                   /locus_tag="BSn5_00025"
FT   CDS_pept        complement(4263..5636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00025"
FT                   /product="hypothetical protein"
FT                   /note="COG1216 Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92641"
FT                   /protein_id="ADV92641.1"
FT                   /translation="MKTSIIVLTYNQLALTKQCLESIWKHTNNDCIEVIVIDNGSHDGT
FT                   RDYLKQITSIKAIFNKTNEGFAKACNQGLEVASGDNILFLNNDTVVTNQWLEPMIKLLY
FT                   QDDKIGMVGPVSNYVSGPQQVPVNYTNVEEIEDFSRLYCLQQRGRSKAVLRLVGFCLLV
FT                   KKKVLDEVGGFDERFVGGSFEDDDLSLRVLQAGYQLKIALDSFVHHHGHATFTGNPDLS
FT                   ISQLYEENRQRFIDKWKVDVTTFFDSQPQLTALVPAEADSILHIGCGTGAAGTELLNRQ
FT                   SCLLYGIEKDELLQTIASPYYEQVISADVETCDLPYPESFFDVILIGDLLNCSKNPRHT
FT                   IETLAVYLKPSGSLICSIPNTAYADTFFSLLCGASTYTHFITPRNVNTLFPEYLYDIKS
FT                   ITSHSSDTESNIQLFLQELQFLAGQFGLSLDHLSKHAHIDYMFVHAIKKKQNKTEVAM"
FT   gene            6250..6348
FT                   /locus_tag="BSn5_00030"
FT   CDS_pept        6250..6348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92642"
FT                   /protein_id="ADV92642.1"
FT                   /translation="MDLLVYEALEFNKELLSRLFEMRRKSRNKICF"
FT   gene            complement(6403..6663)
FT                   /locus_tag="BSn5_00035"
FT   CDS_pept        complement(6403..6663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92643"
FT                   /protein_id="ADV92643.1"
FT                   /translation="MFFKITLIFLIHLNITKYYIFNIGGLVLEQMISSSKVGVKILDIL
FT                   LRKAHLKLQVEVTLLKYVLSPSKILRGDFYDLCPPVSFIGL"
FT   gene            6858..7394
FT                   /locus_tag="BSn5_00040"
FT   CDS_pept        6858..7394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00040"
FT                   /product="putative N-acetyltransferase"
FT                   /note="COG1670 Acetyltransferases, including N-acetylases
FT                   of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92644"
FT                   /protein_id="ADV92644.1"
FT                   /translation="MHITTKRLLIREFAFTDWQAVYEYTSDSNVMKYIPEGVFTEEDAK
FT                   AFVNKNKGDNAEKFPVILRDEDCLIGHIVFYKYFGEHTYEIGWVFNPNYQNKGYASEAA
FT                   QAILEYGFKEMNLHRIIATCQPDNIPSYRVMEKIGMRREGFFKKCIPKGNEWWDEYYYA
FT                   ILEEEWNCKRGNAEI"
FT   gene            7473..8375
FT                   /locus_tag="BSn5_00045"
FT   CDS_pept        7473..8375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00045"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92645"
FT                   /protein_id="ADV92645.1"
FT                   /translation="MQIHLTKSGKQDNHHKWLGTVLLSWGTFVFALFFATLVGSMASQA
FT                   GASKLLKQGIQAGLVTLITVPLLYILLKRMSSRPFYSIGLSGWRQAIPKAIMGAMYVIV
FT                   LSGSGFAIAHLLGWIKVTQFHFSVHLVSALLLNMIIAFFYEAFPEELTFRGTVYYALNK
FT                   RWNCFMALLLQPILFVLAPIIVSGLQYIAGIESPAITLDYIVLLLGFGFILQLLRIVTG
FT                   SLWTSIAFHLAFLENSRFFVLQGKERFITYEEIVPGTGALFVIFFMLLIVGTLLLIPVA
FT                   ITRRNTIQWRKNEKCDQDV"
FT   gene            8464..8844
FT                   /locus_tag="BSn5_00050"
FT   CDS_pept        8464..8844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92646"
FT                   /protein_id="ADV92646.1"
FT                   /translation="MQVLRIIFVHVLSALSAAVVYVFGIGYDGYIPYFLISVLLFIFYL
FT                   IFAAPVQYFLNRNPKRFNTKYLLIYIFFSFLVWLFFAFITDPKNTLNFLMGYEIYLFSV
FT                   SFAVIFWIWDSVFLQNIGRVAA"
FT   gene            9387..9617
FT                   /locus_tag="BSn5_00055"
FT   CDS_pept        9387..9617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00055"
FT                   /product="putative transcriptional regulator; phage SPbeta"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92647"
FT                   /protein_id="ADV92647.1"
FT                   /translation="MIKSKLKTIIDQRKISIRKLSRDIDHEYPTVRKLYNNEMERYPRE
FT                   LFDKVWPYQNIELHELLIFQKDHIPKVRMSK"
FT   gene            9614..10252
FT                   /locus_tag="BSn5_00060"
FT   CDS_pept        9614..10252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92648"
FT                   /protein_id="ADV92648.1"
FT                   /translation="MKIMEYMEERFQNLEFIPSIYNQWGIGIHFCLGENIYQLKEKEEL
FT                   NLKRFQVVYEQITIIFNELFEQNDDIFLVTNMYKHKKEKCIRKLKVYQPFLKCKNHLNQ
FT                   ILVKTYPYPFEINKAEEYEMQQFSLLCKPRDLRVTELLKAASNEDFPLKPKFGGYSIDY
FT                   PDVFFVNITKDIIFFIYDDRGCEVIALDFKRIRPLYEKYHDWVEEYKCM"
FT   gene            10386..10502
FT                   /locus_tag="BSn5_00065"
FT   CDS_pept        10386..10502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92649"
FT                   /protein_id="ADV92649.1"
FT                   /translation="MIQLVVHFKKPYADDEDWIKLSVNRKGWEISELLDFTL"
FT   gene            10521..10685
FT                   /locus_tag="BSn5_00070"
FT   CDS_pept        10521..10685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92650"
FT                   /protein_id="ADV92650.1"
FT                   /translation="MDKKKDEIQRKYREQMREKKEREKEDGSSHTFEIVVVLAIIILMF
FT                   FFNSVFKAF"
FT   gene            10815..11285
FT                   /locus_tag="BSn5_00075"
FT   CDS_pept        10815..11285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00075"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92651"
FT                   /protein_id="ADV92651.1"
FT                   /translation="MKLYNEFINIAKIFNKELDIIPLLYGSLDLEKVTGLDFSPEDIDL
FT                   LIPLIFLEEKWEKLKKVMELHGYKMVDLHEHEFKKTNTKIGIAYIEDLKPFADVDYNNL
FT                   EIFEDDGAKYYLLTIDDYLKVYNRSLLDSYRRTKKNNKDQKKINILNKLIQN"
FT   gene            11813..12118
FT                   /locus_tag="BSn5_00080"
FT   CDS_pept        11813..12118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00080"
FT                   /product="hypothetical protein"
FT                   /note="COG3153 Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92652"
FT                   /protein_id="ADV92652.1"
FT                   /translation="MEFFIRQELTHEYNTTEDIVKKAFLNEKYSDKKEHFLVNKIRKSD
FT                   AFIPELSLVALNGKEIVGPILLSRIKIVDGDNAVDSLALAPVSVAPEYQRKGSGVN"
FT   gene            13106..13222
FT                   /locus_tag="BSn5_00085"
FT   CDS_pept        13106..13222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92653"
FT                   /protein_id="ADV92653.1"
FT                   /translation="MELLNNIKNEVFILCGYRKKMNFLFTDHHLDDENALGK"
FT   gene            13345..14736
FT                   /locus_tag="BSn5_00090"
FT   CDS_pept        13345..14736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00090"
FT                   /product="putative H+-xyloside symporter"
FT                   /note="COG2211 Na+/melibiose symporter and related
FT                   transporters"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92654"
FT                   /protein_id="ADV92654.1"
FT                   /translation="MLSENVKKISMVEKVGYASGDFACNLIYATVSTYLLFFYTDVFGL
FT                   SAAAAGTMFLVVRIIDALADPFIGTIVDRTNSRFGRFRPYLLFGAFPFVILAILCFTTP
FT                   DFSDMGKLIYAYITYVGLSLTYTTINVPYGALTSAMTRNNQEVVSITSVRMLFANLGGL
FT                   VVAFFVPLLAAYLSDTSGNESLGWQLTMGILGMIGGCLLIFCFKSTKERVTLQKSEEKI
FT                   KFTDIFEQFRVNRPLVVLSIFFIIIFGVNSISNSVGIYYVTYNLEREDLVKWYGLIGSL
FT                   PALVILPFIPRLHQFLGKKKLLNYALLLNIIGLLALLFVPPSNVYLILFCRLIAAAGSL
FT                   TAGGYMWALIPETIEYGEYRTGKRMGGLIYAIIGFFFKFGMALGGVVPGLVLDKFGYVA
FT                   NQAQTPAALTGILITTTIIPVFLLVLALIDINFYNLDEKKYKNMVRELENRDKVYLDHI
FT                   DDFKA"
FT   gene            14767..16368
FT                   /locus_tag="BSn5_00095"
FT   CDS_pept        14767..16368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00095"
FT                   /product="xylan beta-1,4-xylosidase"
FT                   /note="COG3507 Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92655"
FT                   /protein_id="ADV92655.1"
FT                   /translation="MKITNPVLKGFNPDPSICRVGEDYYIAVSTFEWFPGVQIHHSKDL
FT                   VNWHLVAHPLQRVSQLDMKGNPNSGGVWAPCLSYSDGKFWLIYTDVKVVDGAWKDCHNY
FT                   LVTCETINGDWSEPITLNSSGFDASLFHDKDGKKYLLNMLWDHRIDRHSFGGIVIQEYS
FT                   DKEQKLIGKPKVIFEGTDRKLTEAPHLYHIGNYYYLLTAEGGTRYEHAATIARSANIEG
FT                   PYEVHPDNPILTSWHDPGNPLQKCGHASIVQTHTDEWYLAHLTGRPIHPDDDSIFQQRG
FT                   YCPLGRETAIQKLYWKDEWPYVVGGKEGSLEVDAPSIPETIFEATYPEVDEFEDSTLNI
FT                   NFQTLRIPFTNELGSLTQAPNHLRLFGHESLTSTFTQAFVARRWQSLHFEAETAVEFYP
FT                   ENFQQAAGLVNYYNTENWTALQVTHDEELGRILELTICDNFSFSQPLHNKIVIPREVKY
FT                   VYLRVNIEKDKYYYFYSFNKEDWHKIDIALESKKLSDDYIRGGGFFTGAFVGMQCQDTS
FT                   GNHIPADFRYFRYKEK"
FT   gene            complement(16506..17660)
FT                   /locus_tag="BSn5_00100"
FT   CDS_pept        complement(16506..17660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00100"
FT                   /product="negative transcriptional regulator"
FT                   /note="COG1940 Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92656"
FT                   /protein_id="ADV92656.1"
FT                   /translation="MDIADQTFVKKVNQKLLLKEILKNSPISRAKLSEMTGLNKSTVSS
FT                   QVNTLMKENLVFEIGQGQSSGGRRPVMLVFNKKAGYSVGIDVGVDYINGILTDLEGTIV
FT                   LDQYCHLESNSPEITKDILIDMIHHFITHMPQSPYGLIGIGICVPGLIDKDQKIVFTPN
FT                   SNWRDIDLKSSIQQKYNVPVFIENEANAGAYGEKVFGAAKNHDNIIYVSISTGIGIGVI
FT                   INNHLYRGVSGFSGEMGHMTIDFNGPKCSCGNRGCWELYASEKALLKSLQTKAKKLSYQ
FT                   DIIDLAHLNDIGTLNALQNFGFYLGIGLTNILNTFNPQAVILRNSIIESHPMVLNSMRS
FT                   EVSSRVYSQLGNSYELLPSSLGQNAPALGMSSIVIDHFLDMITM"
FT   gene            17909..19246
FT                   /locus_tag="BSn5_00105"
FT   CDS_pept        17909..19246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00105"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="COG2115 Xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92657"
FT                   /protein_id="ADV92657.1"
FT                   /translation="MAQSHSSSTNYFGSANKVVYEGKDSTNPLAFKYYNPQEVIGGKTM
FT                   KEHLRFSIAYWHTFTADGTDVFGAATMQRPWDHYKGMDLAKMRVEAAFEMLEKIDAPFF
FT                   AFHDRDIAPEGSTLKETNQNLDMIVGMIKDYMRNSGVKLLWNTANMFTNPRFVHGAATS
FT                   CNADVFAYAAAQVKKGLETAKELGAENYVFWGGREGYETLLNTDLKFELDNLARFMHMA
FT                   VDYAKEIGYTGQFLIEPKPKEPTTHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLA
FT                   GHTFEHELRMARVHGLLGSVDANQGHPLLGWDTDEFPTDLYSTTLAMYEILQNGGLGSG
FT                   GLNFDAKVRRSSFEPDDLIYAHIAGMDAFARGLKVAHKLIEDRVFEDVIQHRYRSFTEG
FT                   IGLEIIEGRANFHTLEQYALNHKLIKNESGRQEKLKAILNQYILEV"
FT   gene            19397..20896
FT                   /locus_tag="BSn5_00110"
FT   CDS_pept        19397..20896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00110"
FT                   /product="xylulokinase"
FT                   /note="COG1070 Sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92658"
FT                   /protein_id="ADV92658.1"
FT                   /translation="MKYVIGIDLGTSAVKTILVNQNGKVCAETSKRYPLIQEKAGYSEQ
FT                   NPEDWVQQTIEALAELVSISNVQAKDIDGISYSGQMHGLVLLDKDCQVLRNAILWNDTR
FT                   TTPQCIRMTEKFGDHLLDITKNRVLEGFTLPKMLWVKEHEPELFKKTAVFLLPKDYVRF
FT                   RMTGAIHTEYSDAAGTLLLHITRKEWSNDICNQIGISADICPPLVESHDCVGSLLPHVA
FT                   AKTGLLEKTKVYAGGADNACGAIGAGILSSGKTLCSIGTSGVILSYEEEKERDFKGKVH
FT                   FFNHGKKDSFYTMGVTLAAGYSLDWFKRTFAPNESFEQLLQGVEAIPIGANGLLYTPYL
FT                   VGERTPHADSSIRGSLIGMDGAHNRKHFLRAIMEGITFSLHESIELFREAGKSVHTVVS
FT                   IGGGAKNDTWLQMQADIFNTRVIKLENEQGPAMGAAMLAAFGSGWFESLEECAEQFIRE
FT                   AAAFYPKAQNVQKYKTLFDLYKNIYTHTKDLNTALKSFRKN"
FT   gene            complement(21382..22017)
FT                   /locus_tag="BSn5_00115"
FT   CDS_pept        complement(21382..22017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00115"
FT                   /product="DNA nuclease, lipoprotein"
FT                   /note="COG1525 Micrococcal nuclease (thermonuclease)
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92659"
FT                   /protein_id="ADV92659.1"
FT                   /translation="MKKILISMIAIVLSITLAACGSNHAAKNHSDSNGTEQVSQDTQSN
FT                   EYSQTEQKAGTPHSKNHKKLIDVTLDRAIDGDTIKVIYNGKEDTVRYLLVDTPETKKPN
FT                   SCVQPYGEDASKRNKELVNSGKLQLEFDKGDRRDKYGRLLAYVYVDGKSVQETLLKEGL
FT                   ARVAYVYEPNTKYIDQFRLDEQEAKSDKLSIWSKSGYVTNRGFNGCVK"
FT   gene            22473..23846
FT                   /locus_tag="BSn5_00120"
FT   CDS_pept        22473..23846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00120"
FT                   /product="putative sugar transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92660"
FT                   /protein_id="ADV92660.1"
FT                   /translation="MISATFGGLLFGYDTGVINGALPFMARPDQLDLTPVTEGLVTSIL
FT                   LLGAAFGALLCGRLADRYGRRKMILNLSFLFFLASLGTALAPNVFVMVAFRFLLGLAVG
FT                   GASAMVPAFLAEMAPHEKRGRMVTQNELMIVGGQFLAYVFNAILGVTMANTGHVWRYML
FT                   VICAVPAIMLFASMLKVPESPRWLISKGKNSEALRVLKQIREDKRAVAECREIQEAVEK
FT                   DTALEKASLKDFSTPWLRRLLWIGIGVAIVNQITGVNSIMYYGTQILKESGFGTKAALI
FT                   ANIGNGLISVIAVIFGIWLVGKVRRRPILLIGLAGTTTALLLIAIFSIVLDGSMALPYV
FT                   VLSLTVLFLAFMQGCVGPVTWLVIAEIFPQRLRGLGSGISVFFLWILNFVIGFAFPILL
FT                   SSVGLSFTFFIFVALGVLAIGFVYKFMPETKGRTLEELEEHFRSRHDHNTPEQSVIEV"
FT   gene            complement(23948..25132)
FT                   /locus_tag="BSn5_00125"
FT   CDS_pept        complement(23948..25132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00125"
FT                   /product="alanine racemase"
FT                   /note="COG0787 Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92661"
FT                   /protein_id="ADV92661.1"
FT                   /translation="MIKLCREVWIEVNLDAVKKNLRAIRRHIPHKSKIMAVVKANGYGH
FT                   GSIEVARHALEHGASELAVASVEEGIVLRKAGITAPILVLGFTSLSCVKKSAAWNITLS
FT                   AFQVDWMKEANEILEKEASANRLAIHINVDTGMGRLGVRTKEELLEVVKALKASKFLRW
FT                   TGIFTHFSTADEPDTTLTKLQHEKFISFLSFLKKQGIELPTVHMCNTAAAIAFPEFSAD
FT                   MIRLGIGLYGLYPSAYIKQLNLVKLEPALSLKARIAYVKTMRTEPRTVSYGATYIAEPN
FT                   EVIATLPIGYADGYSRALSNRGFVLHRGKRVPVAGRVTMDMIMVSLGENGEGKQGEEVV
FT                   IYGKQKGAEISVDEVAEMLNTINYEVVSTLSRRIPRFYIRDGEIFKVSTPVLYV"
FT   gene            25593..26054
FT                   /locus_tag="BSn5_00130"
FT   CDS_pept        25593..26054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00130"
FT                   /product="putative prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92662"
FT                   /protein_id="ADV92662.1"
FT                   /translation="MNRGVSFQIPNEYGNFLWRILQPVEIANYRWQTSGESYFVVEGEL
FT                   DDEELFHDYAIVEGAVFEQQLKTNQYYTIFVELKAFPYGKMVNQVNTYEEFADSDCELV
FT                   LLIADNSYVSIYCKNKNIIEKLYFNALQHDFEDVQFITDENDTRTSLTV"
FT   gene            26084..26518
FT                   /locus_tag="BSn5_00135"
FT   CDS_pept        26084..26518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00135"
FT                   /product="putative deoxyuridine 5'-triphosphate
FT                   pyrophosphatase"
FT                   /note="COG0756 dUTPase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92663"
FT                   /protein_id="ADV92663.1"
FT                   /translation="MTMQIKIKYLDETQTRISKIEQGDWIDLRAAEDVTIKKDEFKLVP
FT                   LGVAMELPEGYEAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYALRDTEI
FT                   KKGDRICQFRIMKKMPAVELVEVEHLGNEDRGGLGSTGTK"
FT   gene            complement(27160..27420)
FT                   /locus_tag="BSn5_00140"
FT   CDS_pept        complement(27160..27420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92664"
FT                   /protein_id="ADV92664.1"
FT                   /translation="MGYYKKYKEEYYTWKKTYYKKYYDNDKKHYDCDKYYDHDKKHYDY
FT                   DKKYDDHDKKYYDDHDYHYEKKYYDDDDHYYDFVESYKKHH"
FT   gene            28230..29069
FT                   /gene="thyA"
FT                   /locus_tag="BSn5_00145"
FT   CDS_pept        28230..29069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="BSn5_00145"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="COG0207 Thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92665"
FT                   /protein_id="ADV92665.1"
FT                   /translation="MTQFDKQYNSIIKDIINNGISDEEFDVRTKWDSDGTPAHTLSVIS
FT                   KQMRFDNSEVPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNKMGVHIWDQWKQEDGTI
FT                   GHAYGFQLGKKNRSLNGEKVDQVDYLLHQLKNNPSSRRHITMLWNPDDLDAMSLTPCVY
FT                   ETQWYVKQGKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCH
FT                   VYTRHIDNLKIQMEREQFEAPELWINPEVKDFYNFTIDDFKLINYKHGDKLLFEVAV"
FT   gene            complement(29192..29404)
FT                   /locus_tag="BSn5_00150"
FT   CDS_pept        complement(29192..29404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92666"
FT                   /protein_id="ADV92666.1"
FT                   /translation="MKYEKSSLFGMILVIVALLISIYFMCNTNALVPAGYDLAIHGIVI
FT                   SRTVMIAFTLYLVSKLGYFLLNKKD"
FT   gene            complement(29522..30241)
FT                   /locus_tag="BSn5_00155"
FT   CDS_pept        complement(29522..30241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92667"
FT                   /protein_id="ADV92667.1"
FT                   /translation="MKKVLIAGAVGTAVLFGTLSSGIPGLPAADAQVAKAASQLPNGIG
FT                   GRVYLNSTGAVFTAKIALPETVKNNDSVSTPYIYSGFRATSGTEADIGLQYSKQYNVWK
FT                   PLMKVGSKNEETYIEGKDKFTYNKGFRPGSTVQMTIYKNLNGNTRMTLWGTNNDGYTGR
FT                   IITEIQGTNIGTISKWKTLATAAVSYESQRDAIKATFSTSFNNITIDNKAVTPVVDTQD
FT                   FAKVSVAGNNVTISVHK"
FT   gene            complement(30404..30760)
FT                   /locus_tag="BSn5_00160"
FT   CDS_pept        complement(30404..30760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92668"
FT                   /protein_id="ADV92668.1"
FT                   /translation="MYRNIVFYLILLCLFISVVMKSFEVISTIANVICFVFVLLYFKDE
FT                   MKTYSRKALAILSICFLFLVGICAFIILQGQTLMKRHLFFTGWETIAGILLIIVSLSIC
FT                   TFILRKISNRLKRL"
FT   gene            complement(31031..31255)
FT                   /locus_tag="BSn5_00165"
FT   CDS_pept        complement(31031..31255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92669"
FT                   /protein_id="ADV92669.1"
FT                   /translation="MGYYKKYKEEYYTVKKTYYKKYYEYDKKYYDHHDKKYDDCDYDKK
FT                   YDDYDKKYYDHDKKDYDYVVEYKKHKKHY"
FT   gene            complement(31431..31619)
FT                   /locus_tag="BSn5_00170"
FT   CDS_pept        complement(31431..31619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00170"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /note="COG1826 Sec-independent protein secretion pathway
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92670"
FT                   /protein_id="ADV92670.1"
FT                   /translation="MELSFTKILVILFVGFLVFGPDKLPALGRAAGKALSEFKQATSGL
FT                   TQDIRKNDSENKEDKQM"
FT   gene            31698..31874
FT                   /locus_tag="BSn5_00175"
FT   CDS_pept        31698..31874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92671"
FT                   /protein_id="ADV92671.1"
FT                   /translation="MNILKPAQRQIHKTAAAEYNVQCHLPKKQGGRLDQLCSSAENDTN
FT                   VSAAIIEIEEWCS"
FT   gene            31874..32272
FT                   /locus_tag="BSn5_00180"
FT   CDS_pept        31874..32272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92672"
FT                   /protein_id="ADV92672.1"
FT                   /translation="MRFTKVVGFLSVLGLAAVFPLSAQAEKAGTAGAGEWDKLGTYTYT
FT                   YSSPTVYSTGGDFRVCLSGSTPFSVSLHLYEDDPGDNPDDYVGANYFSPGECHTFGSIG
FT                   KFVDGSNNKAEFFVTDYSGKSKTVTFYD"
FT   gene            complement(32336..32770)
FT                   /locus_tag="BSn5_00185"
FT   CDS_pept        complement(32336..32770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00185"
FT                   /product="hypothetical protein"
FT                   /note="COG3832 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92673"
FT                   /protein_id="ADV92673.1"
FT                   /translation="MAQNNENTLPDITKSITLEAPIQKVWETVSTSEGIAKWFMPNDFQ
FT                   LKEGQEFHLQSPFGPSPCKVLAVQAPTELSFEWDTEGWVVTFQLEDLGEKTGFTLIHSG
FT                   WKEPNEVIGKANEKSSVVRGKMDGGWTGIVNERLRKAIEE"
FT   gene            32919..33041
FT                   /locus_tag="BSn5_00190"
FT   CDS_pept        32919..33041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92674"
FT                   /protein_id="ADV92674.1"
FT                   /translation="MFEKERDVYVVISFMLVCSAATVMFELEFLFSQFILRFLF"
FT   gene            33079..33267
FT                   /locus_tag="BSn5_00195"
FT   CDS_pept        33079..33267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92675"
FT                   /protein_id="ADV92675.1"
FT                   /translation="MLGKIKAAIDNSPGKPARILVSEKAFQQLEEEMRFVYVSKPKTIM
FT                   GIPVEVSDQAESFKLEF"
FT   gene            33564..35123
FT                   /locus_tag="BSn5_00200"
FT   CDS_pept        33564..35123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00200"
FT                   /product="putative spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92676"
FT                   /protein_id="ADV92676.1"
FT                   /translation="MRWRNNQYKTQKQHKSDYSTAEKQDQDVLTGNIGYDLEHVKRKIG
FT                   HNGDVHFRELEITQLHVKAALIFVEGLSDQNLINKGLSVLVMNQPNQVSDEISQSGKGI
FT                   LISKQIKNQIVSIGDVIESEKISDIVLNVFMGSTALLIDGIPQAFLLGTVKKQNRSIEE
FT                   PLSEALVRGPRTGFTEELSTNTALLRQQGKNDQLTLQRFEVGTRLKKDLIIAYMNDIAD
FT                   PKVVEEVRKRVRGIEIDHLPESGYVEQLIEDNYLSPFPQVQSTERPDRVISGLMEGRVA
FT                   ILLDGTPFALIVPVTFSMMLQSPEDYYERWFPSSLIRLLRFIAAMITLFAPALYISFIS
FT                   FHPGLIPTKLAISISGTRQGVPFPSLIEALFMEVAIEILREAGLRLPKPIGPAIGIVGG
FT                   LIIGEAAVQAGIVSPIMVIVVALTAISSFAIPHYSTGIALRMLRFGAMFCAAVFGLFGV
FT                   IMYYLLLSSHVVKLKSFGVPYASPAVPYQLKDWKDFVIRMPLLVMKRRPKMMNTDNTKR
FT                   VK"
FT   gene            35406..36179
FT                   /locus_tag="BSn5_00205"
FT   CDS_pept        35406..36179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00205"
FT                   /product="putative spore germination integral inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92677"
FT                   /protein_id="ADV92677.1"
FT                   /translation="MSEIVDFFLLEGTPSWAIIMTVLWIGLYSITQGLDPIARLFEMIF
FT                   PITVIIFLTIALMSLGIFEINNLRPVLGDGIMPVLRGVKTTNLSFTCSEIMLILVAFMK
FT                   KPKNAVKAVVIGTGVVTSFYMITLIMVIGALSVEGVVTRTWPGLDLMRSFEIPGLIFER
FT                   FESFLLVIWIMQLFATFIITFYAASLGVSQVFKKKPLSCMFGLLPVIYILSCMPKNEND
FT                   VFILGDTVSHIALYIFGALPILLLVISKWRKRGEK"
FT   gene            36169..37383
FT                   /locus_tag="BSn5_00210"
FT   CDS_pept        36169..37383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00210"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92678"
FT                   /protein_id="ADV92678.1"
FT                   /translation="MKSKLKRQLPAMVMVCLLMICVTGCWSSREIEDLGLTFAIAIDKG
FT                   KETNTEKELKEEGGSYPKKDNITLTYQFVNEKAAGAGTSGGGGSGQGAQKAYINISETG
FT                   DSLQQIGSEVALRRDREVFSPHLKVVVMSEDVLHTFPIDEMLDQFFRDNEIRLSCLVLS
FT                   AKGEARDALQLKENGEIPAFRLIGLGENEHKVSRILPPMTLAKLIGKLHSGSSFLLQNV
FT                   VAANGAVKYSGAAVINGKSKKMIGTLNEYETEGITWIRGEGKGGVVKSHDKKSQQTIAY
FT                   DINKIKSKIQPIVKGKDISFHVDIESEGDLVENWNTKEALDTQFIDRLETTIENEVKKI
FT                   VGQVLKKIQHDYKADVAGFDESFRLTYPHLWKRVKNNWDDTFSKADITYSVNVTITHFG
FT                   TVKTQ"
FT   gene            37530..38276
FT                   /locus_tag="BSn5_00215"
FT   CDS_pept        37530..38276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92679"
FT                   /protein_id="ADV92679.1"
FT                   /translation="MRQKPIYVEIEMKSDLDTLWEYTQNPSLHKEWDLRFSNITYLNSQ
FT                   PCEKQKFLYETRIGFGLKVSGTGETVGVFNKCSSERSSSLAFGSNHPLSLIRHGSGYWK
FT                   YIQRENGKMTFLTQYQYKTAYGLLGRWIDRLLFRPLLGWATAWSFDALRLWVEQNKHPK
FT                   RFIRSAIIYVFMCLFFSLFWFYQGFAGVKTSILAGTAEIGLAILWLLPLKRKWIIHGVQ
FT                   ACIFAGFARNIHVGSVECVFCCKRRS"
FT   gene            38246..38947
FT                   /locus_tag="BSn5_00220"
FT   CDS_pept        38246..38947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92680"
FT                   /protein_id="ADV92680.1"
FT                   /translation="MCFLLQAALLACSSPVPGAQNERERSDIVSSIYEKSIINYHLLHP
FT                   KLRKRYQLDGSQTFSGTGTMSEISGGSFLVRMLLKLGVFFRCFFSERGKDIPFTIQNRT
FT                   CLLKSQHTGIEWNRTFFFKGKKRFFDAIMIYDEKENRILDFFGKPHLLLSVLTFEASLD
FT                   GSLTITSGKQWLLICGKRIPLPKWLTGTSEVCETFDEKKNCFTIEVHVQNTILGTLFFY
FT                   KGTFQEEERES"
FT   gene            38944..40584
FT                   /locus_tag="BSn5_00225"
FT   CDS_pept        38944..40584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00225"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92681"
FT                   /protein_id="ADV92681.1"
FT                   /translation="MKRNGIVSALCFIGFLAAEAPDISVAEAFVLLSILFFAPGIYPFV
FT                   FRQSPVRAAQFMEYGLIQCYPAAAFFAVLALVTEVGVFALIWWMYTVFIALYAILRLWE
FT                   TKIHRIEETSVLFGLIYLAGGGFWFFAYAAHLQIMQFGPLIILLTAVHFHYSAFLIPIF
FT                   NGLLGRTIRKHRMLYSWITWVILLSPLLIALGITYSKTLDVIAVSIYMAAIYLHAFLVF
FT                   TAAFRTKTGTFLIRLSSAVLMITIAFSMIYSFGVFRQEVTLTINQMIWIHGFVNAFGVI
FT                   LPALIGWRIEDAKPFDADSVKTFSRIYGKRKIGEEFLANIQAENNARYSGLVDDMGSLR
FT                   SKDFSPEKLAPLILSFYELTIEYNIKAKVTWSTWFRPLAIIYEWFSRRIGQIHLSTNPD
FT                   WYRMYSKIKGVHSKKDGRERVRAWIRTNEKNETIFTALYSVYRSNGEGYMNISLPLPFS
FT                   SMTGILKPYHHQEKLVLTSRRRKSRAGDEGIYLQTRAGTCPLPLSETFLIEAAHDNKLT
FT                   AVHHMWLFGLKFLTVHYSITHINQPIERT"
FT   gene            40611..40976
FT                   /locus_tag="BSn5_00230"
FT   CDS_pept        40611..40976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00230"
FT                   /product="putative phage/plasmid replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92682"
FT                   /protein_id="ADV92682.1"
FT                   /translation="MLHFKILHRIKTGKEGFMVFYISLFLILWLAAGFAVGMKQVYVDQ
FT                   LFDKAVIERLEKEANDHGHADRMIKQRVLYISAVTVSGFISVYYEMKTIPQRRNIRKIE
FT                   KNIMKLNQAKKRRMKRK"
FT   gene            41202..41960
FT                   /locus_tag="BSn5_00235"
FT   CDS_pept        41202..41960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00235"
FT                   /product="putative phage-related replication protein"
FT                   /note="COG4195 Phage-related replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92683"
FT                   /protein_id="ADV92683.1"
FT                   /translation="MKPAKVSLLRRLLHSLKHVDCNIAKRFPSTIKIVKLLLIFMVFTP
FT                   ISSIYAEDVYQNFEELKSNEDPSDYGVVTKETGSPVLVLAIHGGGIEGGTSEVARELSK
FT                   EYSMYLFEGLKSAGNSVLHITSTHFDEPRALKMTGNHEYVISLHGYAEEDQQIEVGGTD
FT                   RVRAADLVEKLQHAGFPAVLLNTDHPHAGVSPNNIANKSKTGLSIQIEMSTGFRKSLFG
FT                   IFSLKSRAVTQNERFYEFTEVMFRFLKNSY"
FT   gene            complement(41987..42436)
FT                   /locus_tag="BSn5_00240"
FT   CDS_pept        complement(41987..42436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00240"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92684"
FT                   /protein_id="ADV92684.1"
FT                   /translation="MKHIIALASKIAFTLALLYVILDRVYHASFLSVMFIALFLGFVSY
FT                   LSGDMLVLPRTNNITASLADLGLSFVILWVFVLTQTRNDFSPFGAALLSAACLTVFEYF
FT                   FHRYLLKNVLDENFRNELSARDNTLQYQTEAADELFPETKEKHKE"
FT   gene            42645..42896
FT                   /locus_tag="BSn5_00245"
FT   CDS_pept        42645..42896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00245"
FT                   /product="fosfomycin resistance protein FosB"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92685"
FT                   /protein_id="ADV92685.1"
FT                   /translation="MEIKGINHLLFSVSHLDTSIDFYQKVFDAKLLVKGRTTAYFDMNG
FT                   IWLALNEEPDIPRNDIKLSYTHIALQLKIMNVRRYQLN"
FT   gene            42936..43241
FT                   /locus_tag="BSn5_00250"
FT   CDS_pept        42936..43241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92686"
FT                   /protein_id="ADV92686.1"
FT                   /translation="MNAIENQFILPTLTATNLNFIPEPFKTGFDITNKKKRICTFYDET
FT                   FDITTIFHIRLNLKKGVGGDFMFGEGFYPTCSTMPYLLNCTSDWVKVKLKYILHFI"
FT   gene            complement(43613..44230)
FT                   /locus_tag="BSn5_00255"
FT   CDS_pept        complement(43613..44230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00255"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /note="COG1974 SOS-response transcriptional repressors
FT                   (RecA-mediated autopeptidases)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92687"
FT                   /protein_id="ADV92687.1"
FT                   /translation="MTKLSKRQLDILRFIKAEVKSKGYPPSVREIGEAVGLASSSTVHG
FT                   HLARLETKGLIRRDPTKPRAIEILDEEVDIPQSQVVNVPVIGKVTAGSPITAVENIEEY
FT                   FPLPDRMVPPDEHVFMLEIMGDSMIDAGILDKDYVIVKQQNTANNGEIVVAMTEDDEAT
FT                   VKRFYKEDTHIRLQPENPTMEPIILQNVSILGKVIGVFRTVH"
FT   gene            44386..44697
FT                   /locus_tag="BSn5_00260"
FT   CDS_pept        44386..44697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00260"
FT                   /product="cell division suppressor protein YneA"
FT                   /note="COG1388 FOG: LysM repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92688"
FT                   /protein_id="ADV92688.1"
FT                   /translation="MSKESIIFVGLFTVILSAVILMLSYTSSGQELNQYVKIEVQQGDT
FT                   LWSIADQVADTKKINKNDFIEWVADKNQLQTSDIQPGDELVIPLKKKHQDAYELATVK"
FT   gene            44716..45369
FT                   /locus_tag="BSn5_00265"
FT   CDS_pept        44716..45369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00265"
FT                   /product="putative cell division protein"
FT                   /note="COG1961 Site-specific recombinases, DNA invertase
FT                   Pin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92689"
FT                   /protein_id="ADV92689.1"
FT                   /translation="MKALIYARVSTNKEQQETSLKRQEEELTAIAAENGMEVVKVISEK
FT                   ASGYEMDRDGVFELLDEIKNAGIDVILVQDETRLGRGNAKIALLHCIYREGVKVYTTAH
FT                   RGELELSEADSMVLEIVSIVEEYQRKIHNMKIRRGMKRAVKNGFKPQKNLKNQHGNSGK
FT                   EKIEVPISEIVRLRANKLTFAEIAATLRGFGYDVSKATVHRRFQEYIENEETAE"
FT   gene            45433..45666
FT                   /locus_tag="BSn5_00270"
FT   CDS_pept        45433..45666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00270"
FT                   /product="hypothetical protein"
FT                   /note="COG4224 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92690"
FT                   /protein_id="ADV92690.1"
FT                   /translation="MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSM
FT                   KNTLKSVKIIDPEGNDVTPEKLKREQRNNKLH"
FT   gene            45835..47838
FT                   /locus_tag="BSn5_00275"
FT   CDS_pept        45835..47838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00275"
FT                   /product="transketolase"
FT                   /note="COG0021 Transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92691"
FT                   /protein_id="ADV92691.1"
FT                   /translation="MDTIEKKSVATIRTLSIDAIEKANSGHPGMPMGAAPMAYTLWTKF
FT                   MNVSPANPGWFNRDRFVLSAGHGSALLYSMLHLSGFDLSIEDLKGFRQWGSKTPGHPEF
FT                   GHTAGVDATTGPLGQGIAMAVGMAIAERHLAETYNRDSFNVVDHYTYSICGDGDLMEGI
FT                   SSEAASLAGHLQLGRLIVLYDSNDISLDGDLDRSFSENVKQRFEAMNWEVLYVEDGNNI
FT                   EELTAAIEKARQNEKKPTLIEVKTTIGFGSPNRAGTSGVHGAPLGKEESKLTKEAYAWT
FT                   YEEDFYVPSEVYEHFAAAVKESGEKKEQEWNAQFAKYKEVYPELAEQLELAIKGELPKD
FT                   WDQEVPVYEKGSSLASRASSGEVLNGLAKKIPFFVGGSADLAGSNKTTIKNAGDFTAVD
FT                   YAGKNFWFGVREFAMGAALNGMALHGGLRVFGGTFFVFSDYLRPAIRLAALMGLPVTYV
FT                   FTHDSIAVGEDGPTHEPVEQLASLRAMPNLSLIRPADGNETAAAWKLAVQSTDHPTALV
FT                   LTRQNLPTIDQTSEEALAGVEKGAYVVSKSKNETPDALLIASGSEVGLAIEAQAELAKE
FT                   NIDVSVVSMPSMDRFEKQSDEYKNEVLPADVKKRLAIEMGSSFGWGKYTGLEGDVLGID
FT                   RFGASAPGETIINEYGFSVPNVVNRVKALINK"
FT   gene            47991..48437
FT                   /locus_tag="BSn5_00280"
FT   CDS_pept        47991..48437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92692"
FT                   /protein_id="ADV92692.1"
FT                   /translation="MERHYYTYLIKEEFANHYFGRESVMFELFQDYHWTSLEKQQYEMT
FT                   EKQIQYITQPIPILHMHQRLKMNLNKTDYRQLDYIYRIALPKAKGHATFMMKEHMIEIV
FT                   ASGDYEAETIFFEVLRKVSPCFLAMDFNSKRYGWLNPVKERNFV"
FT   gene            48523..48741
FT                   /locus_tag="BSn5_00285"
FT   CDS_pept        48523..48741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00285"
FT                   /product="hypothetical protein"
FT                   /note="COG3763 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92693"
FT                   /protein_id="ADV92693.1"
FT                   /translation="MTLWVGILVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLR
FT                   MMMMQMGMKPSQKKINQMMKAMNNQTK"
FT   gene            complement(48815..49006)
FT                   /locus_tag="BSn5_00290"
FT   CDS_pept        complement(48815..49006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00290"
FT                   /product="Spo0A-P phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92694"
FT                   /protein_id="ADV92694.1"
FT                   /translation="MKGYIPVIREHLLKEIEKKRAELLQIVMANGMTSHITIELSQELD
FT                   HLLIQYQKQRLRAVAGDE"
FT   gene            49208..49915
FT                   /locus_tag="BSn5_00295"
FT   CDS_pept        49208..49915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00295"
FT                   /product="cytochrome c-type biogenesis protein CcdA"
FT                   /note="COG0785 Cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92695"
FT                   /protein_id="ADV92695.1"
FT                   /translation="MGDVNYFLTFGAGFLSFISPCCLPLYPAFLSYITGVSMDDVKTEK
FT                   LLLQKRSLFHTLCFLLGFSVIFIALGYGTSFIGSLFRDYHDAIRQIGALLIILFGFITL
FT                   GVFRPEAMMKERRIHFKHKPSGFLGSVLIGMAFAAGWTPCTGPILAAVITLAGTNPGSA
FT                   VPYMMLYVLGFAVPFLLLSFFITKLKWIRKNQLFIMKAGGVLMIVIGVLLFFNWMSLII
FT                   ILLSDLFGGFTGF"
FT   gene            50004..50366
FT                   /locus_tag="BSn5_00300"
FT   CDS_pept        50004..50366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00300"
FT                   /product="hypothetical protein"
FT                   /note="COG0784 FOG: CheY-like receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92696"
FT                   /protein_id="ADV92696.1"
FT                   /translation="MTRVLVVDDAKFMRVKIREILEEANYIIAGEAADGEQAADLYKKL
FT                   RPDLVTMDITMPVKNGIKALRDILTFDPKAKVIMCTAMRQQRIVTEAIELGAKDFIVKP
FT                   FEETKVLEAVSRVMGH"
FT   gene            50454..50936
FT                   /locus_tag="BSn5_00305"
FT   CDS_pept        50454..50936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00305"
FT                   /product="putative integral inner membrane protein"
FT                   /note="COG4846 Membrane protein involved in cytochrome C
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92697"
FT                   /protein_id="ADV92697.1"
FT                   /translation="MMIIVSSIIAVLMAVAVMVVRIKSSDKPVSPKKIILPPIFMSTGA
FT                   LMFLFPVFWVTGAEFLEAFTLGVIFSIFLIKTSKFEIKNNEIYMRRSKAFVFILVGLLV
FT                   IRIVMKSILSTSIDYGALSGMFWILAFGMIVPWRIAMYLSYRKLHNELQSSNIQMN"
FT   gene            complement(50967..51395)
FT                   /locus_tag="BSn5_00310"
FT   CDS_pept        complement(50967..51395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92698"
FT                   /protein_id="ADV92698.1"
FT                   /translation="MLEGWFLWFILFWVIMMVVLLSIGGFFMFRKFLKRLPKEDGRSEL
FT                   DWQDYYIENSRHLWNDENKQFLDELTAPVPELFRDAAKAKIAGKIGELAIKEKVAKIDQ
FT                   QLMIKGYILATPKRDHTFLKRHLRDKKIDLEPYQTLLK"
FT   gene            complement(51630..52004)
FT                   /locus_tag="BSn5_00315"
FT   CDS_pept        complement(51630..52004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00315"
FT                   /product="spore coat protein (outer)"
FT                   /note="COG0071 Molecular chaperone (small heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92699"
FT                   /protein_id="ADV92699.1"
FT                   /translation="MNHSKRNDANDFDSMDEWLRQFFEDPFAWYDETLPIDLYETSQQY
FT                   IIEADLTFLQPTQVTVTLSGCEFILTVKSSGQTFEKQMMLPFYFNDKTIQAECENQILT
FT                   VAVNKETEDGSSFSLQFPLS"
FT   gene            complement(52103..52249)
FT                   /gene="sspP"
FT                   /locus_tag="BSn5_00320"
FT   CDS_pept        complement(52103..52249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspP"
FT                   /locus_tag="BSn5_00320"
FT                   /product="acid-soluble spore protein P"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92700"
FT                   /protein_id="ADV92700.1"
FT                   /translation="MTNKNTSKDMHKNAPKGHNPGQPEPLSGSKKVKNRNHTRQKHNSS
FT                   HDM"
FT   gene            complement(52281..52427)
FT                   /gene="sspO"
FT                   /locus_tag="BSn5_00325"
FT   CDS_pept        complement(52281..52427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspO"
FT                   /locus_tag="BSn5_00325"
FT                   /product="acid-soluble spore protein O"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92701"
FT                   /protein_id="ADV92701.1"
FT                   /translation="MVKRKANHVINGMNDAKSQGKGAGYIENDQLVLTEAERQNNKKRK
FT                   TNQ"
FT   gene            52655..55384
FT                   /locus_tag="BSn5_00330"
FT   CDS_pept        52655..55384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00330"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="COG1048 Aconitase A"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92702"
FT                   /protein_id="ADV92702.1"
FT                   /translation="MANEQKTAAKDVFQARKTFTTNGKTYHYYSLKALEDSGIGKVSKL
FT                   PYSIKVLLESVLRQVDGFVIKKEHVENLAKWGTAELKDIDVPFKPSRVILQDFTGVPAV
FT                   VDLASLRKAMAAVGGDPDKINPEIPVDLVIDHSVQVDKAGTEDALAVNMDLEFERNAER
FT                   YKFLSWAKKAFNNYQAVPPATGIVHQVNLEFLASVVHAIEEDGELVTYPDTLVGTDSHT
FT                   TMINGIGVLGWGVGGIEAEAGMLGQPSYFPVPEVIGAKLVGKLPNGTTATDLALKVTQV
FT                   LREKGVVGKFVEFFGPGIAELPLADRATIANMAPEYGATCGFFPVDEEALNYLRLTGRD
FT                   PEHIDVVEAYCRSNGLFYTPDAEDPQFTDVVEIDLSQIEANLSGPKRPQDLIPLSAMQE
FT                   TFKKQLVSPAGNQGFGLNAEEENKEIKFKLLNGEETVMKTGAIAIAAITSCTNTSNPYV
FT                   LIGAGLVAKKAVELGLKVPNYVKTSLAPGSKVVTGYLVNSGLLPYMKELGFNLVGYGCT
FT                   TCIGNSGPLSPEIEEAVAKNDLLITSVLSGNRNFEGRIHPLVKGNYLASPPLVVAYALA
FT                   GTVNINLKTDPIGVGKDGQNVYFNDIWPSMDEINALVKQTVTPELFRKEYETVFDDNKR
FT                   WNEIETTDEALYKWDSESTYIQNPPFFEEMSVEPGKVEPLKGLRVVGKFGDSVTTDHIS
FT                   PAGAIGKDTPAGKYLQEKGVSPRDFNSYGSRRGNHEVMMRGTFANIRIKNQIAPGTEGG
FT                   FTTYWPTGEVTSIYDACMKYKEDKTGLVVLAGKDYGMGSSRDWAAKGTNLLGIRTVIAE
FT                   SFERIHRSNLVFMGVLPLQFKQGENADTLGLTGKEVIEVDVDETVRPRDLVTVRAINED
FT                   GNVTTFEAVVRFDSEVEIDYYRHGGILQMVLREKMKQS"
FT   gene            55456..55968
FT                   /locus_tag="BSn5_00335"
FT   CDS_pept        55456..55968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00335"
FT                   /product="putative membrane-bound proteins with a
FT                   thioredoxin-like domain"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92703"
FT                   /protein_id="ADV92703.1"
FT                   /translation="MLKKWLAGILLIMLAGYTGWNLYQTYSKKEVGIQEGKQAPDFSLK
FT                   TLSGEKSSLQDAKGKKVLLNFWATWCKPCRQEMPAMEKLQKEYADKLAVVAVNFTSAEK
FT                   SEKQVRAFADTYDLTFPILIDKKGINADYNVMSYPTTYILDEKGVIQDIHVGTMTKKEM
FT                   EQKLDLD"
FT   gene            55961..56173
FT                   /locus_tag="BSn5_00340"
FT   CDS_pept        55961..56173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92704"
FT                   /protein_id="ADV92704.1"
FT                   /translation="MIRFSFFMLRYAYKFSELEKIKEYAEVRSVKKMRKRSFHELVMEN
FT                   KKELMTNTEYLNQLEEKLEQRFKQK"
FT   gene            56238..56384
FT                   /gene="sspN"
FT                   /locus_tag="BSn5_00345"
FT   CDS_pept        56238..56384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspN"
FT                   /locus_tag="BSn5_00345"
FT                   /product="acid-soluble spore protein N"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92705"
FT                   /protein_id="ADV92705.1"
FT                   /translation="MGNNKKNGQPQYAPSHLGTKPVKYKANKGEKMHDTSGQRPIIMQT
FT                   KGE"
FT   gene            56421..56672
FT                   /locus_tag="BSn5_00350"
FT   CDS_pept        56421..56672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00350"
FT                   /product="small acid-soluble spore protein Tlp"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92706"
FT                   /protein_id="ADV92706.1"
FT                   /translation="MTKNQNQYQQPNPDDRSDNVEKLQDMVQNTIENIEEAEASMEFAS
FT                   GEDKQRIKEKNARREQSIESFRNEIQDESAARQNGYRS"
FT   gene            56757..57173
FT                   /locus_tag="BSn5_00355"
FT   CDS_pept        56757..57173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00355"
FT                   /product="putative acyl-CoA thioesterase"
FT                   /note="COG0824 Predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92707"
FT                   /protein_id="ADV92707.1"
FT                   /translation="MHVSKKEIEVRYAETDQMGIVYHANYLVWMEVGRTALIKDLGFLY
FT                   SDMEKKGVLSPVVDINISYKKPLHYGETAVVHTWIEDYNGFKTVYGYHIYNPAGELSIK
FT                   ATSSHICVDKESFKPIQFRKAFPDWHTAYEKAKK"
FT   gene            57189..57488
FT                   /locus_tag="BSn5_00360"
FT   CDS_pept        57189..57488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92708"
FT                   /protein_id="ADV92708.1"
FT                   /translation="MAFGVKREELNRWKQAVKRGEIAFLTHYWLDDRFPEAKTVTKAGC
FT                   ADIDKLVQWGAAYGLKKEWIHKKSEFPHFDLLGETQKYILEQENLTDHLIRFHL"
FT   gene            complement(57519..57806)
FT                   /locus_tag="BSn5_00365"
FT   CDS_pept        complement(57519..57806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00365"
FT                   /product="hypothetical protein"
FT                   /note="COG4841 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92709"
FT                   /protein_id="ADV92709.1"
FT                   /translation="MNMTINEDALNWYKEELDLESGDQVRFFVRYGGCSNVQKGFSLGV
FT                   AKDAPQEAGVTAEADGITFFIEESDLWYFDNHDLLVSYSEDADEPVFEYQ"
FT   gene            complement(57894..58475)
FT                   /locus_tag="BSn5_00370"
FT   CDS_pept        complement(57894..58475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00370"
FT                   /product="putative glycerol-3-phosphate acyltransferase
FT                   PlsY"
FT                   /note="COG0344 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92710"
FT                   /protein_id="ADV92710.1"
FT                   /translation="MLIALLIILAYLIGSIPSGLIVGKLAKGIDIREHGSGNLGATNAF
FT                   RTLGVKAGSVVIAGDILKGTLATALPFLMHVDIHPLLAGVFAVLGHVFPIFAKFKGGKA
FT                   VATSGGVLLFYAPLLFITMVAVFFIFLYLTKFVSLSSMLTGIYTVIYSFFVHDTYLLIV
FT                   VTLLTIFVIYRHRANIKRIINKTEPKVKWL"
FT   gene            complement(58476..58643)
FT                   /locus_tag="BSn5_00375"
FT   CDS_pept        complement(58476..58643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00375"
FT                   /product="hypothetical protein"
FT                   /note="COG0067 Glutamate synthase domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92711"
FT                   /protein_id="ADV92711.1"
FT                   /translation="MCHSFFTYFTRSKQEKSKYDACLIGFVSKLYKKTYHQIMTSHVKI
FT                   KRREFEKGEM"
FT   gene            58645..59052
FT                   /locus_tag="BSn5_00380"
FT   CDS_pept        58645..59052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00380"
FT                   /product="putative CoA-binding protein"
FT                   /note="COG1832 Predicted CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92712"
FT                   /protein_id="ADV92712.1"
FT                   /translation="MQNPSKAEIKEILQRSKRIAVVGLSDRPDRTSHMVSKAMQDAGYE
FT                   IIPVNPTIDEALGVKAVSSLKEIDGPIDIVNVFRRSEQLPGVAEEFLETDAPVFWAQQG
FT                   LVNEEAYQMLKEKGRTVIMDLCIKVAHAVTK"
FT   gene            59452..61419
FT                   /locus_tag="BSn5_00385"
FT   CDS_pept        59452..61419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00385"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92713"
FT                   /protein_id="ADV92713.1"
FT                   /translation="MARKQQFDYNEDAIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYE
FT                   IVDNSVDEVLAGHGDHIIVKIHKDNSISVQDRGRGMPTGMHKLGKPTPEVILTVLHAGG
FT                   KFGQGGYKTSGGLHGVGASVVNALSEWLTVTIERDGFVYQQRFENGGKPVTSLEKIGKT
FT                   KKTGTLTHFKPDPTMFSTTTYNFETLSERLRESAFLLKGLKIELIDERNDQHEVFYYEN
FT                   GIEAFVAYLNEEKDVLSEVVSFEGEHHSIEVDFAFQFNDGYSENILSFVNNVRTKDGGT
FT                   HESGAKTAMTRAFNEYARKVALLKEKDKNLEGTDIREGLSAIISVRIPEELLQFEGQTK
FT                   GKLGTSEARSAVDAIVSEQLAYFLEENRDTATLLVKKAIKASQAREAARKAREEARSGK
FT                   KRKKSEATLSGKLTPAGSRNPAKNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINT
FT                   EKAKLADIFKNEEINTIIHAIGGGVGADFSIDDINYDKIIIMTDADTDGAHIQVLLLTF
FT                   FYRYMKPLIEHGKVFIALPPLYKVSKGSGKKEIIEYAWSDEEMGDVLKKVGKGYTIQRY
FT                   KGLGEMNADQLWETTMNPESRTLVRVKIDDAARVERRVTTLMGDKVEPRRKWIEKNVAF
FT                   GLDEESNILENENLSVAEEV"
FT   gene            61423..63843
FT                   /locus_tag="BSn5_00390"
FT   CDS_pept        61423..63843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00390"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /note="COG0188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92714"
FT                   /protein_id="ADV92714.1"
FT                   /translation="MSQPELFHDLPLEEVIGDRFGRYSKYIIQDRALPDARDGLKPVQR
FT                   RILYAMHTDGNTFDKNFRKAAKTVGNVIGNYHPHGDSSVYEAMVRMSQDWKVRNVLIEM
FT                   HGNNGSIDGDPPAAMRYTEARLSPIASELLRDIDKNTVEFVPNFDDTSKEPVVLPAMFP
FT                   NLLVNGSTGISAGYATDIPPHHLGEVIDAVIKRIQMPSCSVDELMEVIKGPDFPTGGII
FT                   QGIDGIRKAYETGKGKIIIRGKAEIETIRGGREQIVITEIPFEVNKANLVKKMDEFRID
FT                   KKVEGISEVRDETDRTGLRVVIELKKEADAKGILNFLYKNTDLQITYNFNMVAIHNRRP
FT                   MLMSLPSILDAYIGHQKEVVTNRSVYELQKAKDRHHIVEGLMKALSILDEVIATIRSSS
FT                   DKRDAKNNLIAKYEFTEPQAEAIVSLQLYRLTNTDITALKEEAEELGKKIEELESILSN
FT                   DKKLLKVITNSLKALKKKYADTRRSVIEEKIEEIKINLEVMVASEDVYVTVTKDGYLKR
FT                   TSQRSFAASNGQDFGMKDTDRMLHQFEMNTTDVLLLFTNKGSYIYCPVHQLPDIRWKDM
FT                   GQHFSNLITIDRDETIVKAIPIKEFDPSAYLLFFTKNGMVKKTELTHYKAQRYSKALVA
FT                   LNLKGEDELIDVHVTNGESQIFMATHLGYGLWFGEDEVNVVGARAAGVKGINLKEDDFV
FT                   VSGEILQQSDSIVLFTQRGAVKRMSLSEFEKTSRAKRGVVMLRELKKNPHRVVALFACG
FT                   LEQRLMAETEKGDRKELQAKELRTNDRYSNGSFFFDEEESGKVTAVWRLHTEQ"
FT   gene            complement(63890..64015)
FT                   /locus_tag="BSn5_00395"
FT   CDS_pept        complement(63890..64015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92715"
FT                   /protein_id="ADV92715.1"
FT                   /translation="MLFILRMVILGLFSFTALNLFVWQGIEVIHAVTDLFTNHES"
FT   gene            complement(64041..64394)
FT                   /locus_tag="BSn5_00400"
FT   CDS_pept        complement(64041..64394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92716"
FT                   /protein_id="ADV92716.1"
FT                   /translation="MKKVTILKASILFLAIASFHLFSIPHAFDIGHHYKAVADQQEMHE
FT                   MKAGQNADDEKKSITGAFTLTALWAMAVLLLTAESKSTGYSRRRQRKKSFILAKFYQSS
FT                   YFGKLHVQHHPIM"
FT   gene            64905..66302
FT                   /locus_tag="BSn5_00405"
FT   CDS_pept        64905..66302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00405"
FT                   /product="amino acid carrier protein"
FT                   /note="COG1115 Na+/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92717"
FT                   /protein_id="ADV92717.1"
FT                   /translation="MESFFNSLINIPSDFIWNYLFYILIGLGLFFTIRFGFIQFRYFIE
FT                   MFRIVGEKPEGNKGVSSMQAFFISAASRVGTGNLTGVALAIATGGPGAVFWMWVVAAVG
FT                   MASSFVESTLAQLYKVRDGEDFRGGPAYYIQKGLGARWLGIVFAILITVSFGLIFNAVQ
FT                   TNTIAGALDGAFHVNKIVVAIVLAVLTAFIIFGGLKRVVAVSQLIVPVMAGIYILIALF
FT                   VVITNITAFPGVIATIVKNALGFEQVVGGGIGGIIVIGAQRGLFSNEAGMGSAPNAAAT
FT                   AHVSHPAKQGFIQTLGVFFDTFIICTSTAFIILLYSVTPKGDGIQVTQAALNHHIGGWA
FT                   PTFIAVAMFLFAFSSVVGNYYYGETNIEFIKTSKTWLNIYRIAVIAMVVYGSLSGFQIV
FT                   WDMADLFMGIMALINLIVITLLSNVAYKVYKDYAKQRKQGLDPVFKAKNIPGLKNAETW
FT                   EDEKQEA"
FT   gene            66604..68106
FT                   /locus_tag="BSn5_00410"
FT   CDS_pept        66604..68106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00410"
FT                   /product="endo-1,4-beta-glucanase"
FT                   /note="COG2730 Endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92718"
FT                   /protein_id="ADV92718.1"
FT                   /translation="MKRSISIFITCLLITLLTMGGMLASPASAAGTKTPVAKNGQLSIK
FT                   GTQLVNRDGKAVQLKGISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYID
FT                   NPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVI
FT                   YEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDA
FT                   NVMYALHFYAGTHGQFLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYL
FT                   DSKTISWVNWNLSDKQESSSALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTKDIP
FT                   ETPAKDKPTQENGISVQYRAGDGSMNSNQIRPQLQIKNNGNTTVDLKDVTARYWYNAKN
FT                   KGQNVDCDYAQLGCGNVTYKFVTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHN
FT                   DDWSNYAQSGDDYSFFKSNTFKTTKKITLYDQGKLIWGTEPN"
FT   gene            68173..68436
FT                   /locus_tag="BSn5_00415"
FT   CDS_pept        68173..68436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92719"
FT                   /protein_id="ADV92719.1"
FT                   /translation="MDEILKQYIVLYKKMSNMINGPDYPGKEKDIQHQKDQIEVYEKQL
FT                   QQGFSTDYDYDVFADSVIKCAYGDMTLEDLEAVYYGLTTPFF"
FT   gene            complement(68703..69971)
FT                   /locus_tag="BSn5_00420"
FT   CDS_pept        complement(68703..69971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00420"
FT                   /product="endo-xylanase"
FT                   /note="COG5520 O-Glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92720"
FT                   /protein_id="ADV92720.1"
FT                   /translation="MIPRIKKTICVLLVCFTMLSVMLGPGATEVLAASDVTVNVSAEKQ
FT                   VIRGFGGMNHPAWAGDLTAAQRETAFGNGQNQLGFSILRIHVDENRNNWYKEVETAKSA
FT                   VKHGAIVFASPWNPPSDMVETFNRNGDTSAKRLKYNKYAAYAQHLNDFVTFMKNNGVNL
FT                   YAISVQNEPDYAHEWTWWTPQEILRFMRENAGSINARVIAPESFQYLKNLSDPILNDPQ
FT                   ALANMDILGTHLYGTQVSQFPYPLFKQKGAGKDLWMTEVYYPNSDTNSADRWPEALDVS
FT                   QHIHNAMVEGDFQAYVWWYIRRSYGPMKEDGTISKRGYNMAHFSKFVRPGYVRIDATKN
FT                   PNANVYVSAYKGDNKVVIVAINKSNTGVNQNFVLQNGSASNVSRWITSSSSNLQPGTNL
FT                   TVSGNHFWAHLPAQSVTTFVVNR"
FT   gene            complement(70102..71643)
FT                   /locus_tag="BSn5_00425"
FT   CDS_pept        complement(70102..71643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00425"
FT                   /product="endo-1,4-beta-xylanase (xylanase D)"
FT                   /note="COG0536 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92721"
FT                   /protein_id="ADV92721.1"
FT                   /translation="MRKKCSVCLWILVLLLSCLSGKSAYAATSTTIAKHIGNSNPLIDH
FT                   HLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGA
FT                   IPVAGANGANGGRGIAKWADASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIG
FT                   PWTDPIGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGGSNPTQAQWANP
FT                   KTARVIKLGPDMTSVVGSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPG
FT                   EIGYMTSSNPMGPFTYRGHFLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALF
FT                   GAGKGYRSPHINKLVHNPDGSIQEVAANYAGVTQLSNLNPYNRVEAETSAWNGRILTEK
FT                   STAPGGPVNNQHVTSIQNGDWIAVGNADFGAVGARSFKANVASTSGGKIEVRLDSADGK
FT                   LVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR"
FT   gene            complement(71643..71792)
FT                   /locus_tag="BSn5_00430"
FT   CDS_pept        complement(71643..71792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92722"
FT                   /protein_id="ADV92722.1"
FT                   /translation="METHEDELSEQLGTLLNSFRLIYACDLHDLLSSNSKRKSPILRKK
FT                   EDVK"
FT   gene            72239..72685
FT                   /locus_tag="BSn5_00435"
FT   CDS_pept        72239..72685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00435"
FT                   /product="putative conserved membrane protein"
FT                   /note="COG2246 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92723"
FT                   /protein_id="ADV92723.1"
FT                   /translation="MTATRIFYEGRFVTLKEKIKTLGRFCTVGVGNTLIDFGVFFLLTA
FT                   CHVSYLPAQICSYTAGIINSYVWNRNWTFCVKGKADGKEVVRFLMINIAASGITFLLLY
FT                   LFQNCGCSLLVSKLAATIGGMMMNFIGNRIWVFGDSLKNIQDQE"
FT   gene            72692..73585
FT                   /locus_tag="BSn5_00440"
FT   CDS_pept        72692..73585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00440"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /note="COG1210 UDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92724"
FT                   /protein_id="ADV92724.1"
FT                   /translation="MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEE
FT                   AAESGIEDILIITGRNKRSIEDHFDRSAELEFNLREKGKTETLKEMQQIADLANIHYIR
FT                   QKEPLGLGHAVLCAEHFIGDEPFAVLLGDDIMVSETPALRQLMDVYDVYGTEVVGVQSV
FT                   LPEDVSKYGIINTSGSQGHVYEVNDLVEKPSPEEAPSEIAVMGRYVLNSSIFSVLKTIG
FT                   RGAGNEIQLTDALREVCRKEPIHARLLEGNRYDIGDKLGCFKASTEIGLMRSEMRSQLL
FT                   AYLEDVIKRETKEMLR"
FT   gene            73658..74254
FT                   /locus_tag="BSn5_00445"
FT   CDS_pept        73658..74254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00445"
FT                   /product="putative integral inner membrane protein"
FT                   /note="COG0586 Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92725"
FT                   /protein_id="ADV92725.1"
FT                   /translation="MGSLISEILTWLTNMGYAGIAIGLMIEIIPSEIVLAYGGYMVSEG
FT                   TIGFIGAIIAGVIGGTIAQIFIYWIGRYGGRPFLDKYGKYLLIKKHHIDMSENWFQKYG
FT                   AGVVFSARFIPVVRHAISIPAGIARMPFLKFVVLTVLAIIPWSILFVYLGIQLGSQWDD
FT                   VENIAGTYTTPIMILAVVVIALYFVIKKRTAIFKR"
FT   gene            complement(74304..75503)
FT                   /locus_tag="BSn5_00450"
FT   CDS_pept        complement(74304..75503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00450"
FT                   /product="putative ribonuclease"
FT                   /note="COG2404 Predicted phosphohydrolase (DHH
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92726"
FT                   /protein_id="ADV92726.1"
FT                   /translation="MYHLYSHNDLDGVGCGIVAKLAFGKDVEVRYNSVNGLNAQVQYFL
FT                   EKAKESNRQDALFITDLAVNEENEERLNEYVHAGGKVKLIDHHKTALHLNEHEWGFVQV
FT                   EYDDGRLTSATSLLYGYLVENGFMKPTNALDQFTELVRQYDTWEWERYDQKQAKRLNDL
FT                   FFLLSIDEFEAKMIQRLSTHDEFFFDDFEEKLLDLEDEKIERYLRRKKREMVQTFVHEH
FT                   CVGIVHAESYHSELGNRLGKDNPHLDYIAILSMGSKRVSLRTIHDYIDVSEIAGRYGGG
FT                   GHAKASGCSITDEVYELFVAEAFRIDPVRPDAFRNIYNLKGSANGSLYENRAQMRFFLF
FT                   PLDNEWNIQINGETQDETFAAFEEAEWFIKRNYAASLVRDEVFVAFLAENLKLANQHRK
FT                   "
FT   gene            complement(75673..77202)
FT                   /locus_tag="BSn5_00455"
FT   CDS_pept        complement(75673..77202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00455"
FT                   /product="putative propionyl-CoA carboxylase"
FT                   /note="COG4799 Acetyl-CoA carboxylase, carboxyltransferase
FT                   component (subunits alpha and beta)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92727"
FT                   /protein_id="ADV92727.1"
FT                   /translation="MDYEKERTERAERIRKGGAEKYHQSNREKGKLFVRERLSLLFDDD
FT                   IELEDAFFAECMSDGLPADGVVTGIGKIGGQTVCVMANDSTVKAGSWGAKTVEKIIRIQ
FT                   ETAEKLNCPLIYLVDSAGARITDQINVFPGRRGAGRIFYNQVKLSGRIPQICLLFGPSA
FT                   AGGAYIPAFCDIVVMVDGNASMYLGSPRMAEMVIGEKVSLEEMGGARMHCSISGCGDIL
FT                   AETEEEAIQLARAYLSYFPANFQEKAPIHEKRPPKHFDTPLADVIPQNQNAPFDMHELI
FT                   ERVIDEDSFFEIKALFAPELLTGLARIHGQPVGIVANQPKVKGGVLFHDSADKAAKFIT
FT                   LCDAFHIPLLFLADIPGFMIGTKVEQAGIIRHGAKMISAMSEATVPKLSVIVRKAYGAG
FT                   LYAMAGPAFEPDCCLALPTAQIAVMGPEAAVNAVYAKKIAELPEEERAAFISSKREEYK
FT                   EDINIYRLASEMIIDAVIPANSLRDELAKRLKAYMTKEMTFTNRKHPVYPV"
FT   gene            complement(77219..78001)
FT                   /locus_tag="BSn5_00460"
FT   CDS_pept        complement(77219..78001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00460"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="COG1024 Enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92728"
FT                   /protein_id="ADV92728.1"
FT                   /translation="MGNSILFTVKNEHMALITLNRPQAANALSAEMLRNLQMILQEIEF
FT                   NSNIRCVILTGTGEKAFCAGADLKERIKLKEDQVLESVSLIQRTAALLDALPQPVIAAI
FT                   NGSALGGGLELALACDLRIATESAVLGLPETGLAIIPGAGGTQRLPRLIGRGKAKEFIY
FT                   TGRRVTAHEAKEIGLVEHVTAPCDLMPKAEELAAAISANGPIAVRQAKFAINKGLETDL
FT                   ATGLAIEQKAYEQTIPTKDRREGLQAFQEKRRAVYKGI"
FT   gene            complement(78022..78921)
FT                   /locus_tag="BSn5_00465"
FT   CDS_pept        complement(78022..78921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00465"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="COG0119 Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92729"
FT                   /protein_id="ADV92729.1"
FT                   /translation="MSYPKKVTIKEVGPRDGLQNEPVWIATEDKITWINQLSRTGLSYI
FT                   EITSFVHPKWIPALRDAIDVAKGIDREKGVTYAALVPNQRGLENALEGGINEACVFMSA
FT                   SETHNRKNINKSTSESLHILKQVNNDAKKANLTTRAYLSTVFGCPYEKDVPIEQVIRLS
FT                   EALFEFGISELSLGDTIGAANPAQVETVLEALLARFPANQIALHFHDTRGTALANMVTA
FT                   LQMGITVFDGSAGGLGGCPYAPGSSGNAATEDIVYMLEQMDIKTNVKLEKLLSAAKWIE
FT                   EKMGKPLPSRNLQVFKSS"
FT   gene            complement(78936..79157)
FT                   /locus_tag="BSn5_00470"
FT   CDS_pept        complement(78936..79157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00470"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0511 Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92730"
FT                   /protein_id="ADV92730.1"
FT                   /translation="MTVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRS
FT                   GIVKEVKKNEGDFVNEGDVLLELSNSTQ"
FT   gene            complement(79172..80506)
FT                   /locus_tag="BSn5_00475"
FT   CDS_pept        complement(79172..80506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00475"
FT                   /product="acetyl-CoA carboxylase biotin carboxylase
FT                   subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0439 Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92731"
FT                   /protein_id="ADV92731.1"
FT                   /translation="MFTKVLIANRGEIAMRIIRTCSRLGIKTVAVYSEADKDAPHTKAA
FT                   TEAYLIGESRVSESYLNIERIIKTAKKANADAIHPGYGLLSENSRFAERCKQENIVFIG
FT                   PSPDIIEKMGSKIEARKAMEAAGVPVVPGVSESLGDIEAACRTASQIGYPVMLKASAGG
FT                   GGIGMQRVENEEALKKAYEGNKKRAADFFGDGSMYIEKVIEHARHIEVQLLADQHGHTV
FT                   HLFERDCSVQRRHQKVIEEAPSPFVDDELRMKIGQTAVKAAKAIGYTNAGTIEFIVDQK
FT                   QNFYFLEMNTRLQVEHPVTEEITGLDLVEQQLRIAAGHTLTFSQKDIQRNGHAIEVRIY
FT                   AEDPKTFFPSPGTITAFSLPDQKGVRHECAVAKDSTVTPFYDPMIAKMIVKGQTRTEAI
FT                   EKLETALRDYRVEGIKTNLPLLIQAAATKAFKEGDVTTDFLKQHL"
FT   gene            complement(80516..82165)
FT                   /locus_tag="BSn5_00480"
FT   CDS_pept        complement(80516..82165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00480"
FT                   /product="AMP-binding domain protein"
FT                   /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92732"
FT                   /protein_id="ADV92732.1"
FT                   /translation="MAELIHSTIGRLLEQTADAYPDRDAVVYPDRNIRYTYAQFDSLCR
FT                   QTAKGLMRMGIGKGDHVAIWASNIPEWLAVQFATAKIGAVLVTVNTNYQAHELDYLLKQ
FT                   SDAAALIIMDSYRGTSYPDIVNSLIPELQEAKPGQLKSERYPFLKTLLYIGNKRLPGMY
FT                   HWDDTEILAKTVTDAELEERMNSLDKDNVINMQYTSGTTGFPKGVMLTHFNVINNAANI
FT                   AECMALTSQDRMCIPVPFFHCFGCVLGVLACVSVGAAMIPVQEFDPVTVLKTVEKEKCT
FT                   ALHGVPTMFIAELHHPDFDAYDLSTLRTGIMAGSPCPSEVMKAVIERMGMKDITIAYGQ
FT                   TEASPVITQTRANDSFIRRVETTGRALPHTEVKIVEPGTCQEVQRGVQGELCTRGYHVM
FT                   KGYYKDKEATRKAINHDGWLFTGDLAVMDEDGYCRITGRLKDMLIRGGENIYPREIEEF
FT                   LYRHPAVLDVQVVGVPDAKFGEEAAAWIKLKDGKSVSPDELKAYCKGKIARHKIPRYVI
FT                   FTDDYPMTASGKIQKYKLREKTIEMFNLSSSQ"
FT   gene            complement(82209..83351)
FT                   /locus_tag="BSn5_00485"
FT   CDS_pept        complement(82209..83351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00485"
FT                   /product="acyl-CoA dehydrogenase, short-chain specific"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92733"
FT                   /protein_id="ADV92733.1"
FT                   /translation="MNFELTKEQQMVREMVKDFAKKEIAPHAEHVDQTGEFPMQTFEKM
FT                   GELGLMGIPFPEEYGGSGGDTISYALAVEEVGKACGSTGLSYAAAVSLGASPLYYFGTE
FT                   EQKQTHLTPLASGTALGSFGLTEPNAGSDAGGTQTKAISNGDEYVINGEKCWITNASYA
FT                   RTVIVTAVTGKNKDGKNIISALIVPTDTPGLTITSPYDKMGVRGSNTAEILLEDVRVPA
FT                   ANLLGDPTKGFKQFLYTLDGGRISIAALAVGIAQAALDASLAYAKERKQFGQPISSFQA
FT                   IQFKLADMAMEIDLARQMVLKAAWLKDHNRPFTKEAAYAKLFASEMATRACNQAIQIHG
FT                   GSGYMKEYGVERMLRDAKLMEIGEGTSEIQRLVIARKLLK"
FT   gene            complement(83442..83765)
FT                   /locus_tag="BSn5_00490"
FT   CDS_pept        complement(83442..83765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92734"
FT                   /protein_id="ADV92734.1"
FT                   /translation="MLFEDAVLTDPAEEAFLTNFLLLEAGTALVLCLVFFLYQKLDQSQ
FT                   FAVIKLGIWGSAVGLLIDTISLWNHPLILPALSKGQVIAFAIWMVCAYCMYLLIPLKLS
FT                   HKK"
FT   gene            complement(84009..85541)
FT                   /locus_tag="BSn5_00495"
FT   CDS_pept        complement(84009..85541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00495"
FT                   /product="hypothetical protein"
FT                   /note="COG1649 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92735"
FT                   /protein_id="ADV92735.1"
FT                   /translation="MKVCQKSIVRFLVSLIIGTFVISVPFMANAQSDRELRAVWIASVL
FT                   NIDWPSKKGLSVKEQKQEYIKLLDDVQKMGMNAVIVQIKPMADAFYPSAYGPWSEYLTG
FT                   VQGKDPGYDPLAFIIKETHKRNLEFHAWFNPYRITMNHTDLNKLSEDHPARKHPDWVAA
FT                   YGNQLYYHPGIPEARDFIVKGIEEVVKHYDIDAVHMDDYFYPYKIAGQEFPDQAQYEQY
FT                   GKGAFSNIDDWRRDNVNQLVKQINQTIKAAKPYVKFGISPFGVWRNAADDPTGSNTKAG
FT                   VRNYDDLYADTRHWIQEGDIDYIAPQIYWSIGFNAAAYDVLADWWSNEVKNRPVHLYIG
FT                   QAAYKINNNFDPPWSDPEEYVRQITLNRQLELVKGSMHFSLKDLNKNPLSIKDRLSTDL
FT                   YSKPALVPQMPWLDNTAPKKPKLTKVTEDKNGNLLQIKDHPSNLKTKETAYYAIYRAEG
FT                   KKQRTLLATQRKTHEQQTFLDNTADPNKKYTYYVTSADRLHNESKASKRTTK"
FT   gene            complement(85674..86066)
FT                   /locus_tag="BSn5_00500"
FT   CDS_pept        complement(85674..86066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00500"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92736"
FT                   /protein_id="ADV92736.1"
FT                   /translation="MDRLSFLTFIMLILASYRLTHLIVFDKITEFIRKPFMKKKRIVDQ
FT                   NGHVDEKSVPASNFGYMLNCYWCAGVWCAILIGLGYLFLPRIAIPLIFILAIAGAQAIL
FT                   ETAVGVGVKLIDVLKSLQTMMNDKKS"
FT   gene            complement(86176..89994)
FT                   /locus_tag="BSn5_00505"
FT   CDS_pept        complement(86176..89994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00505"
FT                   /product="plipastatin synthetase"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92737"
FT                   /protein_id="ADV92737.1"
FT                   /translation="MNTIKKIKNIYPLSHMQEGMLFHSFLRKEEGAYVEQSLFTIKGSL
FT                   SYDWFQRSIQAIIDRHDIFRTVFLPHVPHLSGPRQVVMTEREFHLNSEDISHLPTNDQN
FT                   EYIERFKEKDKQKGFDLQKDMLMRISLFKTAKDEHVCIWSHHHILMDGWCLGIVMQEFM
FT                   QIYQSIHAGKPLSLDPVRPYSTYISWLTNRDKEKAAAYWDTYLKNYSAPSPLPRVSDKE
FT                   TKEGYHREDLIFSLNKPLTDKLKETAKQHGVTLATLIQAVWGVMLQQYNRTDDVVFGAV
FT                   VSGRPSEIPGVEQMIGLFINTIPIRIKTHQDETFHELLIRCQKEMLEAEPFTCQPLFDI
FT                   QANTALKQELIDHIIVFENYPLQQKIADSADQTDSPLQIDQVQVSEQSGYNFNLVVAPG
FT                   EELVIKFSYNAFVYDAAWISCIKRQFTQALSTAAQHPHMPIADFSFLDATEKEQIVTQF
FT                   NNTKTEYPKNHTIIDLFREQAEKTPDHTALVYGNMSISYKELDKRSNALARELIQKGFR
FT                   QNETAGILAAHSPEFMISVLAVLKAGGAYLPLDAELPPERVSFMLEETQAKMLIVQKGL
FT                   EQNAAFSGTCMIADAQALMEENHFPINSSSSPDDLAYIMYTSGSTGRPKGVMITNRNVV
FT                   SLVSNSNYTSASGDDRFIMTGSISFDAVTFEMFGALLNGASLHIIDKSTMLTPDRFGAY
FT                   LLENDITVLFLTTALFNQLAQVRADMFRGLHTLYVGGEALSPALMNAVRHACPDLALHN
FT                   IYGPTENTTFSTFFEIKRDYAGPIPIGKPISNSTTYILDTKGRLLPIGVPGELCVGGDG
FT                   VAKGYLNRDDLTNALFSPHPFLPGERIYRTGDLARWLPDGNLEYISRIDRQMKIRGKRI
FT                   EPAEIEARLLEMEGVQEAAVTLREKDGEAQLYTHYVGDHKKTDTDFRADLARVLPDYMI
FT                   PQHWVRVERMPLTGNGKIDRSALPIPENKPAKRQDIILPRNLVEEELANIWKQVLGVNT
FT                   ISIDDDFFAIGGHSLKALQVIHTLKHQQNIDIPIDFLFEHPTIAQLAEKLYSKQLTAAN
FT                   EQHVIKLNQHGAQNLFCFPPISGFGIYFKDLALLLNEKAAVYGFHFIEQDTRIEQYVNC
FT                   MTDIQPEGPYVLLGYSAGGNLAFEVAQAMERKGLEVSDFIIVDAYLKEQPLPIDTGNDE
FT                   SAAYLPEAVREKVMKKKRNYQEYWAQLLNEGHIKASIHFIEAGIHPETSGHTGLTKWEG
FT                   ACGNYSEYTGFGAHKDMLEGTYAEKNADIILDILEKITSNQVILHKR"
FT   gene            complement(90023..100837)
FT                   /locus_tag="BSn5_00510"
FT   CDS_pept        complement(90023..100837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00510"
FT                   /product="plipastatin synthetase"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92738"
FT                   /protein_id="ADV92738.1"
FT                   /translation="MTKANSIQDIYPLSYMQEGMLFHSLLQKDSQAYVEQASFTIEGKV
FT                   NPQFFQNSINALVERHDIFRTIFISQNVSSPQQVVLRERNVIVLEENITHLNEAEQSQF
FT                   IEQWKEKDRDQGFHLQKDVLMRIALIQTGESQYSCIWTFHHIMMDGWCLSIVLKEFLHI
FT                   YASYVNASPITLEPVQPYGKYIKWLMEQDKEQAVSYWDHYLSGHEQQTVLPKQKKTKGK
FT                   SRQEHVTFSFSKEESSRLSELAAREEVTLSTIFHTIWGILLQKYNNNDDAVFGSVISGR
FT                   PAEIEGIEHMVGLFINTMPVRVQGAKTPFLQLIKDMQKDRLAAEAYSYHPLYEIQSRSA
FT                   VKQGLIDHILVFENYPVQQEIQMLNKQEHASDLFQIHNFTVADETNYSFYLMVAPGEEI
FT                   HIKMNYDAEQHDRSFVLSVKEHLLNAVSQILNNPNLPPEEIDITTDTEKRQLIGEITDQ
FT                   TPVYETIHAMFEKQAEKTPDAHAVIDQACSLTYRELNKAANRLARHLRMKGVVRQEPVA
FT                   IMMERSAAFITGVLGILKAGGAIVPVDPHYPADRIRYILHDCGCSHVVSQAHLPSSLED
FT                   NYIITHPEDIESKVDGSNIKSVNNADDLLYMIYTSGTTGKPKGVQFEHRNMANLLKFEY
FT                   THSGIDFEADVLQFATPSFDVCYQEIFSALLKGGTLHIVPEAIKRDVPQLFAFINKHQT
FT                   NIVFLPTAFIKMIFSERELANSFPDGVKHLIAAGEQLMISDLFQDVLRKRGIHLHNHYG
FT                   PSETHVVSTYTIHPGDPIPELPPIGKPIGCTDLYILNHQKQLQPCGVPGELYISGASVA
FT                   RGYVNHDKLTSDKFSSDPFKPDVIMYRTGDLARRLEDGNIEYIGRADNQVKIRGYRIEP
FT                   QEIEVTLMNHPDISEAAILIWQDQNGEHELCAYYCSVQKLNAIDLRSYMASELPEYMIP
FT                   SKWIWVDSIPLTPNGKVDRAALPEPDASISGNPYTAPRNLLEAKLSQLFEDVLKNGHIG
FT                   IQDNFFDNGGHSLKATVLMSRIAKEFHVQVSLKDIFAHPTVEGLALIIREAEQNLYAAI
FT                   EPAEERDTYPVSSAQKRIYVLQQLDEGVAYNMPAVLELEGALDVAKLSAVCKELISRHE
FT                   PLRTSFVSGADDEPVQRIHTEVPFTLSKETTIEGFVRPFCLSQAPLFRAGLIEVSNEKH
FT                   VLLVDMHHIISDGVSVQLLIREFTDLYANRQLKPLRIQYKDYAVWQQKFKKGDSYQKQE
FT                   TYWQQQFSGDLPILELPTDKRRPAERQFIGGKVTFQLDKEITARIKRLAHKNRSTLYMT
FT                   LLALYSAFLSRLSGQDDIVIGSPIAGRPHADLEAVLGMFVNTLALRTRPAGNKTFEEFL
FT                   KEVRQTALEAYEHQDYPFEELVDKLGVQREMSRNPLFDTTLVLQNMEQQKLKMNDVQLQ
FT                   WNDLEHPISKFDISLYVTEHDSELFCQFEYSTALFEKETIQRWASLFTTLVEHTAASPE
FT                   TELDNIPILTKEEERDFIESCHLFEETGYSMNQTLHYALEQQAEKTPDQAAVIFEDGVM
FT                   TYKELNEQANRIAWELIGRGVKPETTVAIIGKRSPEMLLGIYGILKAGGAYLPIDPDYP
FT                   EERISFLLEDSGTNILLLQSAGLHVPAFTGEIVYLNQTNSGLAHRLSNPNVDVLPQSLA
FT                   YVIYTSGSTGMPKGVEIEHRSAVNFLNSLQSRYQLKHSDMIMHKTSYSFDASIWELFWW
FT                   PYAGASVYLLPQGGEKEPEVIAKAIEEQKITAMHFVPSMLHAFLEHIKYRSVPIKTNRL
FT                   KRVFSGGEQLGTHLVSRFYELLPNVSITNSYGPTEATVEAAFFDCPPQEKLERIPIGKP
FT                   VHHVRLYILNQNQRMLPVGCIGELYIAGAGVARGYLNRPALTEERFLEDPFYPGERMYK
FT                   TGDVARWLPDGNIEFLGRTDDQVKIRGYRIEPGEIEAALRSIEGVREAAVTVRTDSGEP
FT                   ELCAYIEGLQRNEVRAQLERLLPGYMVPAYMIEMKQWPVTPSGKLDRNALPAPGGAADA
FT                   ETYTAPRNVTEMKLSQLWEDVLKNGPVGIHDNFFDRGGHSLKATALVSRITKEFDVQVP
FT                   LKDVFAHPTVEGLAAVIREGTDSPYEAIKPAEKQETYPGFLCPKADLCPSAAGRRRDRL
FT                   QYAGCVRARREAQPERMDRAFKELIKRHESLRTSFEQDAGGDPVQRIHDEVPFTLQTTV
FT                   LGERTEQEAAAAFIKPFDLSQAPLFRAQIVKVSDERHLLLVDMHHIISDGVSVNILIRE
FT                   FGELYNNRNLPALRIQYKDYAVWQEGFKTRDAYKTQGAYWLKQLEGELPVLDLPADHAR
FT                   PPVRSFAGDKVSFTLDQEVASGLHKLARENGSTLYMVLLAAYTAFLSRLSGQEDIIVGS
FT                   PIAGRPHKDLEPILGMFVNTLALRTRPEGGKPFVQYLQEVRETALEAFEHQDYPFEELV
FT                   DKLELTRDMSRNPVFDAMLVVQNNDYERLHLHDLQMKPAQVSHLVSKFDLTLQASEGDG
FT                   NIHFLFEYSTALFEKTTIERWASHLTNVLSIIGKNPEVTLNHIDILTQEERHQLLNEFN
FT                   TRQANQYGVQTISQLFEQQAARTPKATALVSGDKTLTYQELDEWSNGIARALRNRGVKP
FT                   DTPVGIMMHRSFSMIASILGVWKAGGCYVPIDPEYPKERKRYILSDSGTKLLMTINEAD
FT                   LGVLADFEGEILTIESVEEDDKSPLPQMSSAHHLAYIIYTSGTTGRPKGVMVEHKGIAN
FT                   TLQWRRNAYAFNETDTILQLFSFSFDGFITSMFTPLLSGAKAVLLHEEEAKDILAIKHQ
FT                   LSRQRITHMIIVPVLYRALLDVVQPEDVKTLRVVTLAGEAADRELIARSLAICPHTELA
FT                   NEYGPTENSVATTVMRHMEKQAYVSIGQPIDGTQVLILNSNHQLQPIGVAGELCIAGTG
FT                   LARGYVNLPELTERAFTQNPFKPEARMYRTGDAARWMADGTLEYLGRIDDQVKIRGYRV
FT                   ETKEIESVIRCIKGVKDAAVVAHVTASGQTELSAYVVTKPGLSTNAVRSELQNKLPVFM
FT                   HPAFIEKLDSLPLSPNGKLDRGALPKPVYNHEGERPFLPPSSKMEQILADIWKEVLGAE
FT                   KIGTADSFFELGGDSIKALQVSARLHRIGKQMAVKDLFSHPTIQELAAYIRDSDTSSSQ
FT                   AAVEGDVQWSPVQKWFLSQDIKEKHHFNQSVMLHRSTSVQEDALRKTLKAITCHHDALR
FT                   MVFTQNEQGKWDQYNRPLSHSDDALYGLQMIDLSAPDGTDGNRAYEPIIKRHVLDIQQK
FT                   MDLKNGPLLQAGLFHTIDGDFLFLSAHHLVVDGISWRVLLEDLALGYRQAAGGGKEIQL
FT                   PPKTSSFKAYTKKLSDYAESQQLMKQLKYWREAEEYQTEALPFDHIDGTRAHEGQRSTI
FT                   SFTLNEKETAALLKDANSAYNTDTQDMLLASVILALRHWTNQSAFKLSLEGHGREDVLK
FT                   GIDVSRTIGWFTAIYPLLIKLNADLPDSEESMVHVLKTTKDTLRRVPDKGFGYGVIKYL
FT                   TPPGKKDINFTGAPEISFNYLGQFESGRTAEVPEEDAFSFSPLGAGGDISTTWNREQSL
FT                   DISAIAAEGKLTVNMTYDNARFQRKTIEQLSETCRQFLLQLIEHCQNKSETEKTISDFD
FT                   DQELTEDALQEIADMLSFH"
FT   gene            complement(100863..108530)
FT                   /locus_tag="BSn5_00515"
FT   CDS_pept        complement(100863..108530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00515"
FT                   /product="plipastatin synthetase"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92739"
FT                   /protein_id="ADV92739.1"
FT                   /translation="MPQQPEIQDIYPLSFMQEGMLFHSLYDEQSRAYFEQASFTINGQL
FT                   DLERFQKSMDAVFDRYDIFRTAFIYKNVAKPRQVVLKQRHCPVHVEDISHLNEKDKEHC
FT                   TEAFKEQDKSRGFDLQTDVLMRISILKWAPDHYVCIWSHHHILMDGWCLGIVIKDFLHI
FT                   YQALGKGQFPDLPPVQPYGTYIKWLMQQDREEAAEYWKKRLQHFEKASPLPKRTDQMSD
FT                   GTLQQITFTIPEKETSELQKIAAACGATLNTVFQALWGIMLQKFNRRDDAVFGSVISGR
FT                   PSELKDVENMVGLFINTIPIRVQSDFLSFSDLVSGMQKDMTEAEAYSYFPLYDIQAQSA
FT                   LKQELIDHIIVFENTPTQQEIEELNQAGSFDFSVKDFEMEEVTNYRCSVKVIPGRTLYV
FT                   RIHFHTGTYQPNMMSEIKDYLQHMISDVISDPSLPVSKMTLLDEDKTRKIVSQNNRTVS
FT                   VSPKAPTLHGLFERQAAVTPERPAIRFSGGLLTYAELDMYASRLAAHLAARGVTNESIV
FT                   GVLSERSPDMLIAVLAVLKAGGAYLPLDPAYPKERVSYMLKASGASLLLTQPGCSAPNF
FT                   SGETLEVDMTSLASEKAENHLFTPADGGSLAYVIYTSGSTGQPKGVAVEHRQAVSFLTG
FT                   MQYQFPLSEDDIVMVKTSFSFDASVWQLFWWALSGASAYLLPPGWEKDSALIVQAIHQE
FT                   KVTTAHFIPAMLNSFLDQAEMLALGDGTNLKRVFAGGEPLAPRTAARFASVLPQVSLIH
FT                   GYGPTEATVDAAFYVLDPERDRDRLRIPIGKPVPGARLYVLDPHLAVQPSGVAGELYIA
FT                   GAGVARGYLNRPALTEERFPEDPFYPGERMYKTGDVARWLPDGNIEFLGRTDDQVKIRG
FT                   YRIEPGEIEAALRSVEGVREAAVTVRTGSGEPELCAYIEGLQRNEVRAQLERLLPGYMV
FT                   PAYMIEMEQWPVTPSGKLDRNALPAPGVAADAETYTAPRNVTEMKLSQLWEDVLKNGPV
FT                   GIHDNFFDRGGHSLKATALVSRITKEFDVQVPLKDVFAHPTVEGLAAVIREGTDSPYEA
FT                   IKPAEKQETYPVSSAQKRIYVLQQLEDGGTGYNMPAVLELEGKLNPERMGRAFKELIKR
FT                   HESLRTAFEQDAGGDPVQRIHDEVPFTLQTTVLGARTEEEAAAAFIKPFDLSQAPLFRA
FT                   QIVKVSDERHLLLVDMHHIISDGVSVNILIREFGELYNNRKLPALRIQYKDYAVWQEGF
FT                   KTGDAYKTQEVYWLKQLEGELPVLDLPADHARPPVRSFAGDKVSFTLDQEVASGLHKLA
FT                   RENGSTLYMVLLAAYTAFLSRLSGQEDIIVGSPIAGRPHKDLEPILGMFVNTLALRTRP
FT                   EGGKPFVQYLQEVRETALEAFEHQDYPFEELVDKLELTRDMSRNPLFDVMFVLQNMDQE
FT                   SLELNELCLKPAAHNGHQTSKFDLTLYTQEQPRGLLTFQMEFSTDLYKKKTIEKWLQYF
FT                   INMLLSIIKDNKAALGTINILNEDETHYLIHELNRTKIDYPRNETISRLFEMQAEQTPN
FT                   AVAIVSDTQVFTYEDLNSWANQIASVLQIKGVGPDSVVALLTGRTPELIAGMLGILKAG
FT                   GAYLPIASDLPVERIAYMLSDSGAALLLQSEKTEKQLLDIECEQIIIEDIQKQGKTKNV
FT                   DSSAGPHSLAYIIYTSGSTGKPKGVMIEQRSVIRLVKNSNYITFTPEDRLLMTSSIGFD
FT                   VGSFEIFGPLLNGAALHLSDQQTFLDSHQLKRYIEHQGITTIWLTSSLFNHLTEQNEQT
FT                   FSQLKHLIIGGEALSPSHVNRIRNVCPEVSIWNGYGPTENTTFSTCLHIQKTYELSIPI
FT                   GRPVGNSTAYILNQWGVLQPVGAVGELCVGGDGVARGYLGRPDLTKEKFVPHPFAPGDR
FT                   LYRTGDLARWLPDGTIEYVGRIDDQVKVRGYRVELGEIETAFRQIDGVKEAAVLARTAQ
FT                   TGSKELFGYISVKAGTNAEQVRSLLACSLPNYMIPAYIIEMENLPLTSNGKLNRKALPE
FT                   PDFASKQTYIPPRNELEEQLALIWQEVLGIQRIGIEDSFFELGGDSIKALQVSARLGRH
FT                   GLSLQVSDLFRRPKIKDLSPFIRKTERVIEQGPVQGDVPWTPIQKWFLSQDIEERHHFN
FT                   QSVMLFHTDRLSEDALRASLKKLAEHHDALRMVYRNDDRRWIQINQGIHESQLYSLRTF
FT                   DLSQSESGWETQIKQEVADLQQSINLQEGPLLHAALFKTLTGDYLFLAIHHLVVDGVSW
FT                   RILLEDLSAGYQQAAAGQTIQLPPKTDSYQEYARRIQEYAQSSKLIREEAYWRTVEEQQ
FT                   DAELPYEIPHQVNIDFSKRDSLNFSLTEADTAVLLQNVNHAYGTDTQDILLTAASLAIC
FT                   EWTGGSKLRIAMEGHGREHILPELDISRTVGWFTSMYPALISFENHRDELGTALKTVKD
FT                   TLGRIPNKGVGYGMLKYLTHPENKSITFSKTPEISFNYLGQFNDIERQDTFRPSSLGSG
FT                   KDITHTWKREQIIEMSAMAADKKLHFNLSYPPARFHRNTMEQLINRIEHFLLDIMKHCA
FT                   GQQKTEKTLSDFSSQSLTAEDLDSISSLVEEL"
FT   gene            complement(108547..116229)
FT                   /locus_tag="BSn5_00520"
FT   CDS_pept        complement(108547..116229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00520"
FT                   /product="plipastatin synthetase"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92740"
FT                   /protein_id="ADV92740.1"
FT                   /translation="MAQSAQIQDIYPLSHMQEGMLFHSLMDFSSKAYIEQTSFTITGNL
FT                   CVDSFQKSLNLLVSRYDIFRTIFIKEVPDLTGPQQVVLSNRELTVYREDISRLADQEQQ
FT                   TLIDAFMTKDREKGFDLQKDPLMRLALFDRGDSQYTCVWTHHHIIMDGWCLGIILKEFF
FT                   SMYDSLKNNSPVQLGSTVPYSRYIEWLGEQDQEETAAYWSEYLKEYGNTASIPRIKRRT
FT                   ADGNYKADQVSFSLAQEMVEKLTKAAQNWGVTLNTLFMSIWGVLLHRYNAADDAVFGSV
FT                   ISGRPSAIDGIESMVGLFINTVPVRIRSAEGITFSSLVKAVQEDILSSEQHGYYPLYEI
FT                   QNHSPLKQGLIDHIFVFENYPVQLHHALSVESENDEGALKLSDISMSEQTNYDFNIVIV
FT                   PGESFYIKFSYNADVYEREEMLRIQGHLKQALDCILTNPDVAVSDINIVPPEEQQVIQL
FT                   FNETERPYVNKTIPQLFEEQARKTPEAAALKMGDDCWTYRQLNIRANQIAHALIEKGVR
FT                   SGDIVAVMMGRSMEMPAALLGIWKAGGAYMPLDPHFPAERLSFLLKDSQAAQLLIEEDL
FT                   ISLIPPSYEGNTITIEHTESYQTEAPNMPPGDLAYLIYTSGTTGRPKGVLVDHHGIANT
FT                   LQWRREEYSMTEQDISLHLFSYVFDGCVTSLFTPLLSGACVLLTTDDEAKDVLALKRKI
FT                   ARYKVSHMIIVPSLYRVLLEVMTADDAKSLRIVTFAGEAVTPDLLELSQMICPYAELAN
FT                   EYGPTENSVATTILRHLNEKERITIGHPIRNTKVFVLHGNQMQPIGAAGELCISGAGLA
FT                   RGYYKQQELTQKAFSDHPFLEGERLYRTGDAGRFLPDGTIEYIGRFDDQVKIRGYRIEL
FT                   REIETVLRQAPGVKEAAVLARDVSAEEKELVAYIVPEKGNSLPDLYQHLAGTLPSYMIP
FT                   ASIINISRMPLTSSGKLDRFALPEPENNTSVTYMAPRTLIEADLAHIWEDVLNKQHIGI
FT                   RDDFFQLGGQSLKATALVSRIHKKLNVELPLSEVFSYPTVESMAVKLMSLKEHAFTQIE
FT                   PADQRDVYPLSFSQKRLYALHQLADDSTGYNMPAVLELRGNLNHQRLRSVLTELVNRHE
FT                   ALRTVFVLDRDEPVQIIYPEIAFDLKELEMESEQMLESAIETFIKPFDLSSGPLFRACV
FT                   ITMGNNRGFLLLDMHHIIADGVSMSTLVQEFTDLYCGKELPALNLHYKDFAVWQQEKYP
FT                   KELYKKQEAYWLGQLGGSLPTLELPLDKTRPRLPDFSGGTIEVNIDKDMTDELHRLMAE
FT                   TGTTLYMILLAVYSILLSKLSGQEDIVVGSPAAGRPHADLERVIGMFVNTLAMRSKPEG
FT                   HKTFSSYLQDIRHLALTAYEHQDYPFEELADKVDTNREVNRNPLFDAMLVLQSSEDFRF
FT                   EVPGLSISSVTPKHDISKFDLTLHAEEHPSGIRCRFEYSTALFEEETITRWASYFIELV
FT                   KGVTADTEMRISDVQLLPAAERRLLLEKMGQYAAYPRNENIVSLFEKQAAKYPEHIAVV
FT                   CGHSQLTYRDLNEKAERAAAMLIKQGVRTGDIVGLMLDRSPDMIIGILSILKAGGAYLP
FT                   IDPEYPQERISFMLNDSGAKLLLTERGQNKPADYTGHILYIDECENDSIPADANIQEIV
FT                   TDQPAYVIYTSGTTGQPKGVIVEHSNVISLLKHQNLPFEFNHEDIWTLFHSYCFDFSVW
FT                   EMFGALLNGSTLVVVSKETARDPHAFRLLLKKERVTVLNQTPTAFYGLMHEDQNHPDRL
FT                   NVRYVIFGGEALQPGMLQSWNKKYPHTDLINMYGITETTVHVTFKKLSAADIAKNKSNI
FT                   GRPLSTLQAYVMDAHMNLQPIGVPGELYIGGEGVARGYLNRDELTSDRFVSNPYLPGDR
FT                   LYRTGDLARRLSNGELEYLGRIDEQVKVRGHRIELGEIQAALLQYPMIKEAAVITRADE
FT                   QGQTAIYAYMVIKDQQAANISDIRTYLKNALPDFMLPARMIQIDSIPVTVNGKLDQKAL
FT                   PEPEKHAYTADDISPRNEIETVMAEIWEELLNVDELGVSANFFELGGDSIKALQVCARL
FT                   KQRGFETTVREMFEHQTLGELSARVRKDVRAIDQGPVEGEITWTPIQQWFFSQSLESHH
FT                   FNQSVMIYRAERFDEAALRKVLKSLVTHHDALRIVCRHEDGRQVQINRGIDLSDEELYA
FT                   LELFDVKDSLTEARNTIEEAASRMQEHIRLETGPLLHAGLFRTENGDHLFLTIHHLVVD
FT                   AVSWRILFEDFSAAYKQAVSGESIKLPQKTDSYLTYSQRIADYSKSRQVQREAAYWDEC
FT                   ENRHIQPIPKDNDASSNTFKDTEVIDFELSRHHTELLLTAAHKAYSTEMNDILLTALGL
FT                   ALQKWTGNNQFKISMEGHGRESYLEKIDISRTVGWFTSIYPVWLDMRDSDHKDKEERLG
FT                   HLIKQTKDMLHRIPHKGAGYGVLKYISKRWGSQKNSPEISFNYLGQFDQDIQSNAFEVS
FT                   DIKPGNEISPNWERPYALDISGAVSSGCLNMHIIYNRFQFEEKTIQTFSRHFKQTLENI
FT                   IEHCTGKENHEWSASDFTDEDLTLDELSEIMGAVNKL"
FT   misc_feature    complement(116254..123938)
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|255767429|ref|NP_389716.2| plipastatin synthetase"
FT   gene            complement(124320..125795)
FT                   /locus_tag="BSn5_00535"
FT   CDS_pept        complement(124320..125795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00535"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="COG2027 D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 4)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92741"
FT                   /protein_id="ADV92741.1"
FT                   /translation="MKKSIKLYVAVLLLFVVASVPYMHQAALAAEKQDALSGQIDKILA
FT                   DHPALEGAMAGITVRSAETGAVLYEHSGETRMRPASSLKLLTAAAALSVLGENYSFTTE
FT                   VRTDGTLKGKKLNGNLYLKGKGDPTLLPSDFDKMAEKLKHSGVKVIKGNLIGDDTWHDD
FT                   MRLSPDMPWSDEYTYYGAPISALTASPNEDYDAGTVIVEVTPNQKEGEEPAVSVSPKTD
FT                   YITIKNDAKTTAAGSEKDLTIEREHGTNTITIEGSVPVDANKTKEWISVWEPAGYALDL
FT                   FKQSLKKQGITVKGDIKTGEAPSSSDVLLSHRSMPLSKLFVPFMKLSNNGHAEVLVKEM
FT                   GKVKKGEGSWEKGLEVLNSTLPEFGVDSKSLVLRDGSGISHIDAVSSDQLSQLLYDIQD
FT                   QSWFSAYLNSLPVAGNPDRMVGGTLRNRMKDTPAQGKVRAKTGSLSTVSSLSGYAETKS
FT                   GKKLVFSILLNGLIDEEDGKDIEDQIAVILANQ"
FT   gene            complement(125829..126806)
FT                   /locus_tag="BSn5_00540"
FT   CDS_pept        complement(125829..126806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00540"
FT                   /product="putative epimerase"
FT                   /note="COG2017 Galactose mutarotase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92742"
FT                   /protein_id="ADV92742.1"
FT                   /translation="MANFIEKITYLGTPAIKAGNEHLEMIVVPEWGSNVISLVDKTTKV
FT                   QLLREPETAESFHDTPTLYGIPILFPPNRISDGTFSFRGRTYHFDINEKDKHNHLHGFL
FT                   YHEKWNVVTTKQTDEGVIVETEIDLSELPHVQKQFPHHAVVRMTYTIKENTLFKHATVM
FT                   NKGKEAFPWGIGYHTTFVFPAESSLFSLTADQQWELDERLLPTGKLMDVPNKEALHEGM
FT                   DLRHKQLDDVFLSSYQKRGGENQAVIYHQHAHISIIYKADEQFNHWVVYNADGKQGYLC
FT                   PEPYTWVTNAVNLDLPSSLTGLQVLEPGEETTAKSSITIELNHQ"
FT   gene            complement(126940..128331)
FT                   /locus_tag="BSn5_00545"
FT   CDS_pept        complement(126940..128331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00545"
FT                   /product="putative efflux transporter"
FT                   /note="COG0534 Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92743"
FT                   /protein_id="ADV92743.1"
FT                   /translation="METSQEPLVTQKKSKPSVWRSMSLFLVPLLLSNVLQSVGQLVGMM
FT                   AVGRWLGVDAVAAVSSFFPLFFLLISFTIGIGSGSSILIGQAYGAKNEERLKAVVGTTL
FT                   TFTFLLGVVLAVIGSIFTLDILRLMGTPENVIHVSANYARILFYAMPFMFLYFAYTTFL
FT                   RGTGDSKTPFYTLIVSTVINIALLPVLILGMFGFPKLGIYGSAYATVISTIATFLVLMV
FT                   YLRKRKHPLQFDKTVRRYLKMDKELLVLLLRLGVPASINMILVSLSEIAVISFVNHYGS
FT                   NATAAYGVVNQVASYVQMPAVSLGIAVSIFAAQSIGANEFDRLKQVIRVGIWLNYIIGG
FT                   VLIILIYVFSHQILSLFLTEQETLYIAHRLLMITLWSYLLFGNAQIISATMRASGTVLW
FT                   PTVISIFAIWGVEVPVAFVLSHYTKLEILGVWVGYPAAFAVSLLLIYGYYQFVWKKKQI
FT                   TRLIQ"
FT   gene            128618..129163
FT                   /locus_tag="BSn5_00550"
FT   CDS_pept        128618..129163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00550"
FT                   /product="inhibitor of cell-separation enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92744"
FT                   /protein_id="ADV92744.1"
FT                   /translation="MKKCLLFLTTIALILSLSTNAFAKNTSGDLSQKQALQLALSAREH
FT                   FWNTMSGHNPKVKKAVCPSGTFEYQNLQYVYMCSDLGTKAKAVNYLTPIFTKTAIEKGF
FT                   KDYHFTVSKGKLAVPIGDGDNLLNWKKSTAKLISKKGGTITYEFTVPTLDGSPSAKRKV
FT                   TFVKENKKWKVNQFDAVI"
FT   gene            complement(129257..129329)
FT                   /locus_tag="BSn5_t20892"
FT   tRNA            complement(129257..129329)
FT                   /locus_tag="BSn5_t20892"
FT                   /product="tRNA-Arg"
FT   gene            complement(129382..129927)
FT                   /locus_tag="BSn5_00555"
FT   CDS_pept        complement(129382..129927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00555"
FT                   /product="putative bacteriophage integrase"
FT                   /note="COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92745"
FT                   /protein_id="ADV92745.1"
FT                   /translation="MHIVQPIRSLEKIQEVKQYLLNKNKRDYFLFIFGINSALRISDIL
FT                   PLQVKDVQNKDHLWATESKTKKKRKILILESLKQEIYEYTKDMKENEYLFKSVRTRKPI
FT                   SRIQAYRILREAAAACGLEEIGTHTLRKTFGYHFYQRTKDIAELQRILNHSSPSITMRY
FT                   IGIDEDTTRAAYKVFGGL"
FT   gene            complement(130244..130474)
FT                   /locus_tag="BSn5_00560"
FT   CDS_pept        complement(130244..130474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00560"
FT                   /product="putative excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92746"
FT                   /protein_id="ADV92746.1"
FT                   /translation="MYLTIEETAEYTNLSEDYIKSLVLEGKIRAVHDGEQFLIYKEQFK
FT                   THLEQLENYKALVQEILNEPIPEDIDVKDED"
FT   gene            130643..132406
FT                   /locus_tag="BSn5_00565"
FT   CDS_pept        130643..132406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00565"
FT                   /product="gamma-glutamyltransferase"
FT                   /note="COG0405 Gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92747"
FT                   /protein_id="ADV92747.1"
FT                   /translation="MKRTWNVCLTALLSVLLVAGSVPFHAEAKKPPKSYDEYKQVDVGK
FT                   DGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKT
FT                   KDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGT
FT                   RSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQ
FT                   KDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQ
FT                   GYQIATTPPPSSGGIFLLQMLKILDDFNLSQYDVRSWEKYQLLAETMHLSYADRASYAG
FT                   DPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQPKDKV
FT                   EGQTTHFTVADRWGNVVSYTTTIEQLFGTGIMVPDYGVILNNELTDFDAIPGGANEVQP
FT                   NKRPLSSMTPTILFKDDKPVLTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIY
FT                   TNSMSSYRYEDGVPKDVLSKLNGMGHKFGTSPVDIGNVQSISIDHENGTFKGVADSSRN
FT                   GAAIGINLKRK"
FT   gene            complement(132594..133451)
FT                   /locus_tag="BSn5_00570"
FT   CDS_pept        complement(132594..133451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00570"
FT                   /product="transcriptional regulator (LysR family) protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92748"
FT                   /protein_id="ADV92748.1"
FT                   /translation="MESGDLKIFQAVAREGSITKAAQMLNYVQSNVTARVHKLEEDLNI
FT                   RLFHRTNRGMKLTAAGENLLQYADQVLSLLDKAEKSTRMSRQPKGPLRIGSLETTAVTH
FT                   LPEHAASFLRRFPEVDLSVNTADTHHLIQQVLDHKVDGAFVYGPVEHAAVRQLHVSHDE
FT                   LVLISAREGMAEDMLQQPMLFFGAGCSHRDRVKRLLEEAGIHNQKIIEFGTLEAIIKGV
FT                   SAGMGTALLPKSSVDCSEHRTNVWIHQLPPAYQDLEIVFIYRKDFFITSAFQTFLDEIN
FT                   EMKR"
FT   gene            133580..134569
FT                   /locus_tag="BSn5_00575"
FT   CDS_pept        133580..134569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00575"
FT                   /product="putative oxidoreductase"
FT                   /note="COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92749"
FT                   /protein_id="ADV92749.1"
FT                   /translation="MKAVIHNGKAGLQGLSVEDAPSTKPGYGEVKVKLKSAGLNHRDLF
FT                   LMKNKSEQDPHMILGSDGAGIIEEIGEGVKNVTVQTEVVIFPTLNWDLTENVPPVPEIL
FT                   GGPSDGTLAEYVIIPSQNAIKKPAYLSWEEAGVLPLSALTAYRALFTKGQLKKGEHLLI
FT                   PGIGSGVATYALFMAKAIGATVSVTSRSEEKRKKALKLGADYAFDSYSNWDEQLQGKKA
FT                   DVVLDSIGPALFSEYFRHVKPNGRIVSFGASSGDNLSFPVRSLFFPQVNVLGTSMGSSE
FT                   EFQAMLAFIDKHKLRPVIDRIYPLEKACEAYKRMQEGRQFGNIGIVME"
FT   gene            complement(134626..136107)
FT                   /gene="gltD"
FT                   /locus_tag="BSn5_00580"
FT   CDS_pept        complement(134626..136107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="BSn5_00580"
FT                   /product="glutamate synthase subunit beta"
FT                   /EC_number="1.4.1.13"
FT                   /note="COG0493 NADPH-dependent glutamate synthase beta
FT                   chain and related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92750"
FT                   /protein_id="ADV92750.1"
FT                   /translation="MGKPTGFMEIKREKPAERDPLTRLKDWKEYSAPFSEEASKRQGAR
FT                   CMDCGTPFCQIGADINGFTSGCPIYNLIPEWNDLVYRGRWKEALERLLKTNNFPEFTGR
FT                   VCPAPCEGSCTLAISDPAVSIKNIERTIIDKGFENGWIQPRIPKKRTGKKVAIVGSGPA
FT                   GLASADQLNQAGHSVTVFERSDRAGGLLTYGIPNMKLEKGIVERRIKLLTQEGIDFVTN
FT                   TEIGVDITADELKEQFDAVILCTGAQKQRDLLIEGRDSKGVHYAMDYLTLATKSYLDSN
FT                   FKDKQFIDAKGKDVIVIGGGDTGADCVATALRQKAKSVHQFGKHPKLPPARTNDNMWPE
FT                   QPHVFTLEYAYEEAEAKFGRDPREYSIQTTKMVADKNGKLKELHTIQMEKVKNEHGKYE
FT                   FRELPGTEKVWPAQLVFIAIGFEGTEQPLLKQFGVDSVNNKISAAYGDYQTNIDGVFAA
FT                   GDARRGQSLIVWAINEGREVAREVDRYLMGSSVLP"
FT   gene            complement(136124..140686)
FT                   /locus_tag="BSn5_00585"
FT   CDS_pept        complement(136124..140686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00585"
FT                   /product="glutamate synthase (large subunit)"
FT                   /note="COG0067 Glutamate synthase domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92751"
FT                   /protein_id="ADV92751.1"
FT                   /translation="MTYNQMPKAQGLYRPEFEHDACGIGLYAHLKGKQTHDIVKQGLKM
FT                   LCQLDHRGGQGSDPDTGDGAGLLVQIPDAFFRKECKDINLPEKERYGVGMVFFSQKEDE
FT                   RKKIEKQINALIEQEGQVVLGWRTAPVNVGKIGTVAQKSCPFVRQVFIGASSDLKDNLS
FT                   FERKLYVIRKQAENWGVTEGLDFYFASLSSQTIVYKGLLTPEQVDAFYSDLQDEAFVSA
FT                   FALVHSRFSTNTFPTWERAHPNRYLVHNGEINTLRGNINWMRAREQQFVSESFGEDLNK
FT                   ILPILNADGSDSSILDNAFEFFVMAGRKPAHTAMMLIPEPWTENTHMSKEKRAFYEYHS
FT                   SLMEPWDGPTAISFTDGKQIGAILDRNGLRPARYYVTKDDYIIFSSEVGVIEVEQENVL
FT                   YKNRLEPGKMLLIDLEEGRIISDEEVKTQIATEYPYQKWLEEELVQVNPDPESREEEQF
FT                   SDLLTRQKAFGYTYEDIQKYLIPVIKEGKDPLGSMGNDAPLAVLSDRAQSLFNYFKQLF
FT                   AQVTNPPIDAIREQLVTSTMTWLGAEGDLLHPSERNVRRIKLYTPVLSNEQFYALKTIV
FT                   HPDLKSQKIDVLFSEDLERGLKDMFTQAEKAISQGVSLLILSDKKMNERLIPIPPLLAV
FT                   SALHQHLIRKGLRTKVSIIVESGEAREVHHFAALIGYGADAINPYLAYATYKQEIDEGR
FT                   LDISYEEAVSKYGKSITEGVVKVMSKMGISTVQSYRGAQIFEAVGISRDVIDRYFTGTA
FT                   SQLGGIDLQTIAEEAQRRHREAYQDDYSKTLEPGSDFQWRNGGEHHAFNPKTIHTLQWA
FT                   CRRNDYNLFKQYTKAADEERIGFLRNLFAFDGNRKPLKLEEVESAESIVKRFKTGAMSF
FT                   GSLSKEAHEALAIAMNRLGGKSNSGEGGEDSKRFVPDENGDDRRSAIKQIASGRFGVKS
FT                   HYLVNADELQIKMAQGAKPGEGGQLPGNKVYPWVADVRGSTPGVGLISPPPHHDIYSIE
FT                   DLAQLIHDLKNANRDARISVKLVSKAGVGTIAAGVAKATADVIVISGYDGGTGASPKTS
FT                   IKHTGLPWELGLAEAHQTLMLNGLRDRVVLETDGKLMTGRDVVMAALLGAEEFGFATAP
FT                   LVVLGCVMMRACHLDTCPVGVATQNPELRKKFMGDPDHIVNYMLFIAEEVREYMAALGF
FT                   KTFDEMIGRTDVLHVSERAKGHWKASQLDLSTLLYQPEGVRTFRSPQNHKIDQSLDITT
FT                   ILPAVQEAIESGKEADISIEINNTNRVAGTITGSEISKRYGEEGLPEDTIKLHFTGSAG
FT                   QSFGAFVPKGMTLYLDGDSNDYVGKGLSGGKIIVKSPEGFNSASDDNVIIGNVAFYGAT
FT                   SGEAYINGRAGERFAVRNSGVNVVVEGIGDHGCEYMTGGSVVVLGDVGKNFAAGMSGGI
FT                   AYVLAEDVKAFKRKCNLEMILFESLEDEKEIQHIKAMLERHTAYTNSQKAEDLLDQWED
FT                   SVKKFVKVIPKNYKQMLASIQEQKAAGLSDEEAIMFAFEANTKPKQNTAASGQKQAVVQ
FT                   "
FT   gene            140833..141735
FT                   /locus_tag="BSn5_00590"
FT   CDS_pept        140833..141735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00590"
FT                   /product="transcriptional regulator (LysR family) protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92752"
FT                   /protein_id="ADV92752.1"
FT                   /translation="MELRQLRYFMEVAEREHVSEAADHLHVAQSAISRQIANLEEELNV
FT                   TLFEREGRNIKLTPIGKEFLIHVKTAMKAIDYAKEQIDEYLDPHRGTVKIGFPTSLASQ
FT                   LLPTVISAFKEEYPHVEFLLRQGSYKFLIEAVRNRDIDLALLGPVPTNFSDITGKILFT
FT                   EKIYALVPLNHPLAKQKTVHLIDLRNDQFVLFPEGFVLREMAIDTCKQAGFAPLVSTEG
FT                   EDLDAIKGLVSAGMGVTLLPESTFAETTPRFTVKIPIEFPQVKRTVGIIKPKNRELAPS
FT                   ANDFYEFVIQFFSKLEQYQ"
FT   gene            complement(141786..142901)
FT                   /locus_tag="BSn5_00595"
FT   CDS_pept        complement(141786..142901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00595"
FT                   /product="gamma-glutamyl kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="COG0263 Glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92753"
FT                   /protein_id="ADV92753.1"
FT                   /translation="MTPDTSMKRVVVKIGSSSLTSLHGEISIRKLEALVDQVVKLKDAG
FT                   YEVILVSSGAVAAGYRKLGFIQRPEKLPEKQASASIGQGLLMEAYSKLFLAHGYVASQI
FT                   LITRSDFSDEYRYNNVRNTMNVLLERGIIPIINENDTVTVNRLKFGDNDTLAAKVAGLI
FT                   DADMLVILSDIDGLYDGNPRTNPEAKRIQRVSEITPDIEACAGDTGSIVGTGGMRSKLD
FT                   AFKIVMASGIKGFLGQADVGDILYHAVHEQAEGTYFEAEGTLPLNQKEQWIAFNSGPEG
FT                   EMILSDDCSRKITNGQSSLYLDGVQKIKGKFKSGSVVRLMDSKGTEIGLGIVNYSSVQL
FT                   QEPEKNKELTNRALIDQEAFVCHVDFSLPVN"
FT   gene            complement(142898..143713)
FT                   /locus_tag="BSn5_00600"
FT   CDS_pept        complement(142898..143713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00600"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /note="COG0345 Pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92754"
FT                   /protein_id="ADV92754.1"
FT                   /translation="MAEGMISGIVRANKIPKQNICVTNRSNTERLTELELQYGIKGALP
FT                   NQLCIEDMDVLILAMKPKDAENALSSLKSRIQPHQLILSVLAGITTSFIEQSLLNEQPV
FT                   VRVMPNTSSMIGASATAIALGKYVSEDLKKLAEALLGCMGEVYTIQENQMDIFTGIAGS
FT                   GPAYFYYLMEFIEKTGEEAGLDKQLSRSIGAQTLLGAAKMLMETGEHPEILRDNITSPN
FT                   GTTAAGLQALKKSGGGEAISQAIKHAAKRSKEISEGIEKTAAPLSGVIK"
FT   gene            complement(143939..144307)
FT                   /locus_tag="BSn5_00605"
FT   CDS_pept        complement(143939..144307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00605"
FT                   /product="replication terminator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92755"
FT                   /protein_id="ADV92755.1"
FT                   /translation="MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEF
FT                   KEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLK
FT                   VELDRCKKLIEKALSDNF"
FT   gene            complement(144607..145323)
FT                   /gene="fabG"
FT                   /locus_tag="BSn5_00610"
FT   CDS_pept        complement(144607..145323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BSn5_00610"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92756"
FT                   /protein_id="ADV92756.1"
FT                   /translation="MQSLQHKTALITGGGRGIGRATALALAKEGVNIGLIGRTSANVEK
FT                   VAEEVKALGVKAAFAAADVKDAEQVNQAVAQVKEQLGDIDILINNAGISKFGGFLDLSA
FT                   DEWENIIQVNLMGVYHVTRAVLPEMIERKAGDIINISSTAGQRGAAVTSAYSASKFAVL
FT                   GLTESLMQEVRKHNIRVSALTPSTVASDMSIELNLTDGNPEKVMQPEDLAEYMVAQLKL
FT                   DPRIFIKTAGLWSTNP"
FT   gene            145474..145782
FT                   /locus_tag="BSn5_00615"
FT   CDS_pept        145474..145782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92757"
FT                   /protein_id="ADV92757.1"
FT                   /translation="MIIVYISLAVLAVSIIFLGVTVIQNKKKMDPALKELSSVTQAMQK
FT                   QIEGLKTETELLTQKQKKIQHDVQMKKSAFQQTAAEVKEVPKAVKEVWQAGHLNSRS"
FT   gene            145849..146607
FT                   /locus_tag="BSn5_00620"
FT   CDS_pept        145849..146607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92758"
FT                   /protein_id="ADV92758.1"
FT                   /translation="MIVNRSCLKEFAEKLHSLPSSLTKSDLLISPFHLHQENELDIYYS
FT                   PHNEYINRTATIVIAGITPGFSQMKTAYETAVESLRQGRTLEQMAVDTKIAAGFSGSMR
FT                   HNLITMLDLCGLPQAFGIQSAAKLFGELRHMLHTTSVIKYPVFIQQKNYTGYKPAITHS
FT                   PILSTYAFGHFPAELNHVTGPALLIPLGKAAETVCETLIRQHRLQNLICLSGFPHPSGA
FT                   NGHRLKQFAKNKEQLERQIHSFASSVLNFL"
FT   gene            146663..146974
FT                   /locus_tag="BSn5_00625"
FT   CDS_pept        146663..146974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00625"
FT                   /product="putative N-acetyltransferase"
FT                   /note="COG1670 Acetyltransferases, including N-acetylases
FT                   of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92759"
FT                   /protein_id="ADV92759.1"
FT                   /translation="MFPVLETERLTLRQMTDQDAEAIFACFSNHEVTRYYGLENLESIE
FT                   QAISMVQTFAALYQEKRGIRWGIERQDTKELIGTIGFHALAQKHRRAEIGYEIIPAHW"
FT   gene            complement(147275..148516)
FT                   /locus_tag="BSn5_00630"
FT   CDS_pept        complement(147275..148516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00630"
FT                   /product="negatively charged metabolite transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92760"
FT                   /protein_id="ADV92760.1"
FT                   /translation="MDKIGIPKRLAWGFLGVILFMMGDGLEQGWLSPFLIENGLTVQQS
FT                   ASIFSIYGIALAIASWFSGVCLEAFGAKRTMFMGLLFYVIGTAAFIVFGFEQLNLPVMY
FT                   VTYFVKGLGYPLFAYSFLTWVIYRTPQSKLSTAVGWFWIAYCLGMFVFGAWYSSYAIKA
FT                   FGYLNTLWSSIFWVCLGAFFALFINKDRFEKKKRKRSETAKELLKGVTILFTNPRVLTG
FT                   GIIRIINSIGTYGFPVFLPMHMAQHGISTNVWLQIWGTIFLGNIVFNLIFGIVGDKFGW
FT                   KNTVIWFGGVGCGIFTVLLYYAPVFSGGSLAVVSVIGFIWGGLLAGYVPIGAIVPTVAG
FT                   KDKGAAMSVLNLAAGLSAFVGPALAWLFIGLVGAQGVVWIFAALYLASAVLTKCIHIPE
FT                   EKAVKEETSPQYAS"
FT   gene            complement(148613..150076)
FT                   /locus_tag="BSn5_00635"
FT   CDS_pept        complement(148613..150076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00635"
FT                   /product="hydroxylated metabolite kinase"
FT                   /note="COG1070 Sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92761"
FT                   /protein_id="ADV92761.1"
FT                   /translation="MKKQKGYLVFDIGTGNARVAVVSVTGSVLTVEREDIEYSTETLYP
FT                   DSRYFSPQVLWKQVMNLAKRALSRSRDIDIIGLTSTSQRQGIVLIDQNGNPFLGLPNID
FT                   NRGREWEAGIPDREEIYSRTGRLPTALFSALKLYGLKQRQPSLWEKTASFTSISDWVTY
FT                   QLSGILTYEPSQATETLLFDVKQNTWSEEMCDIFGFSPSILPPLVRAGTAIGTIANEYA
FT                   SELGLSINAKVIAGGGDTQLAVKSTGAGLEDIVIVSGTTTPITKITADHGDTKHKAWLN
FT                   CHTDQGHWLVETNPGITGLNYQKLKQIFYPNETYEVMEEEISALAKEDHACVAALGSYL
FT                   SAEKNALTRGGFLFDAPLSAHLKRAHFVRAALEEIAFSIKWNFDILTEVTPFERDYVWV
FT                   CGGGFQSKALTQYIADLLQKKVYVQEGYHQASVVGAAVICNETFQLTEEMSANVRVIEP
FT                   KDCQTELALYEEWKQTQRFFSGSESKVLI"
FT   gene            complement(150094..151128)
FT                   /locus_tag="BSn5_00640"
FT   CDS_pept        complement(150094..151128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00640"
FT                   /product="putative 2-hydroxyacid dehydrogenase"
FT                   /note="COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92762"
FT                   /protein_id="ADV92762.1"
FT                   /translation="MKNTMKRMFCTMTVLVTAPYNEEGRKELENLFGSVTYQSWKEQGR
FT                   AYREDELIQLLKATNATGLITELDQVTDSVFASVPELSFVGVCRGMPSNVDVAAASKRG
FT                   IPVFYAPGRNAQAVAEMFIGNVISFLRHTSASNQWLKDGKWNSDYLQAYVKFKGNELTG
FT                   KTVGMIGFGAVGQRIAKLLTVFDCKIKYYDPYIQDDHPLYEKVSLKTVFSDSDIVSVHL
FT                   PRTEETLGLIDRKHFDLMKQSAIFVNTSRAVVVNREDLLSVLKEHKIRGAILDVFYHEP
FT                   PEESDYELISLPNVLATPHLAGATFEVEDHHVTILNKALKKWKGEKTLNIPTMYNKDEL
FT                   KTGV"
FT   gene            151452..153494
FT                   /locus_tag="BSn5_00645"
FT   CDS_pept        151452..153494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00645"
FT                   /product="molybdopterin cofactor oxido-reductase"
FT                   /note="COG0243 Anaerobic dehydrogenases, typically
FT                   selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92763"
FT                   /protein_id="ADV92763.1"
FT                   /translation="MKSFATQQNGIFKSVCSLDCPDQCGLLIHKKDGKIVKVQGDPDHP
FT                   VTAGNICNKVRNMTERIYDEKRLTTPLKRTGAKGQAIFEPISWKEAIDTITSRWKQLID
FT                   EEGAESILPYSFYGNMGKLTAEGMDRRFFYRMGSSQLERTICSKAGSEGYKYTMGISAG
FT                   IDPEETIHTKLFIFWGINAVSTNMHQITIAQKARKQGAKIVVIDVHKNQTGRLADWFIP
FT                   IKPGTDSALALGIMHILFKENLHDEAFLSEYTVGYEELREHVKQYDPEKVSTITGVSTE
FT                   DIYRLAKMYGETSPSFIRIGNGPQHHDNGGMIVRTIACLPAITGQWLHTGGGAIKHNSG
FT                   ILEYNTNALQRPDLLKGRTPRSFNMNQLGRVLLETDPPIRSLFIYGTNPAVVAPEANKV
FT                   RQGLLREDLFTVVHDLFLTETAAYADIVLPATSSFENTDFYTSYWHHYIQLQQPVIERY
FT                   GKSKSNTEVFRLLAEAMGFTDQELKDSDEVLIRQALDHPDNPHLAEIDYDALTKHSFMK
FT                   AKREKRLFPGELPTPSGKIELYSEKMKQDGFPALPTYTPLVTDNEHPFMYVPGPNHNFL
FT                   NSTFSNNEKHIKLEKTPKLFINTKDAEKHGIVDGAPVRIWNSRGECELTAAVGEQVLPG
FT                   VVVSQGLWADEQGKKQLVNALTPDRLSDMGGGATFFSGRVQIEKV"
FT   gene            153562..153855
FT                   /locus_tag="BSn5_00650"
FT   CDS_pept        153562..153855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00650"
FT                   /product="hypothetical protein"
FT                   /note="COG0378 Ni2+-binding GTPase involved in regulation
FT                   of expression and maturation of urease and hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92764"
FT                   /protein_id="ADV92764.1"
FT                   /translation="MDVFLGIGIALAGYFIGEGLKQRNQTKGNEQNDIFLIKERDIYFY
FT                   IGLFLGITTTEAKQLAGDMADLPYIEINGKKYVQKHMLKDWTFTLVEKHQGE"
FT   gene            complement(154230..154634)
FT                   /locus_tag="BSn5_00655"
FT   CDS_pept        complement(154230..154634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00655"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92765"
FT                   /protein_id="ADV92765.1"
FT                   /translation="MKKIASYYLMTLGLSSLTFGLFLGFYSFVMYGDMIIALFTAAIAL
FT                   LYGFVVYGLFAVPLQMKLQKKARTFNVMYLLIYSVVAFIAAFLFFVINEPASIAWTLQS
FT                   YFYYMLSIAAAVIYWLWDSLILYKRTASGV"
FT   gene            154910..155032
FT                   /locus_tag="BSn5_00660"
FT   CDS_pept        154910..155032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92766"
FT                   /protein_id="ADV92766.1"
FT                   /translation="MSKKGIQNSSIEQIRNDHETETAFKADDPKKHGSDPKRTK"
FT   gene            155076..155369
FT                   /locus_tag="BSn5_00665"
FT   CDS_pept        155076..155369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92767"
FT                   /protein_id="ADV92767.1"
FT                   /translation="MTQKNGADRPDDYKRFSSLDKEYDFQQSISSNTETESVNTETQTH
FT                   NKENKNDTTDVAGKYFEPSDYKGSTQLEKGLAETHEQVSDDYFEGTIDQNLD"
FT   gene            complement(155485..157170)
FT                   /locus_tag="BSn5_00670"
FT   CDS_pept        complement(155485..157170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00670"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="COG0840 Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92768"
FT                   /protein_id="ADV92768.1"
FT                   /translation="MKVKTKLLGIISILVVSIIGIGGSSVFMISSTVKKNEELKDKMEF
FT                   QKEIKHIQYELTGLSNDERGFLITGDKEYDEGMKEKADDVLKSLDRVNDLIDEEKYQSN
FT                   IEDIKTSFTQYRALNQQVVTAYSSNPKKAETIHFGEERTLRKEVVDPAVNKLSDRLDQE
FT                   VEDLKDEIQGNGKMSQSLIIIVTGISVILGIVLSIMLLKSIMVPLRSINKQLEEIAHGE
FT                   ADLTKKVIVKNKDEFGQLAKSFNSFTHSLSQIVKQISSSSEQVAASSEELSASAEESKS
FT                   TSEHISRAMQMAAESNVKQSSMTEKSAESITELLDSISSVASNTGNIADLSSSMRDKAE
FT                   IGSKSVNKMLDQMKFIDKSVDSAGNGLQALVASTAEISDISSLITTISEQTNLLALNAA
FT                   IEAARAGEQGKGFAVVAEEVRKLADETNKSANHIQSVVATIQNESIETVNNIKVVQENV
FT                   SSGIVLSQETTGNFNEILNLVEQVTSQIQEVAAATQQLTSGVEVIQHTVHTLAAGTKET
FT                   SANTEAVAKSSEEQLHSMEEISYAAESLSQLAEELQTVINRFKY"
FT   gene            157505..158956
FT                   /locus_tag="BSn5_00675"
FT   CDS_pept        157505..158956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00675"
FT                   /product="putative 4-hydroxyphenylacetate-3-hydroxylase"
FT                   /note="COG2368 Aromatic ring hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92769"
FT                   /protein_id="ADV92769.1"
FT                   /translation="MGIINGKEFIDRLNKLENEIWYDGEKIKGNISEHPAFKGIIKTKS
FT                   SLYELQTKDELIHEMTYCLPGDHNRIGLSYLQPKTKNDLKKRRTMIEHWARHTHGMMGR
FT                   SPDYMNTVMMSFASSAELLKDKENCFPEHILDMYEQAAKHDLSFTHTFITPQVNRSQSY
FT                   FGLSEKPISAKVIDRTEKGLMIHGARLLATQGGLTDEILVFSAPKFFFETDEAYAFSIP
FT                   SNTKGVKFITRESFVLSDSSFNHPLSSRYEEMDSIVVFDHVLVPWNRVFFYDNVEAAKD
FT                   FMTKSSFHAFTFHQVVIRQMIKIEFLLGVAQLLVDTINVSEYQHIQEKLSEIIVGLETI
FT                   KALIDKSENDAQLDEFGYMRPCLIPLQVISTIIPKLYPRFTEIIQLIGASGMVTLPTEN
FT                   AFDSEIREDLDQYLQATNTNAEERVKIFRLAWDLTMSSFGTRQTHYERYFFGDPIRISS
FT                   RLYTSYPKQEQLNMIKTFLHADAEQ"
FT   gene            complement(158992..159690)
FT                   /locus_tag="BSn5_00680"
FT   CDS_pept        complement(158992..159690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00680"
FT                   /product="extracellular endoglucanase precursor (expansin)"
FT                   /note="COG4305 Endoglucanase C-terminal domain/subunit and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92770"
FT                   /protein_id="ADV92770.1"
FT                   /translation="MKKIMSAFVGMVLLTIFCFSPQASAAYDDLHEGYATYTGSGYSGG
FT                   AFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGA
FT                   LDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVM
FT                   KMQYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGNVVKDTIPKLPESGTSKAY
FT                   TVPGHVQFPE"
FT   gene            complement(159960..160637)
FT                   /locus_tag="BSn5_00685"
FT   CDS_pept        complement(159960..160637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00685"
FT                   /product="hypothetical protein"
FT                   /note="COG3619 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92771"
FT                   /protein_id="ADV92771.1"
FT                   /translation="MTAAAYRNTLLSLLCLTAGIVDVIGYLSLGHVFTANMTGNIVLLG
FT                   LAIGKSIQVTVFNSLTALIGFICGVIIATLMVGKAENTLWPSAVTKALALEAFILFVFA
FT                   CLSFYRAFVPVHILIILMSISMGIQTTAAKKLGIAGISSTVLTGTLASLLEDISGRLFF
FT                   KKQKKTFLRDTVLRALAIILYCVGAIIVALAEPDFYHFIIWVPIVLIFGIMMTAKLKLS
FT                   GEK"
FT   gene            160810..161847
FT                   /locus_tag="BSn5_00690"
FT   CDS_pept        160810..161847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00690"
FT                   /product="pectin lyase"
FT                   /note="COG3866 Pectate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92772"
FT                   /protein_id="ADV92772.1"
FT                   /translation="MKRLFLWFTVFSLFLVLLPGKALGAVDFPNTSTNGLLGFAGNAKN
FT                   EKGIAKTGTTGGKNGQIVYIQSVNDLKTHLGGSTPKILVLQNDLSASAKTTVTIGSNKT
FT                   LVGSYAKKTLKNIYLTTSSASGNVIFQNLTFEHSPQINGNNDIQLYLDSGMNYWIDHVT
FT                   FSGHSYNASGSDLDKLVYIGKSADYITISNSKFANHKYGLILGYPDDSQHQYDGYPHMT
FT                   IANNYFENLYVRGPGLMRYGYFHVKNNYSNNFNQAITIATKAKIYSEYNYFGKGSEKGG
FT                   ILDDKGTGYFKDIGSYPSLNKQTSPLTSWNPGSNYSYRVQTPEYTKEFVTKYAGSQSTT
FT                   LVFGY"
FT   gene            162104..162787
FT                   /locus_tag="BSn5_00695"
FT   CDS_pept        162104..162787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00695"
FT                   /product="hypothetical protein"
FT                   /note="COG2135 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92773"
FT                   /protein_id="ADV92773.1"
FT                   /translation="MCGRFTLYSAFDDIIDQFDIDQFFPKGEYQPSYNVAPSQNILAII
FT                   NDGSNNRLGKLRWGLIPPWAKNEKIGYKMINARAETITEKPAFRRPLVSKRCIIPADSF
FT                   YEWKRLDSKTKIPMRIKLKSSALFAFAGLYEKWSTHQGDPLYTCTIITTEPNEFMKDIH
FT                   DRMPVILAHDHEKEWLNPKNTSPDYLQSLLLPYDADDMEAYQVSSLVNSPKNNSAELLD
FT                   AENHM"
FT   gene            complement(162983..163087)
FT                   /locus_tag="BSn5_00700"
FT   CDS_pept        complement(162983..163087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92774"
FT                   /protein_id="ADV92774.1"
FT                   /translation="MDLPLWAYIIFAITGAAGFISLMWFSFFADKIEK"
FT   gene            complement(163123..163428)
FT                   /locus_tag="BSn5_00705"
FT   CDS_pept        complement(163123..163428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00705"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92775"
FT                   /protein_id="ADV92775.1"
FT                   /translation="MKALIFLSSLTAIGSSILGRWLGMLDDSYAVGDAWFIGVLAGLIS
FT                   LLILIDSQTMTKNYIVSLSTILGILGVGFIYFPAAFINILLSITLDKQKKEDLHVR"
FT   gene            complement(163644..164816)
FT                   /locus_tag="BSn5_00710"
FT   CDS_pept        complement(163644..164816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00710"
FT                   /product="oxalate decarboxylase"
FT                   /note="COG2140 Thermophilic glucose-6-phosphate isomerase
FT                   and related metalloenzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92776"
FT                   /protein_id="ADV92776.1"
FT                   /translation="MEQQPINHEDRNVPQPIRSDGAGAIDAGPRNIIRDIQNPNILVPP
FT                   VTDEGMIPNLRFSFSDAPMKLDHGGWSREITVRQLPISTAIAGVNMSLTAGGVRELHWH
FT                   KQAEWAYMLLGRARITAVDQDGRNFIADVGPGDLWYFPAGIPHSIQGLEHCEFLLVFDD
FT                   GNFSEFSTLTISDWLAHTPKDVLSANFGVPENAFNSLPSEQVYIYQGNVPGSVASEDIQ
FT                   SPYGKVPMTFKHELLNQPPIQMPGGSVRIVDSSNFPISKTIAAALVQIEPGAMRELHWH
FT                   PNSDEWQYYLTGQGRMTVFIGNGTARTFDYRAGDVGYVPSNAGHYIQNTGTETLWFLEM
FT                   FKSDRYADVSLNQWMALTPKELVQSNLNAGSVMLDSLRKKKVPVVKYPGT"
FT   gene            complement(164945..165427)
FT                   /locus_tag="BSn5_00715"
FT   CDS_pept        complement(164945..165427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92777"
FT                   /protein_id="ADV92777.1"
FT                   /translation="MRKKNNIKKWLLIIAGFLIICIITLFVMVSGNKVKYEGSGKSGLW
FT                   MSNLEKSDKTSIGPNYFLNLYWQGSKKDEKRTVIEKITLYIDGKMYDDRENYDLSEYTG
FT                   DEMPGGGRMEDHIATFDYMPEDEVIGHDVLVKVEWKTGQKKQTEEIKLHKKPWYKK"
FT   gene            complement(165660..165926)
FT                   /locus_tag="BSn5_00720"
FT   CDS_pept        complement(165660..165926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92778"
FT                   /protein_id="ADV92778.1"
FT                   /translation="MGVKCLSMITKSLWNTNRDFVTDCAFQRNILLIMTVTPKQVQPVS
FT                   LLKIFNFEIFRVQFQSIQLSSKEEEQKSPAIWTTFSVFLMGDL"
FT   gene            complement(166091..166588)
FT                   /locus_tag="BSn5_00725"
FT   CDS_pept        complement(166091..166588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00725"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00725"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92779"
FT                   /protein_id="ADV92779.1"
FT                   /translation="MKRVLFSVIVFTAVGFTFCQSKAHALTFTVLPITQKTDQWSVKVS
FT                   EAKNVKEFARPQKGEYQVYSLEVKNIGEKAATVDVQLYRNDPDSITRFSLFGCPDENCV
FT                   KPKEDSKMLAESLNDGSPLKFNHFMLADKASELEVVIIWTQKGQEGRNLKQTFKFTEDG
FT                   VN"
FT   gene            complement(166690..167601)
FT                   /locus_tag="BSn5_00730"
FT   CDS_pept        complement(166690..167601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00730"
FT                   /product="putative factor for cell wall maintenance or
FT                   synthesis"
FT                   /note="COG2720 Uncharacterized vancomycin resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92780"
FT                   /protein_id="ADV92780.1"
FT                   /translation="MIQILITGLFLLAQPSEPQDSLTVTQQGRTIATVNREDFTMPLPG
FT                   TPMVDYEKYSKFIKQLDQKVYREPINAVLNDHGSIVPGRVGYKLYQQAFMEKFYAYFYG
FT                   QGPSKIEVPEMNIYPKVDSELLAHISTQQLGQYVTYFNSSNKSRSHNISLSAKAIDNHV
FT                   VFPNETFSFNQVVGMRTRNKGYKSAPIIVKGELSEGVGGGICQVSSTLFNAVDRAGLQI
FT                   VQRYSHTRSVPYVPPGRDATVSWGGPDFRFQNQYNQPILIRAKRYGGSMIITLYSSDVI
FT                   NSKLRKIPKAPSRIPKEINAEQ"
FT   gene            167948..168430
FT                   /locus_tag="BSn5_00735"
FT   CDS_pept        167948..168430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00735"
FT                   /product="hypothetical protein"
FT                   /note="COG0040 ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92781"
FT                   /protein_id="ADV92781.1"
FT                   /translation="MNRMSTIFLKIALVLIGIPILALCIFLVPKIANYSAELFPNIAYI
FT                   KYLVFIYLYVTAIPFYFALYQAFKLLSYIDKNKAFSGLSVRALKNIKYCAVTISIFYAA
FT                   GMPVFYLMAEIDDAPGIIVIGLVIIFASMVIAVFAAVLQKLLKEAIDIKSENDLTV"
FT   gene            168440..168664
FT                   /locus_tag="BSn5_00740"
FT   CDS_pept        168440..168664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00740"
FT                   /product="putative transcriptional regualtor"
FT                   /note="COG3655 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92782"
FT                   /protein_id="ADV92782.1"
FT                   /translation="MAIIINIDVMLAKRKMSVTELSERVGITMANLSILKNGKAKAIRL
FT                   STLEAICKALECQPGDILEYRSDEDTQDS"
FT   gene            168799..169593
FT                   /locus_tag="BSn5_00745"
FT   CDS_pept        168799..169593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00745"
FT                   /product="putative integral inner membrane protein"
FT                   /note="COG3739 Uncharacterized integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92783"
FT                   /protein_id="ADV92783.1"
FT                   /translation="MRAIKQIVHFGWEQALSCLFPAVIFASLAITQIIPLPFLPRYDWL
FT                   LIICVLMQLWMVRSGLETLDELKVITLFHLIGLALELFKVHMGSWSYPEEGYSKIFGVP
FT                   LYSGFMYASVASYLCQAWRRLKVELIKWPPFFAVVPLAAAIYLNFFTHHFSIDIRWWLS
FT                   GLVIIVFWQTWVTYEVNGARYRRPLALSFVLIGFFIWIAENIATFFGAWKYPNQIDTWS
FT                   LVHLGKVSSWLLLVIVSFLIVASLKQVKEQSPTKAEMDESFS"
FT   gene            complement(169710..170582)
FT                   /locus_tag="BSn5_00750"
FT   CDS_pept        complement(169710..170582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00750"
FT                   /product="putative transcriptional regulator (LysR family)
FT                   protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92784"
FT                   /protein_id="ADV92784.1"
FT                   /translation="MVMNMNHLHIFVKVGEKLNITEAAKELFISQPAVSKAIKNLESSL
FT                   QLKLLIRDKHHGLMLTDIGKEILLLARQMKGIESKIYQVANRENKLLNGKVKIGSFPAV
FT                   STNIMPQAIAAFRSNYPLIRIELIEGTSDQIKGWVEDRTVDIGIAASPFEPFENQLLCN
FT                   DYMVAVIPPQRDELKLEKHVDLETYQDDLIFCKGGHEIAMSNAFSQYNIELKENLTVQN
FT                   AETLINMVKNNLGIGIISNFTLSSVPHQLIKKDIFPRVTRDIGVIVHSFEEITPAAHEF
FT                   IKVLKAVVI"
FT   gene            170683..171561
FT                   /locus_tag="BSn5_00755"
FT   CDS_pept        170683..171561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00755"
FT                   /product="cysteine and O-acetyl serine efflux permease"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00755"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92785"
FT                   /protein_id="ADV92785.1"
FT                   /translation="MVKVMLGIISVTLIWGYTWVAMKVGIHDIPPLLFSGLRLFIGAVP
FT                   LFLILFIQRKKLTIQKEHLKSYIIMSLLMGLGYMGILTYGMQFVDSGKTSVLVYTMPIF
FT                   VTVISHFTLNEKMNVYKTMGLVCGLFGLLFIFGKEMLNIDQSALFGELCVLAAALSWGI
FT                   ANVFSKLQFKHIDIIHMNAWHLMMGAVMLLVFSFIFEPVPSAEWTYQAVWSLLFNGLLS
FT                   TGFTFVVWFWVLNQIQASKASMALMFVPVLALFFGWLQLHEQITINIILGALLICCGIF
FT                   MNTFTFSRRKV"
FT   gene            complement(171734..172165)
FT                   /locus_tag="BSn5_00760"
FT   CDS_pept        complement(171734..172165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00760"
FT                   /product="biofilm forming exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92786"
FT                   /protein_id="ADV92786.1"
FT                   /translation="MKKMLMLAFTILLAFTIHVGEASAVIVKDEEKVSFTMTENEKWFM
FT                   KSDDLNSNHWTSHFGYRFTIFDTEGCTINARIMRMTLSGYEITVSEKNFSGDHFDLSAT
FT                   DRVETMPYKTHYLILTKDPDCGDVKVKGLYGFQFDQPEW"
FT   gene            complement(172429..173061)
FT                   /locus_tag="BSn5_00765"
FT   CDS_pept        complement(172429..173061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00765"
FT                   /product="putative factor of the oxidative stress response"
FT                   /note="COG0693 Putative intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00765"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92787"
FT                   /protein_id="ADV92787.1"
FT                   /translation="MQTRKVYLYVFHTMSDWEYGYLIAELNSGRYFKQDAASLKVVTVG
FT                   VNKEMITTLGGLSIKPDISLDECTLGSQDLIILPGGNTWGEDIHQPILKKVGDALKLGT
FT                   TIAAICGATLGLANEGYLNSRKHTSNDLECMKMVCPNYKGETLYEKEPAVSDKNLVTAS
FT                   GIAPLEFAVEVLKKLDVFAPDTLRSWYKLNKTQKPEYFFELMNTINR"
FT   gene            173323..174237
FT                   /locus_tag="BSn5_00770"
FT   CDS_pept        173323..174237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00770"
FT                   /product="beta-lactamase precursor"
FT                   /note="COG2367 Beta-lactamase class A"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92788"
FT                   /protein_id="ADV92788.1"
FT                   /translation="MKNKASIKFGICVGLLCLSITGFTPFFNSTHAEAKSIEDTNMASC
FT                   ITNKKFVQLEKKFDARLGVYAIDTGSNKTIAYRPNERFAYASTYKVLAAAAVLKRNSIE
FT                   KLNEVIHYSKDDLVTYSPITEKHLDTGMSLKEISEAAIRYSDNTAGNILLQQLGGPKGF
FT                   EKSLKQIGDHVTKAKRFETDLNSAIPGDIRDTSTAKALATDLKAFTLDNTLTTDKRTIL
FT                   TDWMRGNATGDELIRAGAPIGWEVGDKSGAGSYGTRNDIAIVWPPNRAPIVLAILSNRF
FT                   TKDANYDNALIAEAAKVVLNDLK"
FT   gene            complement(174734..175096)
FT                   /locus_tag="BSn5_00775"
FT   CDS_pept        complement(174734..175096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92789"
FT                   /protein_id="ADV92789.1"
FT                   /translation="MPKIGVSLIVLIMLIIFLAGCNKNEQNGDETKMQSLVGYVVLKDN
FT                   ERAILITDTKAPVKGDYDLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTR
FT                   KESNPPSATIQKYELL"
FT   gene            complement(175157..175369)
FT                   /locus_tag="BSn5_00780"
FT   CDS_pept        complement(175157..175369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92790"
FT                   /protein_id="ADV92790.1"
FT                   /translation="MEVAIVNDSKDKYIYAGIQKEAAFNNIFESAKMSKRIISRATTCK
FT                   YLRKNKKKVEELENEYAAVMNCKKK"
FT   gene            175474..175737
FT                   /locus_tag="BSn5_00785"
FT   CDS_pept        175474..175737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00785"
FT                   /product="putative transcriptional regulator from
FT                   bacteriophage"
FT                   /note="COG3604 Transcriptional regulator containing GAF,
FT                   AAA-type ATPase, and DNA binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00785"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92791"
FT                   /protein_id="ADV92791.1"
FT                   /translation="MKIRKILLSSALSFGMLISTVPALAAGTSSAVAVKSGEYDYDTIY
FT                   RISPLPMDFQPTIEYNGYTYKLTRHYFDYSIGFYTAIYTKVV"
FT   gene            complement(176035..178635)
FT                   /locus_tag="BSn5_00790"
FT   CDS_pept        complement(176035..178635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00790"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /note="COG0574 Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92792"
FT                   /protein_id="ADV92792.1"
FT                   /translation="MSSLVLGLHEIEKTQLSLVGGKGLHLGELSKIQGIQVPEGFCVTT
FT                   VGYQKAIEQNETLQVLLDQLAMLKVEDRDQIGNISRKIRQIIMEVDIPSDVVKAVAHYL
FT                   SQFGEEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGVDAILQHISKCWASLFTDRAVI
FT                   YRMQNGFDHSQVYLSVIVQRMVFPQASGILFTADPITSNRKVLSIDAGFGLGEALVSGL
FT                   VSADCYKVQDGQIIDKRIATKKLAIYGRKEGGTETQQIDSDQQKAQTLTDEQILQLARI
FT                   GREIEAHFGQPQDIEWCLARDTFYIVQSRPITTLFPIPEASDQENHVYISVGHQQMMTD
FT                   PIKPLGLSFFLLTTAAPMRKAGGRLFVDVTHHLASPDSREVFLKGMGQHDQLLKDALMT
FT                   IIKRRDFIKSIPNDKTAPNPSRGNADMPAQVENDPTIVSDLIKSSQTSIEELKQNIQTK
FT                   SGSDLFRFILEDIQELKKILFNPECSVVIRTAMNASLWINEKMNEWLGEKNAADTLSQS
FT                   VPHNITSEMGLALLDVADVIRPYPEVIDYLQHVKDDNFLDELAKFDGGSKTRDAIYDYL
FT                   SKYGMRCTGEIDITRTRWSEKPTTLIPMILNNINNSEPNASHRKFEQGRQEALKKEQEL
FT                   LDRLKQLPDGEQKAKETKRMIDIIRNFSGFREYPKYGMVNRYFVYKQALLKEAEQLIEA
FT                   GVIHEKEDIYYLTFEELHEVVRTHKLDYQIISARKDEYTLYEKLSPPRVITSDGEIVTG
FT                   EYKRENLPAGAIVGLPVSSGVIEGRARVILNMEDADLEDGDILVTSFTDPSWTPLFVSI
FT                   KGLVTEVGGLMTHGAVIAREYGLPAVVGVENAAKLIKDGQRIRVHGTEGYIEIL"
FT   gene            complement(179093..179734)
FT                   /locus_tag="BSn5_00795"
FT   CDS_pept        complement(179093..179734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00795"
FT                   /product="endo-1,4-beta-xylanase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00795"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92793"
FT                   /protein_id="ADV92793.1"
FT                   /translation="MFKFKKNFLVGLSAALMSISLFSATASAASTDYWQNWTDGGGIVN
FT                   AVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPL
FT                   IEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQTK
FT                   RPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVLATEGYQSSGSSNVTVW"
FT   gene            complement(180364..180603)
FT                   /locus_tag="BSn5_00800"
FT   CDS_pept        complement(180364..180603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00800"
FT                   /product="hypothetical protein"
FT                   /note="COG2314 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92794"
FT                   /protein_id="ADV92794.1"
FT                   /translation="MVSKKNKIVAALLAFFFGGLGIHKFYLGRVGQGILYILFCWTGIP
FT                   SIIAFIEFIIFLCGSEEAFDQKYNFYYFQQQSKA"
FT   gene            complement(181364..181702)
FT                   /locus_tag="BSn5_00805"
FT   CDS_pept        complement(181364..181702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00805"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92795"
FT                   /protein_id="ADV92795.1"
FT                   /translation="MGVFSAVKKYAQVEYHCSQASVLFGGVPTTKELIRKGTAERNPKA
FT                   IRPLMFSKGIETVAMNGEPFTDLNDLLFATGNLHIGLGYDYLKCIALLINVKRFFSLTE
FT                   SYGNISIN"
FT   gene            complement(182139..182258)
FT                   /locus_tag="BSn5_00810"
FT   CDS_pept        complement(182139..182258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00810"
FT                   /product="histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92796"
FT                   /protein_id="ADV92796.1"
FT                   /translation="MSEDFYCDEVLSGKTKVNKVLENENVLAIITQDLFGPSI"
FT   gene            complement(182373..182654)
FT                   /locus_tag="BSn5_00815"
FT   CDS_pept        complement(182373..182654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00815"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92797"
FT                   /protein_id="ADV92797.1"
FT                   /translation="MLKERGQIGQEFGAEEIAEYLKSKGYKPKLNVDHYRNHFGGSITF
FT                   WPRLRRYYIALIQSDKQGDGEPLSSKGGFTQLGMDSKGKAEKINDSFG"
FT   gene            complement(182743..182946)
FT                   /locus_tag="BSn5_00820"
FT   CDS_pept        complement(182743..182946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00820"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92798"
FT                   /protein_id="ADV92798.1"
FT                   /translation="MGVLAGLLVLLSLKSRNTEMQTFIVSSSTALGIIGAGVLYLPSAI
FT                   VNVLIGFKLNKKLKDENTKEQI"
FT   gene            complement(183239..183532)
FT                   /locus_tag="BSn5_00825"
FT   CDS_pept        complement(183239..183532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00825"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92799"
FT                   /protein_id="ADV92799.1"
FT                   /translation="MEFKVGQDVSEIWNIHGSILPEVLMYMFPHSDESYHWEFVNDNGR
FT                   HIFTAWRKSEPIPTVEEIEKAAIELEEKKNAPKPKTLEERVADLETSGLLNE"
FT   gene            complement(184761..185045)
FT                   /locus_tag="BSn5_00830"
FT   CDS_pept        complement(184761..185045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00830"
FT                   /product="putative phage DNA manipulating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92800"
FT                   /protein_id="ADV92800.1"
FT                   /translation="MKVFEADSLLFEADKRTKEYKELRSQMVKLRKAFQNVANLDDSEF
FT                   SGKGADNIKAFYHDHVGVTDQWIDLIDMKIAFLSSISAKLEDAKMSVLT"
FT   gene            complement(185146..185856)
FT                   /locus_tag="BSn5_00835"
FT   CDS_pept        complement(185146..185856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00835"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92801"
FT                   /protein_id="ADV92801.1"
FT                   /translation="MSSFIREFNFWRHLFLEFIALYSLKRAPITICSHLLEFERLLLKG
FT                   NKGVMYVTNFVHKTVNGLKSLLDEKGAIKLFCSEGDIMEFLVTFSQDKATLNDIQSFEA
FT                   KHQITLPEDYQKFMTLHNGAKIFEILSDGENIGGGLQLFSLEEIEDELKYEDLFEDING
FT                   IPIGYLLEECHLMIDKDKVNHGDPNYLYIFESGLEYNPLNVNFEIFLDRYILANGEPFW
FT                   DWRYYTAENYYRTR"
FT   gene            185843..187267
FT                   /locus_tag="BSn5_00840"
FT   CDS_pept        185843..187267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00840"
FT                   /product="amine oxidase, flavin-containing"
FT                   /note="COG1231 Monoamine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92802"
FT                   /protein_id="ADV92802.1"
FT                   /translation="MNDDMVKIIRNGLSASQHPKHILVIGAGLSGLVTASLLKNAGHRV
FT                   TILEASGRAGGRVCTLRSPFSDDLYFNAGPMRIPNNHSLTLEYIKKFKLPTNVFINRTP
FT                   MDIIYANGIKTRLQVFERAPGILRYPVAPNEQGKTSEELMLSLLQPILNFINQNPERNW
FT                   RIVEEQYKNHSLSSFLNTYFSYGAIDMIGVLLDMEAYMGMSLVEVLRESIFFSSPAHFY
FT                   EITGGMDLLPHAFLPQLKTNILYHQKMMKMSQGENRVTIHCQHQQTAEFTSFTADLAIV
FT                   TIPFSTLRFVKVEPYHSFSYYKRRAIRELNYISATKIGIEFKSRFWEKASQRGGKSITD
FT                   LPIRFSYYPSRNIGANGHAVILASYTWADEALIWDSLSEGERIQYTLLNLSEIYGDIVW
FT                   SEFVSGTYFSWSQYPYSAGGFTAFEPGQELELYPYIPVPEGRIHFAGEHASLTHAWMQG
FT                   AIESGIRVAYEVNRLP"
FT   gene            187694..190114
FT                   /locus_tag="BSn5_00845"
FT   CDS_pept        187694..190114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00845"
FT                   /product="putative phage-related pre-neck appendage
FT                   protein"
FT                   /note="COG5434 Endopolygalacturonase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00845"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92803"
FT                   /protein_id="ADV92803.1"
FT                   /translation="MVHFKNCPDPSLNANSQSHPEFSSELEHIKTRMQNFIKHSVTAQN
FT                   IEVTDARVTAEGEVTSLLKERLDKEYYRLLSKITREVNVADFGAVPDGRDNTEAFRKAI
FT                   GNGRVKVHVPAGEYLVQGIKLPSWTTIVGQGKGITVIKLHEDTPAHEWVITNDDYQNGN
FT                   RNIFVQGMSLDWNPSRQCGVRNPGGQFSSCLTFAKVEYGWIKDVEAINAGLHGIDITSP
FT                   TYDHLPDTDWTKDGSRYIWIDNCVTYGSGDDGITTHYSEYIFISNCHSGNPRGTEFAEG
FT                   VSNSNGIEIDDGSRHVWLLNNFTSGNIRGVEVKAHELWPASQNVHIIGHISYRDVRAFD
FT                   LRHIGHHQITDPESTTAYDVTLIDCSAVEPVFNSLYDAVTPRALVISAYKNVNVSGFTA
FT                   IGDPDYDYKENPVVALQYRSQNITINGIKIRGFKKAGVDINLSGGSNKTDYIKISNFDI
FT                   YNSAPKGISIGGGLYNVNILNGTMITDNGTVAIQSPNNQATILGVQSEGYSVAASIKGQ
FT                   TYQQVPINLKGGIQLATTSGFAVNQTSAVIAGTGDITARGERNAVISSSGGSSTEGSRA
FT                   LIASSNNAHIRGNQASRTILSSENIILEEPYTVAGGHQSIKWLLDSVRGNGTFAGAISS
FT                   SLGGYGEYFESSTGQLIHTGTIVTLRGEKIVPANVGDYMLGVISENSAFISGASSFVWQ
FT                   GRYLTNEFGGFIYETVTDEESGELIRVPKQNPDYDTALEANYYSRAARDEWHVVGLVGQ
FT                   HYVRIDETVNQGDYLTAHNGIGTKAAEGSWKVMKITSAYKSEKGYGIALTVIK"
FT   gene            complement(190702..191034)
FT                   /locus_tag="BSn5_00850"
FT   CDS_pept        complement(190702..191034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00850"
FT                   /product="molecular chaperone"
FT                   /note="COG0073 EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92804"
FT                   /protein_id="ADV92804.1"
FT                   /translation="MAVIEDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQ
FT                   SSAQITKRYKPEDLINKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVS
FT                   NGTKIG"
FT   gene            complement(191099..191818)
FT                   /locus_tag="BSn5_00855"
FT   CDS_pept        complement(191099..191818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00855"
FT                   /product="putative transcriptional regulator (AraC/XylS
FT                   family) protein"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00855"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92805"
FT                   /protein_id="ADV92805.1"
FT                   /translation="MDSLQEMICEKRTYTRLYHSHKHAYSQFLFPLEGSIDLETEERQV
FT                   KLKPDHFLYIPPQCEHRFRSIGRNECLVLDVPLHAMKIDEYRAGSGIEAALDPFWSSIR
FT                   YLLTEEAKAGTANSLHMLVQYIKEKLQSHNYASIAYIHSHLFERLTIKKLAEIEHYHPA
FT                   YYSSWFKKQTGKSPHNYIADLRLEEAKRMLMERNETLTVVSEALGFQNLSSFTRWFTKS
FT                   TGMPPRLYRNTLYSDKK"
FT   gene            complement(191839..192579)
FT                   /locus_tag="BSn5_00860"
FT   CDS_pept        complement(191839..192579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00860"
FT                   /product="putative acetyltransferase"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92806"
FT                   /protein_id="ADV92806.1"
FT                   /translation="MDDIHKIERLAAASWPAYFQKSIGQWLLRANFGVTKRANSVWTST
FT                   DMPEGNFQLEAELFYQSLGLPVCFHISNASPKGLDDALADSRYEKVDECFQMTALCRSI
FT                   MSRTNDNSRFTYKWEQEPSSVWIDEFIQLEGFSPERHKGYKHIFERMPPCKTFFKMYDK
FT                   ESLTALGTVSVIDGYGGLSNIVVAEEHRGKGAGTQVIRVLTEAKNNGAERMFLQVMKEN
FT                   LAAVSLYEKIGFSPISEHHYRIKS"
FT   gene            complement(192657..193232)
FT                   /locus_tag="BSn5_00865"
FT   CDS_pept        complement(192657..193232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00865"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00865"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92807"
FT                   /protein_id="ADV92807.1"
FT                   /translation="MSPRIGLTQKMIVDAAAEIADQEGVNGVSLAALSKKMNVRPPSLY
FT                   NHINGLQAIRAELAVRGLTKLFDQMADSVTERKGDSAMLSLAHAYVDFAIENPGYYEAA
FT                   LLKVQDKRTEIVSDQIVCLVTKLLIENGYASEKTAIHATRGLRSLLHGFTVLIAKEAFE
FT                   REEDILESLSFSIRTFLSGLLINNKNIM"
FT   gene            complement(193238..193939)
FT                   /locus_tag="BSn5_00870"
FT   CDS_pept        complement(193238..193939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00870"
FT                   /product="putative metal-dependent hydrolase"
FT                   /note="COG0491 Zn-dependent hydrolases, including
FT                   glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92808"
FT                   /protein_id="ADV92808.1"
FT                   /translation="MRITQYQTVWQLTFFPALFPVNCYLVEEENEVTLIDAALPGSYKG
FT                   IIQAVNQLGKPLQHILLTHAHGDHVGSLDTLAQTFPHAKVMISERDSFLLQGDTSLRQD
FT                   EPQTPIKGGIPKHIQTKPHQLLTGGETIGSLLAIPTPGHTPGSMSFLDTRNGTLIAGDA
FT                   LQLRGGIAVSGQIKWAFPFPAFATWNKEEAIKSAQLLADKAPTCLAVGHGKFLRSPSER
FT                   MRQAIQKAKKG"
FT   gene            complement(194015..194497)
FT                   /locus_tag="BSn5_00875"
FT   CDS_pept        complement(194015..194497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00875"
FT                   /product="putative effector of transcriptional regulator"
FT                   /note="COG3708 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92809"
FT                   /protein_id="ADV92809.1"
FT                   /translation="MGFSHITHLDRKRFAGLSQRTSNALEMTEERRIPALWDQFWKQDM
FT                   SALLSQAEKDKSIIALYSNYEQETNGFYTFSVGTFQEYDDILPGPYENIDLPASAYAVF
FT                   TSRIGPIEEIVLETWKEIWTWDKRHLRTFTGDFEMYDQSAAVPQRAQVNIYVAIKK"
FT   gene            complement(194551..195489)
FT                   /locus_tag="BSn5_00880"
FT   CDS_pept        complement(194551..195489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00880"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG2378 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92810"
FT                   /protein_id="ADV92810.1"
FT                   /translation="MKLERLLAMVVLLISKKQVQAAELAELFEVSVRTIYRDIETINRA
FT                   GIPIVTSQGSGGGIGIMETYRLEREWLKEEELFAIASALQSVSSMYEPVSHSKAYQKIK
FT                   HLIPEQSAQAFKHQTEKWFIDMTAWGHTEDQKTLREKISAAIDRLSTISFTYTSASGET
FT                   LLRETEPYTLVCKAGHWYLYAYCLVRNDFRFFKLNRMKDLAILHQTFIRKDIQLDTLPW
FT                   DKNWYQKGRLTELVILVQPAARQRIGEWFGYDVLHCEEDEICRAVISLPEDQWLIGFLL
FT                   QFGKDIEVLQPLHIRDKVKETIHHMQKIYET"
FT   gene            195694..196239
FT                   /locus_tag="BSn5_00885"
FT   CDS_pept        195694..196239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00885"
FT                   /product="mother cell-specific membrane sporulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00885"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92811"
FT                   /protein_id="ADV92811.1"
FT                   /translation="MHLTLQSVYPAMIIIFFLYKKIKRSIGYQPLKPRWLFTRIILFSL
FT                   FAFGLSIFSAIHPFLYGYLILGILGGWLLVFFAKKNISFEKRRGKIYFRTHIWVEVILL
FT                   TLFLSRFLYRVTELYLTSPDLNRLGSYSQSIGTDPLTIGVCFLIAVYYIGFSSFVIKLS
FT                   RNELEQHGHNKEKDILAR"
FT   gene            complement(196266..196589)
FT                   /locus_tag="BSn5_00890"
FT   CDS_pept        complement(196266..196589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00890"
FT                   /product="transcriptional regulator (multiple metal-sensing
FT                   ArsR-SmtB transcriptional repressors family) protein"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92812"
FT                   /protein_id="ADV92812.1"
FT                   /translation="MTEFRETEQSAADLDEETLFLVAQTFKALSDPTRIRILHLLSQGE
FT                   HAVNGIAEKLNLLQSTVSHQLRFLKNLRLVKSRREGTSIYYSPEDEHVLDVLQQMIHHT
FT                   QHD"
FT   gene            196784..197461
FT                   /locus_tag="BSn5_00895"
FT   CDS_pept        196784..197461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00895"
FT                   /product="putative transposon-related lytic enzyme"
FT                   /note="COG0741 Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00895"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92813"
FT                   /protein_id="ADV92813.1"
FT                   /translation="MKKKRKGCFAAAGFMMIFVFVIASFLLVLLFFNRDLVKKLPIDTK
FT                   TIVLERLTDYKPLVEEELESQGLSNYTSLILGMMYQESKGKGNDPMQSSESLGLKRNEI
FT                   TDPQLSVKQGIKQFTLMYKTGKEKGVDLDTIIQSYNMGAGYIDFVAEHGGTHTEELAKQ
FT                   YSEQQVKKNPDLYTCGGNAKNFRYPYCYGDYTYAEKVKEKTKTVEESLQVATLETMESK
FT                   AHE"
FT   gene            complement(197551..198087)
FT                   /locus_tag="BSn5_00900"
FT   CDS_pept        complement(197551..198087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00900"
FT                   /product="putative integral inner membrane protein"
FT                   /note="COG2322 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92814"
FT                   /protein_id="ADV92814.1"
FT                   /translation="MNQTENKPKNYTGIVLTLTVLINGLIAVLFFMPKLDQFSHANIHI
FT                   LPMLNAIFNSFTFIFLLAALIMIKQKNIKAHKRFILAAFTTTLLFLICYVTYHSIAENT
FT                   LYGGEGIMRPIYFFILITHICLSAIIVPLALFTLIRGFSMQVERHKKIARWTMPLWLYV
FT                   SLTGVIVYLMISPYY"
FT   gene            complement(198224..199006)
FT                   /locus_tag="BSn5_00905"
FT   CDS_pept        complement(198224..199006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00905"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92815"
FT                   /protein_id="ADV92815.1"
FT                   /translation="MAIDSLINKLQYVQLEPPDKILSLYLNTDMRDPEQQGGEWKIALK
FT                   SGFSRLKEYLAASDPEEEKCLDGIRAKMNQYLNAMGKDMPRSLVFFVSDSGIWEPIKLQ
FT                   VPVDTRFYWEETAVLDQLKGLRQAYPSTAFILTQQHEVKIIETVLGKIEAVERYEYDMI
FT                   NESWKNSHSAVDKAPPFEENRMREHVTENQSRLYKRLAASLDQKAAAKRWERMVIAGDK
FT                   ETADILDQHMNKPIHSKIQKNLLNENEHKVIEHLIKEA"
FT   gene            199177..199674
FT                   /locus_tag="BSn5_00910"
FT   CDS_pept        199177..199674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92816"
FT                   /protein_id="ADV92816.1"
FT                   /translation="MFTIKEKNRQELEEELNDLEFQIYRMQENMKDLSKDAKVLGIDQS
FT                   KHDEWMIVSSIDDGQTCKIMLTDCKTAYRGKGCFSLVASYKDDAIHIGDIKGPPNHGFG
FT                   SICMKYLKDIARDHNIPKVTGDIAKRDWNHVDRLIHFYEKHHFKVCIDHDTQSGSIKWV
FT                   DL"
FT   gene            199738..200715
FT                   /locus_tag="BSn5_00915"
FT   CDS_pept        199738..200715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00915"
FT                   /product="putative carboxypeptidase"
FT                   /note="COG1619 Uncharacterized proteins, homologs of
FT                   microcin C7 resistance protein MccF"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00915"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92817"
FT                   /protein_id="ADV92817.1"
FT                   /translation="MHASKLKKGDEIRIVSPATSMSILTNEAKIQAKTALERLGYRVTI
FT                   AEHANECNEFDSSSIESRVHDLHAAFFDPGVKAILTTLGGFNSNQLLRYLDYEQIKRHP
FT                   KILCGYSDITALCNAIYQKTGLVTYSGPHFSTFAMKKGLDYTQEYFLSCCASDDPFEIL
FT                   PSSEWSDDRWFLDQENRRFYPNNGPVVIQEGYAEGTLIGGNLCTLNLLQGTEYFPETEH
FT                   TILLIEDDYMSDIHMFDRDLQSLIHLPAFSHVKAILIGRFQKASNVSMDLVKAMIETKK
FT                   ELSGIPIIANINAGHTSPIATFPIGGTCRIEAISGTSRIWIDKH"
FT   gene            200878..201936
FT                   /locus_tag="BSn5_00920"
FT   CDS_pept        200878..201936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00920"
FT                   /product="fatty acid desaturase"
FT                   /note="COG3239 Fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92818"
FT                   /protein_id="ADV92818.1"
FT                   /translation="MTEQTIAHKQKQLTKQVAAFAQPETKNSLIQLLNTFIPFFGLWFL
FT                   AYLSLDVSYLLTLALTVIAAGFLTRIFIIFHDCCHQSFFKQKRYNHILGFLTGVLTLFP
FT                   YLQWQHSHSIHHATSSNLDKRGTGDIWMLTVNEYKAASRRTKLAYRLYRNPFIMFILGP
FT                   IYVFLITNRFNKKGARRKERVNTYLTNLAIVALAAACCLIFGWQSFLLVQGPIFLISGS
FT                   IGVWLFYVQHTFEDSYFEADENWSYVQAAVEGSSFYKLPKLLQWLTGNIGYHHVHHLSP
FT                   KVPNYKLEVAHEHHEPLKNVPTITLKTSLQSLAFRLWDEDNKQFVSFRAIKHIPVSLPP
FT                   DSPEKQKLRKNA"
FT   gene            202056..203168
FT                   /locus_tag="BSn5_00925"
FT   CDS_pept        202056..203168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00925"
FT                   /product="two-component sensor histidine kinase (DesR)"
FT                   /note="COG4564 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92819"
FT                   /protein_id="ADV92819.1"
FT                   /translation="MIKNHFTFQKLNGITPYIWTIFFILPFYFIWKSSSTFVIIVGIIL
FT                   TLLFFSVYRFAFVSKGWTIYLWGFLLIGISTASITLFSYIYFAFFIAYFIGNIKERVPF
FT                   HILYYVHLISAAVAANFSLVLKKEFFLTQIPFVVITLISAILLPFSIRSRKERERLEEK
FT                   LEDANERIAELVKLEERQRIARDLHDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKS
FT                   VQQTARTSLNEVRKIVSSMKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNEN
FT                   ILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEVVITVSDDGTFKGEENSFSKGHGLLGM
FT                   RERLEFANGSLHINTENGTKLTMAIPNNSK"
FT   gene            203187..203786
FT                   /locus_tag="BSn5_00930"
FT   CDS_pept        203187..203786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00930"
FT                   /product="two-component response regulator (DesK)"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92820"
FT                   /protein_id="ADV92820.1"
FT                   /translation="MISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKK
FT                   RQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDS
FT                   PSEELANAIRSVMNGKRIYAPELMEDLYSEANPLTDREKEVLELVADGKNTKEIAQELS
FT                   IKSGTVRNYISMILEKLEVKNRIEAITRSKEKGWFK"
FT   gene            complement(204394..205257)
FT                   /locus_tag="BSn5_00935"
FT   CDS_pept        complement(204394..205257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00935"
FT                   /product="putative exported cell wall-binding protein"
FT                   /note="COG1388 FOG: LysM repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00935"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92821"
FT                   /protein_id="ADV92821.1"
FT                   /translation="MKKTIMSFVAVAALSTTAFGAHASAKEITVQKGDTLWGISQKNGV
FT                   NLKDLKEWNKLTSDKIIAGEKLTISSEETTTTGQYTIKAGDTLSKIAQKFGTTVNNLKV
FT                   WNNLSSDMIYAGSTLSVKGQATAANTATENAQTNAPQAAPKQEAVQKEQPKQEAVQQQP
FT                   KQETKAEAETSVNTEEKAVQSNTNNQEASKELTVTATAYTANDGGISGVTATGIDLNKN
FT                   PNAKVIAVDPNVIPLGSKVYVEGYGEATAGDTGGAIKGNKIDVFVPSKSDASNWGVKTV
FT                   NVKILN"
FT   gene            complement(205505..207280)
FT                   /locus_tag="BSn5_00940"
FT   CDS_pept        complement(205505..207280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00940"
FT                   /product="putative ATP-dependent nucleic acid helicase"
FT                   /note="COG0514 Superfamily II DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92822"
FT                   /protein_id="ADV92822.1"
FT                   /translation="MLHRAQSLLAHYFGYEKFRSGQDEAIRLVTEARQNTACIMPTGGG
FT                   KSICYQIPALMFEGTTIVISPLISLMKDQVDALEEAGINAAYINSTQSNQEIYERLNGL
FT                   KEGAYKLFYITPERLTSTEFIRILQGIDVPLVAIDEAHCISQWGHDFRPSYRNIEILFR
FT                   ELHDKPVIMALTATATPEVHDDICKQLHIQKENTVYTGFSRENLTFKVVKGENKDRFID
FT                   EYVQNNRHEAGIVYTATRKEADRIYERLKRNQVRAGRYHGGLADDERKEQQERFLNDEL
FT                   QVMVATSAFGMGIDKSNIRFVLHAQIPKDMESYYQEAGRAGRDGLASECVLLFSPQDIM
FT                   VQRFLIEQSEHEEKQKQDLKKLRQMVDYCHTEDCLQRFILMYFGEKEPDACGQCGNCTD
FT                   TRAAHDVTREAQMVLSCIIRMKERFGKTMVAQVLAGSKNKKVLENGFSDLSTYGILKHQ
FT                   SVGEISDFIEFLISDDFIRMSDGTFPTLFVSSKGRNVLKGELSVARKESLKAAAITEND
FT                   ELFERLRMVRKEIAAEQGVPPFVVFSDQTLKEMSGKQPVNDDELLSIKGVGEQKRAKYG
FT                   RLFLQEIQAYARMTD"
FT   gene            complement(207624..207806)
FT                   /locus_tag="BSn5_00945"
FT   CDS_pept        complement(207624..207806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00945"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92823"
FT                   /protein_id="ADV92823.1"
FT                   /translation="MYIHINIEENNHSLLAKKAVFFIVIYFLFVELSGILEKKQFYSLE
FT                   KVFLNNCSDLLIKTA"
FT   gene            complement(207845..208471)
FT                   /locus_tag="BSn5_00950"
FT   CDS_pept        complement(207845..208471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00950"
FT                   /product="azoreductase"
FT                   /note="COG1182 Acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92824"
FT                   /protein_id="ADV92824.1"
FT                   /translation="MSTVLFVKSSDRTAEEGVSTKLYEAFLAAYKENNPNDEVVELDLH
FT                   KENLPYLGRDMINGTFKAGQGMEMTEDEKKQAAIADKYLNQFVKADKVVFAFPLWNFTV
FT                   PAVLHTYVDYLSRAGVTFKYTQEGPVGLMGGKKVALLNARGGVYSEGPMAALEMSLNFM
FT                   KTVLGFWGVQDLHTVVIEGHNAAPDQAQEIVEKGLQEAKDLAAKF"
FT   gene            complement(208623..209114)
FT                   /locus_tag="BSn5_00955"
FT   CDS_pept        complement(208623..209114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00955"
FT                   /product="putative general stress protein"
FT                   /note="COG1734 DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00955"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92825"
FT                   /protein_id="ADV92825.1"
FT                   /translation="MALTKEQTQHLYHKLLDMQKELSGEKKETESMTEEVGELSNGVDN
FT                   HMADHGTLVTDRMTDQTVREIDRELLEEVNRALQKMKDGTYGVCEKTGQEIPYERLEAV
FT                   PYARMTVEAQADVEDDLETDAPSYEREFHEQVKDLSNKETIDQKSSQTYEILDREQDSK
FT                   "
FT   gene            complement(209189..209521)
FT                   /locus_tag="BSn5_00960"
FT   CDS_pept        complement(209189..209521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92826"
FT                   /protein_id="ADV92826.1"
FT                   /translation="MKKMFRSLIRHCLKPELDKLRECEERLSVIEKQKQSSKQESEETY
FT                   IHIETLNVEKIDYHLEFGELTIDELSGRLNIGATYYIPPEEKDKKCQRKPEAPSTPAVT
FT                   IRSKRQ"
FT   gene            209599..209826
FT                   /locus_tag="BSn5_00965"
FT   CDS_pept        209599..209826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00965"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00965"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92827"
FT                   /protein_id="ADV92827.1"
FT                   /translation="MLPTNINISHLKTNSIGTGSSLTFGSAELRNRRSAIKRNNGFGEQ
FT                   NADVIVMVIPIESIDDRDGADALSMKINHQ"
FT   gene            complement(209813..210289)
FT                   /locus_tag="BSn5_00970"
FT   CDS_pept        complement(209813..210289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00970"
FT                   /product="putative spore coat protein"
FT                   /note="COG0071 Molecular chaperone (small heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92828"
FT                   /protein_id="ADV92828.1"
FT                   /translation="MDFEKMKQWMEFAQQMYGGDFWKQVFDEDQKTPFMTNGQSPFPFA
FT                   QQDQRGKGDASFPSMDIVDTVTEVQFLIYLPGYRKQDVHILSYGDYLVVKGQRFSYFNE
FT                   QDFRQKEGRYGSFEKKIPLSDHLHGKMNAIFKDGILYITIQKDEGQAKTIVIDD"
FT   gene            210356..210619
FT                   /locus_tag="BSn5_00975"
FT   CDS_pept        210356..210619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00975"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92829"
FT                   /protein_id="ADV92829.1"
FT                   /translation="MVQPTPYININIFMLKINSFENASAVNVGQNLLAEWQNSDKKNQG
FT                   YGQNFGDASGFMGTRSHVDDRDQIDSPASFESEAVNSSIKRK"
FT   gene            210624..210857
FT                   /locus_tag="BSn5_00980"
FT   CDS_pept        210624..210857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92830"
FT                   /protein_id="ADV92830.1"
FT                   /translation="MFFSPSVVNVGGFKINTMDRGSSLTLGPYQQVDYFLSAKINQGFG
FT                   EENGDFTPLVVPISNVLDADLVDSNSAKNSVV"
FT   gene            complement(210951..211295)
FT                   /locus_tag="BSn5_00985"
FT   CDS_pept        complement(210951..211295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00985"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92831"
FT                   /protein_id="ADV92831.1"
FT                   /translation="MGIFSVSRSTDAKKLEALLVEGERIESIYKLRVDQICFTNKRIIF
FT                   FDNKMFSKKKVRVFLPYKTIESFAIQEAGMFDPDTGLLLMTRSKTFELEFAKDTDLSEV
FT                   QAVLTKHLCS"
FT   gene            complement(211542..211643)
FT                   /locus_tag="BSn5_00990"
FT   CDS_pept        complement(211542..211643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92832"
FT                   /protein_id="ADV92832.1"
FT                   /translation="MNNQEYFVKSGQSTKPQLSCGFFVVKTGNIKQE"
FT   gene            complement(211651..211854)
FT                   /locus_tag="BSn5_00995"
FT   CDS_pept        complement(211651..211854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_00995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_00995"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92833"
FT                   /protein_id="ADV92833.1"
FT                   /translation="MIHKNWLEKETIKKVKCVQTNAKKYIVNRVLTPGKEYEVKNETEE
FT                   FLFVVDNTNKVGGYYKEYFEEM"
FT   gene            212084..213571
FT                   /locus_tag="BSn5_01000"
FT   CDS_pept        212084..213571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01000"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92834"
FT                   /protein_id="ADV92834.1"
FT                   /translation="MSSLTMQVTKRLETFLQGTKKLYIDGKFVPSASGATFDTPNPATG
FT                   ETLMTLYEAQAADVDKAVKAARKAFDQGEWRTMSPASRSRLMYKLADLMEEHKTELAQL
FT                   ETLDNGKPINETTNGDIPLAIEHMRYYAGWCTKITGQTIPVSGAYFNYTRHEPVGVVGQ
FT                   IIPWNFPLLMAMWKMGAALATGCTIVLKPAEQTPLSALYLAELIDQAGFPAGVINIIPG
FT                   FGEDAGEALTNHEAVDKIAFTGSTEIGKKIMSTAAKSIKRVTLELGGKSPNILLPDANL
FT                   KKAIPGALNGVMFNQGQVCCAGSRVFIHKDQYDEVVDEMASYAESLRQGAGLHKDTQIG
FT                   PLVSKEQHERVLSYIQKGKDEGAKAVTGGSCPFEAGYFVAPTVFANVEDEMTIAKEEIF
FT                   GPVLTAIPYETVDEVIERANHSEYGLAAGLWTENVKQAHYIADRLQAGTVWVNCYNVFD
FT                   AASPFGGYKQSGLGREMGSYALDNYTEVKSVWINLED"
FT   gene            213672..215570
FT                   /locus_tag="BSn5_01005"
FT   CDS_pept        213672..215570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01005"
FT                   /product="squalene-hopene cyclase"
FT                   /note="COG1657 Squalene cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01005"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92835"
FT                   /protein_id="ADV92835.1"
FT                   /translation="MGTLQEKVRRFQKKTITELRDRQNADGSWTFCFEGPILTNSFFIL
FT                   LLTSLDEGENEKELISSLAAGIHAKQQPDGTFINYPDETRGNLTATVQGYVGMLASGCF
FT                   HRSEPHMKKAEQFIISHGGLRHVHFMTKWMLAANGLYPWPALYLPLSLMALPPTLPIHF
FT                   YQFSSYARIHFAPMAVTLNQRFVLINRNISSLHHLDPHMTKNPFTWLRSDAFEERDLTS
FT                   ILSHWKRVFHAPFAFQQLGLQTAKTYMLDRIEKDGTLYSYASATIFMVYSLLSLGVSRY
FT                   SPVIRRAITGIKSLVTKCNGIPYLENSTSTVWDTALISYALQKNGVTETDGSVTKAADF
FT                   LLERQHTKIADWSVKNPNSVPGGWGFSNINTNNPDCDDTAAVLKAIPRNHSPAAWERGV
FT                   SWLLSMQNNDGGFSAFEKNVNHPLIRLLPLESAEDAAVDPSTADLTGRVLHFLGEKVGF
FT                   TEKHQHIQRAVKWLFEHQEQNGSWYGRWGVCYIYGTWAALTGMHACGVDRKHPGIQKAL
FT                   RWLKSIQNDDGSWGESCKSAEIKTYVPLHRGTIVQTAWALDALLTYENSEHPSVVKGMQ
FT                   YLTDSSSHSADSLAYPAGIGLPKQFYIRYHSYPYVFSLLAVGKYLDSIEKETANET"
FT   gene            215560..216405
FT                   /locus_tag="BSn5_01010"
FT   CDS_pept        215560..216405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01010"
FT                   /product="superoxide dismutase"
FT                   /note="COG0605 Superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92836"
FT                   /protein_id="ADV92836.1"
FT                   /translation="MKRESYQTEMFNWCEALKDQIQKRGQLDQFEDQIDKMIEALEDDQ
FT                   TTEEDWYKQAAALYRDITESDDTSERRAYVPIGKHVLPKLPYKYSALEPYISRDIMVLH
FT                   HTKHHQSYVDGLNKAESELKKARATKNYDLITHWERELAFHGAGHYLHSIFWFSMHPNG
FT                   KRRPTGALFQMIDLSFGSYSAFKEHFTQAAKKVEGVGWAILVWAPRSGRLEILTAEKHQ
FT                   LLSQWDVIPLLPLDVWEHAYYLQYKNDRASYVDHWWNVVDWREAEKRFEQAKEVVWKLY
FT                   "
FT   gene            complement(216438..217775)
FT                   /locus_tag="BSn5_01015"
FT   CDS_pept        complement(216438..217775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01015"
FT                   /product="putative sodium-dependent transporter"
FT                   /note="COG0733 Na+-dependent transporters of the SNF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01015"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92837"
FT                   /protein_id="ADV92837.1"
FT                   /translation="MKEANQWSSKLGFILAAAGSAIGLGAIWKFPYVAGTSGGGAFLLI
FT                   FILFTVLIGLPLLLGEFIIGRRTQKDAVQSYKTLAPGTKWHWIGYLGMVTCFILLSFYS
FT                   VVGGWILIYIIKGFTGGLSQTSGFDTIFASTISNPYLAVGGQLLFMVVTILVVAKGVSS
FT                   GIEKASQVLMPALFLLFIILMVRSVTLDGAMEGIKFFLMPDLTAIDANTILYAMGQSFF
FT                   LLSVGVSVMVTYSAYLEKQENLVQSAVSVTVMNMLVAVMAGIAIFPAVFSFGLKPDQGP
FT                   VLLFNVLPTVFNQMPFGIIFLLAFLLLFLFAALTSAFSMLEILVAVLSKGDVNKRKRFA
FT                   WLGGIAIFIVGVPSALSYGVLSDVTIFHLSIFDAADYLVSNILMPLGALLISIFVPLKI
FT                   PKQDLFDELKSGSNLKRKWFAVWLLLIRYLSPVAIIIVFLHVVGIF"
FT   gene            217994..218959
FT                   /locus_tag="BSn5_01020"
FT   CDS_pept        217994..218959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01020"
FT                   /product="putative sodium-dependent transporter"
FT                   /note="COG0385 Predicted Na+-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92838"
FT                   /protein_id="ADV92838.1"
FT                   /translation="MDIIRKISHFAGQTFGIWVIVFAVLGFSFPSLFTWISSYITIFLG
FT                   IIMFGMGLTLQADDFKELVRKPWQVIIGVIAQYTIMPLVAFGLAFGLHLPAEIAVGVIL
FT                   VGCCPGGTASNVMTFLAKGNTALSVAVTTISTLLAPVVTPLLIMLFAKEWLPVSPGSLF
FT                   ISILQAVLFPIIAGLIVKMFFRKQVAKAVHALPLVSVIGIVAIVSAVVSGNRENLLQSG
FT                   LLIFSVVILHNGIGYLLGFLCAKLLKMDYPSQKAIAIEVGMQNSGLGAALATAHFSPLS
FT                   AVPSAIFSVWHNLSGSMLATYWSKKVKKKQAGSKSSNLSL"
FT   gene            complement(219009..220262)
FT                   /locus_tag="BSn5_01025"
FT   CDS_pept        complement(219009..220262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01025"
FT                   /product="dihydrolipoamide succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01025"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92839"
FT                   /protein_id="ADV92839.1"
FT                   /translation="MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNV
FT                   ELTAEESGVLQEVLKDSGDTVQVGEIIGTISEGAGESSAPAPTEKTESKESVKEEKQAE
FT                   PAAQEVSEEAQSEAKSRTIASPSARKLAREKGIDLSQVPTGDPLGRVRKQDVEAYEKPA
FT                   SKPAPQQKQQPQAQKAQQSFDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMT
FT                   AVMNLRKRRKDQFFEQNEVKLGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIG
FT                   IAVAADEGLVVPVVRDADRLTFAGIEKEIGELAKKARNNKLTLSELQGGSFTITNGGTF
FT                   GSLMSTPILNSPQVGILGMHKIQLRPVAIDEERFENRPMMYIALSYDHRIVDGKEAVGF
FT                   LVTIKNLLEDPEQLLLEG"
FT   gene            complement(220278..223112)
FT                   /gene="sucA"
FT                   /locus_tag="BSn5_01030"
FT   CDS_pept        complement(220278..223112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="BSn5_01030"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="COG0567 2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92840"
FT                   /protein_id="ADV92840.1"
FT                   /translation="MFQNSMKQRMNWEDFYGPNLGYALELYDQYTQDPNSIDPDLKEMF
FT                   DELGAPPSDIKEASGTKEKGRVTADLIQKIASAVRLAEDIRTYGHLNASVNPLRKDEKK
FT                   SELFPLSDYGLTEEEIKAIPASVICKDAPKNISNGLEAIQYLRNTYKRTISFEFDHVHD
FT                   FKEREWLTRKIESGELFQKNSAEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDA
FT                   LVPVLDDIIAQSVKSGTTSVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPS
FT                   EGSIGISYGWTGDVKYHLGANRELQDAETKSARITLANNPSHLEFINPIVEGSTRAAQE
FT                   TRTQSGYPVQDETKSLAILIHGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIG
FT                   FTTESAESRSTKYASDLAKGYEIPIVHVNADDPEACLSAVKFAVEYRKTFNKDFLIDLI
FT                   GYRRYGHNEMDEPSTTQPMLYDAVRKHPTVKQIFAEKLVKEGVVTEEVVQNIEKSVTKR
FT                   IEDAYQKVPSKKEHTACEIELPEPVSNGFPDVDTSIDFDVLRKLNGELINWPESFNVFG
FT                   KLKRILERRAKAFDDDRKVEWSLAESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLH
FT                   DSETGKEFVPLHHLSDCSTSFAVHNSPLSEGSVLGFEYGYNVHSPETLVLWEAQYGDFA
FT                   NAAQVYFDQFISAGRAKWGQKSGLVMLLPHGYEGQGPEHSSGRIERFLQLAAENNWTVA
FT                   NLTSAAQYFHILRRQAKMLLREEIRPLVIMTPKSLLRNPNTVSEVQELSESRFQPVYEQ
FT                   SGLSHDYEKVTRLVLSSGKVSIDISDHFNKLEDGKEWLHIARIEQLYPFPAKGVKELFA
FT                   KLPNLKEIVWVQEEPQNMGAWGYISPYLTEIAPEGVSVQYIGRRRRSSPAEGDPTVHKK
FT                   EQERIVSDSLTRKN"
FT   gene            complement(223341..225257)
FT                   /locus_tag="BSn5_01035"
FT   CDS_pept        complement(223341..225257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01035"
FT                   /product="von Willebrand factor type A"
FT                   /note="COG4548 Nitric oxide reductase activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01035"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92841"
FT                   /protein_id="ADV92841.1"
FT                   /translation="MKFIKFNDSTIDSFLFMMLTDLAKTLTKSEAVEVEYGVQSYYNPF
FT                   EKKIYMSHFWKDRAAEDMEAGLKSDVYLRSVGTRYSSLHEFANFLNDIHRHLTFKSFAK
FT                   QLFMLLEDIRIEECIKRERPGTKHVFAKRKDMYRKHFSTQLTLNLERSIFTDALFCAIY
FT                   VKLTAESPLETLPSIREDIDLMRPFIEQQLLRVYEADSTRQVLKIVEDLMDGLEEVLDK
FT                   DMLNTYFFLPELDYAKAAEQPLFEEEKKAPKLSDDITLPKQSDGDEDIHEEEMPTWHRE
FT                   TEAPSKSFLQFDIEHGAKSDLGKDASREGDDGDQALGSVQGSARQTKRKDYSKLEALES
FT                   QKDQPNGAGMADGKENKYAFPIYKEPQPATSEEELSYKQQAKTIESYQKRLKQMIQKTL
FT                   EHKKTLPRTDLHAGRLNNKLLRYFTERNPRLFYKKQEPSSEIDAVFTLLVDCSASMFDK
FT                   MDETKRGIVLFHEALKSVAVPHQIVGFWEDTNDATEKSQPNYFNTVIPFQSSLRQDSGP
FT                   AIMQLEPEEDNRDGYAIRQMTKKMLHRSEAQKFLIVFSDGEPAAFGYEQNGIVDTSEAV
FT                   IEARKRGIEVINVFLSNSEIEESQMKTIQDMYGKFSIFVPDVDQLSDVLYPLLKKLLHK
FT                   SIG"
FT   gene            complement(225268..226158)
FT                   /locus_tag="BSn5_01040"
FT   CDS_pept        complement(225268..226158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01040"
FT                   /product="putative nitric-oxide reductase"
FT                   /note="COG0714 MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92842"
FT                   /protein_id="ADV92842.1"
FT                   /translation="MTTQLQHLTLPEDIQQKLLSYKEQPISSEFQSLIGTSGYEAEDEA
FT                   ILFDAIIALAMGKNVLLKGPTGSGKTKLAETLSSYFHKPMHSVNCSVDLDAEALVGYKT
FT                   IENQSGQATIEFVSGPVTKAMKEGHFLYIDEINMAKPETLPILNGVLDYRKMMTNPFTG
FT                   EVIRAKSGFGVIAAINEGYVGTVPLNEALKNRFVIIDVPYIKGELLKQVLMSQSALKDE
FT                   KLIDRFITLSSDLIVQANNGQVSEEAASIRALLDTCDLAAYIPPRRAIERGIVEKLDDD
FT                   REKAAVRNIAETLFE"
FT   gene            complement(226246..226836)
FT                   /locus_tag="BSn5_01045"
FT   CDS_pept        complement(226246..226836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01045"
FT                   /product="superoxide dismutase (exported lipoprotein)"
FT                   /note="COG2032 Cu/Zn superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01045"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92843"
FT                   /protein_id="ADV92843.1"
FT                   /translation="MYRLLLLMMLTALGVAGCGQKKPPDPPNRVPEKKVVETSAFGHHV
FT                   QLVNREGKAVGFIEIKESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGP
FT                   FNPLNKEHGFNNPMGHHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAF
FT                   IIHEQADDYLTNPSGNSGARIVCGALLGNNEKQ"
FT   gene            complement(226929..228173)
FT                   /locus_tag="BSn5_01050"
FT   CDS_pept        complement(226929..228173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01050"
FT                   /product="peptidoglycan hydrolase (cell wall-binding
FT                   d,l-endopeptidase)"
FT                   /note="COG1388 FOG: LysM repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92844"
FT                   /protein_id="ADV92844.1"
FT                   /translation="MKKKIVAGLAVSAVVGSSMAAAPVEAKTIKVKSGDSLWKLSRQYD
FT                   TTISALKSENKLKSTVLYVGQSLKVPESSKKSTTSPSNSSKTSTYTVAYGDSLWMIAKN
FT                   HKMSVSELKSLNSLSSDLIRPGQKLKIKGTSSSSGSNGSKKNSGSNSSGSSKSTYTVKL
FT                   GDSLWKIANSLNMTVAELKTLNGLTSDTLYPKQVLKIKGSSSPKSGNSGSKKPSNSNSS
FT                   KTTTYKVKAGDSLWKIANRLGVTVQSIRDKNNLSSDVLQIGQVLTISGASKSNPSNPTK
FT                   PTKPKDNSGSNIQIGSKIDRMITEAKKYVGVPYRWGGNTPAGFDCSGFIYYLINNVSSI
FT                   SRLSTAGYWNVMQKVSQPSVGDFVFFTTYKSGPSHMGIYLGGGDFIHASSSGVDISNLS
FT                   NSYWKQRYLGARSYF"
FT   gene            complement(228544..229761)
FT                   /locus_tag="BSn5_01055"
FT   CDS_pept        complement(228544..229761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01055"
FT                   /product="putative glycosyltransferase"
FT                   /note="COG1819 Glycosyl transferases, related to
FT                   UDP-glucuronosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01055"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92845"
FT                   /protein_id="ADV92845.1"
FT                   /translation="MANVLMIGFPGEGHINPSIGVMKELKSRGENITYYAVKEYKEKIT
FT                   ALDIEFREYHDFRGDYFGKNATGDEERDFTEMLCAFLKACKDIATHIYEEVKHESYDYV
FT                   IYDHHLLAGKVIANMLKLPRFSLCTTFAMNEEFAKEMMGAYMKGSLEDSPHYESYQQLA
FT                   ETLNADFQAEIKKPFDVFLADGDLTIVFTSRGFQPLAEQFGERYVFVGPSITERAGNND
FT                   FPFDQIDNENVLFISMGTIFNNQKQFFNQCLEVCKDFDGKVVLSIGKHIKTSELNDIPE
FT                   NFIVRPYVPQLEILKRASLFVTHGGMNSTSEGLYFETPLVVIPMGGDQFVVADQVEKVG
FT                   AGKVIKKEELSESLLKETIQEVMNNRSYAEKAKEIGQSLKAAGGSKKAADSILEAVKQK
FT                   TQSANA"
FT   gene            complement(229997..230611)
FT                   /locus_tag="BSn5_01060"
FT   CDS_pept        complement(229997..230611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01060"
FT                   /product="hypothetical protein"
FT                   /note="COG1624 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92846"
FT                   /protein_id="ADV92846.1"
FT                   /translation="MRYEQISENAFKGKIQVYLEQILGDASLILKTLHEKDQCLLCELD
FT                   DLGHIFQDMQGIASSFYLQSYIEEFTPAFIELAKAIKALSEHKHGALIVIERADPVEHF
FT                   IQKGTSLHAEISSSLIESIFFPGNPLHDGALLVRENKLVSAANVLPLTTKEVDIHLGTR
FT                   HRAALGMSGYTDALVLVVSEETGKMSFAKDGVLYPLISPRT"
FT   gene            230700..230810
FT                   /locus_tag="BSn5_01065"
FT   CDS_pept        230700..230810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01065"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92847"
FT                   /protein_id="ADV92847.1"
FT                   /translation="MEIERIIQYICTFLGVISLSFIYAQMFRKTKPTKKE"
FT   gene            230886..232244
FT                   /locus_tag="BSn5_01070"
FT   CDS_pept        230886..232244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01070"
FT                   /product="multidrug efflux protein"
FT                   /note="COG0534 Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92848"
FT                   /protein_id="ADV92848.1"
FT                   /translation="MKETQNAREKIKQLLHILIPIFITQAGLSLMTFLDTVMSGKVSPA
FT                   DLAGVAIGSSLWTPVYTGLAGILMAVTPIVAQLLGAEKKQKIPFTVLQAVYVAALLSIA
FT                   VLVIGYAAVDLILGRLNLDIHVHQIAKHFLGFLSLGIFPLFVYTVLRSFIDSLGKTRVT
FT                   MMITLSSLPINFVLNYVFIFGKFGMPALGGVGAGLASALTYWCICIISFFIIHKNAPFS
FT                   EYGIFLTMYKFSWKACKNLLKIGLPIGFAVFFETSIFAAVTLLMSHFHTVTIASHQAAM
FT                   NFASLLYMLPLSVSMALTIVVGFEAGAARFKDARSYSLIGIMMAIGFSLFTAACILLFR
FT                   EQIAGMYTSDPDVLRLTQHFLIYALFFQLSDAVAAPIQGALRGYKDVNYTLAAAFVSYW
FT                   VIGLPVGYMVGTFTSLGAFGYWIGLIAGLAAGAVGLFFRLAKLQKRYSQKQHI"
FT   gene            232260..233108
FT                   /locus_tag="BSn5_01075"
FT   CDS_pept        232260..233108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01075"
FT                   /product="Component of the piezosome (stressosome)"
FT                   /note="COG1366 Anti-anti-sigma regulatory factor
FT                   (antagonist of anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01075"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92849"
FT                   /protein_id="ADV92849.1"
FT                   /translation="MAKNKKLFEYLSQHAETISSTWYETIEETDPNSIYASTDPVVIHN
FT                   LKSQNLAFNYKINRIFIDDEDVYLPILKEWAFEVTQDQEHLKTPIHYIIREFVRVRDLY
FT                   VSYVKEFVHLNQDTVKSEEAEDLYHALIKAFDLVIHIFIEEMYKNTSLQLQAQKDMITE
FT                   LSAPVIVLFHSVGLLPLIGDIDTVRAKLIMENTLHQCAKKKVTQLYIDLSGVAVIDTMV
FT                   AHQLFSLIEALRLIGVSSTLSGIRPEIAQTAVQLGLSFEGISLRSTLASAIASDLKLKK
FT                   V"
FT   gene            complement(233134..233799)
FT                   /locus_tag="BSn5_01080"
FT   CDS_pept        complement(233134..233799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01080"
FT                   /product="putative deacetylase"
FT                   /note="COG2120 Uncharacterized proteins, LmbE homologs"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92850"
FT                   /protein_id="ADV92850.1"
FT                   /translation="MKEHVLVILPHPDDESYGVAGLIALNRKKDIPVTYACATLGEMGR
FT                   NMGDPFFANRETLPLLRKQELINACKEMDINDLRMLGLRDKTLEFEDDEYLADIMEEII
FT                   DDVKPSLIVTFYPGHGVHPDHDACGEAVIRALYRKKKEDRPRTICMAITRNREEVLGEA
FT                   DVVLDIKEVADIKMNALRAHRTQTEGMLRELEEKLKNNEPVMATWFEEEIYWTYQWND"
FT   gene            complement(233818..234168)
FT                   /locus_tag="BSn5_01085"
FT   CDS_pept        complement(233818..234168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01085"
FT                   /product="hypothetical protein"
FT                   /note="COG0458 Carbamoylphosphate synthase large subunit
FT                   (split gene in MJ)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01085"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92851"
FT                   /protein_id="ADV92851.1"
FT                   /translation="MKAIIKEDVQASLERYADHPVYIHLETTTGSYSAHLNEKNMTVVA
FT                   YIRNAKVTYHQAKIKGNGPYRVGLKTEEGWIYAEGLTEYTVDEENRLLMAGHLPGGKMA
FT                   ISLQISEKPFTV"
FT   gene            complement(234165..234443)
FT                   /locus_tag="BSn5_01090"
FT   CDS_pept        complement(234165..234443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92852"
FT                   /protein_id="ADV92852.1"
FT                   /translation="MDNDKEIVKAYASLWNNRSLAHDDAEAVAEAIDLELLDKRTHPRL
FT                   RKPMLEKYFAAIQRIVNSQLEPAVKYQLVKLHTERAEYLKEERGEQS"
FT   gene            complement(234519..235415)
FT                   /locus_tag="BSn5_01095"
FT   CDS_pept        complement(234519..235415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01095"
FT                   /product="putative integral inner membrane protein"
FT                   /note="COG2962 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01095"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92853"
FT                   /protein_id="ADV92853.1"
FT                   /translation="MQYSETKKGVIYTAVSFIMWGLFPLYWKLLEQLPALDILAHRIIW
FT                   SFVFMCIVLFFLRQWKLGWQELCSLKKNGGILSLFLASILISINWFVYIWAVNHGFLLE
FT                   ASLGYYINPLVSVLLGILFLKEKLNRLQLVAVSIAAAGVIISAFQYGSIPYVALLLAFS
FT                   FGLYGLSKKRTSLPSAIGLTLETFMIMPIALGYLLFSGHVQPAGAESGGTWLLLFLAGV
FT                   FTALPLLLFAEGAKRLPLYQVGILQYIAPTITLLIGLFVYHEPFSSSKAFTFSCIWAAL
FT                   LLFTFSQVKWKRASKSH"
FT   gene            235514..235987
FT                   /locus_tag="BSn5_01100"
FT   CDS_pept        235514..235987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01100"
FT                   /product="component of the spore coat"
FT                   /note="COG0071 Molecular chaperone (small heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92854"
FT                   /protein_id="ADV92854.1"
FT                   /translation="MFEWNKYFPFHNQFSKEALKKADPKEVETYVNRVMESVFGSDYAA
FT                   QFPFRDPLPQKEQPAKPDAKPDVKPDIDIFETADHVFVKVPIGEEQLEHVRIKHTSHEL
FT                   WLENFPRADHPKKVNLPCLVKRKGTKAVYKDGLLEVMFQKQQDYNMSEVEIIR"
FT   gene            complement(236021..236257)
FT                   /locus_tag="BSn5_01105"
FT   CDS_pept        complement(236021..236257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01105"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92855"
FT                   /protein_id="ADV92855.1"
FT                   /translation="MYPHHSYLRGIPGPAGYPARSPFLFGAPLVGGLLGGFLGSALFNY
FT                   SRPYAYPPGPYGYGGGPYGFGAGVPYGGYPGFY"
FT   gene            complement(236342..237676)
FT                   /locus_tag="BSn5_01110"
FT   CDS_pept        complement(236342..237676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01110"
FT                   /product="putative H+/anion permease"
FT                   /note="COG2610 H+/gluconate symporter and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92856"
FT                   /protein_id="ADV92856.1"
FT                   /translation="MPILIVAVGVLILLFLIIKVKLNTFVSLIVVSFLVAIGLGMDINK
FT                   IVLSIEAGIGGQLGHLALVFGLGAMLGRLVSDAGGGYRIAITLIDKFGRKRIQAAVVVA
FT                   SFIIGIALFFEVGLVLLIPIVYAIAKELKMPFLYLGIPMAAALNVTHGFLPPHPAPTAI
FT                   SVAYGAHIGQVLLFGIIIAVPTTVIAGPLFNKFAMKRFPGAYQKHGNLSGLGPRKEFQL
FT                   DETPGFAISAVTSLFPVIFMAMATVFSLLLNEHSKGKDIIEFIGTPGTAILISLLLALY
FT                   TMGYARKIPMQEISRSISESISQIAMMLLIIGGGGAFKQVLIDGGVGDYVADFFRQTNM
FT                   SPLFVAWTIAAVLRLCLGSATVAALTTAGMAAPLMEAGSVNPALMVLATGAGSVIACHV
FT                   NDAGFWMVKEFFGLSMKETFQTWTLLTTVLSVTGLGCVLLAGLVM"
FT   gene            238041..238430
FT                   /locus_tag="BSn5_01115"
FT   CDS_pept        238041..238430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01115"
FT                   /product="putative tautomerase"
FT                   /note="COG1942 Uncharacterized protein, 4-oxalocrotonate
FT                   tautomerase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01115"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92857"
FT                   /protein_id="ADV92857.1"
FT                   /translation="MPLLRFDVIEGRDEKSLQLLLDTAHQAMVEAFGVPERDRYQIVHQ
FT                   HPANELIIQDTGLGFQRTKDMVIISMTSKARTESQKEKLYALLAERLEEKCGISPEDLM
FT                   VSITENGDADWSFGLGEAHFLNGKL"
FT   gene            238417..238611
FT                   /locus_tag="BSn5_01120"
FT   CDS_pept        238417..238611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92858"
FT                   /protein_id="ADV92858.1"
FT                   /translation="MENYKISSPHKKKKRELQEALSFFHKCGSHQSRSIQQYEKPGSPF
FT                   RSGLNANWKLTLAENIKFC"
FT   gene            complement(238800..239138)
FT                   /locus_tag="BSn5_01125"
FT   CDS_pept        complement(238800..239138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01125"
FT                   /product="transcriptional repressor"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01125"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92859"
FT                   /protein_id="ADV92859.1"
FT                   /translation="MGNTMCPKMESAFSLLGKRWNGLIIHVLMDGPKRFKEITETIPMI
FT                   SQKMLAERLKELEQNEIVERQVLPETPVKVIYTLTEKGTALQAVFQEMQAWADQFCEPG
FT                   DTVCEEEK"
FT   gene            239268..239876
FT                   /locus_tag="BSn5_01130"
FT   CDS_pept        239268..239876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01130"
FT                   /product="putative oxidoreductase"
FT                   /note="COG0778 Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92860"
FT                   /protein_id="ADV92860.1"
FT                   /translation="MTNTLDVLKARASVKEYDTNAPISKEELTELLDLATKAPSAWNLQ
FT                   HWHFTVFHSDESKAELLPVAYNQKQIVESSAVVAILGDLKANENGEEVYAELASQGYIT
FT                   DEIKQTLLGQINGAYQSEQFARDSAFLNASLAAMQLMIAAKAKGYDTCAIGGFNKEQFQ
FT                   KQFDISERYVPVMLISIGKAVKPAHQSNRLPLSKVSTWL"
FT   gene            complement(239919..240521)
FT                   /locus_tag="BSn5_01135"
FT   CDS_pept        complement(239919..240521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01135"
FT                   /product="putative hydrolase"
FT                   /note="COG0400 Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01135"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92861"
FT                   /protein_id="ADV92861.1"
FT                   /translation="MKHIYEKGTSDNVLLLLHGTGGNEHDLLSLGRFIDPDAHLLGVRG
FT                   SVLENGMPRFFKRLSEGVFDEKDLVVRTRELKDFIDEAAETHQFNRGRVIAVGYSNGAN
FT                   IAASLLFHYKDVLKGAILHHPMVPIRGIELPDMAGLPVFIGAGKYDPLCTKEESEELYR
FT                   YLRDSGASASVFWQDGGHQLTQHEAEQAREWYKEAIV"
FT   gene            complement(240537..241448)
FT                   /locus_tag="BSn5_01140"
FT   CDS_pept        complement(240537..241448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01140"
FT                   /product="putative lyase/dioxygenase"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92862"
FT                   /protein_id="ADV92862.1"
FT                   /translation="MKTEGLHHVTAFARDPQENLRFYTEVLGLRLVKKTVNFDDPGTYH
FT                   FYFGNQNGDPGTIMTFFPFQGSGQGTVGKGQAGRVYFSVPSGSLSFWKERLEKSGLSLE
FT                   EKTLFGEKGLIFDDTEDLPLAIMEDAKSGKSEWTPDGITTNEAITGMKGVLLYSYDPQA
FT                   TIQLLTESFGYTKVAEEDQIVRLASSAAVGGVIDVHLHPEKRGVGGYGTVHHVAFRTKK
FT                   KEQAKWLPIIAENHLPASEILDREYFTSVYFREKGGILFEIATDEPGFMTDETFAELGT
FT                   SLKLPEWLEKHRQQITDILPEL"
FT   gene            241632..241832
FT                   /locus_tag="BSn5_01145"
FT   CDS_pept        241632..241832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01145"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92863"
FT                   /protein_id="ADV92863.1"
FT                   /translation="MVKKALIVILILLPFVQLALLPLVNRIEPIMFGLPFFHFWLLLWI
FT                   IVTPLCSFGIYQMQKKDGGLE"
FT   gene            241832..243322
FT                   /locus_tag="BSn5_01150"
FT   CDS_pept        241832..243322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01150"
FT                   /product="putative Na+/metabolite permease"
FT                   /note="COG0591 Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92864"
FT                   /protein_id="ADV92864.1"
FT                   /translation="MQGNLTALLITAIIVLTVVCIGFLAGRDKSSRTSVEEWSVGGRRF
FT                   GGLLVWFLVGADLYTAYTFLGLTSTAFTGGSVAFFAIPYSVLAYFIAYFFLPKLWKVAK
FT                   IHKLTTLADYARERFNSKLLASLVAIVGVLMLIPYICLQLSGIQDTLQVAGTGYINVKF
FT                   VVIISFILVALYTFFSGIKGPTYTAIIKDILVWVIMLFMVVSLPLIHFNGWTPMIDTLV
FT                   KEAPQMLTIPAEGPKGIPWFITASIVSALALFMWAHAATGVFTAKSADAVRKNSMFLPL
FT                   YNIVLILVIFLGFIAFLVLPEDTNPRLALLHLIQTSYGGVAQGFAYATIALASLIPCSI
FT                   MAIGASNLFANNLYRDLIHPNVSQSKLTLVTRSMVFVVIGLALLFGMLFPTALVTLQLL
FT                   GVSGMVQIFPAIAVSLFWKNQTKEATVIGLLAGLAVTFIVYITQSAHGIYEGFWGLAAN
FT                   MIAVVILNPLFVKNAGSNPVIEGLFGKKQDANPNQKGA"
FT   gene            complement(243356..244756)
FT                   /locus_tag="BSn5_01155"
FT   CDS_pept        complement(243356..244756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01155"
FT                   /product="carboxy-terminal processing protease"
FT                   /note="COG0793 Periplasmic protease"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01155"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92865"
FT                   /protein_id="ADV92865.1"
FT                   /translation="MKRQLKLFFIVLITAVVASALTLFITGNSSILGQKSASTGDSKFD
FT                   KLNKAYEQIKSDYYQKTDDDKLVDGAIKGMIQSLDDPYSTYMDQEQAKSFDETISASFE
FT                   GIGAQVEEKDGEILIVSPIKGSPAEKAGIKPRDQIIKVNGKSVKGMNVNEAVALIRGKK
FT                   GTKVKLELNRAGVGNIDLSIKRDTIPVETVYSEMKDNNIGEIQITSFSETTAKELTDAI
FT                   DSLEKKGAKGYILDLRGNPGGLMEQAITMSNLFIDKGKNIMQVEYKNGSKEVMKAEKER
FT                   KVTKPTVVLVNDGTASAAEIMAAALHESSDVPLIGETTFGKGTVQTAKEYDDGSTVKLT
FT                   VAKWLTADGEWIHKKGIKPQVKAELPDYAKLPYLDADKTYKSGDTGTNVKVAQKMLKAL
FT                   GYKVKVNSTYDQDFVSVVKQFQKKEKLNETGILTGDTTTKLMIELQKKLSDNDTQMEKA
FT                   IETLKKEM"
FT   gene            244909..245610
FT                   /locus_tag="BSn5_01160"
FT   CDS_pept        244909..245610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01160"
FT                   /product="putative S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92866"
FT                   /protein_id="ADV92866.1"
FT                   /translation="MSRYLEMLSLFGVAGAHPGGLAFSKAVLQKAAPSPDQPILDAGCG
FT                   TGQTAAYLGHLLYPVTVVDKDPIMLEKAKKRFANEGLAIPAYQAELEHLPFSSESFSCV
FT                   LSESVLSFSRLTSSLQEISRVLKPGGMLIGIEAALKKPMPPAEKKQMMDFYGFTCLHEE
FT                   SEWHKLLRSYGFQKTEAMTLLPEDMEFEPTTEMDLSQTIDPIYYDTLQTHYQLMQLYSE
FT                   YMGHCIFIAYK"
FT   gene            245698..245949
FT                   /locus_tag="BSn5_01165"
FT   CDS_pept        245698..245949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01165"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92867"
FT                   /protein_id="ADV92867.1"
FT                   /translation="MERYYHLCKNHQGKVVRITERGGRVHVGRITRVTRDRVFIAPVGG
FT                   GPRGFGYGYWGGYWGYGAAYGISLGLIAGVALAGLFFW"
FT   gene            complement(246020..246841)
FT                   /locus_tag="BSn5_01170"
FT   CDS_pept        complement(246020..246841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01170"
FT                   /product="D-alanyl-D-alanine carboxypeptidase lipoprotein"
FT                   /note="COG1876 D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92868"
FT                   /protein_id="ADV92868.1"
FT                   /translation="MKKSGKWFSLAAALSVTAIVGAGCSMSNGDAQKDTKTTAETKQTE
FT                   QKTADSKKSNTQNSEFSLESQYFNDIKKVDGLETIQNPENILALVNKQYALPGNYEPSD
FT                   LVIPDVEFSFEEKIQKRYIRKEAADALKTMFDAAKKEGYELAAVSGYRSYDRQKVIFDN
FT                   EVSLKGEKKAKEAVAYPGESEHQTGLAMDISSRSNGFELNEAFGSTADGKWVQDNAYKY
FT                   GFIIRYPKNKEDITKYEYEPWHLRYVGKKAAKVIQDNDLTLEEYFEKVKKI"
FT   gene            complement(246924..247625)
FT                   /gene="deoD"
FT                   /locus_tag="BSn5_01175"
FT   CDS_pept        complement(246924..247625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="BSn5_01175"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="COG0813 Purine-nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01175"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92869"
FT                   /protein_id="ADV92869.1"
FT                   /translation="MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGM
FT                   YGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVI
FT                   LAMTSSTDSQMNRVAFGSIDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDD
FT                   SQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHD
FT                   MIEVALHSVSQ"
FT   gene            247827..247952
FT                   /locus_tag="BSn5_01180"
FT   CDS_pept        247827..247952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92870"
FT                   /protein_id="ADV92870.1"
FT                   /translation="MGKKHRNRITGQKKNNHIPEKDIIAAEEAHGKEYSAAKRKP"
FT   gene            complement(247992..248306)
FT                   /locus_tag="BSn5_01185"
FT   CDS_pept        complement(247992..248306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01185"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92871"
FT                   /protein_id="ADV92871.1"
FT                   /translation="MMLSVFKKKSCSYDVTIFQTPRFGEKKGYRAVYRTELNGSDHQDV
FT                   LKRAFSLFNVFDTVPSDYDARFMATGDVILIDEGRKGKTYYQLLPAGWRKINRLIVQTT
FT                   "
FT   gene            complement(248367..248978)
FT                   /locus_tag="BSn5_01190"
FT   CDS_pept        complement(248367..248978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01190"
FT                   /product="putative phospholipid phosphatase"
FT                   /note="COG0671 Membrane-associated phospholipid
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92872"
FT                   /protein_id="ADV92872.1"
FT                   /translation="MYKPVSLFLFFLILAAAIHTNAVQSADEAISKSAVLIRQPWLNEV
FT                   MTGITHLGASSFLLPLIVIIGAGLFFYRKTWDGLLMLLVFGTDRLLNKVLKEWIERVRP
FT                   DFAPLVHESSFSFPSGHSMNAACVYPVIAYFLVKHLPILSKHKKMVYIIAGVIAVLVGI
FT                   SRVYLGVHFVTDVLGGFSLGLLLFFLVKGFDEKIKRFRQK"
FT   gene            complement(249056..249232)
FT                   /locus_tag="BSn5_01195"
FT   CDS_pept        complement(249056..249232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01195"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92873"
FT                   /protein_id="ADV92873.1"
FT                   /translation="MKEIDLVIDTEEIAEFFYRELARRGYIPSEDELFEIADITFDYLI
FT                   EKCMIDEELDEDE"
FT   gene            249351..249494
FT                   /locus_tag="BSn5_01200"
FT   CDS_pept        249351..249494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92874"
FT                   /protein_id="ADV92874.1"
FT                   /translation="MIAKMMEALDGERFDIIMEKTLKGMTRVMIWGCLPYFLYVLIRMF
FT                   TN"
FT   gene            complement(249491..250171)
FT                   /locus_tag="BSn5_01205"
FT   CDS_pept        complement(249491..250171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01205"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92875"
FT                   /protein_id="ADV92875.1"
FT                   /translation="MKQNKPKFQVGDIVVVIMYGTVGTITKVHQIDKHYLYEVNHNEVL
FT                   YFESSIQLYKDYEGVIVDMEKLDIEYEFLIGDVVYVKDYGKELFRIIGHRTEIWRYLED
FT                   GWEDIIYELTRLKDGEWLETEEEDLTLVLRKYEMDQFVHQLLFVHYVGETGHEIGEDIA
FT                   SSALLQFEGDDEDQDTLHILAVSIVDELLDIYNDYKILYEMFQDEEYKDMMMFVLESLK
FT                   EHFS"
FT   gene            250220..250414
FT                   /locus_tag="BSn5_01210"
FT   CDS_pept        250220..250414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92876"
FT                   /protein_id="ADV92876.1"
FT                   /translation="MKPIRMGMKTKGNIQLWYGYGHKKIRSDLRMKQLLSAVHFRLVLI
FT                   PSFIKRRHRVKVISIQLQI"
FT   gene            complement(250322..250546)
FT                   /locus_tag="BSn5_01215"
FT   CDS_pept        complement(250322..250546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01215"
FT                   /product="hypothetical protein"
FT                   /note="COG4479 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01215"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92877"
FT                   /protein_id="ADV92877.1"
FT                   /translation="MKSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISS
FT                   YLELNADYLHTMATFDEAWDQYESEVHGR"
FT   gene            complement(250633..250911)
FT                   /locus_tag="BSn5_01220"
FT   CDS_pept        complement(250633..250911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92878"
FT                   /protein_id="ADV92878.1"
FT                   /translation="MKTCEWCGKLEAVPGRNTVYWELPDGTRAIELTDTPAMVCSSCGM
FT                   TYQEENTVKEIEDQLLLIQTKKLPESLTYQQLMETERILKRNYFDFS"
FT   gene            complement(250908..252323)
FT                   /locus_tag="BSn5_01225"
FT   CDS_pept        complement(250908..252323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01225"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /note="COG1509 Lysine 2,3-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01225"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92879"
FT                   /protein_id="ADV92879.1"
FT                   /translation="MKNKWYKPKRHWKEIELWKDVPEEKWNDWLWQLTHTVRTLDDLKK
FT                   VINLTEDEEEGVRISTKTIPLNITPYYASLMDPDNPRCPVRMQSVPLSEEMHKTKYDLE
FT                   DPLHEDEDSPVPGLTHRYPDRVLFLVTNQCSMYCRYCTRRRFSGQIGMGVPKKQLDAAI
FT                   AYIRETPEIRDCLISGGDGLLINDQILEYILKELRSIPHLEVIRIGTRAPVVFPQRITD
FT                   HLCEILKKYHPVWLNTHFNTSIEMTEESVEACEKLVNAGVPVGNQAVVLAGINDSVPIM
FT                   KKLMHDLVKIRVRPYYIYQCDLSEGIGHFRAPVSKGLEIIEGLRGHTSGYAVPTFVVDA
FT                   PGGGGKIALQPNYVLSQSPDKVILRNFEGVITSYPEPENYIPNQADAYFESVFPETADK
FT                   KEPIGLSAIFADKEVSFTPENVDRIKRREAYIANPEHETLKNRREKRDQLKEKKFLAQQ
FT                   KKQKETECGGDSS"
FT   gene            complement(252352..253179)
FT                   /locus_tag="BSn5_01230"
FT   CDS_pept        complement(252352..253179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01230"
FT                   /product="putative acetyltransferase"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92880"
FT                   /protein_id="ADV92880.1"
FT                   /translation="MLKSIKSSGVTAVLDHDGFNKRIRVVRYDGAIEKALPDIVAAAKE
FT                   ENAEKIIVYAKQHDEPMLAKQLFAPEGYLKGYYLGHSACVMVRYLSESRRQTDSYTEEQ
FT                   EIIEAIYRTAPRLRNDSTPVFTMRKAETNDMYQLSMLYKKVFRTYPTPVFDPAYIEKTM
FT                   NANTVYYIMLDHDRLISAASAEINPELGHAEITDCAVLPEYRGHSLTSFLIEALEKEMA
FT                   GKDIFHVFSLARASSFGMNAVLYHSGYQYGGRLINNCFIAEGLENMNIWCKQL"
FT   gene            complement(253157..254461)
FT                   /locus_tag="BSn5_01235"
FT   CDS_pept        complement(253157..254461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01235"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01235"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92881"
FT                   /protein_id="ADV92881.1"
FT                   /translation="MQDIERKVIEWLDQHSAKAIRLLKRLIGEKSTLGSEFNAQAVVLE
FT                   KLRQFHMDIDVWEPSIKQLKQHPYFKSNRSDFHESPNIVAKKTGAGGGRSLILNGHIDV
FT                   VPEGSVKDWKYEPYQAVEENGKIYGRGSTDMKGGNTALLFALEALHACDVKLKGDVLFQ
FT                   SVVDEECGGAGTLSAIMRGYRADGALIPEPTNMKLFIKQQGSMWFRITVKGLSAHGGTR
FT                   YEGVSAIEKSMHVITAIQELEKVRNARISDPLYDNIPIPVPVNIGTISGGAWPSSVADR
FT                   VVIEGRCGIAPHEKPEAVKLELENWLKDLEYHDEWFKRHPVKVEWFGAQWLPNDLPDDH
FT                   PLISVLQSAYQKMKQTEPIIEASPWGTDGGLLYHAGDTPVIVFGPGETKTAHQANEYIE
FT                   VEAMIESAKIIALFVMDWCGLHTDGEDADAQVNKE"
FT   gene            complement(254476..255129)
FT                   /locus_tag="BSn5_01240"
FT   CDS_pept        complement(254476..255129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01240"
FT                   /product="putative acyloate-acetoacetate CoA-transferase"
FT                   /note="COG2057 Acyl CoA:acetate/3-ketoacid CoA transferase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92882"
FT                   /protein_id="ADV92882.1"
FT                   /translation="MGLGVAEREQIAKRAAAEIKQGMIVNLGIGIPSLVPNFLKPDMQV
FT                   MFQAENGVLGIGESPEKGEEDAHLCNAAGYPVRAVKGASYFDTTMSFAMIRKGKIDITI
FT                   LGALQVSQSGDLANWLVPGKKVPGMGGAMELAQKAKKVVVVMSHTDQKGRPKLTERCTL
FT                   PLTAAGCVDLIITEKAVLEVDSHHFILKELMNGSTIDEVTRLTEAEIKIDMPFS"
FT   gene            complement(255114..255803)
FT                   /locus_tag="BSn5_01245"
FT   CDS_pept        complement(255114..255803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01245"
FT                   /product="acetate CoA-transferase, subunit A"
FT                   /note="COG1788 Acyl CoA:acetate/3-ketoacid CoA transferase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01245"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92883"
FT                   /protein_id="ADV92883.1"
FT                   /translation="MAPFQKAISIDTAIADVRDGSVLMFGGFGGVGSPPSLIEAILDSG
FT                   VTDLTVICNDAGFPDIGIGPLIVNQRVKTLIASHIGSNPVAGKQMTEGTLEVQFSPQGT
FT                   LAERIRAGGAGLGGILTDVGIDNQMVCEKKDIVTVAGKRYLIEEALTADFAFINAYIAD
FT                   EFGNLTYDKTARNMNPLMAMAARRTFAEAERIVPMGEISEEMIVTPGVFVEGVVRSEGV
FT                   KWKWAWE"
FT   gene            complement(255810..257144)
FT                   /locus_tag="BSn5_01250"
FT   CDS_pept        complement(255810..257144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01250"
FT                   /product="hypothetical protein"
FT                   /note="COG0161 Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92884"
FT                   /protein_id="ADV92884.1"
FT                   /translation="MSSYLIKPELSSAYPVVSYAKGSYVYDQTGKKYLDGSSGAVTCNI
FT                   GHGVRDVTEKLKEQLDQVSFAYRSQFTSEPAEQLAALLAQELPGDVNWSFFVNSGSEAI
FT                   ETAMKIAIQYWQEKKQTQKSIFLSRWSSYHGITLGALSLSGFYERRYRFTHLIERYPAI
FT                   SAPHIYRLNHEMEEDFVQTAADELDTMIKRIGSQFIAGFVAEPIIGAAGAAITPPPGYY
FT                   ERLSEVCRTHDVLFIADEVMTGLGRTGRMLATEHWDTVPDIAVLGKGLGAGYAPIAAAV
FT                   VSDSIIETIKQGSGVIMSGHTYSAHPYSAKAALEVLRYVLKHGLIKQSEKKGAVLKKKL
FT                   DEAASQSGIIGEVRGKGLLLGIEFVADQKTKKVFPPEQAITQLIVSEAKKRGLIVYPSK
FT                   AGIDSGEGDAVIIAPPFTISDGEMEELISIFSETVAAVEKNLKKD"
FT   gene            complement(257125..257280)
FT                   /locus_tag="BSn5_01255"
FT   CDS_pept        complement(257125..257280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01255"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92885"
FT                   /protein_id="ADV92885.1"
FT                   /translation="MLDAEIPKEPSLLGRLFLCEKVFAGNVMPPFGHSYNMVKGVLRWE
FT                   HEQLFD"
FT   gene            complement(257274..257444)
FT                   /locus_tag="BSn5_01260"
FT   CDS_pept        complement(257274..257444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92886"
FT                   /protein_id="ADV92886.1"
FT                   /translation="MGLGPHKMPYIVIRKDENSMYGYSGYGYGFGCGTNTFVLIVVLFI
FT                   LLIIVGAAFIC"
FT   gene            complement(257467..258246)
FT                   /locus_tag="BSn5_01265"
FT   CDS_pept        complement(257467..258246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01265"
FT                   /product="protein involved in maturation of the outermost
FT                   layer of the spore"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01265"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92887"
FT                   /protein_id="ADV92887.1"
FT                   /translation="MTGHYSKTEHQYILLTSESASFDHYSVYRDPQLPQIFSHNFVQLH
FT                   DTFPLERLLNFLPSVPKLLDANYLHLKASPQHVFPLSLKQSLVKSGFVVEDELLYDMKL
FT                   SDWKGQMGHPLTAWGTAKSLSDGSSIMKIYDSIYIGEAIAEQKLKRKYPFYEAGIIILV
FT                   VCYSDQAQKVPIGCGELFIDHQEKTAKIEEVAILDQFQRKGYGSILVKEMLSIAKSLGM
FT                   EAAYLVAASTDGATQFYEKLTFKKYERVHTVFHYFLT"
FT   gene            complement(258275..259555)
FT                   /locus_tag="BSn5_01270"
FT   CDS_pept        complement(258275..259555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01270"
FT                   /product="protein involved in maturation of the outermost
FT                   layer of the spore"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92888"
FT                   /protein_id="ADV92888.1"
FT                   /translation="MGEKVSIILTSYNKPDYLQKAIESVIQQTHDLWELFIMDDHSNAE
FT                   TTAVIHKYLHDRRIQYHNSFVHPADRLKTARYATLINSALPFADGDYISYLTDDTVYHP
FT                   ERLSRMVQEFSHKPEAQAVYSKQKVVHVNERGEEISHFYRNANAVLDQAAFQVDHCSVM
FT                   HRRSLLNLIHHKFGGYWDDDMKHWNHGDAIFWARLNNFTPFLPINEVLDTTYKTPDSFQ
FT                   NAYRFLPADLIDGSFVKGSDQNVYFFDQGVRHPVGEKWGFLYLNRTVAVPDPYLFQYRI
FT                   GKILNIPNYILVKEADHPAIFYIEAGKKRRIVDQYAFQFYQFQRKDIVTIGKEEMEMLP
FT                   EGPPITWKRSELIKNPPGRRVFFIEREPFLFLNGVFHPISEQVTRKFFLHQKPISASFR
FT                   NIQQFPIGKPFYPVYDEIIKKLNIATE"
FT   gene            complement(259620..259925)
FT                   /locus_tag="BSn5_01275"
FT   CDS_pept        complement(259620..259925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01275"
FT                   /product="protein involved in maturation of the outermost
FT                   layer of the spore"
FT                   /note="COG1529 Aerobic-type carbon monoxide dehydrogenase,
FT                   large subunit CoxL/CutL homologs"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01275"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92889"
FT                   /protein_id="ADV92889.1"
FT                   /translation="MDLEKQVDREENQDDLHFILLLLILLIRQSSSEGNPSDLRRQLVF
FT                   AKELGVPVSKVNLINGDTLQNVIVKEVLTDLVIFQNPLNNTRSHVSLSSVVSWGAF"
FT   gene            260130..260531
FT                   /locus_tag="BSn5_01280"
FT   CDS_pept        260130..260531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01280"
FT                   /product="spore outermost layer component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92890"
FT                   /protein_id="ADV92890.1"
FT                   /translation="MSSENAQLKKDLIKAVLSPLFPTATEGGENMDSNLKALLDAAIDQ
FT                   KVDESETVTAESLLDPSLPARWIFARITPGTTISIVTDSGDMIGPVVFVAFDQVHGIVF
FT                   VTQESSVTPAGQATTLIDVDKVESVTFFS"
FT   gene            260547..261491
FT                   /locus_tag="BSn5_01285"
FT   CDS_pept        260547..261491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01285"
FT                   /product="protein involved in maturation of the outermost
FT                   layer of the spore"
FT                   /note="COG4641 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01285"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92891"
FT                   /protein_id="ADV92891.1"
FT                   /translation="MYIQSGYGGIYSYFDRWAEECFQNTHTEYMIADKPEAESLMKIEA
FT                   FQPDFTLMMVGDRVPHDWLTWLKGKDIPVYVWLTEDPFYMDISLQVIKLADAILTIEQN
FT                   AALYYQELGYQNVYYVPIPVNHRLFKKMGTEHSYHSNLLIIGYPYPNRVQLMKEAVQLP
FT                   FTVRVIGKEWGKYLPKKVLKQPHIDVVSTWVPPEQAVHYYNGADIVINAHRPYHFAFNQ
FT                   NTMHIKNASFNNRTFDIAACEAFQLTDLPAAHPFSSFISYHGMNDFKEKAAFYINHPEE
FT                   RQKAAAANYKEIVPAFTFDELPAKLKAIHLALS"
FT   gene            complement(261562..262710)
FT                   /locus_tag="BSn5_01290"
FT   CDS_pept        complement(261562..262710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01290"
FT                   /product="phytase"
FT                   /note="COG4247 3-phytase (myo-inositol-hexaphosphate
FT                   3-phosphohydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92892"
FT                   /protein_id="ADV92892.1"
FT                   /translation="MKVSKTMLLSTAAGLLLSLTATSVSAHYVNEEHLFKVTAHTETDP
FT                   VASGDDAADDPAIWVHEKHPEKSKLITTNKKSGLVVYDLDGKQLHSYEFGKLNNVDLRY
FT                   DFPLNGEKIDIAAASNRSEGKNTIEVYAIDGDKGKLKSITDPKHPISTNISEVYGFSLY
FT                   HSQKTGAFYALVTGKQGEFEQFEIVDGGKGYVTGKKVREFKLNSQTEGLVADDEYGNLY
FT                   IAEEDEAIWKFNAEPGGGSKGQVVDRATGDHLTADIEGLTIYYAPNGKGYLMASSQGNN
FT                   SYAMYERQGKNRYVANFEITDGEKIDGTSDTDGIDVLGFGLGPKYPYGIFVAQDGENID
FT                   NGQAVNQNFKIVSWEQIAQHLGEMPDLHKQVNPRKLKDRSDG"
FT   gene            263080..264105
FT                   /locus_tag="BSn5_01295"
FT   CDS_pept        263080..264105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01295"
FT                   /product="capsular polysaccharide biosynthesis protein D"
FT                   /note="COG1086 Predicted nucleoside-diphosphate sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01295"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92893"
FT                   /protein_id="ADV92893.1"
FT                   /translation="MPKQQTAELKPFFHNKTVLVTGGTGSIGSQIVKRLLLLTPKQVIV
FT                   FSKDDSKQYVMSQKYAEDKRLLFVLGDVRDHRRVNQVMKGVDIVFHAAALKQVPTCEDH
FT                   PFEAIQTNLIGGQNVVEAALSHRVQHVINISTDKAVSPVNTMGATKLLSEKLFHQANRH
FT                   VQNKGTLFCSVRFGNVLGSRGSVIPILFEQMMEGEPLTITDKNMTRFFMSIDDAATLTL
FT                   QSAAITKGGETFIFKMESLKLEELIHGFEEYASQHGLPRPAAVEVGKRPGEKLHEELTS
FT                   PHEIESLYEWGNLYAILPEPEKHPDFRKVNLPGYQSDQAPLITKERIAQIIEELHQEKK
FT                   A"
FT   gene            complement(264149..264583)
FT                   /locus_tag="BSn5_01300"
FT   CDS_pept        complement(264149..264583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01300"
FT                   /product="methionine sulfoxide reductase B"
FT                   /EC_number="1.8.4.12"
FT                   /note="COG0229 Conserved domain frequently associated with
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92894"
FT                   /protein_id="ADV92894.1"
FT                   /translation="MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDI
FT                   VSGKPLFTSKDKFDSHCGWPSFTKPIEEEEVEEKLDTSHGMIRTEVRSRTADSHLGHVF
FT                   NDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLFNK"
FT   gene            complement(264584..265117)
FT                   /locus_tag="BSn5_01305"
FT   CDS_pept        complement(264584..265117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01305"
FT                   /product="methionine sulfoxide reductase A"
FT                   /EC_number="1.8.4.11"
FT                   /note="COG0225 Peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01305"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92895"
FT                   /protein_id="ADV92895.1"
FT                   /translation="MSEKKEIATFAGGCFWCMVKPFDEQPGIEKVVSGYTGGHTENPTY
FT                   EEVCSETTGHREAVQITFNPDVFPYEKLLELFWQQIDPTDAGGQFADRGSSYRAAIFYH
FT                   NDKQKELAEASKQRLAESGIFKDPIVTDILKAEPFYEAEGYHQHFYKKNPAHYQRYRTG
FT                   SGRAGFISEHWGAK"
FT   gene            265249..265674
FT                   /locus_tag="BSn5_01310"
FT   CDS_pept        265249..265674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01310"
FT                   /product="putative transcriptional regulator (MarR family)
FT                   protein"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92896"
FT                   /protein_id="ADV92896.1"
FT                   /translation="MKVRTQMMYDMETLLRKVFKQIRNEINEILDKELSRNEFTILRIL
FT                   SEQGPKKVTEFAPILEVSASHITAVTDALVEKEWITRIRSKEDRRIIRIHITEAGEKVL
FT                   QHFNEKKTEYFFKRFDCYTDAELATLIELFSKLDKKR"
FT   gene            complement(265724..267061)
FT                   /locus_tag="BSn5_01315"
FT   CDS_pept        complement(265724..267061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01315"
FT                   /product="damage inducible, Na+ driven multidrug efflux
FT                   pump"
FT                   /note="COG0534 Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01315"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92897"
FT                   /protein_id="ADV92897.1"
FT                   /translation="MKAYDFTQGNVLKQLVLFSMPIMLGNALQVSFQFIDSLWIGNLLG
FT                   AKALGAAAVSSTIVLTVLSFILGLNNATLTILSQQKGKDDVKGMASYINAFVVLLTGLS
FT                   IGFGAAGFFLSELLLRLLKTPESMIPLAETYLQIQFIGILFLFGYNFISTVLRALGDSK
FT                   TPLRFIAFAVVLNTVLAPLFISVFRMGIAGAAYSTILSQGIAFLYGLFYVVKHKLVPFS
FT                   IPRMPKWEESALILKLGIPAGLQMMVITGGMMAIMSVVNSYGDHVVSGFGAVQRLDSII
FT                   TLPAMAAGTAVNSMAGQNIGIGNEKRVGTIARLGVIAVISCMLVIAGMIWVFGKYLIRL
FT                   FISEPDAVAFGEQYLKWIAFFYPFIGINFVLNGIVRAAGAMLQVLVLNLISFWVLRYPF
FT                   TALFSAWLGQKGIGLGIGMSFLFSSCAAFLYYRYGRWKAMKLFTEK"
FT   gene            complement(267133..267327)
FT                   /locus_tag="BSn5_01320"
FT   CDS_pept        complement(267133..267327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92898"
FT                   /protein_id="ADV92898.1"
FT                   /translation="MKRIYQYFSLLSFTFSLYFGWLAYHHLAAEDMDQMYLNVSYCALF
FT                   LSVMVFTFGMRDRKKTDKS"
FT   gene            complement(267340..267903)
FT                   /locus_tag="BSn5_01325"
FT   CDS_pept        complement(267340..267903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01325"
FT                   /product="hypothetical protein"
FT                   /note="COG4698 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01325"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92899"
FT                   /protein_id="ADV92899.1"
FT                   /translation="MNKWKRLFFILLAINFILAAGFVALVLLPGEQAQVKDSSESEYGF
FT                   QVTSTKESLAAFVNSYLNDKASNKLDYKVEIDDDVHVAGKIKAFSTSIDAFIAFEPTVK
FT                   KNGDVELNVTKFSLGKLSIPISFVLNYMDSFYELPSFVHVHPGDKSIEVRLSEMPLTNG
FT                   MYVKADKINLEKDEIEFSYYHPKQ"
FT   gene            complement(267913..268680)
FT                   /locus_tag="BSn5_01330"
FT   CDS_pept        complement(267913..268680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01330"
FT                   /product="putative exported lipase/acylhydrolase
FT                   (lipoprotein)"
FT                   /note="COG2755 Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92900"
FT                   /protein_id="ADV92900.1"
FT                   /translation="MKLRIFSIMASLILLLTACTSIRTSSEGKQKAHETKTKEHIVIAA
FT                   VGDSLTEGVGDPDGKGYVGKVADSIRSDKQVKTVDVKNYAVKGNRSDDLLEKLKDKKVQ
FT                   KGIKDADYVFFTIGGNDLMKILRQNFLQLTVEPFQEAEKPYEKRFEKIISEIRELNDHA
FT                   ELIYVSMYNPFTFTLSELNEINGVVTDWNHIAEKELKKDKHAKVVHIEDLFNQKSDSSR
FT                   ISEEDDFHPNGTGYSLIAKRVYQAIKKEGLPKE"
FT   gene            complement(268758..269339)
FT                   /locus_tag="BSn5_01335"
FT   CDS_pept        complement(268758..269339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01335"
FT                   /product="assembly factor BSco of the Cu(A) site of
FT                   cytochrome c oxidase"
FT                   /note="COG1999 Uncharacterized protein SCO1/SenC/PrrC,
FT                   involved in biogenesis of respiratory and photosynthetic
FT                   systems"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01335"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92901"
FT                   /protein_id="ADV92901.1"
FT                   /translation="MKVIKGLTAGLIFLFLCACGGQQIKDPLNYEVEPFTFQNQDGKNV
FT                   SLESLKGEVWLADFIFTNCETICPPMTAHMTDLQKKLKAENIDVRIISFSVDPENDKPK
FT                   QLKKFAANYPLSFDNWDFLTGYSQSEIEEFALKSFKAIVKKPEGEDQVIHQSSFYLVGP
FT                   DGKVLKDYNGVENTPYDDIISDVKSASTLK"
FT   gene            complement(269486..269737)
FT                   /locus_tag="BSn5_01340"
FT   CDS_pept        complement(269486..269737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92902"
FT                   /protein_id="ADV92902.1"
FT                   /translation="MLLKSLEFKRDDGIQVKVTEIPVLKEDEHYFFMLHHHLQFYLKEV
FT                   FSSNSRAKVYSFRHYMKRRMKWADYQAVFHQEVLKHNA"
FT   gene            complement(269823..271091)
FT                   /locus_tag="BSn5_01345"
FT   CDS_pept        complement(269823..271091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01345"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="COG1171 Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01345"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92903"
FT                   /protein_id="ADV92903.1"
FT                   /translation="MKPLLKENSLIQVKDILKAHQNVKDVVIHTPLQRNDRLSERYECN
FT                   IYLKREDLQVVRSFKLRGAYHKMKQLSSEQTENGVVCASAGNHAQGVAFSCKHLGIHGK
FT                   IFMPSTTPRQKVSQVELFGKGFIDIILTGDTFDDAYKSAAECCEAESRTFIHPFDDPDV
FT                   MAGQGTLAVEILNDIDTEPHFLFASVGGGGLLSGVGTYLKNVSPDTKVIAVEPAGAAAY
FT                   FESNKAGHVVTLDKIDKFVDGAAVKKIGEETFRTLETVVDDILLVPEGKVCTSILELYN
FT                   ECAVVAEPAGALSVAALDLYKDEIKGKNVVCVVSGGNNDIGRMQEMKERSLIFEGLQHY
FT                   FIVNFPQRAGALREFLDEVLGPNDDITRFEYTKKNNKSNGPALVGIELQNKADYGPLIE
FT                   RMNKKPFHYVEVNKDEDLFHLLI"
FT   gene            271340..272335
FT                   /locus_tag="BSn5_01350"
FT   CDS_pept        271340..272335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01350"
FT                   /product="transcriptional enhancer"
FT                   /note="COG1221 Transcriptional regulators containing an
FT                   AAA-type ATPase domain and a DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92904"
FT                   /protein_id="ADV92904.1"
FT                   /translation="MNSAPKLNTFQHLIGEHQTFLEAKRIAKQFSLSELPVLITGKIGT
FT                   GKNHFAHAIHLESSRSNEPFISVNCSTHSEETLIHELFGPNGNTGVFQKAVRGTLFLDD
FT                   VWRMPASVQAQLLKALDSDTEKPRMICASADRSVEHTFRQDLFYRLNILTLTLPELSER
FT                   KSDIPLLTQHFLSNSGQQLLIDPSVFPVLEKHAFEGNVRELKNAADYMAAVSSGGTIQP
FT                   YDLPPYIRGTIDGKTSKKKAKLLTLMEKAEFLFILETIKVLNEKGEPASRRIISEHSKN
FT                   TQTSLTPQQVRSRLDYLEKKDYVTKSRGRAGTKITFEGLSFIETLKNQMI"
FT   gene            272356..272997
FT                   /locus_tag="BSn5_01355"
FT   CDS_pept        272356..272997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01355"
FT                   /product="hemolysin III"
FT                   /note="COG1272 Predicted membrane protein, hemolysin III
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01355"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92905"
FT                   /protein_id="ADV92905.1"
FT                   /translation="MFTIKEEIANAITHGIGVLLSIPALVFLIIFAANYGSAWDIVSFT
FT                   IFGVSMLLLYLSSTLLHSITHKKTKDILEIIDHSAIYVLIAGTYTPFLLGPLKGTLGFT
FT                   LLVIVWSLALGGIVFKIFFVKRFILLSTFVYLVMGWLMIIAVKPLYASLSGAGFSLLFL
FT                   GGILYSVGTIFYIWKKIPFHHAIWHSFVLGGSAAMFFCVLFYCVKVPFLS"
FT   gene            complement(273037..273657)
FT                   /locus_tag="BSn5_01360"
FT   CDS_pept        complement(273037..273657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01360"
FT                   /product="putative acyltransferase"
FT                   /note="COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92906"
FT                   /protein_id="ADV92906.1"
FT                   /translation="MVRYSFLVVYIVYMLLKNMKQLFNQTMLDPRLSYKKQMTLVYEQP
FT                   KAFLEGCIGISGSVVTIHQPEPIPHGPVLYVHPRLRLAELALIAGYIEEPAGFIANPKV
FT                   FRLPFIGQWLDRMDVISDGDSEKVYEDVTKQLEKGQSLILSLDGSIDPEELAARYHLPL
FT                   VMVETKGTDNMQTGSFFKRLKPADIELSFSKAYIPANEKQLRA"
FT   gene            complement(273658..274164)
FT                   /locus_tag="BSn5_01365"
FT   CDS_pept        complement(273658..274164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01365"
FT                   /product="dihydrofolate reductase"
FT                   /note="COG0262 Dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01365"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92907"
FT                   /protein_id="ADV92907.1"
FT                   /translation="MISFIFAMDANRLIGKDNDLPWHLPNDLAYFKKVTSGHSIIMGRK
FT                   TFESIGRPLPNRKNIVVTSAPASEFPGCTVVGSLKDVLDICSGPEECFVIGGAQLYTDL
FT                   FPYADRLYMTKIHHEFEGDRHFPEFDESNWKLVSSEQGIKDEKNPYDYEFLMYEKKNSS
FT                   KAGGF"
FT   gene            complement(274161..274964)
FT                   /gene="thyA"
FT                   /locus_tag="BSn5_01370"
FT   CDS_pept        complement(274161..274964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="BSn5_01370"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="COG0207 Thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92908"
FT                   /protein_id="ADV92908.1"
FT                   /translation="MKKMKQYKDLCRHVLEHGEKKEDRTGTGTISTFGYQMRFNLREGF
FT                   PMLTTKKLHFKSIAHELLWFLKGDTNVRYLQENGVRIWNEWADENGELGPVYGSQWRSW
FT                   RGADGETIDQISRLIEDIKTNPNSRRLIVSAWNVGEIDKMALPPCHCLFQFYVSDGKLS
FT                   CQLYQRSADVFLGVPFNIASYALLTMMIAHVTGLESGEFIHTFGDVHIYQNHIEQINLQ
FT                   LERDVRPLPQLRFARKVDSIFNFAFEDFIIEDYDPHPHIKGAVSV"
FT   gene            complement(275039..275572)
FT                   /locus_tag="BSn5_01375"
FT   CDS_pept        complement(275039..275572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01375"
FT                   /product="putative phosphatidylglycerophosphatase"
FT                   /note="COG1267 Phosphatidylglycerophosphatase A and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01375"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92909"
FT                   /protein_id="ADV92909.1"
FT                   /translation="MKKYTMNEMVDITKDMLNKRGVMIEDIARIVQKLQEKYNPNLPLS
FT                   VCMENVEKVLNKREIIHAVLTGLALDQLAEQKLLPEPLQHLVETDEPLYGIDEIIPLSI
FT                   VNVYGSIGLTNFGYLDKEKIGIIKELDESPDGIHTFLDDIVAALAAAAASRIAHTHQDL
FT                   QDEEKEQDEKPVVS"
FT   gene            complement(275590..276201)
FT                   /locus_tag="BSn5_01380"
FT   CDS_pept        complement(275590..276201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92910"
FT                   /protein_id="ADV92910.1"
FT                   /translation="MKLWMRKTLVVLFTIVTFGLVSPPAALMADKPSGQPSSLEQNDYT
FT                   AFYDEHDLYDDESDDRQNPELLFQSYKEQLLDSAEDQSFLKFGSRIAPVIEDDYRKEIL
FT                   PKIENVISDYLATLQDDEAYQDVVISSMPSAGKTEKIFNVYNRTTGEDLLRFHVRRDHP
FT                   PHDGYWFNFHYHTAEDGFQSHHELGSIYWDRNTPPNWMSA"
FT   gene            complement(276461..277234)
FT                   /locus_tag="BSn5_01385"
FT   CDS_pept        complement(276461..277234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01385"
FT                   /product="putative methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01385"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92911"
FT                   /protein_id="ADV92911.1"
FT                   /translation="MITTSYRPSEHTIKTAKQLSKELNMPYCGRNKQTVEHLLKSAERD
FT                   LLVVGKERFELYTKQGAKFFFHPNTAMFRAKRFLQGEQEPMLRAAGLSEGDTFLDCTLG
FT                   LGSDAIIASMAVGETGSVVGIEKNHLVSVLVGTGLHSWETGIEELQAAMRRIQVKNGDC
FT                   LEYIKQLPDNSVDVVYFDPMFHEPVETSDGIAPLRDLAEDSVLHEGCINEAVRVARKSV
FT                   VLKDHWKSPRFEQFGFNVMKRKTALFHYGVIQTSP"
FT   gene            complement(277276..277710)
FT                   /locus_tag="BSn5_01390"
FT   CDS_pept        complement(277276..277710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92912"
FT                   /protein_id="ADV92912.1"
FT                   /translation="MSMAYEEYMRQLVVPMRRELTGAGFEELTTAEEVENFMEKAEGTT
FT                   LVVVNSVCGCAAGLARPAATQAVLQNDKTPDNTVTVFAGQDKEATAKMREYFTGQEPSS
FT                   PSMALLKGKEVVHFIPRHEIEGHDMEEIMKNLTAAFDAHC"
FT   gene            complement(277817..279493)
FT                   /locus_tag="BSn5_01395"
FT   CDS_pept        complement(277817..279493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01395"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="COG0129 Dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01395"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92913"
FT                   /protein_id="ADV92913.1"
FT                   /translation="MAELRSNMITQGIDRAPHRSLLRAAGVKEEDFGKPFIAVCNSYID
FT                   IVPGHVHLQEFGKIVKEAIREAGGVPFEFNTIGVDDGIAMGHIGMRYSLPSREIIADSV
FT                   ETVVSAHWFDGMVCIPNCDKITPGMLMAAMRINIPTIFVSGGPMAAGRTSDGRKISLSS
FT                   VFEGVGAYQAGKINENELQELEQFGCPTCGSCSGMFTANSMNCLSEALGLALPGNGTIL
FT                   ATSPERKEFVRKSAAQLMETIRKDIKPRDIVTVKAIDNAFALDMALGGSTNTVLHTLAL
FT                   ANEAGVEYSLERINEVAERVPHLAKLAPASDVFIEDLHEAGGVSAALNELSKKEGALHL
FT                   DALTVTGKTLGETIAGHEVKDYDVIHPLDQPFTEKGGLAVLFGNLAPDGAIIKTGGVQN
FT                   GITRHEGPAVVFDSQDEALDGIINRKVKEGDVVIIRYEGPKGGPGMPEMLAPTSQIVGM
FT                   GLGPKVALITDGRFSGASRGLSIGHVSPEAAEGGPLAFVENGDHIIVDIEKRILDVQVP
FT                   EEEWEKRKANWKGFEPKVKTGYLARYSKLVTSANTGGIMKI"
FT   gene            complement(279782..280915)
FT                   /locus_tag="BSn5_01400"
FT   CDS_pept        complement(279782..280915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01400"
FT                   /product="putative lyase"
FT                   /note="COG0694 Thioredoxin-like proteins and domains"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92914"
FT                   /protein_id="ADV92914.1"
FT                   /translation="MKIKSIEPTPSPNTMKVILTEELPAGKSNNYKPEQAEGAPPVIAD
FT                   ILKIDGVKGVYHVADFLAVERNARYDWKDILPQVRTAFGMESAESAEENRSDQESFGEV
FT                   KVFVQMFSGIPMQVKLTDGEREERFGLPERFQQAILKLRSEASNVVFERAWKEQGVRFG
FT                   DFDEIGHDVTEELQAAYSDERLKRLTEAAAQGKGEAKQAVQRKAYKVTLDMLDDEDWKK
FT                   RYAHLEQMDPKEEDIPVLQKALDDPKVSIRRQAVVYLGMIETPDVLPLLYKALEDKAVS
FT                   VRRTAGDCLSDIGDPQAIPAMIKSLSDSSKLVRWRAAMFLYEVGDESAIEALRAAEDDP
FT                   EFEVSLQVKMALERIEHGEEAKGSVWKQMTESRKKGE"
FT   gene            complement(280975..281592)
FT                   /locus_tag="BSn5_01405"
FT   CDS_pept        complement(280975..281592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01405"
FT                   /product="putative metal-dependent phosphohydrolase"
FT                   /note="COG1418 Predicted HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01405"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92915"
FT                   /protein_id="ADV92915.1"
FT                   /translation="MKELKQAEQIRAWVQSILTDESSGHDWHHVSRVADLAAYIGEKEK
FT                   ADLFIVETAALVHDLIDVKLPDTVRLSVSEVYDQLVFFGVGKENADRVIHIITRMSFRD
FT                   REKLAKEPLSIEGKAVQDADRLDAIGAVGIARAFMFAGANGHGLYGDDQSTYAHFFYKL
FT                   LRLKDMMNTDTARELAEERHKFMLQFVRQLEKEIPGIDAKTS"
FT   gene            complement(281608..282090)
FT                   /locus_tag="BSn5_01410"
FT   CDS_pept        complement(281608..282090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01410"
FT                   /product="putative peroxidase"
FT                   /note="COG0386 Glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92916"
FT                   /protein_id="ADV92916.1"
FT                   /translation="MSIYHMKVRTITGKDMTLQPFAGKVLMIVNTASKCGFTPQLKQLQ
FT                   ELYDTYQQEGLEILGFPCNQFMNQEPGEEADIQEFCETNYGVTFPMFSKVDVNGKNAHP
FT                   LFVYLTEHAKGMLGTKAIKWNFTKFIVDRNGEIVGRYSPNTNPKELEDDIVKLLEQ"
FT   gene            282433..283338
FT                   /locus_tag="BSn5_01415"
FT   CDS_pept        282433..283338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01415"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="COG1897 Homoserine trans-succinylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01415"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92917"
FT                   /protein_id="ADV92917.1"
FT                   /translation="MPINIPTHLPAKQVLESEHIFVMDESRAFHQDIRPQKIIILNLMP
FT                   KKIQTETQLLRLLGNSPLQVHFTFLIPSTHTPKNTAREHLDEFYTTFSNIRHKRFDGMI
FT                   ITGAPIEHLAFEEVSYWEELKEIMEWSKTNVTSTLHICWGAQAGLYYHYGVEKIQMPKK
FT                   IFGVFEHTVLSKHERLVRGFDELYYVPHSRHTDINMEQLQAVPELNILTASKEAGVCLI
FT                   VSKDEKQVFLTGHPEYDTNTLLQEYERDLERNLSTVEEPKHYFAKGSNEPVNRWKAHAT
FT                   LLFMNWLNYYVYQETPYEWD"
FT   gene            283569..284717
FT                   /locus_tag="BSn5_01420"
FT   CDS_pept        283569..284717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01420"
FT                   /product="diacylglycerol glucosyltransferase"
FT                   /note="COG0707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92918"
FT                   /protein_id="ADV92918.1"
FT                   /translation="MNTNKRVLILTANYGNGHVQVAKTLYEQCVRLGFQHVTVSNLYQE
FT                   SNPIVSEVTQYLYLKSFSIGKQFYRLFYYGVDKIYNKRKFNIYFKMGNKRLGELVDEHQ
FT                   PDIIINTFPMIVVPEYRRRTGRVIPTFNVMTDFCLHKIWVHENVDKYYVATDYVKEKLL
FT                   EIGTHPSNVKITGIPIRPQFEESMPVGPIYKKYNLSPNKKVLLIMAGAHGVLKNVKELC
FT                   ENLVKDDQVQVVVVCGKNTALKESLSALEAENGDKLKVLGYVERIDELFRITDCMITKP
FT                   GGITLTEATAIGVPVILYKPVPGQEKENANFFEDRGAAIVVNRHEEILESVTSLLADED
FT                   TLHRMKKNIKDLHLANSSEVILEDILKESEMMTAKQKAKVLS"
FT   gene            284960..285160
FT                   /locus_tag="BSn5_01425"
FT   CDS_pept        284960..285160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01425"
FT                   /product="cold-shock protein, molecular chaperone,
FT                   RNA-helicase co-factor"
FT                   /note="COG1278 Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01425"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92919"
FT                   /protein_id="ADV92919.1"
FT                   /translation="MQNGKVKWFNNEKGFGFIEVEGGDDVFVHFTAIEGDGYKSLEEGQ
FT                   EVSFEIVEGNRGPQASNVVKL"
FT   gene            complement(285212..285394)
FT                   /locus_tag="BSn5_01430"
FT   CDS_pept        complement(285212..285394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01430"
FT                   /product="activation of degradative enzymes (aprE, nprE,
FT                   sacB) production or activity"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92920"
FT                   /protein_id="ADV92920.1"
FT                   /translation="MDDKDLKLILHKTFIEIYSDLEELADIAKKGKPSMEKYVEEIEQR
FT                   CKQNILAIEIQMKIK"
FT   gene            285550..285819
FT                   /locus_tag="BSn5_01435"
FT   CDS_pept        285550..285819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01435"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92921"
FT                   /protein_id="ADV92921.1"
FT                   /translation="MTSEFHNEDQTGFTDKRQLELAVETAQKTTGAATRGQSKTLVDSA
FT                   YQAIEDARELSQSEELAALDDPEFVKQQQQLLDDSEHQLDEFKE"
FT   gene            complement(285847..286029)
FT                   /locus_tag="BSn5_01440"
FT   CDS_pept        complement(285847..286029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92922"
FT                   /protein_id="ADV92922.1"
FT                   /translation="MDKKMIFKELTELHDEYCKDCFIKKQFRKEFGKTYAHSFCINKCT
FT                   VGEKLKQYGDVLTNH"
FT   gene            complement(286022..286702)
FT                   /locus_tag="BSn5_01445"
FT   CDS_pept        complement(286022..286702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01445"
FT                   /product="hypothetical protein"
FT                   /note="COG0328 Ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01445"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92923"
FT                   /protein_id="ADV92923.1"
FT                   /translation="MKLRPHLKIEAKGTGSVSFFSEDWLTAQQARMLARELGRFPYMKE
FT                   LEFEDEKGGSWTLKELEKLTEELAQEPDDITVYFDGSFDKESELAGLGIVIYYSLGGTR
FT                   HRLRKNKSFRLKTNNEAEYAALYEAIREVRELGASRNSITIKGDSLVVLNQLDGSWPCY
FT                   DPSHNEWLDKIEALLESLKLTPTYETIQRKDNQEADGLAKKILSHQFVESHTKLDRNGD
FT                   DDIG"
FT   gene            286785..287474
FT                   /locus_tag="BSn5_01450"
FT   CDS_pept        286785..287474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01450"
FT                   /product="putative integral inner membrane protein"
FT                   /note="COG1738 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92924"
FT                   /protein_id="ADV92924.1"
FT                   /translation="MFNNSFWIFFAIIHFIIVLLFYKGFGKMGLFVWIGFATVCANLQV
FT                   VKTVELFGLTATLGNVMYGTIFFATDVLNEKYGPAEARKAVWLGFSTLLTLTFVMQGVL
FT                   LFEPASSDISQTALETIFGFLPRVALGSLLAFIFSQTLDVYVYSAIRRIFPSDRLLWLR
FT                   NGGSTAVSQLFDTFIFTAVAFLGIYPAGVWLHIFISTYLIKFAVSLISLPYAYAAKKMI
FT                   PKDERSS"
FT   gene            287474..287872
FT                   /locus_tag="BSn5_01455"
FT   CDS_pept        287474..287872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01455"
FT                   /product="ribonuclease H"
FT                   /note="COG0328 Ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01455"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92925"
FT                   /protein_id="ADV92925.1"
FT                   /translation="MPTEIYVDGASAGNPGPSGIGIFIKHEGTAESFSIPIGVHTNQEA
FT                   EFLALIEGMKLCATRGYQSVSFRTDSDIVERATELEMVKNKMFQPFVEEIIRLKAAFPL
FT                   FFIKWIPGKQNQKADLLAKEAIRLNEKN"
FT   gene            287914..288042
FT                   /locus_tag="BSn5_01460"
FT   CDS_pept        287914..288042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01460"
FT                   /product="small acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92926"
FT                   /protein_id="ADV92926.1"
FT                   /translation="MKKKDKGRLTGGVTPQGDLEGNTHNDPKTELEERAKKSNTKR"
FT   gene            complement(288050..288940)
FT                   /locus_tag="BSn5_01465"
FT   CDS_pept        complement(288050..288940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01465"
FT                   /product="5'3'-exonuclease"
FT                   /note="COG0258 5'-3' exonuclease (including N-terminal
FT                   domain of PolI)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01465"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92927"
FT                   /protein_id="ADV92927.1"
FT                   /translation="MNNNKLLLVDGMALLFRAFFATAVHRNFMINDSGVPTNGVNGFLK
FT                   HLITAVETFQPTHVICCWDMGSKTYRNDLFQDYKANRSAPPEELIPQFDLAKEAAAELG
FT                   IMNIGFAGYEADDCIGTLADLFANEADITVVTGDRDLLQLLTDKVSVALLQKGIGNYKV
FT                   YTKETFYEETGVMPKALIDIKALMGDSSDNYPGVKGIGEKTAYKLIREYETIDRLLENL
FT                   SLLPKGQQGKIQQGLSDLEMSRKLAEIHCSVPLACTLKDALFTLQMEQAADMLRRHQIK
FT                   GIERMLEKLNAREIV"
FT   gene            complement(288940..289044)
FT                   /locus_tag="BSn5_01470"
FT   CDS_pept        complement(288940..289044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92928"
FT                   /protein_id="ADV92928.1"
FT                   /translation="MINIQTVSLIKEILFFIFGLLYDKIEVMKEKGVI"
FT   gene            complement(289041..289184)
FT                   /locus_tag="BSn5_01475"
FT   CDS_pept        complement(289041..289184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01475"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92929"
FT                   /protein_id="ADV92929.1"
FT                   /translation="MGRTKLGNRNAQANNNAKKKNGFQTHFDSYAGREAEKLIASNKRH
FT                   ND"
FT   gene            complement(289262..289519)
FT                   /locus_tag="BSn5_01480"
FT   CDS_pept        complement(289262..289519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92930"
FT                   /protein_id="ADV92930.1"
FT                   /translation="MSEVHKAISAHSSKQHEHIKAFMRLENMRELAIEEAVAKCKNGEP
FT                   YTTDAINEITEQMNQLSKKGIVPTRRFVSKEMVREYVSRM"
FT   gene            complement(289584..293165)
FT                   /locus_tag="BSn5_01485"
FT   CDS_pept        complement(289584..293165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01485"
FT                   /product="putative GTP-binding protein"
FT                   /note="COG0699 Predicted GTPases (dynamin-related)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01485"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92931"
FT                   /protein_id="ADV92931.1"
FT                   /translation="MTDQNRKELLHKTGEIYKQFIENQDEQRAAKLAAVMKKAADEEVY
FT                   IAFTGHYSAGKSSLLNCLLMENILPTSPIPTSANLVVIRNGEKRVRLHTTDGACAELEG
FT                   AYQKDKVQQYCKDGEQIESVEIFDRYTEIDPGVAYIDTPGIDSTDDAHFLSAASILHQV
FT                   DALFYVVHYNHVHAEENVKFLRSIKESIPNVYFIVNQIDRHDETETKFGDYQAQVEEML
FT                   CNEGISREALYFTSVTEPDHPFNQMGALREELRRIEQQSKSNMQALTEQKVRNLLKEHT
FT                   EMLKKDETGAPSFAEQLNIQIGLVQSLRDQLNEAEKQTTEAETRMQEEINLILKNANLT
FT                   PFEMRELAAAFLESQEPSFKTGFFFSKAKTAQERDKRRNAFFSDVAKRTEAEADWHMID
FT                   TLHKLAKAFDVYTAESEKLIQAYRTPLDISIIERAVKHGAAFSSEYVLQYTKDLAELIR
FT                   KEAKREAADIIKVLSAMVKERVSKDVQTINDRLVQESEKLVFLQEQARLENNAREKTDR
FT                   LWAIWEEESACPMHIDTEWFKSKKTRVAAPEQKQGRSQLTAQPMPKSEIKMEQEMPLQD
FT                   QIKRFYTLSDLLGECSMLLKQTSAFRERVKRLEERKFTLALFGGFSSGKSSFANALVGE
FT                   RVLPSSPTPTTATINKITKPINGNLNKTADVVFKTEDDITAEILQLTGIPKEPAGRSFT
FT                   EKWEKAVKKNRLQEEQVKLISNFLLAYEKYQQYIQEQKKLTIPLSELKPYVAEETTACA
FT                   VKEVTVYYTCPLTEKGITIVDTPGASSMNKRHTELAFQYIKDADAFFYMTYYQHSFSKG
FT                   DRSFLRKLGLVKESLSMDKMFFIINAADLAKDKTELETVTDYVSAELVKEGVYEPQLFT
FT                   VSSKEELVGKPESFYNQFSKVRKHLDRFIEVDVKKASAAQLSSEADKLCETVFQLHQSQ
FT                   HQSREEKEAQKQRLMLSFERTAADIEKRRNSKTIIEKVKKDTREQLYHITQRLSYFAND
FT                   LLKSAFHPGLQNGDWKKNVSKAMTTALHEYQFEYIQEIKTLDVRMSGFIERHINEEWLD
FT                   QFQKTLNEDGYFSVYAGDQHSNGIQLKEVEPEIEERAFEQELKEVKSPKQFFEQKGKSA
FT                   FIEAVRMKLTKITEAWIKNEEESLISHYTAHLRRLQEDMGEKAIAQITDQKETYLRGYA
FT                   EGEHAKEIEMAYQACISWKNSDNTIKM"
FT   gene            complement(293501..294007)
FT                   /locus_tag="BSn5_01490"
FT   CDS_pept        complement(293501..294007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01490"
FT                   /product="putative integral inner membrane enzyme"
FT                   /note="COG1755 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92932"
FT                   /protein_id="ADV92932.1"
FT                   /translation="MFWLLIAILSVQRAAEMAVARQNEQKVKKQGAIEFGESHYPYIIT
FT                   MHILFFLSLIAEVLLMNKQPSSWWLGIAAVILSVQIVRYWALCSLGAYWNTKILVVPGV
FT                   ELVKKGPYKWMKHPNYAVVILEILLIPLLYQAYVTMCLFSIFNAVLLSVRIRAEDKALQ
FT                   EYSVK"
FT   gene            complement(294011..295108)
FT                   /locus_tag="BSn5_01495"
FT   CDS_pept        complement(294011..295108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01495"
FT                   /product="terpene family molecule synthase"
FT                   /note="COG3424 Predicted naringenin-chalcone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01495"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92933"
FT                   /protein_id="ADV92933.1"
FT                   /translation="MAFILSIGTSLPAYNVNQEKAAEFARYMFQHSFKDIDRLLSSFKN
FT                   GQIHSRQFVKPIEWYKEGHSFEEKNQIYIEETLKHSRAAVRECLSHPEFFQEAIPYEKV
FT                   EAVFFVSSTGLSTPSIEARLMNELPFSPYTKRIPIWGLGCAGGASGLARAAEYCKAYPE
FT                   AFVLVIAAELCSLTFQPEDKTKSNLIGTSLFGDGIAAALLCGEKADRRMSKLKLAPKIM
FT                   DAQSVLMKQSEDVMGWDFTDQGFKVIFSRDIPTLVEKWLKTNVQIFLDKHKLSFHDISV
FT                   FLAHPGGKKVIDAYIKSLGLSSEKLSSAQSILQKHGNMSSATILYVIKDHLQNGHKKEA
FT                   ERGLIGALGPGFSSELLLFSWEKGA"
FT   gene            complement(295181..296497)
FT                   /locus_tag="BSn5_01500"
FT   CDS_pept        complement(295181..296497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01500"
FT                   /product="xanthine permease"
FT                   /note="COG2233 Xanthine/uracil permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92934"
FT                   /protein_id="ADV92934.1"
FT                   /translation="MRNGFGKTLSLGIQHVLAMYAGAIVVPLIVGKAMGLTVEQLTYLV
FT                   SIDIFMCGVATLLQVWSNRFFGIGLPVVLGCTFTAVSPMIAIGSEYGVSTVYGSIIASG
FT                   ILVIFISFFFGKLVSFFPPVVTGSVVTIIGITLMPVAMNNMAGGEGSADFGDLSNLALA
FT                   FTVLSIIVLLYRFTKGFIKSVSILIGILIGTFIAYFMGKVQFDNVSDAAVVQMIQPFYF
FT                   GAPSFHAAPIITMSIVAIVSLVESTGVYFALGDLTNRRLTEKDLSKGYRAEGLAVLLGG
FT                   IFNAFPYTAFSQNVGLVQLTGIKKNAVIVVTGVILMAFGLFPKIAAFTTIIPSAVLGGA
FT                   MVAMFGMVIAYGIKMLSRIDFAKQENLLIVACSVGLGLGVTVVPDIFKQLPSALTLLTT
FT                   NGIVAGSFTAVVLNIVYNVFSKAKKTEQEADLAEQKTAV"
FT   gene            complement(296494..297078)
FT                   /locus_tag="BSn5_01505"
FT   CDS_pept        complement(296494..297078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01505"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="COG0503 Adenine/guanine phosphoribosyltransferases
FT                   and related PRPP-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01505"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92935"
FT                   /protein_id="ADV92935.1"
FT                   /translation="MEALKRKIEEEGVVLSDQVLKVDSFLNHQIDPLLMQRVGDEFASR
FT                   FAKDGITKIVTIESSGIAPAVMTGLKLGVPVVFARKHKSLTLTDNLLTASVYSFTKQTE
FT                   SQIAVSGTHLSDQDHVLIIDDFLANGQAAHGLVSIVKQAGASIAGIGIVIEKSFQPGRD
FT                   ELVKLGYRVESLARIQSLEEGKVSFVQEVHS"
FT   gene            complement(297410..298915)
FT                   /locus_tag="BSn5_01510"
FT   CDS_pept        complement(297410..298915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01510"
FT                   /product="metal-dependent carboxypeptidase"
FT                   /note="COG2317 Zn-dependent carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92936"
FT                   /protein_id="ADV92936.1"
FT                   /translation="MEIHTYEKEFFDLLKRISHYSEAVALMHWDSRTGAPKNGSEDRAE
FT                   SIGQLSTDIFNIQTSDRMKELIDVLYERFDDLSEDTKKAVELAKKEYEENKKIPEAEYK
FT                   EYVILCSKAETAWEEAKGKSDFSLFSPYLEQLIEFNKRFITYWGYQEHPYDALLDLFEP
FT                   GVTVKVLDQLFAELKEAIIPLVKQVTASENKPDTSFLTKAFPKEKQKELSLYFLQELGY
FT                   DFDGGRLDETVHPFATTLNRGDVRVTTRYDEKDFRTAIFGTIHECGHAIYEQNIDEALS
FT                   GTNLSDGASMGIHESQSLFYENFIGRNKHFWTPYYQKIQEASPEQFKDISLDDFVRAIN
FT                   ESKPSFIRVEADELTYPLHIIIRYEIEKAIFSNEVSVEDLPSLWNQKYQDYLGITPQTD
FT                   AEGILQDVHWAGGDFGYFPSYALGYMYAAQLKQKMLEDLPEFDALLERGEFHPIKQWLT
FT                   EKVHIHGKRKKPLDIIKDATGEELNVRYLIDYLSNKYSNLYLS"
FT   gene            complement(299027..300019)
FT                   /locus_tag="BSn5_01515"
FT   CDS_pept        complement(299027..300019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01515"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01515"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92937"
FT                   /protein_id="ADV92937.1"
FT                   /translation="MKIKATIERVPGGMMIIPLFLGAALNTFAPGTAEFFGGFTGALIT
FT                   GTLPILGVFIFCVGATIDFRSSGYIARKGITLLLGKIGFAALLGVIAAQFIPDEGIQSG
FT                   FFAGLSVLAIVAVMNETNGGLYLALMNHMGRKEDAGAFAFISTESGPFMTMVTFGVTGL
FT                   AAFPWETLAATVIPFLLGCILGNLDHDLRDLFSKVVPAIIPFFAFSLGNTLNFGMLIQS
FT                   GLLGIFIGVSVVILSGSSLFLLDRFIARGDGVAGVAASSTAGAAVAVPYALAEANASFA
FT                   PVAESATAIIATSVIVTSLLTPLATVWVDKKIKQKKRRTPPPKNQMTIN"
FT   gene            complement(300064..300654)
FT                   /locus_tag="BSn5_01520"
FT   CDS_pept        complement(300064..300654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01520"
FT                   /product="2-keto-3-deoxygluconate-6-phosphate aldolase"
FT                   /note="COG0800 2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92938"
FT                   /protein_id="ADV92938.1"
FT                   /translation="MESKVVENRLKEAKLIAVIRSKDKQEACQQIESLLDKGIRAVEVT
FT                   YTTPEASDIIESFRNREDILIGAGTVITAQQAGEAAEAGAQFIVSPGFSADLAEHLSFV
FT                   KTHYIPGVLTPSEIMEALTFGFTTLKLFPSGVFGIPFMKNLAGPFPQVTFIPTGGIHPS
FT                   EVPDWLRAGAGAVGVGSQLGSCSKEDLQAVFQV"
FT   gene            complement(300656..301630)
FT                   /locus_tag="BSn5_01525"
FT   CDS_pept        complement(300656..301630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01525"
FT                   /product="2-keto-3-deoxygluconate kinase"
FT                   /note="COG0524 Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01525"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92939"
FT                   /protein_id="ADV92939.1"
FT                   /translation="MKLDAVTFGESMAMFYANEYGGLHEVSTFSKGLAGAESNVACGLA
FT                   RLGFRMGWMSKVGNDQLGTFILQELKKEGVDVSRVIRSQDENPTGLLLKSKVKEGDPQV
FT                   TYYRKNSAASTLTSAEYPRDYFQCAGHLHVTGIPPALSAEMKDFTYHVMNDMRNAGKTI
FT                   SFDPNVRPSLWPDQATMVHTINDLAGLADWFFPGIAEGELLTGEKTPEGIADYYLKKGA
FT                   SFVAIKLGKEGAYFKTGTSEGFLEGCRVDRVVDTVGAGDGFAVGVISGILDGLSYKDAV
FT                   QRGNAIGALQVQAPGDMDGLPTREKLASFLSAQRTVHQKKGDY"
FT   gene            complement(301668..302687)
FT                   /locus_tag="BSn5_01530"
FT   CDS_pept        complement(301668..302687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01530"
FT                   /product="Kdg operon transcriptional regulator (LacI
FT                   family) protein"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92940"
FT                   /protein_id="ADV92940.1"
FT                   /translation="MKKKTTGHTTIKDVAECAGVSKSTVSRYINGKIDAISPEKVKNIK
FT                   KAIAELNYRPSKMAQGLKIKKSKLIGFVVADITNPFSVAAFRGVEEVCDQYGYSIMVCN
FT                   TDNSPEKEREMLLKLEAHSVEGLILNATGENKDVLRAFAEQQIPTILIDRKLPDLKLDT
FT                   VTTDNRWITKEILQKVYSKGYTDVALFTEPISSISPRAERAAVYQEMASVQNVNGLVRL
FT                   HEIDVKDKEQLKAALRSFHKEMPEQKKAILALNGLIMLKIISCMEELGLRIPQDIGIAG
FT                   FDDTEWYKLIGPGITTIAQPSHDMGRTAIERVLKRIEGDKGAPQTIELEAKVIMRKSL"
FT   gene            302909..303736
FT                   /locus_tag="BSn5_01535"
FT   CDS_pept        302909..303736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01535"
FT                   /product="5-keto-4-deoxyuronate isomerase"
FT                   /note="COG3717 5-keto 4-deoxyuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01535"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92941"
FT                   /protein_id="ADV92941.1"
FT                   /translation="MENRYSVHPEQVKRFTTEELRSHFLMDPLFTENKLTMYYSHEDRV
FT                   VIGGAAPGQSELKLDAGDFLKTDFFLERREIGIINVGQPGAVRVGDDEYVLQTKDFLYI
FT                   GMGNQDVSFSSLNGEKAKFYFVSACAHKSYPTQKAALAELTPDRLGDDAASNVRSLYKV
FT                   IHQDGIKSCQLMMGITMLDQNNNWNTMPAHVHDRRMEAYLYLDLEKDSKVFHFMGQPDE
FT                   TRHLVVGNEQAVLSPAWSIHSGAGTSNYSFVWAMAGENYTFTDMDLVPMDGLK"
FT   gene            303738..304502
FT                   /locus_tag="BSn5_01540"
FT   CDS_pept        303738..304502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01540"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92942"
FT                   /protein_id="ADV92942.1"
FT                   /translation="MGYLHDAFSLEGKTALVTGPGTGIGQGIAKALAGAGADIIGTSHK
FT                   SSLSETQQLVEQEGRIFTSFTLDMSKPEAIKDSAAELFENRQIDILVNNAGIIHREKAA
FT                   DFPEENWQHVLNVNLNSLFILTQLAGRHMLKRGHGKIINIASLLSFQGGILVPAYTASK
FT                   HAVAGLTKSFANEWAASGIQVNAIAPGYISTANTKPIRDDEKRNEDILKRIPAGRWGQA
FT                   DDIGGTAVFLASRASDYVNGHILAVDGGWLSR"
FT   gene            complement(304544..306469)
FT                   /locus_tag="BSn5_01545"
FT   CDS_pept        complement(304544..306469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01545"
FT                   /product="putative ATP-dependent helicase"
FT                   /note="COG1199 Rad3-related DNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01545"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92943"
FT                   /protein_id="ADV92943.1"
FT                   /translation="MTTSRLPFSLTKTKNFYEELNNWIGDVFYDILPEKGFDLRDEQVF
FT                   MAFQLERAFKEKKVMFAEAGVGTGKTLVYLLFAISYARYVGKPAIIACADETLIEQLVK
FT                   KEGDISKLAEHLDLKIDTRLSKSHEQYLCLKKLEKTMQRSDDDKWLDLYESLPSFVHES
FT                   QAMQRFYPYGDRKQYANLSNEEWSDVSYDSFQDCLTCDMRHRCGLTLSRDYYRKSTDLI
FT                   ICSHDFYMEHVWTEESRKREGQLPLLPDHSAVVFDEGHLLEFAAQKALTYRVKQSTLEL
FT                   FLERLLQNDIREEFAELIEDALLANDEFFYVLSEESKEVAGSHRLEIKNDQRVKKAADE
FT                   LCRLLDKIGEALVFESEMYTIDQYELSVVEEYVEQMAYSLSLYQKDAISWLEKKEAEST
FT                   FVVMPRTVAEVLGEKVFSKKIPYIFSSATLSEGGSFDYIADSLGIHDYLSLTVDSPYDY
FT                   DEQMSINLYAKTDMDAEQKTAETIETIKRYKGRTLVLFPSFEELNEFKELSAAWELPYP
FT                   IFFEGDEEISSLVEKFQEEEETVLCSVHLWEGLDIPGDALKNVTIWSLPFPPHDPVFTA
FT                   KRNGAKKDPFEEVDLPYMLLRVRQGIGRLIRSNQDSGSIHIYAGGENERIIDEVKKVLP
FT                   VEPHKM"
FT   gene            complement(306572..306811)
FT                   /locus_tag="BSn5_01550"
FT   CDS_pept        complement(306572..306811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92944"
FT                   /protein_id="ADV92944.1"
FT                   /translation="MKSSHTMMIISIRGDLMLNSEHFNLIQRALDATANELKELGTDSS
FT                   PSVISHAQTDLEKAVEHIYSTDHPFLSSHVINRK"
FT   gene            complement(307132..308289)
FT                   /locus_tag="BSn5_01555"
FT   CDS_pept        complement(307132..308289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01555"
FT                   /product="putative methylase with RNA interaction domain"
FT                   /note="COG0116 Predicted N6-adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01555"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92945"
FT                   /protein_id="ADV92945.1"
FT                   /translation="MKKYTLIATAPMGIEAVVAKEVRDLGYECKVDNGKVIFEGDALAI
FT                   CRANLWLRTADRIKVQVASFKAKTFDELFEKTKAINWRSFIPENGKFPVIGKSVKSTLA
FT                   SVPDCQRIVKKAIVEKLKLQSGKANDWIEETGAEYKVEISLLKDQALITLDSSGTGLHK
FT                   RGYRVDQGGAPIKETLAAALVQLTNWTPDRPFVDPFCGSGTIAIEAALIGQNIAPGFNR
FT                   DFVSEDWEWIGKDLWNKARLEVEEKANYDQPLTIFASDIDHRMVQIAKENAEEAGLGDL
FT                   IQFKQMQVKDFTTNLEFGVIVGNPPYGERLGEKKAVEQMYKEMGQAFEPLDTWSVYMLT
FT                   SNENFEEAYGRKATKKRKLFNGFIKTDYYQYWSKVRPQRKKTENA"
FT   gene            complement(308837..309133)
FT                   /locus_tag="BSn5_01560"
FT   CDS_pept        complement(308837..309133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01560"
FT                   /product="cell division protein GpsB"
FT                   /note="COG3599 Cell division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92946"
FT                   /protein_id="ADV92946.1"
FT                   /translation="MLADKVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFH
FT                   QEIEELQQENLQLKKQLEEASKKQPVQSNTTNFDILKRLSNLEKHVFGSKLYD"
FT   gene            complement(309211..309753)
FT                   /locus_tag="BSn5_01565"
FT   CDS_pept        complement(309211..309753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01565"
FT                   /product="hypothetical protein"
FT                   /note="COG4474 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01565"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92947"
FT                   /protein_id="ADV92947.1"
FT                   /translation="MKVLAITGYKPFELGIFKQDDKALYYIKKAIKNRLIAFLDEGLEW
FT                   ILISGQLGVELWAAEAAYDLQEEYPDLKVAVITPFYEQEKNWKEPNKEQYEAVLAQADY
FT                   EASLTHRPYESPLQFKQKNQFFIDKSDGLLLLYDPEKEGSPKYMLGTAEKRREQDSYPI
FT                   YFITMDDLRVTVEEDSY"
FT   gene            complement(309842..310069)
FT                   /locus_tag="BSn5_01570"
FT   CDS_pept        complement(309842..310069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01570"
FT                   /product="spore coat protein (inner)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92948"
FT                   /protein_id="ADV92948.1"
FT                   /translation="MHHCRPHMMAPIVHPTHCCEHHTFSKTIVPHIHPQHTTNVNHQHF
FT                   QHVHYFPHTFSNVDPATHQHFQAGKPCCDY"
FT   gene            complement(310153..310248)
FT                   /locus_tag="BSn5_01575"
FT   CDS_pept        complement(310153..310248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01575"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92949"
FT                   /protein_id="ADV92949.1"
FT                   /translation="MYKGVFYLFFVVVFLIAFVFSNFKDSLIAHF"
FT   gene            complement(310382..311623)
FT                   /locus_tag="BSn5_01580"
FT   CDS_pept        complement(310382..311623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01580"
FT                   /product="putative nucleic acid binding enzyme"
FT                   /note="COG3359 Predicted exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92950"
FT                   /protein_id="ADV92950.1"
FT                   /translation="MSLKGKLQRMKKHMALDEGEQKIEAGKQENHFDDIPFLEEWEAFG
FT                   MKPFIFEDEYCLIREVEYPLSHRHGLYSFSELEEVITLWNQSGLSHTLSAKGYNKNNLF
FT                   FFDTETTGLGGGAGNTIFLLGHARVYEDRVTVKQHLLPKPGNEVALYQSFLSEVDITSL
FT                   VTYNGKAFDWPQVKTRHTLIRDRLPKLPEFGHFDLLHGARRLWKHKMDRVSLGTVEKEE
FT                   LGIRRLEDTPGYLAPMLYFHFIKAQEPDLLKGVLHHNEMDVLSLISLYIHMSKKILSES
FT                   HAPKEHSEAYAMAKWFMAHKETDQAIKQLERLIEKSFEDQDSARLDLSLLYKKQNRLEE
FT                   AVPLWEKLSRSQNQKCRYAAVIELAKYFEHKKKEFGKALQIAEQLLSDAACLSEKETEK
FT                   LHVRIARLKRKYSS"
FT   gene            complement(311639..313888)
FT                   /locus_tag="BSn5_01585"
FT   CDS_pept        complement(311639..313888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01585"
FT                   /product="putative ATP-dependent helicase"
FT                   /note="COG1205 Distinct helicase family with a unique
FT                   C-terminal domain including a metal-binding cysteine
FT                   cluster"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01585"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92951"
FT                   /protein_id="ADV92951.1"
FT                   /translation="MKKKSLTELISDLKGNENVVNWHEIEPREAKTRPMPESIDERIKA
FT                   ALSKRGIDELYTHQYSAFQYVQKGESIVTVTPTASGKTLCYNLPVLQSIAQDETNRALY
FT                   LFPTKALAQDQKSELNEIIDEMGIDIKSFTYDGDTSPAIRQKVRKAGHIVITNPDMLHS
FT                   AILPHHTKWVSLFENLKYIVIDELHTYRGVFGSHVANVIRRLKRICRFYGSDPVFICTS
FT                   ATIANPKELGEQLTGKPMRLVDDNGAPSGRKHFVFYNPPIVNKPLNIRRSATAEVNELA
FT                   KEFLKNKVQTIVFARSRVRVEIILSHIQELVKKEIGTKSIRGYRGGYLPKERREIEKGL
FT                   REGDILGVVSTNALELGVDIGQLQVCVMTGYPGSVASAWQQAGRAGRRHGESLIIMVAN
FT                   STPIDQYIVRHPEYFFNRSPESARINPENLIILVDHLKCAAYELPFRADEEFGPMEVSD
FT                   ILEYLEEEAVLHRNGERYHWASESFPASNISLRSASQENVVIVDQSDIANVRIIGEMDR
FT                   FSAMTLLHDEAIYLHEGVQYQVEKLDWDHKKAYVRKVDVEYYTDANLAVQLKVLEIDKT
FT                   KEKSRTSLHYGDVTVNALPTIFKKIKMTTFENIGSGPIHLPEEELHTSAAWLEIKTADE
FT                   DIGEKTLEQLLLGISNVLQHIVPVYIMCDRNDVHVVSQIKAAHTGLPTIFLYDHYPGGI
FT                   GLAEEVFKRFSDINEAAKQLITHCPCHDGCPSCIGTEIEGIKAKERILQLLDQMS"
FT   gene            complement(313991..314497)
FT                   /locus_tag="BSn5_01590"
FT   CDS_pept        complement(313991..314497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01590"
FT                   /product="putative phosphotransferase system enzyme IIA
FT                   component"
FT                   /note="COG2190 Phosphotransferase system IIA components"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92952"
FT                   /protein_id="ADV92952.1"
FT                   /translation="MLKKLFGMGKTQEKVTEEVIYSPADGTVMDLSDVPDPVFSQKMMG
FT                   EGIAVEPSSGEIVSPAEGEVIQIFHTKHAVGIRTRSGIELLIHVGLETVNMNGEGFTAH
FT                   IKEGDKVKVGDPLITCDLELIKEKASSTVIPIVIMNGEAVGSIVPAGEKAARKGESKLL
FT                   TIKAK"
FT   gene            314635..315054
FT                   /locus_tag="BSn5_01595"
FT   CDS_pept        314635..315054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01595"
FT                   /product="hypothetical protein"
FT                   /note="COG0071 Molecular chaperone (small heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01595"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92953"
FT                   /protein_id="ADV92953.1"
FT                   /translation="MEFYDDKKNELQKKEEIITEAIDTLFQSSAFGNLINGFQNLINSS
FT                   LKDVQTTIHVREKDTGLYIDITIPATFRDGEIVVDVKSRYLHVTLQEKQKHQNEATFTS
FT                   MTRTVQLPYEVRQEDMETSWNEQTMTLFFPKNKHE"
FT   gene            complement(315075..315452)
FT                   /locus_tag="BSn5_01600"
FT   CDS_pept        complement(315075..315452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92954"
FT                   /protein_id="ADV92954.1"
FT                   /translation="MNRSSRSYPRQMGYYYPQQMQGYYQQAAPGYLEQQLPQQHYGQQD
FT                   YYQPYAPIQPMPMQPPVFSNPYPIPRPNQQQPSQFQSIMSQFKKANGQFDFNKMMDTTG
FT                   QVMSAMNQVGSLIKGFTSFFK"
FT   gene            315640..315828
FT                   /locus_tag="BSn5_01605"
FT   CDS_pept        315640..315828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01605"
FT                   /product="putative site-specific integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01605"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92955"
FT                   /protein_id="ADV92955.1"
FT                   /translation="MNVSYLSKRFAEMKKYETDCMNKLMDFAKFLYIQGHLSITEFRNS
FT                   MKVLEANGAESPAYEMN"
FT   gene            complement(315867..316238)
FT                   /locus_tag="BSn5_01610"
FT   CDS_pept        complement(315867..316238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92956"
FT                   /protein_id="ADV92956.1"
FT                   /translation="MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVE
FT                   ENDELAARWAEGALELIKAHRPKYVHKEQIETVKDNFLELVLQSYVHHIHKKRFKDITE
FT                   SVLYTLHAVKDEIAREDSR"
FT   gene            complement(316284..316529)
FT                   /locus_tag="BSn5_01615"
FT   CDS_pept        complement(316284..316529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01615"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92957"
FT                   /protein_id="ADV92957.1"
FT                   /translation="MSGYVCKTDILRMLSDIEDELTRAEQSLNHSVNALEAEMRETEND
FT                   RLSMLEEEIIDLHICINELYQSPEHRYAFEKVYRIG"
FT   gene            316728..316832
FT                   /locus_tag="BSn5_01620"
FT   CDS_pept        316728..316832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01620"
FT                   /product="small acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92958"
FT                   /protein_id="ADV92958.1"
FT                   /translation="MKTRPKKAGQQKKTESKAIDSLDKKLGGPNRPST"
FT   gene            complement(316857..317813)
FT                   /locus_tag="BSn5_01625"
FT   CDS_pept        complement(316857..317813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01625"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92959"
FT                   /protein_id="ADV92959.1"
FT                   /translation="MQEQQTIRKLLSRIERQTKIKNADNISRTNAYKAFYDRHPEIKWS
FT                   LLASFVSRNAGWSMTDLKGSLFQLGLRERQQEWFFLAYERANWLIFSDAYPQLLLYHWS
FT                   KRVGKPLFHLLHVFGVSQFMSEEWTRFWHERNTERLMYALIINEQNTIQTPIIQNPSFK
FT                   KNVFDTIPFYLSDWFHFNTVIFPSSNGFLYGISVKRFSKAEERIRLGKQLSQLLFKPEL
FT                   FSSFYHFLHTVPHSGSRFDMEKMIGITKRTSPMLRTCYPELIHSLDGTKTDWFHGKIKK
FT                   TFFRREELPKQIELTDWYLHKKRQLHALFAVKQWLKK"
FT   gene            317860..318480
FT                   /gene="recU"
FT                   /locus_tag="BSn5_01630"
FT   CDS_pept        317860..318480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="BSn5_01630"
FT                   /product="Holliday junction-specific endonuclease"
FT                   /note="COG3331 Penicillin-binding protein-related factor A,
FT                   putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92960"
FT                   /protein_id="ADV92960.1"
FT                   /translation="MIRYPNGKTFQPKHSVSSQNSQKRAPSYSNRGMTLEDDLNETNKY
FT                   YLTNQIAVIHKKPTPVQIVNVHYPKRSAAVIKEAYFKQSSTTDYNGIYKGRYIDFEAKE
FT                   TKNKTSFPLQNFHAHQIEHMKQVKAQDGICFVIISAFDQVYFLEADKLFYFWDRKEKNG
FT                   RKSIRKDELEETAYPISLGYAPRIDYISIIEQLYFSPSSGAKG"
FT   gene            318502..321246
FT                   /locus_tag="BSn5_01635"
FT   CDS_pept        318502..321246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01635"
FT                   /product="peptidoglycan glycosyltransferase
FT                   (penicillin-binding proteins 1A and 1B)"
FT                   /note="COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01635"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92961"
FT                   /protein_id="ADV92961.1"
FT                   /translation="MSDQFNSREARRKANSKSSPSPKKGKKRKKGGLFKKTLFTLLILF
FT                   VLGVVGGAVTFAVMVSDAPSLDESKLKTPYSSTIYDKNGKEIAEVGAEKRTYVSIDEIP
FT                   DVVKEAFIATEDARFYEHHGIDPVRIGGALVANFKDGFGAEGGSTITQQVVKNSLLSHQ
FT                   KTLKRKVQEVWLSIQLERNYSKDEILEMYLNRIYFSPRAYGIGKAAEEFFGVTDLSKLT
FT                   VEQAATLAGMPQSPTAYNPVKNPDKAEKRRNIVLSLMKKQGFISDSQYNKAKKVAVKDE
FT                   GVVSQKEYEKASTNKYSAFVEEVMKEIDEKSDVDPSADGLKIYTTLDTKAQDKLDELMD
FT                   GDTVGFTEGMQGGVTLLDTKNGEVRAIGAGRNQPVGGFNYATQTKAQPGSTIKPILDYG
FT                   PVIENKKWSTYEQIDDSAYTYSNGKPIRDWDRKYLGPISMRYALAQSRNIPALKAFQAV
FT                   GKDTAVDFANGLGLGLTKDNVTEAYSIGGFGGNDDVSPLTMAGAYSAFGNNGTYNEPHF
FT                   VKSIEFNDGTKLDLTPKSKSAMSDYTAFMITDMLKTAVKTGTGQLAQVPGVEVAGKTGT
FT                   TNFDDNEVKRYNIASGGARDSWFVGYTPQYTAAVWTGMGENEAGKKSLSAEEQKVAKRI
FT                   FAQLIADVDDGSGSFEKPDSVVEATVEKGSNPAKLAGPNTPSDKKLTEYFVKGTAPSTV
FT                   SKTYEKEEKEETAKLSGLNVKYDKDNQSLTLSWNYDGDATFAVKQSVDGGSYSEIQNSS
FT                   AKEAVISGVQPGSVYKFEVTAVSDDGKSTASTSYEVPKAEDDEDKKDQQQTDDEKQDDE
FT                   KTQDDTQTDDSQKDDGQTDQDQTDDSTNDQDKKQDNTNTNPSDNNNQDQSNDNDNDNSN
FT                   NQDTSDGDSNSGKNDSTGSDTNKNKTDTSNKTQTNSSSIEKTN"
FT   gene            complement(321322..321816)
FT                   /locus_tag="BSn5_01640"
FT   CDS_pept        complement(321322..321816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92962"
FT                   /protein_id="ADV92962.1"
FT                   /translation="MTQAKEVLASYEQYLRSLGQKSSSDMKKTLQTNPVYFDFCTELQG
FT                   DLPWEDSGKYVPLLFEVWDDIKASLLPVFQTRKSRCDQNEMLKGIVCLLASLHWTAGEP
FT                   VKSLDWQELREKSYPAKPINWAERVEFILLKPTQYHCFIQLEELFTEMKKHFYKYHAMN
FT                   R"
FT   gene            complement(321813..322472)
FT                   /locus_tag="BSn5_01645"
FT   CDS_pept        complement(321813..322472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01645"
FT                   /product="endonuclease III"
FT                   /note="COG0177 Predicted EndoIII-related endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01645"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92963"
FT                   /protein_id="ADV92963.1"
FT                   /translation="MLNLKQIEFCLDKIGDMFPHAECELVHSNPFELVVAVALSAQCTD
FT                   ALVNRVTKTLFQKYKRPEDYLAVPLEELQQDIKSIGLYRNKAKNIQKLSKMIIEDYGGE
FT                   VPRDRDELVKLPGVGRKTANVVVSVAFGVPAIAVDTHVERVSKRLGICRWKDSVLEVEK
FT                   TLMRKVPKEDWSVTHHRLIFFGRYHCKAQSPRCAECPLLSLCREGQKRDKKGLVKR"
FT   gene            complement(322491..323189)
FT                   /locus_tag="BSn5_01650"
FT   CDS_pept        complement(322491..323189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01650"
FT                   /product="DNA-remodelling primosomal protein"
FT                   /note="COG3935 Putative primosome component and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92964"
FT                   /protein_id="ADV92964.1"
FT                   /translation="MKKQQFIDMQEQGTSTIPNLLLTHYKQLGLNETELILLLKIKMHL
FT                   EKGSYFPTPNQLQEGMSISVEECTNILRMFIQKGFLFIEECEDQNGIKFEKYSLQPLWG
FT                   KLYEYIQLAQNQTKERKAEGEQKSLYTIFEEEFARPLSPLECETLAIWQDQDQHDAQLI
FT                   KHALKEAVLSGKLSFRYIDRILFEWKKNGLKTVEQAKIHSQKFRRVQAKQNEPQKEYKR
FT                   QVPFYNWLEQ"
FT   gene            complement(323282..324574)
FT                   /gene="asnC"
FT                   /locus_tag="BSn5_01655"
FT   CDS_pept        complement(323282..324574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="BSn5_01655"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="COG0017 Aspartyl/asparaginyl-tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01655"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92965"
FT                   /protein_id="ADV92965.1"
FT                   /translation="MKTTINQVYKHVGEEVTIGAWVANKRSSGKIAFLQLRDGTGFIQG
FT                   VVVKAEVEESIFQTAKSVTQETSLYIKGIVKEDERSPLGYELAVTDIEVIHEATDYPIT
FT                   PKEHGTEFLMDHRHLWLRSKRQHAIMKIRNEIIRATYEFFNNEGFVKVDPPILTGSAPE
FT                   GTTELFATKYFDEDAYLSQSGQLYMEAAAMALGKVFSFGPTFRAEKSKTKRHLIEFWMI
FT                   EPEMAFVEFEENLQVQENYVSFIVQSVLKNCKIELNTLGRDTSKLEQIKAPFPRITYDE
FT                   AIEFLKEKGFDDIEWGDDFGAPHETAIAEHYDKPVFITRYPTSLKPFYMQPASDREDVV
FT                   LCADLIAPEGYGEIIGGSERIHDMELLESRLKEHGLDSDAYKWYAELRKYGSVPHSGFG
FT                   LGLERTVAWISGAPHVRETIPFPRLLNRLYP"
FT   gene            complement(324718..325899)
FT                   /locus_tag="BSn5_01660"
FT   CDS_pept        complement(324718..325899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01660"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92966"
FT                   /protein_id="ADV92966.1"
FT                   /translation="MKLAKRVSALTPSTTLAITAKAKELKAAGHDVIGLGAGEPDFNTP
FT                   QHIIDAAVRSMNEGHTKYTPSGGLAELKNSIAEKFKRDQNIEYKPSQIIVCTGAKHALY
FT                   TLFQVILDEEDEVIIPTPYWVSYPEQVKLAGGKPVYVEGLEENHFKISPEQLKNAITEK
FT                   TKAIVINSPSNPTGVMYTEEELSALGEVCLEHDILIVSDEIYEKLTYGGKKHVSIAQLS
FT                   DRLKEQTVIINGVSKSHSMTGWRIGYAAGSEDIIKAMTNLASHSTSNPTSIAQYGAIAA
FT                   YNGPSEPLEEMREAFEHRLNTIYAKLIEIPGFSCVKPEGAFYLFPNAKEAAQSCGFKDV
FT                   DEFVKALLEEEKVAIVPGSGFGSPENVRLSYATSLDLLEKAIERIKRFVEKHS"
FT   gene            complement(325922..326407)
FT                   /locus_tag="BSn5_01665"
FT   CDS_pept        complement(325922..326407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01665"
FT                   /product="hypothetical protein"
FT                   /note="COG5353 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01665"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92967"
FT                   /protein_id="ADV92967.1"
FT                   /translation="MRKKALIFTVIFGIIFLAVLLVSASIYKSAMAQKEEGHEAAAAEA
FT                   KKETDLAHVDQVETFVGKEKYYVVKGTDKKGTALYVWVPADKKAKILSKEAKEGISEDK
FT                   AAKIIKDEGLVSKQKEVHLAREGNVLLWEVTYLDKEGQYSLSYVDFTTGKILKNITP"
FT   gene            complement(326416..326586)
FT                   /locus_tag="BSn5_01670"
FT   CDS_pept        complement(326416..326586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92968"
FT                   /protein_id="ADV92968.1"
FT                   /translation="MESKIEILSTINVEHSDDLYKIVDTLNRTLKRDNLMFGLALDEEN
FT                   KNQAVFTIYRT"
FT   gene            complement(326729..329524)
FT                   /locus_tag="BSn5_01675"
FT   CDS_pept        complement(326729..329524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01675"
FT                   /product="bifunctional ATP-dependent DNA helicase/DNA
FT                   polymerase III subunit epsilon"
FT                   /note="COG0847 DNA polymerase III, epsilon subunit and
FT                   related 3'-5' exonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01675"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92969"
FT                   /protein_id="ADV92969.1"
FT                   /translation="MNKQRFVVIDVETTGNSPKKGDKIIQIAAVVIENGQITERFSKYI
FT                   NPNKSIPAFIEQLTGISNQMVENEQPFEAVAEEVFQLLDGAYFVAHNIHFDLGFVKYEL
FT                   HKAGFQLPDCEVLDTVELSRIVFPGFEGYKLTELSEELQLRHDQPHRADSDAEVTGLIF
FT                   LEILEKLRQLPYPTLKQLRRLSQHFISDLTHLLDMFINENRHTEIPGYTRFSSFSVREP
FT                   EAIDARINEDENFSFEIESWEAGNEKALSELMPGYEKRDGQMMMMREVADAFANREHAL
FT                   IEAPPGIGKTIGYLIPAALFAKKSKKPVIISTYSTLLQQQILTKDLPIVQDLFPFPVTA
FT                   AILKGQSHYLCLYKFEQVLHEEDDNYDAVLTKAQLLVWLTETNTGDVAELNLPSGGKLL
FT                   WDRLAYDDDSYKRSRSEHVIGFYERAKQIAMRSDLVITNHSLLLTDESSQKKRLPESGT
FT                   FIIDEAHHFERAASEHLGKRATYIELHTKLSRIGTLKEQGLLKKMRQLFQRNSLPVDSF
FT                   FELEEWLQHVQAESDAFFSSVHSFVKRRKPKEDLNRLVFKVNKESQDKSWSILTDGAER
FT                   LCSMLTHLQQLFEAQSSLMEKHLKGMKSKTVFLADEYQRSMKGLQHYCQTLQKLFFGSD
FT                   DDEAVWIEIDAKGAKNAVAIYAQPLEPGELLADQFFARKNSVVLTSATLTVEGSFQFMI
FT                   ERLGLSDFFPRTMRIESPFSYDERMQVMIPKEMKSIQDTGQPEFIQDTARYIELMAKEK
FT                   QPKILVLFTSHDMLKKVHQELKHNMSASGIQLLAQGITGGSPGKLMKTFKTSNQAILLG
FT                   TNHFWEGVDFPGDELTTVMIVRLPFRSPDHPLHAAKCELARKKGKNPFQTVSLPEAVLT
FT                   FRQGIGRLLRSAGDKGTIIILDRRIKTAGYGRLFLDALPTTSVSEMTDCELEAYVAGEK
FT                   E"
FT   gene            complement(329650..330033)
FT                   /locus_tag="BSn5_01680"
FT   CDS_pept        complement(329650..330033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01680"
FT                   /product="aspartate alpha-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="COG0853 Aspartate 1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92970"
FT                   /protein_id="ADV92970.1"
FT                   /translation="MYRTMMSGKLHRATVTEANLNYVGSITIDEDLIDAVGMLPNEKVQ
FT                   IVNNNNGARLETYIIPGKRGSGVICLNGAAARLVQEGDKVIIISYKMMSDQEAASHEPK
FT                   VAVLNDQNKIEQMLGNEPARTIL"
FT   gene            complement(330035..330895)
FT                   /gene="panC"
FT                   /locus_tag="BSn5_01685"
FT   CDS_pept        complement(330035..330895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="BSn5_01685"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="COG0414 Panthothenate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01685"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92971"
FT                   /protein_id="ADV92971.1"
FT                   /translation="MRQITDISQLKEAIKQYHSEGKSIGFVPTMGFLHEGHLTLADKAR
FT                   QENDAVIMSIFVNPAQFGPNEDFEAYPRDIERDAALAENAGVDILFTPDAHDMYPGEKN
FT                   VTIHVERRTDVLCGRSREGHFDGVAIVLTKLFNLVKPTRAYFGLKDAQQVAVVDGLISD
FT                   FFMDIELVPVDTVREEDGLAKSSRNVYLTAEERKEAPKLYRALQTSAELIQAGERDPEA
FT                   VIKAAKEIIETTSGTIDYVELYSYPELEPVNEVAGKMILAVAVAFSKARLIDNIIIDIR
FT                   EMERI"
FT   gene            complement(330897..331730)
FT                   /gene="panB"
FT                   /locus_tag="BSn5_01690"
FT   CDS_pept        complement(330897..331730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="BSn5_01690"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="COG0413 Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92972"
FT                   /protein_id="ADV92972.1"
FT                   /translation="MKTKLDFLKMKESEEPIVMLTAYDYPAAKLAEQAGVDMILVGDSL
FT                   GMVVLGLDSTVGVTVADMIHHTKAVKRGAPNTFIVTDMPFMSYHLSKEDTLKNAAAIVQ
FT                   ESGADALKLEGGEGVFESIRALTLGGIPVVSHLGLTPQSVGVLGGYKVQGKDEQSAKKL
FT                   IEDSIKCEEAGAMMLVLECVPAELTAKIAETLSIPVIGIGAGVKADGQVLVYHDIIGHG
FT                   VERTPKFVKQYTRIDETIETAISGYVQDVRHRAFPEQKHSFQMNQKVLDGLYGGK"
FT   gene            complement(331977..332954)
FT                   /locus_tag="BSn5_01695"
FT   CDS_pept        complement(331977..332954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01695"
FT                   /product="biotin acetyl-CoA-carboxylase ligase and biotin
FT                   regulon repressor"
FT                   /note="COG1654 Biotin operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01695"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92973"
FT                   /protein_id="ADV92973.1"
FT                   /translation="MRSTLRKDLIELFSQAGNEFISGQKISDALGCSRTAVWKHIEELR
FT                   KEGYEVEAVRRKGYRLIKKPGKLSESEIRFGLKTEVMGQHLIYHDVLSSTQKTAHELAN
FT                   NNAPEGTLVVADKQTAGRGRMSRVWHSQEGNGVWMSLILRPDIPLQKTPQLTLLAAVAV
FT                   VQGIEEAAGIQTDIKWPNDILINGKKTVGILTEMQAEEDRVRSVIIGIGINVNQQPNDF
FT                   PEELKDIATSLSQAAGEKIDRAGVIQHILLCFEKRYRDYMTHGFTPIKLLWESYALGIG
FT                   TNMRARTLNGTFYGKALGIDDEGVLLLETNEGIKKIYSADIELG"
FT   gene            complement(332939..334132)
FT                   /locus_tag="BSn5_01700"
FT   CDS_pept        complement(332939..334132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01700"
FT                   /product="tRNA CCA-pyrophosphorylase"
FT                   /EC_number="2.7.7.72"
FT                   /note="COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92974"
FT                   /protein_id="ADV92974.1"
FT                   /translation="MEKVFIKALPVLRILIEAGHQAYFVGGAVRDSYMKRAIGDVDIAT
FT                   DAAPDQVERLFQRTVDVGKEHGTIIVLWEDETYEVTTFRTESDYVDFRRPSEVQFISSL
FT                   EEDLKRRDLTINAMAMTADGKVLDYFGGKKDIDQKVIRTVGKPEDRFQEDALRMLRAVR
FT                   FMSQLGFTLSPETEEAIAKEKSLLSHVSVERKTIEFEKLLQGRASRQALQTLIQTRLYK
FT                   ELPGFYHKRENLISTSEFPFFSLTSREELWAALLINLGIALKDAPLFLKAWKLPGKVIK
FT                   EAIHIADTFGQSLDAMTMYRAGEKALLSAAKISQLRQNEKLDEKKLKDIQYTYQNLPIK
FT                   SLKDLDITGKDLLALRNRPAGKWVSEELQRIEQAVVTGKLSNQKKYIEEWLKTCGQH"
FT   gene            complement(334137..335270)
FT                   /locus_tag="BSn5_01705"
FT   CDS_pept        complement(334137..335270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01705"
FT                   /product="putative enzyme in leucine catabolism or biotin
FT                   metabolism"
FT                   /note="COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01705"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92975"
FT                   /protein_id="ADV92975.1"
FT                   /translation="MRKLKIGITCYPSVGGSGIIATELGKQLAEKGHEIHFITSSIPFR
FT                   LNTYHSNIHFHEVEVNQYAVFKYPPYDLTLASKIAEVAERENLDIIHAHYALPHAVCAY
FT                   LAKQMLKRNIGIVTTLHGTDITVLGYDPSLKDLIRFAIESSDRVTAVSSALAAETYDLI
FT                   KPEKKIETIYNFIDERVYLKKNTAAIKEKHGILPDEKVVIHVSNFRKVKRVQDVIRVFR
FT                   NIAGKTKAKLLLVGDGPEKSTACELIRKYGLEDQVLMLGNQDRVEELYSISDLKLLLSE
FT                   KESFGLVLLEAMACGVPCIGTNIGGIPEVIKNNVSGFLVDVGDVGAATARAMSILEDEQ
FT                   LSNRFTKAAIEMLENEFSSKKIVSQYEQIYADLAEPE"
FT   gene            complement(335267..335977)
FT                   /locus_tag="BSn5_01710"
FT   CDS_pept        complement(335267..335977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01710"
FT                   /product="hypothetical protein"
FT                   /note="COG2120 Uncharacterized proteins, LmbE homologs"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92976"
FT                   /protein_id="ADV92976.1"
FT                   /translation="MYNADVLAFGAHSDDVEIGMGGTIAKFVKQEKKVMICDLTEVELS
FT                   SNGTVSLRKEEAAEAARILGADKRIQLTLPDRGLIMSDQAIRSIVTVIRTCRPKAVFMP
FT                   YKKDRHPDHGNAAALVEEAIFSAGIHKYKDEKSLPAHKVSKVYYYMINGFHQPDFVIDI
FT                   SDTIEAKKQSLNAYKSQFIPSKDSVSTPLTNGYIEIVEAREKLYGKEAGVEYAEGFFSK
FT                   RMLMLDHDVLGGEQ"
FT   gene            complement(335970..336383)
FT                   /gene="mgsA"
FT                   /locus_tag="BSn5_01715"
FT   CDS_pept        complement(335970..336383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="BSn5_01715"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="COG1803 Methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01715"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92977"
FT                   /protein_id="ADV92977.1"
FT                   /translation="MKIALIAHDKKKQDMVQFTTAYRDILKNHDLYATGTTGLKIQEAT
FT                   GLQIERFQSGPLGGDQQIGALIAANALDLVIFLRDPLTAQPHEPDVSALIRLCDVYSIP
FT                   LATNMGTAEILVRTLDEGVFEFRDLLRGEEPNV"
FT   gene            complement(336399..337202)
FT                   /locus_tag="BSn5_01720"
FT   CDS_pept        complement(336399..337202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01720"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="COG0289 Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92978"
FT                   /protein_id="ADV92978.1"
FT                   /translation="MSNETIKVVIAGPRGRMGQEAVKLAERTPHFDLVGAIDHTYDQQK
FT                   LSDVMPVESDAFIYTDIHACFTETQPDVLIDLTTPEIGKVHTKIALEHGVRPVVGTTGF
FT                   SEADLKELTSLTEEKGIGAIIAPNFALGAILMMKFSKMAANYFEDVEIIELHHDQKLDA
FT                   PSGTALKTAEMISEVRKEKQQGHPDEKEILPGARGAEQNGIRLHSVRLPGLIAHQEVMF
FT                   GMDGQTLQIRHDSYNRASFMSGVKLSVEQVMKIDQLVYGLENIID"
FT   gene            complement(337214..337549)
FT                   /locus_tag="BSn5_01725"
FT   CDS_pept        complement(337214..337549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01725"
FT                   /product="nucleotide phosphohydrolase"
FT                   /note="COG1694 Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01725"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92979"
FT                   /protein_id="ADV92979.1"
FT                   /translation="MSDKTMKDIQAEVDRYIGQFKEGYFSPLAMMARLTEELGELAREV
FT                   NHRYGEKPKKATEDDKSMEEEMGDVLFVLVCLANSLDISLEEAHDRVMHKFNTRDKDRW
FT                   TRKEEGK"
FT   gene            337689..338561
FT                   /locus_tag="BSn5_01730"
FT   CDS_pept        337689..338561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01730"
FT                   /product="putative integral inner membrane protein"
FT                   /note="COG1284 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92980"
FT                   /protein_id="ADV92980.1"
FT                   /translation="MLGEIRLKNIFFILIGAAIFSFGLVHFNMQNNLAEGGFTGITLLL
FT                   YALFHISPSISNLVLNIPIFFIGWRLLGRTMFVYTLVGTVALSLFLSIFQRYEIHMPLQ
FT                   HDLALAALFAGVFIGAGLGIIFKFGGTTGGVDIIARLVNKYFGIPMGRTMFAFDACVII
FT                   LSLLTYLSYKEAMYTLVAVFVAARLIDFIQEGGYAAKGATIISSKNDLIQKKILEEMER
FT                   GVTILKGQGSYTKEDIDVLYCVVPKNELVMLKSVINSIDPHAFVAVSDVHDVLGEGFTL
FT                   DENKNPLPR"
FT   gene            complement(338603..339397)
FT                   /locus_tag="BSn5_01735"
FT   CDS_pept        complement(338603..339397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01735"
FT                   /product="sporulation protein YpjB"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01735"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92981"
FT                   /protein_id="ADV92981.1"
FT                   /translation="MKRKLTICLLIALIFYNGNAKAAERGSLEELNDLSDTVFQMTRQA
FT                   KYEEALQVLEYFEKTLKSTEKKQQDPMLTGAQIRQITLGYNDMVRSLKQADTSDTQKLR
FT                   AAAQFRMLMDAVDNRSDPLWGSLEKPIMEAFTELKRDVQKNGSTSFHEKWNEFISLYDL
FT                   IYPSLTIDVSEDQLETVGKHIDVIEQEEFQQMTESTKLERLSLLQHDLKNVFDRVEEDD
FT                   ADPSLLWVIITTGSIIITALTYVGYRKYKAEKNKLKKRDYPK"
FT   gene            complement(339466..340059)
FT                   /locus_tag="BSn5_01740"
FT   CDS_pept        complement(339466..340059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01740"
FT                   /product="putative integral inner membrane protein"
FT                   /note="COG4347 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92982"
FT                   /protein_id="ADV92982.1"
FT                   /translation="MKWFQYVLGQRPMLILVLAINFLGTVYGYYWYLPQLLETPARFLI
FT                   FVPDSPTATFFFLFVLLAFLMKRNAPFFEALALVTLVKYGLWAVAMNFLVLAVTGDLPW
FT                   EGYMLIASHFAMAVQGVLYSPYFRFSFWHLAIVAVWTLHNDVIDYLFDMMPQYSMLSDY
FT                   MTEIGYGTFWLSIFSIALAYFLVVSKKQTKLELM"
FT   gene            complement(340170..340937)
FT                   /locus_tag="BSn5_01745"
FT   CDS_pept        complement(340170..340937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01745"
FT                   /product="menaquinol:cytochrome c oxidoreductase cytochrome
FT                   cc subunit"
FT                   /note="COG1290 Cytochrome b subunit of the bc complex"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01745"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92983"
FT                   /protein_id="ADV92983.1"
FT                   /translation="MHRGKGMKFVGDSRIPAEKKPNIPKDYSEYPGKTEAFWPNFLLKE
FT                   WMVGAVFLIGFLVLTIVHQPPLERMADPTDTGYIPLPDWYFLFLYQLLKYEYAAGSFTV
FT                   VGAMIMPGLAFGALLLAPFLDRGTERRPWKRPVAVGMMLLAISAAVFLTWQSVATHDWA
FT                   KAEEQGKITKEADIDTNAEGYKVFKEQGCISCHGDNLQGGAAGPSLVDSGLKPDEIKKI
FT                   AVEGKGKMPAGVFKGNDKQLEELAKFISETTAK"
FT   gene            complement(340972..341646)
FT                   /locus_tag="BSn5_01750"
FT   CDS_pept        complement(340972..341646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01750"
FT                   /product="cytochrome b6"
FT                   /note="COG1290 Cytochrome b subunit of the bc complex"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92984"
FT                   /protein_id="ADV92984.1"
FT                   /translation="MLNKIYDWVDERLDITPMWRDIADHEVPEHVNPAHHFSAFVYCFG
FT                   GLTFFVTVIQVLSGMFLTMYYVPDIKNAWESVYYLQNEVAFGQIVRGMHHWGASLVIVM
FT                   MFLHTLRVFFQGAYKKPRELNWIVGVLIFFVMLGLGFTGYLLPWDMKALFATKVGLQIA
FT                   EATPLIGTQVKTLLAGHPDIVGAQTLTRFFAIHVFFLPAALFGLMAAHFIMIRKQGISG
FT                   PL"
FT   gene            complement(341648..342151)
FT                   /locus_tag="BSn5_01755"
FT   CDS_pept        complement(341648..342151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01755"
FT                   /product="menaquinol:cytochrome c oxidoreductase
FT                   (iron-sulfur subunit)"
FT                   /note="COG0723 Rieske Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01755"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92985"
FT                   /protein_id="ADV92985.1"
FT                   /translation="MGGKHDISRRQFLNYTLTGVGGFMAASMLMPMVRFALDPVLKSTG
FT                   KQDMVQVVSVDELTKEPQRFDFKINQVDAWYESEESRSAWVFKNGDEIVALSPICKHLG
FT                   CTVNWNSDPKNPNKFFCPCHYGLYEKDGTNVPGTPPLAPLDHYEQEVKDGFLYLGKAKP
FT                   KGEG"
FT   gene            complement(342294..342740)
FT                   /locus_tag="BSn5_01760"
FT   CDS_pept        complement(342294..342740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92986"
FT                   /protein_id="ADV92986.1"
FT                   /translation="MRWRITDAKDYLQAKDYIDTAVIPLINIRVNNHFKMAAEKGEFTQ
FT                   LLSEELERQLKGRVYLLPPYTYVDRNEITVQGLKDLREELITEFPHVVLLTSDESWRAE
FT                   DALGKMIVTPSVPLEHLNDSLKRKILDERTAEILNVLLQLWSTS"
FT   gene            complement(342795..343334)
FT                   /locus_tag="BSn5_01765"
FT   CDS_pept        complement(342795..343334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01765"
FT                   /product="hypothetical protein"
FT                   /note="COG5582 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01765"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92987"
FT                   /protein_id="ADV92987.1"
FT                   /translation="MQTPVSVNEKKDFIRWFLNHYQLKRRECVWILNYLMSHDSLMEKV
FT                   HFVEQAEFCPRGIIMSTHCVEEVPFRFYKENVMTTDAEKSFHDIRLNKQQDLFIQLNFR
FT                   SAYSSPEYAAVLESNPHIPKNLFENKKDQGLAEQILEHAISTFQREKLLKDIDDALDRH
FT                   DKEAFEQLSRQLNQLT"
FT   gene            complement(343406..344677)
FT                   /locus_tag="BSn5_01770"
FT   CDS_pept        complement(343406..344677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01770"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92988"
FT                   /protein_id="ADV92988.1"
FT                   /translation="MNTLIQEAIKLVEAGETEKGLNTLSKAEKQLHDEDKAIAAQLYYE
FT                   WGDVEKAISLISDLHDLYPNETELTNFYAELLIDIDEEEKALAVLETIPETDPSYPESL
FT                   LLMADLYQMQGLFEVSEQKLLQAKSILDNEPVIDFALGELYFAQGAYAKAVQYFKTTAE
FT                   EQSEIGGVNVHQRLAESLSASGEFEDAIPWYEKAVDENPDPNTIFGYGFTALQAGLVKT
FT                   AIKQLSDLKELDPSYTSLYMPLSKSYEAEGMYEEALKTAKEGIRYDEYNKELFLYAAKM
FT                   ALKIGKSEEGKKLLQEALVLDPGFVEALHTLLAVYHKEEDYDQIIDLIQEVRSYGEEDP
FT                   KYNWYLASAYTELEQYEEAKQSFEAAYLHYREDRDFLYEYASFLLEEGLQKEALPLLKK
FT                   VLEMDGANEELEETILRIEDEFSR"
FT   gene            complement(345012..346298)
FT                   /locus_tag="BSn5_01775"
FT   CDS_pept        complement(345012..346298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01775"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="COG0128 5-enolpyruvylshikimate-3-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01775"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92989"
FT                   /protein_id="ADV92989.1"
FT                   /translation="MKREKVQTLHGEIHIPGDKSISHRSVMFGALAAGTTTVKNFLPGA
FT                   DCLSTIDCFRKMGVHIEQSGSDVVIHGKGIDALKEPESLLDVGNSGTTIRLMLGILAGR
FT                   PFYSAVAGDESIAKRPMKRVTEPLKKMGAKIDGRAGGEFTPLSVSGASLKGIDYVSPVA
FT                   SAQIKSAVLLAGLQAEGTTTVTEPHKSRDHTERMLSAFGVKLSADQTSVSIAGGQKLTA
FT                   ADIFVPGDISSAAFFLAAGAMVPNSRIVLKNVGLNPTRTGIIDVLQNMGAKLEIKPSAD
FT                   SGAEPYGDLIIETSSLKAVEIGGDIIPRLIDEIPIIALLATQAKGTTVIKDAAELKVKE
FT                   TNRIDTVVSELRKLGAEIEPTADGMKVYGKQTLKGGAAVSSHGDHRIGMMLGIASCITE
FT                   EPIEIEHTDAIHVSYPTFFEHLNKLSKKS"
FT   gene            complement(346309..347424)
FT                   /locus_tag="BSn5_01780"
FT   CDS_pept        complement(346309..347424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01780"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="COG0287 Prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92990"
FT                   /protein_id="ADV92990.1"
FT                   /translation="MNQMKDTILLAGLGLIGGSIALAIKKNHPGKRIIGIDISDEQAVA
FT                   ALKLGVIDDRADSFISGAKEAATVIIATPVEQTLVMLEELAHSGIEHELLITDVGSTKQ
FT                   KVVDYADQVLPSRYQFVGGHPMAGSHKSGVAAAKEFLFENAFYILTPGQKTDKQAVEQL
FT                   KNLLKGTNAHFVEMSPEEHDGVTSVISHFPHIVAASLVHQTHHSENLYPLVKRFAAGGF
FT                   RDITRIASSSPAMWRDILLHNKDKILDRFDEWIREIDKIRTYVEQEDAENLFRYFKTAK
FT                   DYRDGLPLRQKGAIPAFYDLYVDVPDHPGVISEITAILAAERISITNIRIIETREDING
FT                   ILRISFQSDDDRKRAEQCIEARAEYETFYAD"
FT   gene            complement(347473..348555)
FT                   /locus_tag="BSn5_01785"
FT   CDS_pept        complement(347473..348555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01785"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /note="COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01785"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92991"
FT                   /protein_id="ADV92991.1"
FT                   /translation="MRIKEHLKQLKPYQPGKPIEAVKSEYGLDKVVKLASNENPYGCSE
FT                   AAKEALHHEIQQLALYPDGYSAALRTRLSKHLNVSETSLIFGNGSDEIIQIICRAFLND
FT                   KTNTVTAAPTFPQYKHNAVIEGAEVREIALRPDGSHDLDAMLEAIDEQTQVVWICSPNN
FT                   PTGTYTSEGELLAFLERVPSRVLVVLDEAYYEYVTAEDYPETVPLLSKYSNLMILRTFS
FT                   KAYGLAALRVGYGIADESLIRQIEPAREPFNTSRLGQAAAIAALDDQAFIASCVEQNNA
FT                   GLQQYYDFAKTHGLKCYPSQTNFVLIDFKRPADELFQALLEKGYIVRSGNALGFPTSLR
FT                   ITIGTKEQNEEILAILAEIL"
FT   gene            complement(348566..349369)
FT                   /gene="trpA"
FT                   /locus_tag="BSn5_01790"
FT   CDS_pept        complement(348566..349369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="BSn5_01790"
FT                   /product="tryptophan synthase subunit alpha"
FT                   /EC_number="4.2.1.20"
FT                   /note="COG0159 Tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92992"
FT                   /protein_id="ADV92992.1"
FT                   /translation="MFKLDLQPTEKLFIPFITAGDPVPEVSIELAKSLQKAGATALELG
FT                   VAYSDPLADGPVIQRASKRALDQGMNIVKAIELGGEMKKNGVNIPIILFTYYNPVLQLN
FT                   KEYFFALLRENHIDGLLVPDLPLEESNSLQEECKSHEVTYISLVAPTSESRLKTIIEQA
FT                   EGFVYCVSSLGVTGVRNEFNSSVYPFIRTVKNLSAVPVAVGFGISNREQVIKMNEISDG
FT                   VVVGSALVRKIEELKDRLISAETRNQALQEFEDYAMAFSGLYSLK"
FT   gene            complement(349362..350564)
FT                   /locus_tag="BSn5_01795"
FT   CDS_pept        complement(349362..350564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01795"
FT                   /product="tryptophan synthase subunit beta"
FT                   /EC_number="4.2.1.20"
FT                   /note="COG0133 Tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01795"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92993"
FT                   /protein_id="ADV92993.1"
FT                   /translation="MYPYPNEIGRYGDFGGKFVPETLMQPLDEIETAFKQIKDDPAFRE
FT                   EYYKLLKDYSGRPTALTYADRVTEYLGGAKIYLKREDLNHTGSHKINNALGQALLAKKM
FT                   GKTKIIAETGAGQHGVAAATVAAKFGFSCTVFMGEEDVARQSLNVFRMKLLGAEVVPVT
FT                   SGNGTLKDATNEAIRYWVQHCEDHFYMIGSVVGPHPYPQVVREFQKMIGEEAKDQLKRI
FT                   EGTLPDKVVACVGGGSNAMGMFQAFLNEDVELIGAEAAGKGIDTPLHAATISKGTVGVI
FT                   HGSLTYLIQDEFGQIIEPYSISAGLDYPGIGPEHAYLHKSGRVTYDSITDEEAVDALKL
FT                   LSEKEGILPAIESAHALAKAFKLAKGMDRGQLILVCLSGRGDKDVNTLMNVLEEEVKAH
FT                   V"
FT   gene            complement(350545..351192)
FT                   /locus_tag="BSn5_01800"
FT   CDS_pept        complement(350545..351192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01800"
FT                   /product="N-(5'-phosphoribosyl)anthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="COG0135 Phosphoribosylanthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92994"
FT                   /protein_id="ADV92994.1"
FT                   /translation="MKKPALKYCGIRSLKDLQLAAESQADYLGFIFAESKRKVSPQDVK
FT                   KWLNQARVEKQVAGVFVNESIETMSRIAKSLKLDVIQLHGDEKPADAAALRKLTGCEIW
FT                   KALHHQGNTTQEIARFKDNVDGFVIDSSVKGSRGGTGVAFSWECVPEYQQAAIGKRCFI
FT                   AGGVNPDSITSLLKWQPEGIDLASGIEKNGQKDQNLMSLLEERMNRYVSISE"
FT   gene            complement(351197..351949)
FT                   /gene="trpC"
FT                   /locus_tag="BSn5_01805"
FT   CDS_pept        complement(351197..351949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="BSn5_01805"
FT                   /product="indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="COG0134 Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01805"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92995"
FT                   /protein_id="ADV92995.1"
FT                   /translation="MLEKIIKQKKEEVKTLVLPVEQPFEKRSFKEALASPNRFIGLIAE
FT                   VKKASPSKGLIKEDFVPVQIAKDYEAAKADAISVLTDTPFFQGENSYLSDVKRAVSIPV
FT                   LRKDFIIDSLQVEESRRIGADAILLIGEVLDPLHLHELYLEAGEKGMDVLVEVHDASTL
FT                   EQILKVFTPDILGVNNRNLKTFETSVKQTEQIASLVPKESLLVSESGIGSLEHLTFVNE
FT                   HGARAVLIGESLMRQTSQRKAIHALFGE"
FT   gene            complement(351942..352958)
FT                   /gene="trpD"
FT                   /locus_tag="BSn5_01810"
FT   CDS_pept        complement(351942..352958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="BSn5_01810"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="COG0547 Anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92996"
FT                   /protein_id="ADV92996.1"
FT                   /translation="MNRFLQLCVDGKTLTAGEAETLMNMMMAAEMTPSEMGGILSILAH
FT                   RGETPEELAGFVKAMRAHALTVDGLPDIVDTCGTGGDGISTFNISTASAIVASAAGAKI
FT                   AKHGNRSVSSKSGSADVLEELEVSIQTTPEKVKSSIETNNMGFLFAPLYHSSMKHVAGT
FT                   RKELGFRTVFNLLGPLSNPLQAKRQVIGVYSVEKAGLMASALETFQPKHVMFVSSRDGL
FT                   DELSITAPTDVIELKDGERREYTVSPEDFGFTNGRLEDLQVQSPKESAYLIQNIFENKS
FT                   SSSALSITAFNAGAAIYTAGITASLKEGTELALETITSGGAAAQLERLKQKEEEIYA"
FT   gene            complement(352930..354477)
FT                   /locus_tag="BSn5_01815"
FT   CDS_pept        complement(352930..354477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01815"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="COG0147 Anthranilate/para-aminobenzoate synthases
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01815"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92997"
FT                   /protein_id="ADV92997.1"
FT                   /translation="MNFQSNISAFLEDSLSHHTIPIVETFTVDTLTPIQMIEKLDREIT
FT                   YLLESKDDTSTWSRYSFIGLNPFLTIKEEQGRFSAADQDSKSLYTGNELKEVLNWMNTT
FT                   YKIKTPQLGIPFVGGAVGYLSYDMIPLIEPSVPSHTKETNMEKCMLFVCRTLIAYDHET
FT                   KNVHFIQYARLNGEETKNEKMDVFHQNHLELQNLIEKMMDQKNIKELFLSADSYKTPSF
FT                   ETVSSNYEKSAFMADVEKIKSYIKAGDIFQGVLSQKFEVPIKADAFELYRVLRIVNPSP
FT                   YMYYMKLQDREIVGSSPERLIHVQDGHLEIHPIAGTRKRGADKAEDERLKVELMKDEKE
FT                   KAEHYMLVDLARNDIGRVAEYGSVSVPEFTKIVSFSHVMHIISVVTGQLKKGVHPVDAL
FT                   MSAFPAGTLTGAPKIRAMQLLQELEPTPRETYGGCIVYIGFDGNIDSCITIRTMSVKNG
FT                   VASIQAGAGIVADSVPEAEYEESCNKAGALLKTIHIAEDMFHSKEDKADEQISTIVR"
FT   gene            complement(354693..355076)
FT                   /locus_tag="BSn5_01820"
FT   CDS_pept        complement(354693..355076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01820"
FT                   /product="chorismate mutase"
FT                   /note="COG4401 Chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92998"
FT                   /protein_id="ADV92998.1"
FT                   /translation="MMIRGIRGATTVERDTKEEILQKTKQLLEKIIEENHTKPEDVVQM
FT                   LLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQI
FT                   RHVYLEKAVVLRPDLSLTKNTEL"
FT   gene            complement(355073..356161)
FT                   /gene="aroB"
FT                   /locus_tag="BSn5_01825"
FT   CDS_pept        complement(355073..356161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="BSn5_01825"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="COG0337 3-dehydroquinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01825"
FT                   /db_xref="EnsemblGenomes-Tr:ADV92999"
FT                   /protein_id="ADV92999.1"
FT                   /translation="MKTLHVQTASSSYPVFIGQGIRKKACELLTSLNRPLTRIMLVTDE
FT                   EVERLYGDEMLHLLQDKWPVKKVTVPSGEQAKSMDMYTKLQSEAIRFHLDRSSCIIAFG
FT                   GGVVGDLAGFVAATFMRGIDFIQMPTTLLAHDSAVGGKVAVNHPLGKNLIGAFYQPKAV
FT                   LYDTDFLRSLPEKELRSGMAEVIKHAFIYDRAFLEELLNIHSLRDITNDQLNDMIFKGI
FT                   SIKASVVQQDEKEEGIRAYLNFGHTLGHAVEAEYGYGQITHGDAVALGMQFALYISEKT
FT                   VGCEMDRKRLVSWLKSLGYPSQIRKETETSVLLDRMMNDKKTRGGKIQFIVLNELGKVA
FT                   DHTFSRNELESWLNKWRLEETS"
FT   gene            complement(356161..357333)
FT                   /locus_tag="BSn5_01830"
FT   CDS_pept        complement(356161..357333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01830"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="COG0082 Chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93000"
FT                   /protein_id="ADV93000.1"
FT                   /translation="MRYLTAGESHGPQLTTIIEGVPAGLYITEEDINFELARRQKGHGR
FT                   GRRMQIEKDQAKIMSGVRHARTLGSPIALVVENNDWKHWTKIMGAAPITEDEEKEMKRQ
FT                   ISRPRPGHADLNGAIKYNHRDMRNVLERSSARETTVRVAAGAVAKKILSELGIKVAGHV
FT                   LQIGTVKAEKTEYTSIEDLQRVTEESPVRCYDEEAGKKMMAAIDEAKANGDSIGGIVEV
FT                   IVEGMPVGVGSYVHYDRKLDSKLAAAVLSINAFKGVEFGIGFEAAGRNGSEVHDEIIWD
FT                   EEKGYTRATNRLGGLEGGMTTGMPIVVRGVMKPIPTLYKPLKSVDIETKEPFSASIERS
FT                   DSCAVPAASVVAEAAVAWEIANAVVEQFGLDQIDRIRENVENMRKLSREF"
FT   gene            complement(357408..358178)
FT                   /locus_tag="BSn5_01835"
FT   CDS_pept        complement(357408..358178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01835"
FT                   /product="methyl-accepting chemotaxis proteins (MCPs)
FT                   methyltransferase"
FT                   /note="COG1352 Methylase of chemotaxis methyl-accepting
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01835"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93001"
FT                   /protein_id="ADV93001.1"
FT                   /translation="MDTYSVFTTKWKQLTGVDLTLYKEAQMKRRLTSLYEKKGFQSFKD
FT                   FAAALEKDQALLNETLDRMTINVSEFYRNYKRWEVLETAILPLIKTSRPLKIWSAACST
FT                   GEEPYTLAMLLDQQKGLPGYQILATDIDEKALEKAKKGVYQERSLQEVPLSVKDRYFTQ
FT                   NANRSYEVKTEIKKNITFKKHNLLADRYEQDFDLIVCRNVFIYFTESAKEELYLKMAHS
FT                   LKKNGVLFVGSTEQIFNPEKFGLVPADTFFYQKR"
FT   gene            358305..358418
FT                   /locus_tag="BSn5_01840"
FT   CDS_pept        358305..358418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93002"
FT                   /protein_id="ADV93002.1"
FT                   /translation="MHTANQHFIHFNVNLYKTDQKPAALYDAGSVAYFHND"
FT   gene            complement(358415..358861)
FT                   /gene="ndk"
FT                   /locus_tag="BSn5_01845"
FT   CDS_pept        complement(358415..358861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="BSn5_01845"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="COG0105 Nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01845"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93003"
FT                   /protein_id="ADV93003.1"
FT                   /translation="MEKTFIMVKPDGVQRQLIGDILSRFERKGLQLAGAKLMRVTEQMA
FT                   EKHYAEHQGKPFFGELVEFITSGPVFAMVWEGENVIEVTRQLIGKTNPKEALPGTIRGD
FT                   YGMFVGKNIIHGSDSLESAEREINIFFKNEELVSYQQLMAGWIY"
FT   gene            complement(358980..359942)
FT                   /locus_tag="BSn5_01850"
FT   CDS_pept        complement(358980..359942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01850"
FT                   /product="heptaprenyl diphosphate synthase component II"
FT                   /note="COG0142 Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93004"
FT                   /protein_id="ADV93004.1"
FT                   /translation="MKFKMAYSFLNDDIDVIERELEQTVRSDYPLLSEAGLHLLQAGGK
FT                   RIRPVFVLLSGMFGDYDINKIKYVAVTLEMIHMASLVHDDVIDDAELRRGKPTIKAKWD
FT                   NRIAMYTGDYMLAGSLEMMTRINEPKAHRILSQTIVEVCLGEIEQIKDKYNMEQNLRTY
FT                   LRRIKRKTALLIAVSCQLGAIASGADEKIHKALYWFGYYVGMSYQIIDDILDFTSTEEE
FT                   LGKPVGGDLLQGNVTLPVLYALKNPALKNQLKLINSETTQEQLEPIIEEIKKTDAIEAS
FT                   MAVSEMYLQKAFQKLNTLPRGRARSSLAAIAKYIGKRKF"
FT   gene            complement(359968..360669)
FT                   /gene="ubiE"
FT                   /locus_tag="BSn5_01855"
FT   CDS_pept        complement(359968..360669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="BSn5_01855"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG2226 Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01855"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93005"
FT                   /protein_id="ADV93005.1"
FT                   /translation="MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNV
FT                   KEGAKALDVCCGTADWTIALAKAAGKSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLH
FT                   GNAMELPFDDDTFDYVTIGFGLRNVPDYLTVLKEMRRVVKPGGQVVCLETSQPEMFGFR
FT                   QAYFMYFKYIMPFFGKLFAKSYKEYSWLQESARDFPGMKELAGLFEEAGLKNVKYHSFT
FT                   GGVAATHIGWK"
FT   gene            complement(360676..361431)
FT                   /locus_tag="BSn5_01860"
FT   CDS_pept        complement(360676..361431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01860"
FT                   /product="heptaprenyl diphosphate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93006"
FT                   /protein_id="ADV93006.1"
FT                   /translation="MQDIYGTLANLNTKLKQKLSHPYLAKHISAPKIDEDKLLLFHALF
FT                   EEADIKNNDRENYIVTAMLVQSALDTHDEVTTARVIKRDENKNRQLTVLAGDYFSGLYY
FT                   SLLSEMKDIYMIRTLATAIKEINEHKIRLYDRSFKDENDFFESVGIVESALFHRVAEHF
FT                   NLPRWKKLSSDFFVFKRLMNGNDAFLDVIGSFIQLGKTKEEILEDCFKKAKNSIESLLP
FT                   LNSPIQNILINRLKTISQDQTYHQKVEEG"
FT   gene            complement(361595..361822)
FT                   /locus_tag="BSn5_01865"
FT   CDS_pept        complement(361595..361822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01865"
FT                   /product="transcription attenuation protein MtrB"
FT                   /note="COG3468 Type V secretory pathway, adhesin AidA"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01865"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93007"
FT                   /protein_id="ADV93007.1"
FT                   /translation="MNQKHSSDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVII
FT                   AQFTEHTSAIKVRGEALIQTAYGEMKSEKK"
FT   gene            complement(361844..362416)
FT                   /gene="folE"
FT                   /locus_tag="BSn5_01870"
FT   CDS_pept        complement(361844..362416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="BSn5_01870"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="COG0302 GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93008"
FT                   /protein_id="ADV93008.1"
FT                   /translation="MKEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFS
FT                   GLNEDPKEHFQTIFGENHEELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPRGGKVTGLS
FT                   KLARAVEAVAKRPQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKT
FT                   VTSAVRGVFKDDAAARAEVLEHIKRQD"
FT   gene            complement(362604..362882)
FT                   /locus_tag="BSn5_01875"
FT   CDS_pept        complement(362604..362882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01875"
FT                   /product="non-specific DNA-binding protein HBsu; signal
FT                   recognition particle-like (SRP) component"
FT                   /note="COG0776 Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01875"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93009"
FT                   /protein_id="ADV93009.1"
FT                   /translation="MNKTELINAVAEASELSKKDATKAVDSVFDTILDALKNGDKIQLI
FT                   GFGNFEVRERSARKGRNPQTGEEIEIPASKVPAFKPGKALKDAVAGK"
FT   gene            complement(363256..364734)
FT                   /locus_tag="BSn5_01880"
FT   CDS_pept        complement(363256..364734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01880"
FT                   /product="stage IV sporulation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93010"
FT                   /protein_id="ADV93010.1"
FT                   /translation="MEKVDIFKDIAERTGGDIYLGVVGAVRTGKSTFIKKFMELVVLPN
FT                   ISNEADRARAQDELPQSAAGKTIMTTEPKFVPNQAMSVHVSDGLDVNIRLVDCVGYTVP
FT                   GAKGYEDENGPRMINTPWYEEPIPFHEAAEIGTRKVIQEHSTIGVVITTDGTIGDIARS
FT                   DYIEAEERVIEELKEVGKPFIMVINSVRPYHPETEAMRQDLSEKYDIPVLAMSVESMRE
FT                   SDVLSVLREALYEFPVLEVNVNLPSWVMVLKENHWLRESYQESVKETVKDIKRLRDVDR
FT                   VVGQFSEFEFIESAGLAGIELGQGVAEIDLYAPDHLYDQILKEVVGVEIRGRDHLLELM
FT                   QDFAHAKTEYDQVSDALKMVKQTGYGIAAPALADMSLDEPEIIRQGSRFGVRLKAVAPS
FT                   IHMIKVDVESEFAPIIGTEKQSEELVRYLMQDFEDDPLSIWNSDIFGRSLSSIVREGIQ
FT                   AKLSLMPENARYKLKETLERIINEGSGGLIAIIL"
FT   gene            complement(364917..365651)
FT                   /locus_tag="BSn5_01885"
FT   CDS_pept        complement(364917..365651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01885"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01885"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93011"
FT                   /protein_id="ADV93011.1"
FT                   /translation="MGKLKCAIIFAAVVFLSGCLYPNERKSSVHAIPYQDQLKQVQSAV
FT                   DEFQKANGGLLPIQTKDMSTPLYQKYPIDFNRLAPRYIAEPPSTAFESGGDYQYVLVDV
FT                   ENDPTVKLIDLKMAEKIRDVKLRIQMYRQEHQYPPYKDVLSRDLFTLDEKKLGDGSSLT
FT                   VTSPISGNSLPLMIDGDGEIYADYRTELASCLKKSKKTFKPGTEIQDMIWQETPFVPAF
FT                   SVKYTVNDKQEPVFLENDMKKE"
FT   gene            complement(365673..365876)
FT                   /locus_tag="BSn5_01890"
FT   CDS_pept        complement(365673..365876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93012"
FT                   /protein_id="ADV93012.1"
FT                   /translation="MNLALMKMWFALGSMGLMFLAVASIYLSRFKCQNRFLKIAISSFA
FT                   YMCMLISGIIVFVVVFSGPVNE"
FT   gene            complement(366214..367251)
FT                   /gene="gpsA"
FT                   /locus_tag="BSn5_01895"
FT   CDS_pept        complement(366214..367251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="BSn5_01895"
FT                   /product="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /note="COG0240 Glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01895"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93013"
FT                   /protein_id="ADV93013.1"
FT                   /translation="MKKVTMLGAGSWGTALALVLTDNGNEVCVWAHRADLIHQINELHE
FT                   NKDYLPNVKLSTSIKGTTDMKEAVSDADVIIVAVPTKAIREVLRQAVPFITKKAVFVHV
FT                   SKGIEPDSLLRISEIMEIEIPSDVRKDIVVLSGPSHAEEVGLRHPTTVTASSKSMRAAE
FT                   EVQDLFINHNFRVYTNPDIIGVEIGGALKNIIALAAGITDGLGYGDNAKAALITRGLAE
FT                   IARLGTKMGGNPLTFSGLTGVGDLIVTCTSVHSRNWRAGNLLGKGYKLEDVLEEMGMVV
FT                   EGVRTTKAAYQLSKKYDVKMPITEALHQVLFNGQKVETAVESLMARGKTHEMEDLVNTF
FT                   ENQVK"
FT   gene            complement(367269..368579)
FT                   /locus_tag="BSn5_01900"
FT   CDS_pept        complement(367269..368579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01900"
FT                   /product="GTP-binding protein Der"
FT                   /note="COG1160 Predicted GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93014"
FT                   /protein_id="ADV93014.1"
FT                   /translation="MGKPVVAIVGRPNVGKSTIFNRIAGERISIVEDTPGVTRDRIYSS
FT                   AEWLNYDFNLIDTGGIDIGDEPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVA
FT                   KILYRTKKPVVLAVNKLDNTEMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHF
FT                   KNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNVAGTTRDAVDTSFTYNQ
FT                   QEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGY
FT                   AHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLM
FT                   PAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFV
FT                   NDPELMHFSYERFLENRIRDAFGFEGTPIKIFARARK"
FT   gene            complement(368733..368927)
FT                   /locus_tag="BSn5_01905"
FT   CDS_pept        complement(368733..368927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01905"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93015"
FT                   /protein_id="ADV93015.1"
FT                   /translation="MSESLTKVILSVITTNPNRVAGGAPVFFCNDQKEMELFAKNLEAI
FT                   LDGIAHRIGDDVYLIVKHF"
FT   gene            complement(368924..369817)
FT                   /locus_tag="BSn5_01910"
FT   CDS_pept        complement(368924..369817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93016"
FT                   /protein_id="ADV93016.1"
FT                   /translation="MSDYIYPIIAGVIAGIATRLYMLKTDYRQYPTYVHGKVIHIALGL
FT                   IAAGLGAIIMPALLQEEFTAITFLTLAATQFRDVRNMERNTLTQMDSYELVSRGSTYIE
FT                   GIAIAFESRNYIVIFTALLTTSAYVFLSIWAAVIAAVVCFLLAMKFMSGSVLKDIVDIE
FT                   YIKPRFDGPGLFVDNIYMMNIGLPEKQELILKHGMGFILTPKNFNSAATIANLGQRQAI
FT                   LFDVSNVLGVYRDSGEPSLTPIAKRDLNDGRVAVFVLPQIHHPETAVQIISNVPTLENA
FT                   IRMPTEFIKNQDKVIG"
FT   gene            complement(369814..370413)
FT                   /locus_tag="BSn5_01915"
FT   CDS_pept        complement(369814..370413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01915"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01915"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93017"
FT                   /protein_id="ADV93017.1"
FT                   /translation="MEQFYYYWSMWFLWVLTTFIFEKTKRRIAVSVFILTNIILSIHDI
FT                   ALYFSLNAAYLMFFVCGCVYAGYLGMYRFRYIMVYLTLVAAYAFVYLFALYDPVWFIIK
FT                   PEWAAVILIVLLTASVERNFEKQLVLFVLGMCQGELVYSFVIQKLAGAMAVGGFQWLNA
FT                   CSAGMILLFGISKYEHLASQIGQKSKRSNKGATKMS"
FT   gene            370491..370622
FT                   /locus_tag="BSn5_01920"
FT   CDS_pept        370491..370622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93018"
FT                   /protein_id="ADV93018.1"
FT                   /translation="MGKDRQEKKLKASGRVESDRDQSIHYDGATSLEQNGRFKKRKS"
FT   gene            complement(370665..371714)
FT                   /locus_tag="BSn5_01925"
FT   CDS_pept        complement(370665..371714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01925"
FT                   /product="isopentenyl pyrophosphate isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="COG1304 L-lactate dehydrogenase (FMN-dependent) and
FT                   related alpha-hydroxy acid dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01925"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93019"
FT                   /protein_id="ADV93019.1"
FT                   /translation="MTRAERKRQHINHALSTGQKRETGLDDITFVHVSLPDLALEQVDI
FT                   STKIGELSSSSPIFINAMTGGGGKLTYEINKSLARAASQAGIPLAVGSQMSALKDPSER
FT                   LSYEIVRKENPNGLIFANLGSEATAAQAKEAVEMIGANALQIHLNVIQEIVMPEGDRSF
FT                   SGALERIEQICSHVSVPVIVKEVGFGMSKESAGKLYEAGAAAVDIGGYGGTNFSKIENL
FT                   RRQRQISFFNSWGISTAASLAEIRSEFPASTMIASGGLQDALDVAKAIALGASCTGMAG
FT                   HFLKALTDSGEEGLLEEIQLILEELKMIMTVLGTRTIADLQKAPLVIKGETHHWLTERG
FT                   INTSSYSVR"
FT   gene            complement(371727..372875)
FT                   /gene="rpsA"
FT                   /locus_tag="BSn5_01930"
FT   CDS_pept        complement(371727..372875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="BSn5_01930"
FT                   /product="30S ribosomal protein S1"
FT                   /note="COG0539 Ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93020"
FT                   /protein_id="ADV93020.1"
FT                   /translation="MTEEMNQIDVQVPEVGDVVKGIVTKVEDKHVDVEIINVKQSGIIP
FT                   ISELSSLHVEKASDVVKVDDELDLKVTKVEDDALILSKRAVDADRAWEDLEKKFETKEV
FT                   FEAEVKDVVKGGLVVDIGVRGFIPASLVEAHFVEDFTDYKGKTLSLLVVELDRDKNRVI
FT                   LSHRAVVESEQANKKQELLQSLEVGSVLDGKVQRLTDFGAFVDIGGIDGLVHISQLSHS
FT                   HVEKPSDVVEEGQEVKVKVLSVDRDNERISLSIKDTLPGPWSQIGEKVKPGDVLEGTVQ
FT                   RLVSFGAFVEILPGVEGLVHISQISNKHIGTPHEVLEEGQTVKVKVLDVNENEERISLS
FT                   MRELEETPKADQEDYRQYQAKEETSTGFQLGDLIGDKLNKLK"
FT   gene            complement(373108..373782)
FT                   /gene="cmk"
FT                   /locus_tag="BSn5_01935"
FT   CDS_pept        complement(373108..373782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="BSn5_01935"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="COG0283 Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01935"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93021"
FT                   /protein_id="ADV93021.1"
FT                   /translation="MEKKLSIAIDGPAAAGKSTVAKIVAEKKSYIYIDTGAMYRAITYA
FT                   ALQENVDLTDEEKLAELLKRTDIELITTKDGQKVLVNGTDVTEAIRTDEVSNQVSIAAK
FT                   HRSVREEMVKRQQQLGEKGGVVMDGRDIGTHVLPNAEVKIFLLASVEERAKRRYEENVK
FT                   KGFDVNYETLIEEIARRDKLDSEREVSPLRKAEDALEIDTTSLSIQEVADKILEAVEQK
FT                   SR"
FT   gene            complement(373861..374037)
FT                   /locus_tag="BSn5_01940"
FT   CDS_pept        complement(373861..374037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93022"
FT                   /protein_id="ADV93022.1"
FT                   /translation="MKTFERLLIKLLFIQAIILLGVQFLFHYQHIEPYVSKVIQYEGVD
FT                   KMEENNRIETFKH"
FT   gene            complement(374082..374735)
FT                   /locus_tag="BSn5_01945"
FT   CDS_pept        complement(374082..374735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01945"
FT                   /product="putative cyclic diGMP binding protein"
FT                   /note="COG5581 Predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01945"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93023"
FT                   /protein_id="ADV93023.1"
FT                   /translation="MIEIGENVLLEYIEENELKKAKSKAVSIENNELLIAYPVDVVTGR
FT                   TVILHNDMEVTVEFVGKDEVPYRFISRIKGKVKDKLQMICLEVPPREKMKRIQRRQYVR
FT                   TDAVLDVQIQPGNEEEIRTLSYNISAGGIAVVLADGLSFQSGESLRLIIRLPEEEHTRQ
FT                   IETEAVVRRIFNDPKSEKRKMTLEYSEIAAGDQQALLQYCIRRQLNKRRKARME"
FT   gene            complement(374829..376181)
FT                   /locus_tag="BSn5_01950"
FT   CDS_pept        complement(374829..376181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01950"
FT                   /product="spore membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93024"
FT                   /protein_id="ADV93024.1"
FT                   /translation="MIRGILIAVLGIAIVGTGYWGYKEHQEKDAVLLHAENNYQRAFHE
FT                   LTYQMDQLHDKIGTTLAMNSQKSLSPALIDVWRITSEAHNSVSQLPLTLMPFNKTEELL
FT                   SKIGDFSYKTSVRDLDQKPLDKNEYTSLNKLYQQSEDIQNELRHVQHLVMSKNLRWMDV
FT                   EMALASDEKQSDNTIINSFKTVEKNVGAFSTGTDLGPSFTSTKKEEKGFSHLKGKQISE
FT                   QEAKQIAERFAPDDNYSIKVVKSGKKTNRDVYSISMKDPDHKAVIYMDITKKGGHPVYL
FT                   IQNREVKDQKISLNDGSNRALAFLKKNGFETDDLEIDESAQYDKIGVFSYVPVENKVRM
FT                   YPEAIRMKVALDDGEVVGFSARDFLTSHRKRTIPKPAITEAEAKSKLNKNIQVRETRLA
FT                   LITNELGQEVLCYEMLGTIENDTFRMYINAKDGSEEKVEKLKNAEPIYKDL"
FT   gene            complement(376216..377133)
FT                   /locus_tag="BSn5_01955"
FT   CDS_pept        complement(376216..377133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01955"
FT                   /product="spore cortex-lytic enzyme"
FT                   /note="COG3409 Putative peptidoglycan-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01955"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93025"
FT                   /protein_id="ADV93025.1"
FT                   /translation="MKSKGSIMACLILFSFTITTFINTETISAFSNQVIQRGATGDDVV
FT                   ELQARLQYNGYYNGKIDGVYGWGTYWAVRNFQDQFGLKEVDGLVGAKTKQTLICKSKYY
FT                   REYVMEQLNKGNTFTHYGKIPLKYQTKPSKAATQKARQQAEARQKQPAEKTTQQPKANA
FT                   NKQQNNTPAKARKQDAVAANMPGGFSNNDIRLLAQAVYGEARGEPYEGQVAIAAVILNR
FT                   LNSPLFPNSVAGVIFEPLAFTAVADGQIYMQPNETAREAVLDAINGWDPSEEALYYFNP
FT                   DTATSPWIWGRPQIKRIGKHIFCE"
FT   gene            complement(377272..377928)
FT                   /locus_tag="BSn5_01960"
FT   CDS_pept        complement(377272..377928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01960"
FT                   /product="protease required for RsiW anti-sigma(W)
FT                   degradation"
FT                   /note="COG2339 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93026"
FT                   /protein_id="ADV93026.1"
FT                   /translation="MFAIISAGIAPGIALLSYFYLKDQYDNEPVHMVLRSFFLGVVLVF
FT                   PIMFIQYVLEKENVGGGSFFVSFLSSGFLEESLKWFILMISVYPHAHFDEHYDGIVYGT
FT                   SVSLGFATLENILYLIGHGVEHAFVRALLPVSCHALIGVIMGFYLGKARFSADKARVKW
FT                   LTLSLVVPSLLHGSYDFILTALSNWIYYMLPFMVFLWWFGLRKAKKARSVNMMQV"
FT   gene            complement(378048..379022)
FT                   /locus_tag="BSn5_01965"
FT   CDS_pept        complement(378048..379022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01965"
FT                   /product="putative FAD-dependent disulfide oxidoreductase"
FT                   /note="COG0492 Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01965"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93027"
FT                   /protein_id="ADV93027.1"
FT                   /translation="MIQEKAIIIGGGPCGLSAAIHLKQIGIDALVIEKGNVVNSIYNYP
FT                   THQTFFSSSEKLEIGDVAFITENRKPVRIQALSYYREVVKRKNIRVNAFEMVRKVTKTQ
FT                   NNTFVIETSKETYTTPYCIIATGYYDHPNYMGVPGEDLPKVFHYFKEGHPYFDKDVVVI
FT                   GGKNSSVDAALELVKSGARVTVLYRGNEYSPSIKPWILPEFEALVRNGTIRMEFGACVE
FT                   KITEDEVVFRSGEKELITIKNDFVFAMTGYHPDHQFLEKIGVEIDKETGRPYFNEETME
FT                   TNVEGVFIAGVIAAGNNANEIFIENGRFHGGHIAAEIAKRENH"
FT   gene            complement(379131..380405)
FT                   /locus_tag="BSn5_01970"
FT   CDS_pept        complement(379131..380405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01970"
FT                   /product="cryptic glutamate dehydrogenase"
FT                   /note="COG0334 Glutamate dehydrogenase/leucine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93028"
FT                   /protein_id="ADV93028.1"
FT                   /translation="MAADRNTGHTEEDKLDVLKSTQTVIHKALEKLGYPEEVYELLKEP
FT                   MRLLTVKIPVRMDDGSVKIFTGYRAQHNDSVGPTKGGIRFHPNVTEKEVKALSIWMSLK
FT                   CGIIDLPYGGGKGGIVCDPRDMSFRELERLSRGYVRAISQIVGPTKDVPAPDVFTNSQI
FT                   MAWMMDEYSRIDEFNSPGFITGKPLVLGGSHGRESATAKGVTICIKEAAKKRGIDIKGA
FT                   RVVVQGFGNAGSYLAKFMHDAGAKVVGISDAYGGLYDPEGLDIDYLLDRRDSFGTVTKL
FT                   FNDTITNQELLELDCDILVPAAIENQITEENAHNIRAKIVVEAANGPTTLEGTKILSDR
FT                   DILLVPDVLASAGGVTVSYFEWVQNNQGFYWSEEEVEEKLEKMMVKSFNNIYEMANNRR
FT                   IDMRLAAYMVGVRKMAEASRFRGWI"
FT   gene            complement(380561..381145)
FT                   /locus_tag="BSn5_01975"
FT   CDS_pept        complement(380561..381145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01975"
FT                   /product="adaptor protein"
FT                   /note="COG4862 Negative regulator of genetic competence,
FT                   sporulation and motility"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01975"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93029"
FT                   /protein_id="ADV93029.1"
FT                   /translation="MRLERLNYNKIKIFLTLDDLTDRGLTKEDLWKDSFKVHQLFKDMM
FT                   NEANTELGFEANGPIAVEVYSLQAQGMVVIVTKNQDADSEDDEYDDDYIEMQVKLDESA
FT                   DIIYQFHSFEDIIQLSESLQRIGITGGTVYHYDGQYFLSLEDLGSHTAEGVVAVLAEYG
FT                   NPTTLTIYRLQEYGKLIMYGNAVETIQTHFS"
FT   gene            complement(381304..382083)
FT                   /locus_tag="BSn5_01980"
FT   CDS_pept        complement(381304..382083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01980"
FT                   /product="putative phosphoesterase"
FT                   /note="COG1408 Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93030"
FT                   /protein_id="ADV93030.1"
FT                   /translation="MKLSVKIAGVLTVAAAAMTAKMYATAKGNHLKTHTFPLSKMKGKP
FT                   PLTIFFISDIHKRLIDQDLLEKARSHAPHLVIIGGDLAEGGVPSARIEENIKRLVHFGV
FT                   PIVFVWGNNDYEVRQHKLYSIFKAHGVIALRNESVPFSYNGHTIAIAGVDDIRMEMDHY
FT                   EEAIKELDESQLNILVCHNPEIHEQINEDDGIDVIFSGHTHGGQIRFGKFGPYELGKTG
FT                   IVKNAAYLISNGYGTTKVPLRLGAEPETHIVTLCGPE"
FT   gene            complement(382170..382613)
FT                   /locus_tag="BSn5_01985"
FT   CDS_pept        complement(382170..382613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01985"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93031"
FT                   /protein_id="ADV93031.1"
FT                   /translation="MESLWNQLDQFTDAPTKQMLQALVKRKQKFENYAAQCRRWRWASL
FT                   ICLGLLCVMIMIKSPEPQLILQEILSHTFYLFWMLATAFAYCTSYYFKKKEEKSETDFH
FT                   KLRCEIIQKSTDLWPQPDKWKARESVFHMMKHKYDINLYFESK"
FT   gene            complement(382676..383404)
FT                   /locus_tag="BSn5_01990"
FT   CDS_pept        complement(382676..383404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01990"
FT                   /product="hypothetical protein"
FT                   /note="COG1388 FOG: LysM repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93032"
FT                   /protein_id="ADV93032.1"
FT                   /translation="MTNMSRVERRKAQNLYEDQNAALADDYVDDGESLPTRQSVKNQRE
FT                   QKKKQGKTKTPLFTVLAVIFVFVPVIVLVTLFYLKSHPDNHDDYEDVFIDSSQSKYEVV
FT                   PKSEDKNDTADTKETALQKESKKEPEDSKPKEPAKTADDKKQTAVAEKEDSANKEEATA
FT                   AAASSSQSTVQQQEQPAEPVQNVPNRVVKHTVQKKETLYRISMKYYKSRTGEEKIRAYN
FT                   HLNGNDVYTGQVLDIPLMDE"
FT   gene            complement(383355..383957)
FT                   /locus_tag="BSn5_01995"
FT   CDS_pept        complement(383355..383957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_01995"
FT                   /product="putative membrane protease"
FT                   /note="COG1266 Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_01995"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93033"
FT                   /protein_id="ADV93033.1"
FT                   /translation="MTDRDMLKQLYLTQLLIIFAAAAAGLFFFEDVRDVLKLWDIRDMR
FT                   IIWYGVSIAVIVILADMAVMKWFPSHLYDDGGINKKIFSKRSIPHIIFLTLLIAFAEEM
FT                   LFRGVLQTHIGLWAASLIFAALHFRYLSKWLLFIMVTAISFLLGLMYEWTGNLFVPMTA
FT                   HFIIDAVFACQIRFEHVRRDKHDEHVESREKKSPESL"
FT   gene            complement(383984..385474)
FT                   /locus_tag="BSn5_02000"
FT   CDS_pept        complement(383984..385474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02000"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="COG0514 Superfamily II DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93034"
FT                   /protein_id="ADV93034.1"
FT                   /translation="MTKLQQTLYQFFGFTSFKKGQQDIIESILSGKDTIAMLPTGGGKS
FT                   LCYQLPGYMLDGMVLIVSPLLSLMEDQVQQLKARGEKRAAALNSMLNRQERQFVLEHIH
FT                   RYKFLYLSPEALQSPYVLEKLKSVPISLFVIDEAHCISEWGHDFRPDYSKLGQLRKKLG
FT                   HPPVLALTATATKETLQDVMNLLELQHAVRHLNSVNRPNIALRVENAADTAEKIDRVIQ
FT                   LVENLQGPGIVYCPTRKWAEELAGEIKSKTSSRADFYHGGLESGDRILIQQQFIHNQLD
FT                   VICCTNAFGMGVDKPDIRYVIHFHLPQTAEAFMQEIGRAGRDGKPSVSILLRAPGDFEL
FT                   QEQIIQMESVTAEEIADVIRVLEKTEERDERRLRDVLLQYGVGETQARMMIHLFMQGKT
FT                   SVELMKKEISYRMELKLEKMHRVSFLLQRDGCLRQALLTYFDESYEPDDGNLPCCSHCG
FT                   FDLSLYEQKGERSKMAPLDSWSSELHRIFSLQTVGELN"
FT   gene            complement(385467..386525)
FT                   /locus_tag="BSn5_02005"
FT   CDS_pept        complement(385467..386525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02005"
FT                   /product="hypothetical protein"
FT                   /note="COG4955 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02005"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93035"
FT                   /protein_id="ADV93035.1"
FT                   /translation="MSLNYFDIMVLDCLCKINGERSGSAVFHLFKGKRSSQTIQDAGLF
FT                   QTAKYFGMAAKCSRSDISASLDKLEKHSYLAPMSESDTYKVTASGAAVLRHALSERPWP
FT                   VHCHGAHYQQAAGVLWKRLSLLVQVLSHKQQGSRQYIPVTKDHKTLHWVKKYLSRHTDH
FT                   IEMAKSLFAMLEAHLKKIENKAAQIFVYSLTSHHRIGYTSRQLADTLKEDEWYVYIMFW
FT                   ASVHYFIHSLPECEDALLKDLLSDVHLDNALTESTRKTWQMVKQGFPIQRIAEIRKLKT
FT                   ATIEDHIVEISLHEPAFMINDYVSAEDQLQIAEFAKRMRTNKIKQIRDGLEQRFSYFQI
FT                   RLALTKQVQQYD"
FT   gene            386791..387039
FT                   /locus_tag="BSn5_02010"
FT   CDS_pept        386791..387039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02010"
FT                   /product="ferredoxin"
FT                   /note="COG1141 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93036"
FT                   /protein_id="ADV93036.1"
FT                   /translation="MAKYTIVDKDTCIACGACGAAAPDIYDYDDEGIAFVTLDENKGVV
FT                   EVPEVLEEDMIDAFEGCPTDSIKVADEPFEGDPLKFE"
FT   gene            complement(387079..387651)
FT                   /locus_tag="BSn5_02015"
FT   CDS_pept        complement(387079..387651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02015"
FT                   /product="FMN permease"
FT                   /note="COG3601 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02015"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93037"
FT                   /protein_id="ADV93037.1"
FT                   /translation="MKVKKLVVVSMLSSIAFVLMLLNFPFPGLPDYLKIDFSDVPAIIA
FT                   ILIYGPLAGIAVEAIKNVLQYIIQGSMAGVPVGQVANFIAGTLFILPTAFLFKKLNSAK
FT                   GLAVSLLLGTAAMTILMSILNYVLILPAYTWFLHSPALSDSALKTAVVAGILPFNMIKG
FT                   IVITVVFSLIFIKLKPWIEQQRSAHIH"
FT   gene            complement(387757..387891)
FT                   /locus_tag="BSn5_02020"
FT   CDS_pept        complement(387757..387891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93038"
FT                   /protein_id="ADV93038.1"
FT                   /translation="MALSPRAVFTAGFGEIPEPTVQSGWEKMEVHKRFEIEFFKRFFA"
FT   gene            388148..389725
FT                   /locus_tag="BSn5_02025"
FT   CDS_pept        388148..389725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02025"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02025"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93039"
FT                   /protein_id="ADV93039.1"
FT                   /translation="MFRVLVSDKMSNDGLQPLIESDFIEIVQKNVADAEDELHTFDALL
FT                   VRSATKVTEDLFNKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTF
FT                   AMISSLMRHIPQANISVKSREWNRTAYVGSELYGKTLGIVGLGRIGSEIAQRARAFGMT
FT                   VHVFDPFLTEERAKKIGVNSRTFEEVLESADIITVHTPLTKETKGLLNKETIAKTKKGV
FT                   RLINCARGGIIDEAALLEALENGHVAGAALDVFEVEPPVDNKLVDHPLVIATPHLGAST
FT                   KEAQLNVAAQVSEEVLQFAKGLPVMSAINLPAMTKDEFAKIKPYHQIAGKIGSLVSQCM
FT                   KEPVQDVAIQYEGTIAKLETSFITKALLSGFLKPRVDSTVNEVNAGGVAKERGISFSEK
FT                   ISSSESGYDNCISVKVTGDRSTFTVTATYIPHFGERIVEINGFNIDFYPTGHLVYIQHQ
FT                   DTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIMMLSFDRHLEDKIVKELTNVPDIV
FT                   SVKLIDLP"
FT   gene            complement(389768..390535)
FT                   /gene="aroD"
FT                   /locus_tag="BSn5_02030"
FT   CDS_pept        complement(389768..390535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="BSn5_02030"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="COG0710 3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93040"
FT                   /protein_id="ADV93040.1"
FT                   /translation="MNVLTIKGVSIGEGMPKIIVPLMGKTEKQILNEAEAVKLLNPDIV
FT                   EWRVDVFEKANDREAVTKLISKLRKSLEDKLFLFTFRTHKEGGSMEMDESSYLALLESA
FT                   IQTKDIDLIDIELFSGDANVKALVSLAEENNVYVVMSNHDFEKTPVKDEILSRLRKMQD
FT                   LGAHIPKMAVMPNDTGDLLTLLDATYTMKTKYADRPIITMSMAATGLISRLSGEVFGSA
FT                   CTFGAGEEASAPGQIPVSELRSVLDILHKNTRG"
FT   gene            complement(390647..391750)
FT                   /locus_tag="BSn5_02035"
FT   CDS_pept        complement(390647..391750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02035"
FT                   /product="negative regulator of sigma(X) activity"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02035"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93041"
FT                   /protein_id="ADV93041.1"
FT                   /translation="MMKSEWNEEQIKELLSQLPAVKDHRSPQDIYKRLTMAKRKNKPAV
FT                   RWIGPACAAAIAVYIAFIISPHFFDQAQPQQKEASQENAVTKTETEDSPKAASSLDHTS
FT                   FVVPEKEQDNYITVAVADADTSAIIPVSIQKTNADQTIQDMLFESSELGILDHAITIPT
FT                   FIDEVEIKEKPKQKELSIRVHQPATAFSVKDDTLLKKLLKESLKWSPYEKVKFLSDQNE
FT                   TGVRIGSYGTFTEISIPKQSKRAYYLYKNKQGNFLIPSEKTFDTVKEAIKEMESSSQED
FT                   TTPLIQAGAVQSVTKKQKHLYIRFSKDSEVEDSIAGILMIEGLLLTAKEFGFTEVTFTE
FT                   TRTNKIGKYDVSDAIPVPAAPNPIFLN"
FT   gene            complement(391686..392270)
FT                   /locus_tag="BSn5_02040"
FT   CDS_pept        complement(391686..392270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02040"
FT                   /product="RNA polymerase sigma factor SigX"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93042"
FT                   /protein_id="ADV93042.1"
FT                   /translation="MEETFQLLYDTYHQDLYQFLFYMVKDKNQTEDLLQEVYIRVLNSY
FT                   HTFEGRSSEKTWLLSIARHVAIDWFRKQQTIRQRILGTFDWDTQDVRDQQLLPDELAVQ
FT                   HENVREIYAALDQCTIDQRAVIILRFIQGYSIQETAKALRFSESKVKTTQHRGLKVLRK
FT                   HMELLREELMDDEVRMERRTDKGVVKSTSGS"
FT   gene            complement(392474..394243)
FT                   /locus_tag="BSn5_02045"
FT   CDS_pept        complement(392474..394243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02045"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02045"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93043"
FT                   /protein_id="ADV93043.1"
FT                   /translation="MKFWKSVVGKLWFTILSLVLIVLFILTVLLLEFIENYHVEEAEND
FT                   LTQLANKVAVILENHEDQALARSITWELADNLTSIAIIQDEKNHWYSPNDKNRLSSITV
FT                   EQIQHDKDLNKALKDHKKVSKRTGLSDTDTDNERLIVGVPYEKDGKKGMVFLSQSLLAV
FT                   KDTTKHTTRYIFLAAGIAIVLTTFFAFFLSSRVTYPLRKMREGAQDLAKGKFDTKIPIL
FT                   TQDEIGELATAFNQMGRQLNFHINALNQEKEQLSNILSSMADGVITINIDGTILVTNPP
FT                   AERFLQAWYYEQNMNIKEGDNLPPEAKELFQNAVSTEKEQMIEMTLQGRSWVLLMSPLY
FT                   AESHVRGAVAVLRDMTEERRLDKLREDFIANVSHELRTPISMLQGYSEAIVDDIASSEE
FT                   DRKEIAQIIYDESLRMGRLVNDLLDLARMESGHTGLHYEKINVNEFLEKIIRKFSGVAK
FT                   EKNIALHHDISLTEEEFMFDEDKMEQVFTNLIDNALRHTSAGGSVSISVHSVKDGLKID
FT                   IKDSGSGIPEEDLPFIFERFYKADKARTRGRAGTGLGLAIVKNIVEAHNGSITVHSRID
FT                   KGTTFTFYIPTKR"
FT   gene            complement(394240..394962)
FT                   /locus_tag="BSn5_02050"
FT   CDS_pept        complement(394240..394962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02050"
FT                   /product="two-component response regulator"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93044"
FT                   /protein_id="ADV93044.1"
FT                   /translation="MDQTNETKILVVDDEARIRRLLRMYLERENYAIDEADNGDEAITK
FT                   GLEANYDLILLDLMMPGTDGIEVCRQIREKKATPIIMLTAKGEEANRVQGFEAGTDDYI
FT                   VKPFSPREVVLRVKALLRRASQTSYFNANTPTKNVLVFSHLSIDHDAHRVTADGTEVSL
FT                   TPKEYELLYFLAKTPDKVYDREKLLKEVWQYEFFGDLRTVDTHVKRLREKLNKVSPEAA
FT                   KKIVTVWGVGYKFEVGAE"
FT   gene            complement(395043..396218)
FT                   /locus_tag="BSn5_02055"
FT   CDS_pept        complement(395043..396218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02055"
FT                   /product="factor required for cytochrome c synthesis"
FT                   /note="COG0755 ABC-type transport system involved in
FT                   cytochrome c biogenesis, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02055"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93045"
FT                   /protein_id="ADV93045.1"
FT                   /translation="MAELSGNFLYAAFLVYLIAVPIFGGAIRGNKDKKGRPNRWANIGI
FT                   TLSIVGFFCHLGYFITRWAASGHAPVSNMFEFTTAFGMMLVLAFIILYFLYRLPSLGLF
FT                   TLSIALLLIAYASMFPTDISPLIPSLQSNWLYIHVTTAALGQAILAISFVAGVIFLLKH
FT                   VDQTKPSKKTFWLEAIMFILVTTVAFIAITSAFRLAGYEAEFNWVDKNKEKSVMVYEMP
FT                   ALVGPHQGELLTEGRMEPLVDLPALFSGRKVNTVIWSFGAGLVLYGALRLIIRKRISAL
FT                   LHPLVKNVNLDLVDEVGYRAVSIGFPIFTLGALIFAMIWAQLAWTRFWGWDPKEVWALI
FT                   TFLFYAAYLHLRLSRGWHGEKSAWLAVIGFAIIMFNLIFVNLVLAGLHSYA"
FT   gene            complement(396238..397866)
FT                   /locus_tag="BSn5_02060"
FT   CDS_pept        complement(396238..397866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02060"
FT                   /product="factor required for cytochrome c synthesis"
FT                   /note="COG1333 ResB protein required for cytochrome c
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93046"
FT                   /protein_id="ADV93046.1"
FT                   /translation="MKQVKCECGHINPVGTVLCESCGRALQETQPPLADMRYDGSARRS
FT                   QTYNKTIIDKIWNFFSSVKVGIWLIVITLAASAFGTIFPQEAYLPPGAQADTYYKEQYG
FT                   TFGQLYYLLGFHHLYGSWWYLLLIASIGISLVICSLDRVIPLYRALKNQGVRRSPAFLR
FT                   RQRLFSETVTVLNGESKEKIVTLLKKKHYRIREKEGSILAEKGRFSRWGPYVNHIGLII
FT                   FLIGAMLRFVPGMYVDETLWVREGETAAIPGTDGKYYLKNNQFSVETYNSKTEKKVFAD
FT                   AIDRVGDGRVAKNFQTDAVLYKREGKIVYGEKPKLEKVTEEDIRVNQPLRFDSFSVYQV
FT                   DYKENQLDQMVFQLIDKKTKKSFGSLKINLLDPDSVYDLGNGYKVEIASYLPDFYFNQD
FT                   GEPSTKTKIPNNPAFVFNIITPDKPKGEKSFVAIQETIEGSGNNKYKLKFDHVEMKNIT
FT                   GLTVRKDLTLWVLAVGGAIFMIGVIQGMYWQHRRIWLHSQDGAVMVAGHTNKNWFGLKK
FT                   DLAFILADSGLTEPVDQKELIKTQK"
FT   gene            complement(397863..398402)
FT                   /locus_tag="BSn5_02065"
FT   CDS_pept        complement(397863..398402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02065"
FT                   /product="thiol-disulfide oxidoreductase"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02065"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93047"
FT                   /protein_id="ADV93047.1"
FT                   /translation="MKKKRRLFIRTGILLVLICALGYTIYNAVFAGKESISEGSDAPNF
FT                   VLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVNVG
FT                   ESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTES
FT                   MIHDYMNLIKPGETSG"
FT   gene            complement(398497..399231)
FT                   /locus_tag="BSn5_02070"
FT   CDS_pept        complement(398497..399231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02070"
FT                   /product="pseudouridine synthase"
FT                   /note="COG1187 16S rRNA uridine-516 pseudouridylate
FT                   synthase and related pseudouridylate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93048"
FT                   /protein_id="ADV93048.1"
FT                   /translation="MERLQKVIAHAGVASRRKAEELIKEGKVKVNGKVVTELGVKVTGS
FT                   DQIEVNGLKVEREEPVYFLLYKPRGVISAAQDDKGRKVVTDFFKNIPQRIYPIGRLDYD
FT                   TSGLLLLTNDGEFANKLMHPKYEIDKTYVAKVKGIPPKELLRKLERGIRLEEGKTAPAK
FT                   AKLLSLDKKKQTSIIQLTIHEGRNRQVRRMFEAIGHEVIKLKREEYAFLNLRGLHTGDA
FT                   RELTPHEVKRLRALADHGKNAF"
FT   gene            complement(399323..399859)
FT                   /locus_tag="BSn5_02075"
FT   CDS_pept        complement(399323..399859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02075"
FT                   /product="spore maturation protein B"
FT                   /note="COG0700 Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02075"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93049"
FT                   /protein_id="ADV93049.1"
FT                   /translation="MEIINWLSLAMIPIIIAGILLYGTIKKVPTYESFVEGGKEGIEIA
FT                   FSIIPYLVGMLVAITVFRSSGALDFIMDLLKPAFSAIGIPAEVVPLALIRPISGTAALG
FT                   MTTDLIAVYGPDSFIGRLASVMQGSTDTTLYVLTVYFGAVGIKKMGDALKVGLLADLIG
FT                   VVASIIIVTLLFGSA"
FT   gene            complement(399864..400454)
FT                   /locus_tag="BSn5_02080"
FT   CDS_pept        complement(399864..400454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02080"
FT                   /product="spore maturation protein A"
FT                   /note="COG2715 Uncharacterized membrane protein, required
FT                   for spore maturation in B.subtilis."
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93050"
FT                   /protein_id="ADV93050.1"
FT                   /translation="MVNIIWVSLTVIGLVFAMCNGTLQDVNEAVFKGAKEAITISFGLM
FT                   SVLVFWLGLMKIAEQSGLLDIFSRMCRPFISKLFPDIPPDHPAMGYILSNLMANFFGLG
FT                   NAATPLGIKAMEQMKKLNGNRSEASRSMITFLAVNTSCITLIPTTVIAVRMAYSSKTPT
FT                   DIVGPSILATLISGIGAIIIDRYFYYRRKKKGR"
FT   gene            complement(400442..401590)
FT                   /locus_tag="BSn5_02085"
FT   CDS_pept        complement(400442..401590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02085"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="COG1686 D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02085"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93051"
FT                   /protein_id="ADV93051.1"
FT                   /translation="MRIFKKAVFVIMISFLIATVNVNTAHAAIDVSAKSAIIIDGASGR
FT                   VLYAKDEHQKRRIASITKIMTAVLAIESGKMDQTVTVSANAVRTEGSAIYLTEGQKVKL
FT                   KDLVYGLMLRSGNDAAVAIAEHVGGSLDGFVYMMNQKAEQLGMKNTRFQNPHGLDDHEN
FT                   HYSTAYDMAILTKYAMKLKDYQKISGTKIYKAETMESVWKNKNKLLTMLYPYSTGGKTG
FT                   YTKLAKRTLVSTASKDGIDLIAVTINDPNDWDDHMKMFNYVFEHYQTYLIAKKGDIPKL
FT                   KGTFYESKAFIKRDITYLLTEEEKENVKINTTLLKPKKAWEKDASKIPDIVGHMEIMFN
FT                   DATIAKVPIYYENERHQKPKKQFFETFKSIFLNAAGGAKWSI"
FT   gene            complement(401713..402252)
FT                   /locus_tag="BSn5_02090"
FT   CDS_pept        complement(401713..402252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93052"
FT                   /protein_id="ADV93052.1"
FT                   /translation="MKEAKCERQRHEGKIPNEMGHSIVRAQTQKTGEFLSMVVNTVNDY
FT                   LNQTTLESLQAELPIEKGYCCDVLSTLRRMAVFCEGGAEACRRLLMQEPFQEARAEKTL
FT                   YNVYHQCIEEFFMPKKDTWCENSRASYTGVSAIEFYHAVPASLEQLLLPLSAAFLKMRE
FT                   ELAHYEASGSSMAPIR"
FT   gene            complement(402307..402900)
FT                   /locus_tag="BSn5_02095"
FT   CDS_pept        complement(402307..402900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02095"
FT                   /product="chromosome condensation and segregation factor"
FT                   /note="COG1386 Predicted transcriptional regulator
FT                   containing the HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02095"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93053"
FT                   /protein_id="ADV93053.1"
FT                   /translation="MGLDIVNWKAIVEALLYAAGDEGLTKKQLLTVLEIEEPELNTVMA
FT                   DVADEYRGDTRGIELIEYADTYMLSTKKDFAPYLKKLIEVPSKGLSQASLEVLAIVSYK
FT                   QPITRAEIEEIRGVKSERILHSLVAKALLCEVGRADGPGRAILYGTTPTFLEQFGLKTL
FT                   DELPPLPENAEEDVLQEEADLFFENFNQTFEDIK"
FT   gene            complement(402890..403645)
FT                   /gene="scpA"
FT                   /locus_tag="BSn5_02100"
FT   CDS_pept        complement(402890..403645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpA"
FT                   /locus_tag="BSn5_02100"
FT                   /product="segregation and condensation protein A"
FT                   /note="COG1354 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93054"
FT                   /protein_id="ADV93054.1"
FT                   /translation="MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYV
FT                   HTMRVLELDMASEYLVMAATLLSIKSRMLLPKQEEELFEDELLEEEDPREELIEKLIEY
FT                   RKYKDAAKELKEREEERQKSFTKPPSDLSEYAKEVKQSEQKLSVTVYDMIGAFQKVLKR
FT                   KKINRPMETTITRQDIPIEARMNEIVHSLKSRGTRINFMDLFPYEQKEHLVVTFLAVLE
FT                   LMKNQLVLIEQEHNFSDIYITGSESIHGA"
FT   gene            403919..404443
FT                   /locus_tag="BSn5_02105"
FT   CDS_pept        403919..404443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02105"
FT                   /product="hypothetical protein"
FT                   /note="COG1547 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02105"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93055"
FT                   /protein_id="ADV93055.1"
FT                   /translation="MYPKAYIDYLVEFHATRDYFECHEILEEYWKEDPPKKRKRYWVGF
FT                   IQLAVALYHHRRQNTAGAKRLMANSIRILQAEHRAVEDLGLDHGRLLELMQSVYEQIET
FT                   GSAYKSIMLPIKDKKLEEACRIECRKKKYTWGQPSALSNIFLIDKHRLRDRTDVIRERE
FT                   KEIERRKKSRD"
FT   gene            complement(404457..404831)
FT                   /locus_tag="BSn5_02110"
FT   CDS_pept        complement(404457..404831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02110"
FT                   /product="putative acetyltransferase"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93056"
FT                   /protein_id="ADV93056.1"
FT                   /translation="MLIRYKKSFEKIAMGLLSFMPNEKDLKQLQQTIKDYETDTDRQLF
FT                   LWKEDEDIVGAIGVEKKDSEVEIRHISVNPSHRHQGIGKQMMDALKHLFKTQVLVPNEL
FT                   TQSFFERCQGQQDQDISYNN"
FT   gene            complement(404944..405408)
FT                   /gene="ribH"
FT                   /locus_tag="BSn5_02115"
FT   CDS_pept        complement(404944..405408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="BSn5_02115"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /note="COG0054 Riboflavin synthase beta-chain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02115"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93057"
FT                   /protein_id="ADV93057.1"
FT                   /translation="MNIIQGNLVGTGLKIGIVVGRFNDFITSKLLSGAEDALLRHGVDT
FT                   NDIDVAWVPGAFEIPFAAKKMAETKKYDAIITLGTVIRGATTHYDYVCNEAAKGIAQAA
FT                   NTTGVPVIFGIVTTENIEQAIERAGTKAGNKGVDCAVSAIEMANLNRSFE"
FT   gene            complement(405441..406637)
FT                   /locus_tag="BSn5_02120"
FT   CDS_pept        complement(405441..406637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02120"
FT                   /product="bifunctional 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase/GTP cyclohydrolase II protein"
FT                   /EC_number="4.1.99.12"
FT                   /note="COG0108 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93058"
FT                   /protein_id="ADV93058.1"
FT                   /translation="MFHPIEEALDALKKGEVIIVVDDEDRENEGDFVALAEHATPEVIN
FT                   FMATHGRGLICTPLSEEIADRLDLHPMVEHNTDSHHTAFTVSIDHRETKTGISAQERSF
FT                   TVQALLDSTSVPSDFQRPGHIFPLIAKKGGVLKRAGHTEAAVDLAEACGSPGAGVICEI
FT                   MNEDGTMARVPELIEIAKKHQLKMITIKDLIQYRYNLTTLVEREVDITLPTDFGTFKVY
FT                   GYTNEVDGKEHVAFVMGDVPFGEEPVLVRVHSECLTGDVFGSHRCDCGPQLHAALNQIA
FT                   ADGRGVLLYLRQEGRGIGLINKLKAYKLQEQGYDTVEANEALGFLPDLRNYGIGAQILR
FT                   DLGVRNMKLLTNNPRKIAGLEGYGLSISERVPLQMEAKEHNKKYLQTKMNKLGHLLHF"
FT   gene            complement(406652..407299)
FT                   /locus_tag="BSn5_02125"
FT   CDS_pept        complement(406652..407299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02125"
FT                   /product="riboflavin synthase subunit alpha"
FT                   /EC_number="2.5.1.9"
FT                   /note="COG0307 Riboflavin synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02125"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93059"
FT                   /protein_id="ADV93059.1"
FT                   /translation="MFTGIIEETGTIESMKKAGHSMALTIKCSKILEDVHLGDSIAVNG
FT                   ICLTVTDFTKNQFTVDVMPETVKATSLNDLTKGSKVNLERAMAANGRFGGHFVSGHVDG
FT                   TAEITRIEEKSNAVYYDLKMDPSLTKTLVLKGSITVDGVSLTIFGLTEDTVTISLIPHT
FT                   ISETIFSEKTIGSKVNIECDMIGKYMYRFLHKANENKTQQTITKAFLSENGF"
FT   gene            complement(407310..408395)
FT                   /locus_tag="BSn5_02130"
FT   CDS_pept        complement(407310..408395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02130"
FT                   /product="fused diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase; 5-amino-6-(5-phosphoribosylamino) uracil
FT                   reductase"
FT                   /note="COG0117 Pyrimidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93060"
FT                   /protein_id="ADV93060.1"
FT                   /translation="MEEYYMKLALDLAKQGEGQTESNPLVGAVVVKDGQIVGMGAHLKY
FT                   GEAHAEVHAIHMAGAHAEGADIYVTLEPCSHYGKTPPCAELIINSGIKRVFVAMRDPNP
FT                   LVAGRGISMIKEAGIEVREGILADQAERLNEKFLHFMRTGLPYVTLKAAASLDGKIATS
FT                   TGDSKWITSEAARQDAQQYRKTHQSILVGVGTVKADNPSLTCRLPNVTKQPVRVILDTV
FT                   LSIPEDAKVICDQIAPTWIFTTARADEEKKKRLSAFGVNIFTLETERIQIPDVLKILAE
FT                   EGIMSVYVEGGSAVHGSFVKEGCFQEIIFYFAPKLIGGTHAPSLISGEGFQSMKDVPLL
FT                   QFTDITQIGRDIKLTAKPTKE"
FT   gene            complement(408789..409133)
FT                   /locus_tag="BSn5_02135"
FT   CDS_pept        complement(408789..409133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02135"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93061"
FT                   /protein_id="ADV93061.1"
FT                   /translation="MGRIKTKITILLVLLLLLAGGYMYINDVELKDVPTAIGQTLSSEE
FT                   EEYTIQEYKVTKIDGSEYHGVAENGTKIIFNGKKLNQDLSDIKEGDKIKAYFSKSKRID
FT                   GLIKVAKVND"
FT   gene            complement(409368..409922)
FT                   /locus_tag="BSn5_02140"
FT   CDS_pept        complement(409368..409922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02140"
FT                   /product="type I signal peptidase"
FT                   /note="COG0681 Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93062"
FT                   /protein_id="ADV93062.1"
FT                   /translation="MKSENVSKKKTILEWAKAIVIAVVLALLIRNFIFAPYVVDGDSMY
FT                   PTLHNRERVFVNMTVKYIGEFDRGDIVVLNGDDVHYVKRIIGLPGDTVEMKNDQLYING
FT                   KKVDEPYLAANKKRAKQDGFDHLTDDFGPVKVPDNKYFVMGDNRRNSMDSRNGLGLFTK
FT                   KQIAGTSKFVFYPFNEMRKTN"
FT   gene            complement(410349..410555)
FT                   /locus_tag="BSn5_02145"
FT   CDS_pept        complement(410349..410555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02145"
FT                   /product="hypothetical protein"
FT                   /note="COG3478 Predicted nucleic-acid-binding protein
FT                   containing a Zn-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02145"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93063"
FT                   /protein_id="ADV93063.1"
FT                   /translation="MNNKGCIKCGSTEAGQKEIATTVTGLSKLFDVQHNRFLVVYCKNC
FT                   GYSEFYNKESSTAGNILDLFFGG"
FT   gene            410725..410937
FT                   /locus_tag="BSn5_02150"
FT   CDS_pept        410725..410937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93064"
FT                   /protein_id="ADV93064.1"
FT                   /translation="MIDYPININNVSGNSVINVGGAFMIRPLTLSKSVFGSGGLNTGIV
FT                   FENNFVSKAKMINHQFTDQNVTKTF"
FT   gene            complement(411073..411243)
FT                   /locus_tag="BSn5_02155"
FT   CDS_pept        complement(411073..411243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02155"
FT                   /product="Resolvase domain protein"
FT                   /note="COG0652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02155"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93065"
FT                   /protein_id="ADV93065.1"
FT                   /translation="MAHAGKDTGGSQFFIVHEPQPHLNGVHTVFGKVTSGLEFAKNMSN
FT                   GDVMKEVRVEG"
FT   gene            411297..411725
FT                   /locus_tag="BSn5_02160"
FT   CDS_pept        411297..411725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93066"
FT                   /protein_id="ADV93066.1"
FT                   /translation="MCILGRQYQYSNDQGIITGSIDGNAEFLGGKLHSEYALYSDVPQM
FT                   AKGTYVGDGTISKQILLPFTPTLVKVYPLSMEDSVLLIDIDNGGHTYQVNELGISLVGG
FT                   ISTYGSINELGFLTGSDSNQRGNKLNTKYIWEAYRYVH"
FT   gene            411814..412722
FT                   /locus_tag="BSn5_02165"
FT   CDS_pept        411814..412722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02165"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93067"
FT                   /protein_id="ADV93067.1"
FT                   /translation="MNTSSLQSQINIHSRPLQDAMKAASKIQLELIEAYKKQNPALNTI
FT                   IYSAITPPLEHKQLATLQSAINQVRTVLSSNEKNAQLLKSTMIKLGNINNAQLSYTLNQ
FT                   LRTVFKDQAILNSSLYVTNEEISSEIVSEIDEISDYVEETVIALTNNDGITRQNYFEGL
FT                   NRLWNTVLYFISKHSTALLLLANLIYTDLISPINQALTSKYIIDEFIEKKPETVSEAKN
FT                   VLKDIPMNKELKTNYRMVIKDTLVVRTRPKTNSNVAYVLDKSSIVFVEEKKKNWSKVLF
FT                   RNEAGEDQSGWVYTRYIKKLD"
FT   gene            complement(412828..413019)
FT                   /locus_tag="BSn5_02170"
FT   CDS_pept        complement(412828..413019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93068"
FT                   /protein_id="ADV93068.1"
FT                   /translation="MQQEKTTAINRVIKRYILLFLVLCACYFVYMGVLGNKFTLIPLII
FT                   FIVGSVIGELIRIARIKR"
FT   gene            complement(413037..413720)
FT                   /locus_tag="BSn5_02175"
FT   CDS_pept        complement(413037..413720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02175"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93069"
FT                   /protein_id="ADV93069.1"
FT                   /translation="MKKIKSLFLMFLVIAMFIGILPDIKAKADSEDVLDTSSPVLSDIE
FT                   GKEELEINGEKYTYTYDFTDPAVNRVNVTDESGVEIKFEYDTKTNTLYKNNELDFNLVK
FT                   EEDGIISPSDASTMKIPPGGKYMGKYNYKYNLKGVSVGVATAAIAAVSKAPYNVILSIV
FT                   SFLAGTQTTAYYTVFQYRYAFKCNAYPYANRTKFYEDSSRKKVLRTADSAKFFGSRPTP
FT                   ASCQP"
FT   gene            complement(414105..414374)
FT                   /locus_tag="BSn5_02180"
FT   CDS_pept        complement(414105..414374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93070"
FT                   /protein_id="ADV93070.1"
FT                   /translation="MNNEIYEIVEKINNLNNKEQLELLDLMMGFLQQTVLDKESLDSAR
FT                   VIQMFNTLLKEINREYTPEEVEKMYLLRDMLGLKQALINSIKTV"
FT   gene            complement(414508..414939)
FT                   /locus_tag="BSn5_02185"
FT   CDS_pept        complement(414508..414939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02185"
FT                   /product="peptidyl-prolyl isomerase"
FT                   /note="COG0652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02185"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93071"
FT                   /protein_id="ADV93071.1"
FT                   /translation="MKTGYFLLEDGNKIEFELYPEAAPGTVANFEKLANEGFYDGLTFH
FT                   RVIPGFVSQGGCPHGTGTGGPGYTIKCETEGNPHAHEAGALSMAHAGKDTGGSQFFIVH
FT                   EPQPHLNGVHTVFGKVTSGLEFAKNMSNGDVMKEVRVEG"
FT   gene            415130..416068
FT                   /locus_tag="BSn5_02190"
FT   CDS_pept        415130..416068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02190"
FT                   /product="hypothetical protein"
FT                   /note="COG4086 Predicted secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93072"
FT                   /protein_id="ADV93072.1"
FT                   /translation="MIQVLTKQHYPAACEIEGGQTALKKIWIGMLATAVLLLTVPKVSL
FT                   ADAAVGDVIVTLGADLSESDKQKVLDEMNVPDNATTVTVTNKEEHEYLGKYISNAQIGS
FT                   RAISSSSITIAKKGSGLNVETHNISGITDEMYLNALMTAGVKDAKVYVTAPFEVSGTAA
FT                   LTGLIKAYEVSSDEAISEDVKQVANQELVTTSELGDKIGNENAAALIAKIKEEFAKNGV
FT                   PDNKADIEKQVDDAASDLNVTLTDSQKNQLVSLFNKMKNADIDWGQVSDQLDKAKDKIT
FT                   KFIESDEGKNFIQKVIDFFVSIWNAIVSIFK"
FT   gene            complement(416098..417417)
FT                   /locus_tag="BSn5_02195"
FT   CDS_pept        complement(416098..417417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02195"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="COG0019 Diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02195"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93073"
FT                   /protein_id="ADV93073.1"
FT                   /translation="MFLHGTSRQNQHGHLEIGGVDALYLAEKYGTPLYVYDVALIRERA
FT                   KSFKQAFISAGLKAQVAYASKAFSSVAMIQLAEEEGLSLDVVSGGELYTAVAAGFPAER
FT                   IHFHGNNKSREELRMALEHRIGCIVVDNFYEIALLEDLCKETGHSIDVLLRITPGVEAH
FT                   THDYITTGQEDSKFGFDLHNGQTERAIEQVLQSEHIQLLGVHCHIGSQIFDTAGFVLAA
FT                   EKIFKKLDEWRDSYSFVSKVLNLGGGFGIRYTEDDEPLHATEYVEKIIEAVKENASRYG
FT                   FDIPEIWIEPGRSLVGDAGTTLYTVGSQKEVPGVRQYVAVDGGMNDNIRPALYQAKYEA
FT                   AAANRIGEAHDKTVSIAGKCCESGDMLIWDIDLPEVKEGDLLAVFCTGAYGYSMANNYN
FT                   RIPRPAVVFVENGEAHLVVKRETYEDIVKLDLPFKTGVKQ"
FT   gene            complement(417523..419004)
FT                   /locus_tag="BSn5_02200"
FT   CDS_pept        complement(417523..419004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02200"
FT                   /product="stage V sporulation protein AF"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93074"
FT                   /protein_id="ADV93074.1"
FT                   /translation="MPDHKEEKIRVYRNPAKNEEYFKNRVGMGTSYDVGVRKLTILDKE
FT                   IQLYYLNGLCDTAYIIHLMRELVAINNRKEDPDELVDIVENRLLNAQVEKVKTLDETTD
FT                   QVLSGLVAVIVEGAGFAFIIDVRSYPGRNPEEPDTEKVVRGARDGFVENIVVNTALLRR
FT                   RIRDERLRVKMTKVGERSKTDLSICYIEDIADPDLVEIVEKEIASIDVDGLTMADKTVE
FT                   EFIVNQSYNPFPLVRYTERPDVAANHVLEGHVIIIVDTSPSVIITPTTLFHHVQHAEEY
FT                   RQAPSVGTFLRWVRFFGILASTLFLPIWFLFVLQPDLLPDNMKFIGLNKDTHIPIILQI
FT                   FLADLGIEFLRMAAIHTPTALSTAMGLIAAVLIGQIAIEVGLFSPEVILYVSLAAIGTF
FT                   TTPSYELSLANKMSRLVLMILVALFHIKGLVIGFTVLIIAMASIKSLQTPYLWPLIPFN
FT                   GKALWQVLVRTAKPGAKVRPSIVHPKNRLRQPTNS"
FT   gene            complement(418955..419566)
FT                   /locus_tag="BSn5_02205"
FT   CDS_pept        complement(418955..419566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02205"
FT                   /product="stage V sporulation protein AE"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02205"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93075"
FT                   /protein_id="ADV93075.1"
FT                   /translation="MTTKRKVILVTDGDVYAAKTIEYAASKVGGRCISQSKGNPSTRSG
FT                   AELVKLIASAPYDPVFVMFDDSGLQGEGPGEAALTYVATHPSIEVLGVIAVASKTHQAE
FT                   WTRVDVSIDRNGEITEYGVDKVGEREFDDHRMSGDTVYCLDKLDLPLIVGIGDIGKMGR
FT                   KDDISKGSPITMKAVEFILERSGYHAGPQGRENSGLSESS"
FT   gene            complement(419574..419924)
FT                   /locus_tag="BSn5_02210"
FT   CDS_pept        complement(419574..419924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02210"
FT                   /product="stage V sporulation protein AE"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93076"
FT                   /protein_id="ADV93076.1"
FT                   /translation="MDYLLAFVCGGAICIVGQLLLDIFKLTPAHVMTSFVVIGAILDGF
FT                   GIYDKFIEFAGGGATVPIVSFGHSLLHGAMHQAHIHGFIGIGMGIFELTSAGISAAILF
FT                   AFIVAVIFKPKG"
FT   gene            complement(419926..420942)
FT                   /locus_tag="BSn5_02215"
FT   CDS_pept        complement(419926..420942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02215"
FT                   /product="stage V sporulation protein AD"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02215"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93077"
FT                   /protein_id="ADV93077.1"
FT                   /translation="MKLTGKQTWVFEHPIFVNSAGTAAGPKEKDGPLGSLFDKTYDEMH
FT                   CNQKSWEMAERQLMEDAVNVALQKNNLTKDDIDLLLAGDLLNQNVTANYVARHLKIPFL
FT                   CMFGACSTSMETVAVASALVDGGFAKRALAATSSHNATAERQFRYPTEYGGQKPDTATS
FT                   TVTGSGAVVISQTPGDIQITSATVGKVSDLGITDPFDMGSAMAPAAADTIKQHFKDLNR
FT                   TADDYDLILTGDLSGVGSPIVKDILKEDGYPVGTKHDDCGLLIYTPDQQVFAGGSGCAC
FT                   SAVVTYSHIFKQLREGKLNRVFVVATGALLSPTMIQQKETIPTIAHGVVFERAGGAS"
FT   gene            complement(420955..421407)
FT                   /locus_tag="BSn5_02220"
FT   CDS_pept        complement(420955..421407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02220"
FT                   /product="stage V sporulation protein AC"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93078"
FT                   /protein_id="ADV93078.1"
FT                   /translation="MTNIKENYKSKVKTYQPKPPYVWNCVKAFLVGGLICAIGQGLQNF
FT                   YIHFFDFNEKTAGNPTAATLILISALLTGFGIYDRIGQFAGAGSAVPVTGFANSMASAA
FT                   LEYKSEGLVLGVATNMFKLAGNVIVFGVVAAYIVGMIRFAFEKLMS"
FT   gene            complement(421420..421845)
FT                   /locus_tag="BSn5_02225"
FT   CDS_pept        complement(421420..421845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02225"
FT                   /product="stage V sporulation protein AB"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02225"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93079"
FT                   /protein_id="ADV93079.1"
FT                   /translation="MIVSVLFIIFVGLGGGITVGAGFVAFLTVMGIIPRLMQLTKTMRF
FT                   VQAYEAAVILGAVCGGWETLHMNHLYLTKWIAVPVGLLAGLFVGMLAAALTEVLNVLPI
FT                   LAKRIGLRSKIIILLMAIVIGKIAGSLFHWLYFIDHS"
FT   gene            complement(421835..422455)
FT                   /locus_tag="BSn5_02230"
FT   CDS_pept        complement(421835..422455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02230"
FT                   /product="stage V sporulation protein AA"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93080"
FT                   /protein_id="ADV93080.1"
FT                   /translation="MERRIFIRLRHRVLAHPGDIITVGDAAQIEGQLQLKKKLSAMPLY
FT                   QVSEKDKNIVILDIIQVLRAIHLQDPTLDVQTVGGAETIVEIQYRKRNLSTVLFIGVWL
FT                   LLFIGSCLAIMNFHEDVSMRDVHIALYEIITGERNDYPYLLQIPYSIGLGLGMIVFFNH
FT                   IFKKRLNEEPSPLEVEMFNYQLDLDQYVAMHENQETIKDLHDR"
FT   gene            complement(422582..423349)
FT                   /locus_tag="BSn5_02235"
FT   CDS_pept        complement(422582..423349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02235"
FT                   /product="sporulation sigma factor SigF"
FT                   /note="COG1191 DNA-directed RNA polymerase specialized
FT                   sigma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02235"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93081"
FT                   /protein_id="ADV93081.1"
FT                   /translation="MDVEVKKNGKNAQLKDHEVKELIKQSQNGDQQARDLLIEKNMRLV
FT                   WSVVQRFLNRGYEPDDLFQIGCIGLLKSVDKFDLTYDVRFSTYAVPMIIGEIQRFIRDD
FT                   GTVKVSRSLKELGNKIRRAKDELSKTLGRVPTVQEIADHLEIEAEDVVLAQEAVRAPSS
FT                   IHETVYENDGDPITLLDQIADNSEEKWFDKIALKEAISDLEEREKLIVYLRYYKDQTQS
FT                   EVAERLGISQVQVSRLEKKILKQIKVQMDHTDG"
FT   gene            complement(423361..423801)
FT                   /locus_tag="BSn5_02240"
FT   CDS_pept        complement(423361..423801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02240"
FT                   /product="anti-sigma F factor"
FT                   /EC_number="2.7.11.1"
FT                   /note="COG2172 Anti-sigma regulatory factor (Ser/Thr
FT                   protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93082"
FT                   /protein_id="ADV93082.1"
FT                   /translation="MKNEMHLEFSALSQNESFARVTVASFIAQLDPTMDELTEIKTVVS
FT                   EAVTNAIIHGYEENCEGKVYISVTLEDHVVYMTIRDEGLGITDLEEARQPLFTTKPELE
FT                   RSGMGFTIMENFMDDVSIDSSPEMGTTIRLTKHLSKSKALCN"
FT   gene            complement(423798..424151)
FT                   /locus_tag="BSn5_02245"
FT   CDS_pept        complement(423798..424151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02245"
FT                   /product="anti-sigma F factor antagonist"
FT                   /note="COG1366 Anti-anti-sigma regulatory factor
FT                   (antagonist of anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02245"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93083"
FT                   /protein_id="ADV93083.1"
FT                   /translation="MSLGIDMNVKESVLCIRLTGELDHHTAETLKQKVTQSLEKDDIRH
FT                   IVLNLEDLSFMDSSGLGVILGRYKQIKQIGGEMVVCAISPAVKRLFDMSGLFKIIRFEQ
FT                   SEQQALLTLGVAS"
FT   gene            complement(424247..425416)
FT                   /locus_tag="BSn5_02250"
FT   CDS_pept        complement(424247..425416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02250"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="COG1686 D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93084"
FT                   /protein_id="ADV93084.1"
FT                   /translation="MKRLLSTLLIGIMLLTFAPSAFAKQDGKRTSELAHEAKSAVLIER
FT                   DTGKVLYNKNSNERLAPASMTKIMTMLLIMEALDKGKIKMSDKVRTSEHAASMGGSQIF
FT                   LEPGEEMTVKEMLKGIAIASGNDASVAMAEFISGSEEEFVQKMNKKAKELGLKNTSFKN
FT                   PTGLTEEGHYSSAYDMAIMAKELLKYESITKFTGTYEDYLRENTDKKFWLVNTNRLIKF
FT                   YPGVDGVKTGYTGEAKYCLTASAKKGNMRAIAVVFGASTPKERNAQVTKMLDFAFSQYE
FT                   THPLYKRNQTVAKVKVKKGKQKFIELTTSEPISILTKKGEDMNDVKKEIKMKDNISAPI
FT                   QKGQELGTLVLKKDGEVLAESPVAAKEDMKKAGFITFLKRTMGDWTKFK"
FT   gene            complement(425571..426386)
FT                   /locus_tag="BSn5_02255"
FT   CDS_pept        complement(425571..426386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02255"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.-"
FT                   /note="COG0005 Purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02255"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93085"
FT                   /protein_id="ADV93085.1"
FT                   /translation="MKDRIERAAAFIKQNLPESPKIGLILGSGLGILADEIENPVKLKY
FT                   EDIPEFPVSTVEGHAGQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVE
FT                   ALIVTNAAGGVNTEFRAGDLMIITDHINFMGTNPLIGPNEADFGARFPDMSSAYDKDLS
FT                   SLAEKIARDLNIPIQKGVYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAG
FT                   MRVLGISCISNAAAGILDQPLSHDEVMEVTEKVKAGFLKLVKAIVAQYE"
FT   gene            complement(426399..427583)
FT                   /locus_tag="BSn5_02260"
FT   CDS_pept        complement(426399..427583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02260"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="COG1015 Phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93086"
FT                   /protein_id="ADV93086.1"
FT                   /translation="MPAYKYNRVFLIVMDSVGIGEAPDAADFNDEGAHTLGHIAEHMNG
FT                   LHMPNMAKLGLGLIEDIKGVEKTEHPLAYYGKMQEASNGKDTMTGHWEIMGLYIDKPFK
FT                   VFPEGFPDELLQELEKRSGRKIIGNKPASGTAILDELGQEHMETGALIVYTSADSVLQI
FT                   AAHEEVVPLEELYRICETARELTLDPKYMVGRIIARPFVGEPGQFKRTPNRHDYALKPF
FT                   DRTVMNELKDSGLDVISIGKISDIYDGEGITSSRRTVSNMDGMDKVIDTLGEDFTGLSF
FT                   ANLVDFDALFGHRRDPEGYGRALEEFDARLPEVFEKMREDDLLIITADHGNDPIHHGTD
FT                   HTREYVPILAYSKKHKKAQMLPLADTFADIGATIADNFQTNKPKYGKSFLSLLQ"
FT   gene            complement(427744..428634)
FT                   /gene="xerD"
FT                   /locus_tag="BSn5_02265"
FT   CDS_pept        complement(427744..428634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="BSn5_02265"
FT                   /product="site-specific tyrosine recombinase XerD"
FT                   /note="COG4974 Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02265"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93087"
FT                   /protein_id="ADV93087.1"
FT                   /translation="MKDQIKDFIHYVMVERGLSQNTIVSYERDLKSYSLYLTETLHVTD
FT                   WNHVTRIHIIQYLKHLKDSGKSGKTSARHLASIRSFHQFLLREKVTDKDPSVHIETQKT
FT                   ERALPKVLALNEVERLLDTPKLTSPFGYRDKAMLELLYATGIRVSEMIELKTADVHLSM
FT                   GFIRCFGKGRKERIVPIGEAAASAIEEYMTKARGKLLKNNVSDALFLNHHGKQISRQGF
FT                   WKNLKKIALEAGIKKELTPHTLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVT
FT                   KTRLKDVYKQFHPRA"
FT   gene            complement(428642..428869)
FT                   /locus_tag="BSn5_02270"
FT   CDS_pept        complement(428642..428869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93088"
FT                   /protein_id="ADV93088.1"
FT                   /translation="MGRFLKTAVDALKVFILFTGFTALFYYAMIWVNQEYENYHRYDKP
FT                   EGSAVKVVEMDQDEKGGWLDRLIFFYQNGE"
FT   gene            complement(429009..429443)
FT                   /locus_tag="BSn5_02275"
FT   CDS_pept        complement(429009..429443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02275"
FT                   /product="transcriptional regulator for iron transport and
FT                   metabolism"
FT                   /note="COG0735 Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02275"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93089"
FT                   /protein_id="ADV93089.1"
FT                   /translation="MENRIDRIKKQLHSSSYKLTPQREATVRVLLENEEDHLSAEDVYL
FT                   LVKEKSPEIGLATVYRTLELLTELKVVDKINFGDGVSRYDLRKEGAAHFHHHLVCMECG
FT                   AVDEIEEDLLEDVEEIIERDWKFKIKDHRLTFHGICHRCN"
FT   gene            complement(429556..430200)
FT                   /locus_tag="BSn5_02280"
FT   CDS_pept        complement(429556..430200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02280"
FT                   /product="stage II sporulation protein M"
FT                   /note="COG1300 Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93090"
FT                   /protein_id="ADV93090.1"
FT                   /translation="MRKISYKDMFLRHVKDHLSLYIFVSVLFFMGVIFGAIIVNSMTIS
FT                   QKEDLYYYLSQFFGQLSDGKQASSADMFGQSIFHNAKYLGLMWILGISVIGMPIIFIMI
FT                   FLKGIVVGFTVGFLVNQMGVSGFFLSFVSVLPQNVLLIPAYLIMGTCAIAFSLKLIRQL
FT                   FVKRSLHDAPIQWFGRYAFVLLVILFLALISSLFEAYLSPVLMEKLTSRLF"
FT   gene            complement(430301..430516)
FT                   /locus_tag="BSn5_02285"
FT   CDS_pept        complement(430301..430516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02285"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93091"
FT                   /protein_id="ADV93091.1"
FT                   /translation="MAKSQAKKKRGHRLRNGGRDVLLSRGSTPSFSTHERMTKSKKEIL
FT                   NKRKHKNPYDHTAVDDKDFFVPQKAA"
FT   gene            complement(430616..431935)
FT                   /locus_tag="BSn5_02290"
FT   CDS_pept        complement(430616..431935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02290"
FT                   /product="NAD-dependent malic enzyme (conversion of malate
FT                   into pyruvate)"
FT                   /note="COG0281 Malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93092"
FT                   /protein_id="ADV93092.1"
FT                   /translation="MIAKHMIRTLMIETPSVPGNLGRVATAIGLLGGDIGEVETVKVGP
FT                   NYTMRNITVQVENEEQLQEVIAAVQALGEGIRLHTVSDEVLSAHEGGKIQMKSKMPIRS
FT                   LAELGRVYTPGVADVCRLIEKEPEKASIYTTISNSVAIVTDGTAILGLGNIGSVAGMPV
FT                   MEGKAALFDQLAGISGIPILLDTSDPEEIIKTVKHISPGFSGILLEDIGSPHCFEIEDR
FT                   LKEELNIPVMHDDQHGTAVVTLAAAISACRSAGVDLKEAKVGQIGLGAAGVAICRMFMA
FT                   YGVNAVYGTDKSESAMNRLEQYGGQAVSSIEELMETCDIVIATTGVPGLIKPAFVRSGQ
FT                   VILALSNPKPEIEPEAALQAGAAYAADGRSVNNVLGFPGIFRGALNAKSTEINHDMLVA
FT                   AAEAIAACTKQGDVVPQPLDSKVHHAVAAAVEHAALTAVK"
FT   gene            complement(431953..433359)
FT                   /locus_tag="BSn5_02295"
FT   CDS_pept        complement(431953..433359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02295"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="COG1757 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02295"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93093"
FT                   /protein_id="ADV93093.1"
FT                   /translation="MKDVRLPTLFEIIIVLGVFLALVLSFTVFLDLPIQLALFVSWFIA
FT                   MLLGIRLGYSYKDLQNAIVHGISNGLEAVLILVSVGALIGTWIAGGVVPTLIYYGLEFI
FT                   HPSIFLLATLIICSIMSVATGTSWGTVGTAGIAMIAIGEGLGIPLPLVAGAILSGAYFG
FT                   DKLSPLSDSTVLASSLSKVDVLAHVRAMLYLSIPAYVITAILFTVVGFMYGGKNIDLDK
FT                   VEFLKSSLQNTFDIHIWMLIPAVLVIVLLAMKKPSMPVIVIGALLGAIWAVVFQGMDIA
FT                   HAIATAYNGFSIKTDVEFLNGLLNRGGIVGMLDSLVVIIFGLGFGGLLEKLGVLKVIVS
FT                   TFEKKLTSAGNVTLSTLIVAFLANIFGCAMYVSLILTPKIMEDSYDRLHLDRRVLSRNS
FT                   EVGGTLTSGMVPWSDNGIYMAGILGVSTFSYLPFMWLSFVAIGLAIIYGYTGKFIWYTK
FT                   NNTVKAEKLG"
FT   gene            complement(433500..434927)
FT                   /locus_tag="BSn5_02300"
FT   CDS_pept        complement(433500..434927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02300"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="COG1027 Aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93094"
FT                   /protein_id="ADV93094.1"
FT                   /translation="MLNGQKEYRVEKDFLGEKQIEADVYYGIQTLRASENFPITGYKIH
FT                   EEMINALAIVKKAAALANMDVKRLYEGIGQAIVQAADEILEGKWHDQFIVDPIQGGAGT
FT                   SMNMNANEVIGNRALEIMGHKKGDYIHLSPNTHVNMSQSTNDVFPTAIHISTLKLLEKL
FT                   LKTMEDMHSVFKQKAQEFDSVIKMGRTHLQDAVPIRLGQEFEAYSRVLERDIKRIKQSR
FT                   QHLYEVNMGATAVGTGLNADPEYIKQVVKHLADISGLPLVGADHLVDATQNTDAYTEVS
FT                   ASLKVCMMNMSKIANDLRLMASGPRAGLAEISLPARQPGSSIMPGKVNPVMAELINQIA
FT                   FQVIGNDNTICLASEAGQLELNVMEPVLVFNLLQSISIMNNGFRSFTDNCLKGIEANEK
FT                   RLKQYVEKSAGVITAVNPHLGYEAAARIAREAIMTGQSVRDLCLQHDVLTEEELDIILN
FT                   PYEMTKPGIAGKELLEK"
FT   gene            complement(434972..435961)
FT                   /locus_tag="BSn5_02305"
FT   CDS_pept        complement(434972..435961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02305"
FT                   /product="L-asparaginase"
FT                   /note="COG0252 L-asparaginase/archaeal Glu-tRNAGln
FT                   amidotransferase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02305"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93095"
FT                   /protein_id="ADV93095.1"
FT                   /translation="MKKLLMLTTGGTIASVEGENGLAPGVKADELLSYVSTLDNDYTME
FT                   TQSLMNIDSTNMQPEYWVEIAEAVKENYDAYDGFVITHGTDTMAYTSAALSYMLQHAKK
FT                   PIVITGSQIPITFQKTDAKKNITDAIRFACEGVGGVYVVFDGRVIQGTRAIKLRTKSYD
FT                   AFESINYPYIAFINEDGIEYNKQVTEPENDTFTVDTSLCTDVCLLKLHPGLKPEMFDAL
FT                   KSMYKGIVIESYGSGGVPFEGRDILSKVNELIESGIVVVITTQCLEEGEDMSIYEVGRR
FT                   VNQDLIIRSRNMNTEAIVPKLMWALGQSSDLPVVKRIMETPIADDVVL"
FT   gene            436143..436493
FT                   /locus_tag="BSn5_02310"
FT   CDS_pept        436143..436493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02310"
FT                   /product="transcriptional regulator of ansAB (Xre family)
FT                   protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93096"
FT                   /protein_id="ADV93096.1"
FT                   /translation="MNLDRLTELRKKKNWSLQYTADLLGIAKSTYAGYESGYRRPSLEA
FT                   LAMLADLFDTTCDELLGREKQKQTAPQAIELATWSSLDFTISVDGQPLSEDEIIQLITF
FT                   IRTKRKVQEELS"
FT   gene            complement(436502..437665)
FT                   /locus_tag="BSn5_02315"
FT   CDS_pept        complement(436502..437665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02315"
FT                   /product="hypothetical protein"
FT                   /note="COG1379 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02315"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93097"
FT                   /protein_id="ADV93097.1"
FT                   /translation="MKKIYADLHIHIGRTFTGRAVKITGAKTLTLDRILVEASEHKGIE
FT                   LLGIIDCHSPEVILELEEGISSGKYRELDGGGIRYRSTTLLLGSELEIYDEACSGPIHV
FT                   LVFMPTLADMKQFSNWLSARLKNIHLSSQRIYETGLNLQKKVQDMGGLFIPAHIFTPHK
FT                   SLYGKGVKSSLTEVFDPSMIDAVELGLSCDTDMASHVSQLNPYPFLTNSDAHSLGKIGR
FT                   EYNELYVQSADFTEFALALKGQDDRKIIANYGLDPLLGKYYQTACEACGEPAVSGETAC
FT                   ANCGNSRFTKGVSERLHELSNQLEVRVPRPRYVHQIPLQFVPGVGPKTLDKLKKAFGTE
FT                   MAVLHEAAEEDLARVVPPKTAALIVKARSGKLELKAGGGGTYGKIKP"
FT   gene            complement(437662..438219)
FT                   /locus_tag="BSn5_02320"
FT   CDS_pept        complement(437662..438219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02320"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93098"
FT                   /protein_id="ADV93098.1"
FT                   /translation="MKSLEEKTIAKEQIFSGKVIDLYVEDVELPNGKASKREIVKHPGA
FT                   VAVLAVTDEGKIIMVKQFRKPLERTIVEIPAGKLEKGEEPEYTALRELEEETGYTAKKL
FT                   TKITAFYTSPGFADEIVHVFLAEELSVLEEKRELDEDEFVEVMEVTLEDALKLVESREV
FT                   YDAKTAYAIQYLQLKEALQAQK"
FT   gene            438294..438416
FT                   /locus_tag="BSn5_02325"
FT   CDS_pept        438294..438416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02325"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93099"
FT                   /protein_id="ADV93099.1"
FT                   /translation="MKVHRMPKGVVLVGKAWKIRAKLKEYGRTFQYVKDWISKP"
FT   gene            438479..439399
FT                   /locus_tag="BSn5_02330"
FT   CDS_pept        438479..439399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02330"
FT                   /product="NADPH-dependent aldo-keto reductase"
FT                   /note="COG0667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93100"
FT                   /protein_id="ADV93100.1"
FT                   /translation="MRKRKLGTSDLDISEVGLGCMSLGTEKNKALSILDEAIELGINYL
FT                   DTADLYDRGRNEEIVGDAIQNRRQDIILATKAGNRWDDGSEGWYWDPSKAYIKEAVKKS
FT                   LTRLKTDYIDLYQLHGGTIEDNIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYVKKS
FT                   NIVSIMMQFSLFDRRPEEWLPLLEEHQISVVARGPVAKGLLTEKPLDQASDSMKQNGYL
FT                   SYSFEELTNARKAMEEVAPDLSMTEKSLQYLLAQPAVASVITGASKIEQLRENIQAANA
FT                   RRLTEEEIKALQSHTKQDIYKAHRS"
FT   gene            complement(439431..439655)
FT                   /locus_tag="BSn5_02335"
FT   CDS_pept        complement(439431..439655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02335"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93101"
FT                   /protein_id="ADV93101.1"
FT                   /translation="MKKQKSADKHQLKDGLQSDIKAKLMEMKSQLKEEDEKRQEREKAE
FT                   QIRKKKEIEKNKSFEELLNESQMDWHQYK"
FT   gene            439815..440732
FT                   /locus_tag="BSn5_02340"
FT   CDS_pept        439815..440732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02340"
FT                   /product="putative hydrolase"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93102"
FT                   /protein_id="ADV93102.1"
FT                   /translation="MKKILLAIGALVTAVIAIGIVFSNMILFIKKKTDEDIIKRETDNG
FT                   HDVFESFEQMEKTAFVIPSAYGYDIKGYHVAPHDTPNTIIICHGVTMNVLNSLKYMHLF
FT                   LDLGWNVLIYDHRRHGQSGGKTTSYGFYEKDDLNKVVSWLKNKTNHRGLIGIHGESMGA
FT                   VTALLYAGAHCSDGADFYIADCPFACFDEQLAYRLRAEYRLPSWPLLPIADFFLKLRGG
FT                   YRAREVSPLAVIDKIEKPVLFIHSKDDDYIPVSSTERLYEKKRGPKALYIAENGEHAMS
FT                   YTKNRDTYRKTVQEFLDNMNDSTE"
FT   gene            complement(440772..441011)
FT                   /locus_tag="BSn5_02345"
FT   CDS_pept        complement(440772..441011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02345"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93103"
FT                   /protein_id="ADV93103.1"
FT                   /translation="MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVW
FT                   LLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL"
FT   gene            complement(441024..441347)
FT                   /locus_tag="BSn5_02350"
FT   CDS_pept        complement(441024..441347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02350"
FT                   /product="hypothetical protein"
FT                   /note="COG4918 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93104"
FT                   /protein_id="ADV93104.1"
FT                   /translation="MNIHVTDAAKQALQQAFDANPGKKAQLRYDAEGCGCAVSGVPTIW
FT                   LAEELTGQCEQLETNGIPLYIQSSQKVFFDDQMTIDYNEKAKTLALKSPAEMLSPRMSI
FT                   LVK"
FT   gene            complement(441344..442375)
FT                   /locus_tag="BSn5_02355"
FT   CDS_pept        complement(441344..442375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02355"
FT                   /product="hypothetical protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02355"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93105"
FT                   /protein_id="ADV93105.1"
FT                   /translation="MIEFLQHKEDTIAREILAVQIPAYIKETEIIGFDGIPALQEKVKD
FT                   IQASHERFAGYRKNGKLIGVISYEKNMHHLTICRLVVHPDGFRKGIGRALLQFVIDHNE
FT                   DAEKIEVVTAENNTPAVSLYTQAGFQKAETVKAAQGLLLSVFHLYPKRKVEVILYNEKW
FT                   AECFDEEKERLKLVFGPEIIAVHHIGSTSIPNMAAKPIIDMLIEVRSIEAVSQFDEQMK
FT                   ANGYIPKGENGIAGRRYFQKGGNKRTHHVHMYEQGNPAIERHLLFRDYLRAHPNIAKEY
FT                   AVLKKQLAAQHPDSINQYIQGKDEWIKTAEENAKRWKKGRNNANGSVVCYNSENDENGG
FT                   FTL"
FT   gene            complement(442368..442709)
FT                   /locus_tag="BSn5_02360"
FT   CDS_pept        complement(442368..442709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02360"
FT                   /product="putative degradation enzyme (oxygenase)"
FT                   /note="COG2329 Uncharacterized enzyme involved in
FT                   biosynthesis of extracellular polysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93106"
FT                   /protein_id="ADV93106.1"
FT                   /translation="MDFLSKTPEPPYYAVIFSSVKSENDTGYGETAERMVSLAADQPGF
FT                   LGVESVREADGRGITVSYWDSMDAINHWKHHTEHQAAKEKGKSVWYESYAVRVAKVDRQ
FT                   RLFQENTND"
FT   gene            complement(442722..443192)
FT                   /locus_tag="BSn5_02365"
FT   CDS_pept        complement(442722..443192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02365"
FT                   /product="putative acetyltransferase"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02365"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93107"
FT                   /protein_id="ADV93107.1"
FT                   /translation="MDIRTIMSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDTSFI
FT                   TSEHNSMTGFLIGFQSQSDPETAYIHFSGVHPDFRKMQIGKQLYDVFIETVKQRGCTRV
FT                   KCVTSPVNKVSIAYHTKLGFDIEKGTKTVNGISVFANYDGPGQDRVLFVKNI"
FT   gene            complement(443377..443715)
FT                   /locus_tag="BSn5_02370"
FT   CDS_pept        complement(443377..443715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93108"
FT                   /protein_id="ADV93108.1"
FT                   /translation="MNDHLKRGNLLWEGSRMFLPEHKQSLLERKRLKQKLQKPIFDPDK
FT                   LEEMNQTLCAAMEFAQDITVSCFQDGEIVRCTGKICRYEEFEKAVWIKGDEDQLYKLRL
FT                   DQVLDIVL"
FT   gene            complement(443712..444947)
FT                   /locus_tag="BSn5_02375"
FT   CDS_pept        complement(443712..444947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02375"
FT                   /product="DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0389 Nucleotidyltransferase/DNA polymerase
FT                   involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02375"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93109"
FT                   /protein_id="ADV93109.1"
FT                   /translation="MKEKVIFLVDMQSFYASVEKAENPHLKNKPVIVSGDPEKRGGVVL
FT                   AACPLAKQKGVVNASRLWEAQEKCPEAVVLRPRMQRYIDVSLQITAILEEYTDLVEPYS
FT                   IDEQFMDITGSQKLFGTPMEIAKSIQGRIMREIGVYARVGIGPNKALAKIACDNFAKKN
FT                   TNGIFTLTKENMKTEMWPLPVGSMFGVGSRMKHHLNRMGISTIGGLAAFPLDLLKKKWG
FT                   INGHVLWMTANGIDYSPVSTSSLDGQKAIGHGMTLPRDYEHFDKEIKVVLLELSEEVCR
FT                   RSRNAGVMGQTVSVSCRGADFDWPTGFNRQVKLAEPTNSTQDVYEAVRRLFLTFWDGKP
FT                   VRRLGVNLSQLSSDDIWQLNLFQDYAKKMSLGYVMDGIKNRFGDTAIIRAASLTAAGQA
FT                   FERAAKIGGHYK"
FT   gene            445115..445321
FT                   /locus_tag="BSn5_02380"
FT   CDS_pept        445115..445321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93110"
FT                   /protein_id="ADV93110.1"
FT                   /translation="MEKFVEKMMEQALRQYGRNVAIDPLSPYEKQSLKAALQERRNEEP
FT                   DEDLHAHIEDIIYDYVTNQGLFS"
FT   gene            445874..447127
FT                   /locus_tag="BSn5_02385"
FT   CDS_pept        445874..447127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02385"
FT                   /product="putative efflux transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02385"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93111"
FT                   /protein_id="ADV93111.1"
FT                   /translation="MKKWKDIHPISWTIIIGTIFGRMATSMSIPFLAIYLTAVQGASAS
FT                   YAGLVIAASSSVGILASFYGGYISDKFGRKNMMLVSIFGWMLVFAGFAAASNLWVFFVV
FT                   NALNGLCKSLFEPASKALLSDMTEEKTRLLVFNLRYAAINIGVVFGPVLGLYFGSSQST
FT                   TPFLVPAVIYGLYGIVLALQFKKHPSLSAPAQSRNMSVREAFMVTQKDYLFTIALVGIT
FT                   LCTFGYSQFSSTFPQYMAQNPLIGNGTKLYGLMLTLNAIVVLATQFPIVHFAKRFSPLC
FT                   SLMLGNVMVSISMAIFTVSHGVPSIVMIVITFTIGEVLLFSMMDLYVDQIAKPGLKGTY
FT                   FGAIGFSQLGNVIGPWVGGICIDLFGAGRPIYIFSVLSGITLLGLPFLAFAYRQMKMET
FT                   TKHRSRLEKPLYIKNGRE"
FT   gene            447157..447315
FT                   /locus_tag="BSn5_02390"
FT   CDS_pept        447157..447315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93112"
FT                   /protein_id="ADV93112.1"
FT                   /translation="MNIGDVMFQLFVFIIFAAVVFAAVTGFKYAKNRKAQLDRIEKKLN
FT                   SLSEDHD"
FT   gene            complement(447312..447698)
FT                   /locus_tag="BSn5_02395"
FT   CDS_pept        complement(447312..447698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02395"
FT                   /product="putative lyase"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02395"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93113"
FT                   /protein_id="ADV93113.1"
FT                   /translation="MHHIELYVSDLEASRRFWGWFLKELGFKEYQKWSSGISWKKDRFY
FT                   LVIVQAKESFLEPKYHRCRVGLNHLAFHAESKLQVDQMTEKLTAKGYRVLYRDRHPFAG
FT                   GDGHYAVFCEDPDRIKVELVAPSC"
FT   gene            complement(447703..448662)
FT                   /locus_tag="BSn5_02400"
FT   CDS_pept        complement(447703..448662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02400"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COG1072 Panthothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93114"
FT                   /protein_id="ADV93114.1"
FT                   /translation="MKNKELNLHTLYTQHNRESWSGFGGHLSIAVSEEEAKAVEGLNDY
FT                   LSVEEVETIYIPLVRLLHLHVKSAAERNKHVNVFLKHPHSAKIPFIIGIAGSVAVGKST
FT                   TARILQKLLSRLPDRPKVSLITTDGFLFPTAELKKKNMMSRKGFPESYDVKALLEFLND
FT                   LKSGKDSVKAPVYSHLTYDREEGVFEVVEQADIVIIEGINVLQSPTLEDDRENPRIFVS
FT                   DFFDFSIYVDAEESRIFTWYLERFRLLRETAFQNPDSYFHKFKDLSDQEADEMAASIWE
FT                   SVNRPNLYENILPTKFRSDLILRKGDGHKVEEVLVRRV"
FT   gene            complement(448734..450080)
FT                   /locus_tag="BSn5_02405"
FT   CDS_pept        complement(448734..450080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02405"
FT                   /product="D-serine dehydratase"
FT                   /EC_number="4.3.1.18"
FT                   /note="COG3048 D-serine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02405"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93115"
FT                   /protein_id="ADV93115.1"
FT                   /translation="MSVHSEVLHALLKDPFIQKLIDAEPVFWANSGKKEGPIPRADEWA
FT                   TEIAEAEKRLRRFAPYIAEVFPETKGAKGIIESPLFEVQHMKEKLEAAYQQPFPGRWLL
FT                   KCDHELPISGSIKARGGIYEVLKHAENLALQEGMLQETDDYRILQEERFTGFFSRYSIA
FT                   VGSTGNLGLSIGIIGAALGFRVTVHMSADAKQWKKDLLRQKGVTVMEYETDYSEAVNEG
FT                   RRQAEHDPFCYFIDDEHSRQLFLGYAVAASRLKTQLDCMNIKPSLETPLFVYLPCGVGG
FT                   GPGGVAFGLKLLYGDDVHVFFAEPTHSPCMLLGLYSGLHEKISVQDIGLDNQTAADGLA
FT                   VGRPSGFVGKLIEPLLSGCYTVEDNTLYTLLHMLAVSEDKYLEPSALSGMFGPVQLFTT
FT                   EEGRHYAQKYKMEHAVHVVWGTGGSMVPKDEMAAYNRIGADLLKKRNEK"
FT   gene            complement(450152..450931)
FT                   /locus_tag="BSn5_02410"
FT   CDS_pept        complement(450152..450931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02410"
FT                   /product="putative metabolite dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="COG0300 Short-chain dehydrogenases of various
FT                   substrate specificities"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93116"
FT                   /protein_id="ADV93116.1"
FT                   /translation="MKHIAGKRIWITGASGGLGERIAYLCAAEGAHVLLSARREDRLIE
FT                   IKRKITEEWSGQCEIFPLDVGRLEDIARVRDQIGSVDVLINNAGFGIFETVLDSTLDDM
FT                   KAMFDVNVFGLIACTKAVLPQMLEQKKGHIINIASQAGKIATPKSSLYSATKHAVLGYS
FT                   NALRMELSGTGIYVTTVNPGPIQTDFFSIADKGGDYAKNVVRWMLDPDDVAAQITAAIF
FT                   TKKREINLPRLMNAGTKLYQLFPALVEKLAGRALMKK"
FT   gene            complement(450937..451896)
FT                   /locus_tag="BSn5_02415"
FT   CDS_pept        complement(450937..451896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02415"
FT                   /product="putative metal-dependent hydrolase"
FT                   /note="COG0491 Zn-dependent hydrolases, including
FT                   glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02415"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93117"
FT                   /protein_id="ADV93117.1"
FT                   /translation="MTTEDVIAIRVPTPFAVGDVIVYLVKGDALTLIDAGPNTKEAARA
FT                   LQEQLAAVNVKMSDIEQVVLTHHHADHAGLLDVFSDEIEVIGHTFNEPYISRNQAFMDW
FT                   QKRFFQKLLPELGVPFDTRKAEKLIRSAYAFSCTRSLTKSIREGMGIDGLEGWSVLEMP
FT                   GHAESHIVLFHEKSGRMLGGDLLLANSSSNPILEAPKAGDVRSKPLVDYQRSLRRLSQL
FT                   DPTIVFPGHGEPITSVQALIEKRFDKQRNRTEDVRRMLDEKPMTAFQVCQQLFPAVYEK
FT                   ELFLTMSETAGHLDVLEAEEAITSYWEGNTVYFKTMKR"
FT   gene            452301..453137
FT                   /locus_tag="BSn5_02420"
FT   CDS_pept        452301..453137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02420"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /note="COG0345 Pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93118"
FT                   /protein_id="ADV93118.1"
FT                   /translation="MKKIGFVGAGSMAEAMINGILQSGITKPEHIYITNRSNDERLIEL
FT                   KETYGVRPCRDKNEFFTHTDIIILAFKPKDAAESIDSIRPYIKDQLVISVLAGLTIETI
FT                   QHYFGRKLAVIRVMPNTSAAIRKSATGFSVSTEASKNDIIAAKALLETIGDATLVEERH
FT                   LDAVTAIAGSGPAYVYRYIEAMEKAAQKVGLDKETAKALILQTMEGATDMLLQSGKQPE
FT                   KLRKEITSPGGTTEAGLRALQDSRFEEAIIHCIEETAKRSAEIKEQFAGAALERHS"
FT   gene            complement(453177..454820)
FT                   /locus_tag="BSn5_02425"
FT   CDS_pept        complement(453177..454820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02425"
FT                   /product="putative N-deacylase"
FT                   /note="COG4187 Arginine degradation protein (predicted
FT                   deacylase)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02425"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93119"
FT                   /protein_id="ADV93119.1"
FT                   /translation="MNWQTKDELLALLTSLVQYESITGSKGEAALAEYLYFILKDKPYF
FT                   QKHPDDVTLHPMDDGRSFLTALVKKKNVKKTVLLLSHFDVVDIEDYGEFKHMACKPAEL
FT                   LSSFLEKKELLPERVRRDAESGDWLFGRGTMDMKAGLCVQLSMLERAMNGHFEGNLLLI
FT                   TVPDEEVNSRGMIEAVPALKEMEKKHDITLTACLNAEPMFEKFPGDQQQYFYTGSIGKV
FT                   LAGFFCKGIETHVGEPFSGLNANLMVSEINRLLELNADYCEKVDGEVTPPPVNLMQKDL
FT                   KEAYSVQTPHTAVTLFNVLSMKRSASELHQMLLKTAEQAAEEIMSNVRKKTQDFQQFEP
FT                   FQPIERDVTVLTFDELVSRAKKRAGISETERALNYAFANRGELGDRDFSTKIVSELASL
FT                   CKEDAPLIVLFYSPPLYPAVSSKDDQLIRNTADQIKHYAAEQYGIALREVQYFPGLSDL
FT                   SYLQLEKQEVDAYTSNMPLFNRGYSLPSGKNQALYVPVLNVGPAGKDPHKWTERLYMPY
FT                   SFEVLPDLLSFTISALLKQSESAGQLLREK"
FT   gene            454992..456008
FT                   /locus_tag="BSn5_02430"
FT   CDS_pept        454992..456008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02430"
FT                   /product="NADPH dehydrogenase NamA"
FT                   /EC_number="1.6.99.1"
FT                   /note="COG1902 NADH:flavin oxidoreductases, Old Yellow
FT                   Enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93120"
FT                   /protein_id="ADV93120.1"
FT                   /translation="MARKLFTPITIKDMTLKNRIVMSPMCMYSSHEKDGKLTPFHMAHY
FT                   ISRAIGQVGLIIVEASAVNPQGRITDQDLGIWSDEHIEGFAKLTEQVKEQGSKIGIQLA
FT                   HAGRKAELEGDIFAPSAIAFDEQSATPVEMSAEKVKETVQEFKQAAARAKEAGFDVIEI
FT                   HAAHGYLIHEFLSPLSNHRTDEYGGSPENRYRFLREIIDEVKQVWDGPLFVRVSASDYT
FT                   DKGLDIADHIGFAKWMKEQGVDLIDCSSGALVHADINVFPGYQVSFAEKIREQADMATG
FT                   AVGMITDGSMAEEILQNGRADLIFIGRELLRDPFFARTAAKQLNTEIPAPVQYERGW"
FT   gene            456118..456879
FT                   /locus_tag="BSn5_02435"
FT   CDS_pept        456118..456879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02435"
FT                   /product="putative hydrolase"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93121"
FT                   /protein_id="ADV93121.1"
FT                   /translation="MKSAWMEKTYIIDGCAFHTQHRKGSSGVTIVFEAGYGTSSETWKP
FT                   LMADIDDEFGIFTYDRAGIGKSGQSRAKRTADQQVKELESLLKAADVKPPYLAVSHSYG
FT                   AVITGLWACKNKHDIIGMVLLDPALGDCASFTFIPEEMHKSHTRKMMLEGTHAEFSKSL
FT                   QELKKRQVHLGNMPLLVLSSGERTEKFAAEQEWQNLHSSILSLSNQSGWIQAKNSSHNI
FT                   HHDEPHIVHLAIYDVWCAACQQAAPLYQAVN"
FT   gene            complement(456923..457072)
FT                   /gene="rpmG"
FT                   /locus_tag="BSn5_02440"
FT   CDS_pept        complement(456923..457072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BSn5_02440"
FT                   /product="50S ribosomal protein L33"
FT                   /note="COG0267 Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93122"
FT                   /protein_id="ADV93122.1"
FT                   /translation="MRVNVTLACTETGDRNYITTKNKRTNPDRLELKKYSPRLKKYTLH
FT                   RETK"
FT   gene            complement(457154..458077)
FT                   /locus_tag="BSn5_02445"
FT   CDS_pept        complement(457154..458077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02445"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="COG1234 Metal-dependent hydrolases of the
FT                   beta-lactamase superfamily III"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02445"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93123"
FT                   /protein_id="ADV93123.1"
FT                   /translation="MELLFLGTGAGIPAKARNVTSVALKLLEERRSVWLFDCGEATQHQ
FT                   ILHTTIKPRKIEKIFITHMHGDHVYGLPGLLGSRSFQGGEDELTVYGPKGIKAFIETSL
FT                   AVTKTHLTYPLAIQEIEEGIVFEDDQFIVTAVSVIHGVEAFGYRVQEKDVPGSLKADVL
FT                   KEMNIPPGPVYQKIKKGETVTLEDGRIINGNDFLEPPKKGRSVVFSGDTRVSDKLKELA
FT                   RDCDVLVHEATFAKEDRKLAYDYYHSTTEQAAVTAKEARAKQLILTHISARYQGDASLE
FT                   LQKEAVDVFPNSVAAYDFLEVNVPRG"
FT   gene            458304..459773
FT                   /locus_tag="BSn5_02450"
FT   CDS_pept        458304..459773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02450"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="COG0364 Glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93124"
FT                   /protein_id="ADV93124.1"
FT                   /translation="MKTNQQPKAVIVIFGATGDLAKRKLYPSIHRLYQNGQIGEEFAVV
FT                   GVGRRPWSNEDLRQTVKTSISSSADKHIDDFTSHFYYHPFDVTNPGSYQELNVLLNQLE
FT                   DTYQIPNNRMFYLAMAPEFFGTIAKTLKSEGVTATTGWSRLVIEKPFGHDLPSAQALNK
FT                   EIREAFTEDQIYRIDHYLGKQMVQNIEVIRFANAIFEPLWTNRYISNIQITSSESLGVE
FT                   DRARYYEKSGALRDMVQNHIMQMVALLAMEPPIKLNTEEIRSEKVKVLRALRPIAKDEV
FT                   DEYFVRGQYQAGEIDGVPVPAYTDEDNVAPDSNTETFVAGKLLIDNFRWAGVPFYIRTG
FT                   KRMKEKSTKIVVQFKDIPMNLYYGNENNMNPNLLVIHIQPDEGITLYLNAKKLGGAAHA
FT                   QPIKLDYCSNCNDELNTPEAYEKLIHDCLLGDATNFAHWDEVALSWSFVDSISETWAAN
FT                   KTLSPNYESGSMGPKESDDLLVKDGLHWWNI"
FT   gene            459761..459895
FT                   /locus_tag="BSn5_02455"
FT   CDS_pept        459761..459895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02455"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93125"
FT                   /protein_id="ADV93125.1"
FT                   /translation="MEYIIRRKKPKMFTSIFGFFTLNKGITISLITKPPKLKSFGGFY"
FT   gene            complement(459896..461305)
FT                   /locus_tag="BSn5_02460"
FT   CDS_pept        complement(459896..461305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02460"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /note="COG0362 6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93126"
FT                   /protein_id="ADV93126.1"
FT                   /translation="MSKQQIGVIGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFLQE
FT                   AKGKNVVGTYSIEEFVQSLETPRKILLMVKAGTATDATIQSLLPHLEKDDILIDGGNTY
FT                   YKDTQRRNKELAESGIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKV
FT                   DGEPCTTYIGPDGAGHYVKMVHNGIEYGDMQLISESYFILKQVLGLSADELHEVFAEWN
FT                   KGELDSYLIEITADIFTKKDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIIT
FT                   ESVFARFISAMKEERVKASGLLSGPEVKPVTENKEELIEAVRKALFMSKICSYAQGFAQ
FT                   MKAASEEYNWDLKYGEIAMIFRGGCIIRAAFLQKIKEAYDREPELDNLLLDSYFKNIVE
FT                   SYQGALRQVISLAVAQGVPVPSFSSALAYYDSYRTAVLPANLIQAQRDYFGAHTYERTD
FT                   KEGIFHTEWMK"
FT   gene            complement(461415..462659)
FT                   /locus_tag="BSn5_02465"
FT   CDS_pept        complement(461415..462659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02465"
FT                   /product="DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0389 Nucleotidyltransferase/DNA polymerase
FT                   involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02465"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93127"
FT                   /protein_id="ADV93127.1"
FT                   /translation="MPGKSRIIFHIDMNSFYASVEMAYDPALRGKPVAVAGNVKERKGI
FT                   VVTCSYEARARGVKTTMPVWQAKRHCPELIVLPPNFDRYRNSSRAMFTILREYTDLVEP
FT                   VSIDEGYMDMTDTPYSSRALETAKEIQSRLQKELLLPSSIGIAPNKFLAKMASDMKKPL
FT                   GITILRKRQVPDILWPLPVGEMHGVGKKTAEKLKGLGIHTIGELAAADEHSLKRLLGIN
FT                   GPRLKNKANGIHHAPVDPERIYEFKSVGNSSTLSHDSSDEEELLGVFRKLAASVSDRLQ
FT                   RKEVMASKLFIMIRYADWRTITRSTTLRNPIDQKNDILKEAEHLFFKHWNKNPVRLLGI
FT                   TGTDLVEKEQAYKQLDLFSFNEDAKDEPIQQMMEKLNKKYGTKLIRKGATLKKEESKTK
FT                   GTSFNKDFFQDEKKS"
FT   gene            462723..463019
FT                   /locus_tag="BSn5_02470"
FT   CDS_pept        462723..463019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93128"
FT                   /protein_id="ADV93128.1"
FT                   /translation="MDVMTMFVESINDVLFLVDFFTIILPALTAIGIAFLLRECRAGEQ
FT                   WKSKRTDEHQTVFHINRTDFLIIIYHRITTWIRKVFRMNSPVNDEEDAGSLLL"
FT   gene            463050..463877
FT                   /locus_tag="BSn5_02475"
FT   CDS_pept        463050..463877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02475"
FT                   /product="OxaA-like protein precursor"
FT                   /note="COG0706 Preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02475"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93129"
FT                   /protein_id="ADV93129.1"
FT                   /translation="MLKTYQKLLAMGIFLIVLCSGNAAFAATNQVGGLSNVGFFHDYLI
FT                   EPFSALLKGVAGLFHGEYGLSIILVTIIVRIVVLPLFVNQFKKQRIFQEKMAVIKPQVD
FT                   SIQVKLKKTKDPEKQKELQMEMMKLYQEHNINPLAMGCLPMLIQSPIMIGLYYAIRSTP
FT                   EIASHSFLWFSLGQSDILMSLSAGIMYFVQAYIAQKLSAKYSAVPQNPAAQQSAKLMVF
FT                   IFPVMMTIFSLNVPAALPLYWFTSGLFLTVQNIVLQMTHHKSKKTAALTESVK"
FT   gene            464059..464787
FT                   /locus_tag="BSn5_02480"
FT   CDS_pept        464059..464787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02480"
FT                   /product="hypothetical protein"
FT                   /note="COG3361 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93130"
FT                   /protein_id="ADV93130.1"
FT                   /translation="MTERFQQKNISVPDGIWIMRQTWNDVLFAHWPVDVSILRALVPSV
FT                   LELDTYNGQAWISMLPFMLTNLRARYLPVIPGARAFPELNLRTYVTYKGKPGIYFFSLD
FT                   ADHRLAVLGARTFFHLPYFYADMKSEKNGDAIDYVSKRKNDKEAAFHAAYRPISAPFTA
FT                   EKDSLDYWLTERYRLYTTNQNKLYYEDIHHHPWLLQNAEAEISVNTVTDAHGITLPESD
FT                   PLLHYAKKQDVLFWPLRKWS"
FT   gene            complement(464828..465943)
FT                   /locus_tag="BSn5_02485"
FT   CDS_pept        complement(464828..465943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02485"
FT                   /product="putative deacylase"
FT                   /note="COG2195 Di- and tripeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02485"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93131"
FT                   /protein_id="ADV93131.1"
FT                   /translation="MVNEKRLLEEFLELVQIDSETKHEAEICKVLKRKFSDLGVDVKED
FT                   DTMDITGHGAGNLICTLKGTKQTDTIYFTSHMDTVVPGNGVKPVVENGYVKTDGTTILG
FT                   ADDKAGLAAMFEAIKVLKEENIEHGTIEFIITVGEESGLIGAKALDRSMITASYGYALD
FT                   SDGKVGNIIVAAPTQAKVRAAIFGKTAHAGVEPEKGISAITIASKAISKMPLGRIDEET
FT                   TANIGRFEGGTQTNIVCDEVHILAEARSLVPEKMEAQVQKMKAAFEEAAADMGGRAEVE
FT                   IEVMYPGFKYQDGDQVVEIAKKAAAKIGRPSELQTSGGGSDANVIAGHGIPTVNLAVGY
FT                   EQIHTKNEKMPIEELVKTAEMVVAIIEEAAK"
FT   gene            complement(465961..467490)
FT                   /locus_tag="BSn5_02490"
FT   CDS_pept        complement(465961..467490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02490"
FT                   /product="putative acyl-CoA carboxylase"
FT                   /note="COG4799 Acetyl-CoA carboxylase, carboxyltransferase
FT                   component (subunits alpha and beta)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93132"
FT                   /protein_id="ADV93132.1"
FT                   /translation="MNMNEHMDHLYTKRKQAEEGGGREKLAQQRQKGKLTARERIIFLL
FT                   DQDSFIELHPFMESQVLTREQRMLGDGVVTGYGTIDGRSVYVFAQDFTVYGGALGETHA
FT                   RKICALMDLAAKNKAPIIGLNDSGGARIQEGVLSLDGYGHIFYRNVLYSGVIPQISVIL
FT                   GPCAGGAVYSPALTDFIFMAEQTGRMFITGPKVIEKVTGEQVDAESLGGAGIHNAVSGN
FT                   AHFSGHTEKEVLTGVRKLLSYLPLNGRTTEPKPEKEASRPLLNRLVPADTTKPYDVRKV
FT                   IRELADPQSFFEIQPFFAKNIVIGFARLGEKAIGIVASQPKHLAGSLTIDAADKAARFI
FT                   RFCDAFDIPLLTVEDVPGFLPGIQQEHNGIIRHGAKLLFAYAEATVPKVTLIIRKAYGG
FT                   AYVAMNSKAIGADLVFAWPNAEIAVMGPEGAASILYEKEIKASADPQKTKREKTAEYKK
FT                   QNAGPYKAAACGMVDDIILPEESRGKLIQAFHMLAHKTEERPKKKHGNIPL"
FT   gene            complement(467477..467899)
FT                   /locus_tag="BSn5_02495"
FT   CDS_pept        complement(467477..467899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02495"
FT                   /product="putative lyase"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02495"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93133"
FT                   /protein_id="ADV93133.1"
FT                   /translation="MNRLDHIGIAVFSIKDARSFYENVLGLAFLHQETVEEQKVNVAFF
FT                   QAGSVKLELIEPLTADSPVHLFLEKKGQGLHHIAFLCNCLSEQLQALSDQHVQLIDRFP
FT                   RQGANGKKIAFISPRETNGVLVELCEPKGDQHNEHE"
FT   gene            467989..468081
FT                   /locus_tag="BSn5_02500"
FT   CDS_pept        467989..468081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93134"
FT                   /protein_id="ADV93134.1"
FT                   /translation="MSQKLMKSVLIVILGVFILSTVLSGIVMFL"
FT   gene            complement(468101..468631)
FT                   /locus_tag="BSn5_02505"
FT   CDS_pept        complement(468101..468631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02505"
FT                   /product="hypothetical protein"
FT                   /note="COG1376 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93135"
FT                   /protein_id="ADV93135.1"
FT                   /translation="MRFFLCSIFMMISPIWPLGENPLPGDPYVIVNKRTNELAVILDNK
FT                   VEGVYSVATGKTDDLTPEGEFSVTVKAENPYYRKKNIEGGSPDNPLGARWIGFDAKGTD
FT                   GRIYGIHGTNREESVGKFVSNGCIRMHNDEVVHLFQTIPVGTRVLITDDNRSFEEIAIE
FT                   HKALIKKQDIPIE"
FT   gene            complement(468683..469651)
FT                   /locus_tag="BSn5_02510"
FT   CDS_pept        complement(468683..469651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02510"
FT                   /product="hypothetical protein"
FT                   /note="COG4129 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93136"
FT                   /protein_id="ADV93136.1"
FT                   /translation="MFKIGYRTIKTALGTALAIYISQLLHLQNFASAGIITILCIQITQ
FT                   KRSLQASWARFAACCLAIAFSYLFFELIGYHPFVIGALLLIFIPITVLLKINEGIVTSS
FT                   VIILHLYMSGGITPTFIWNEVQLITVGIGVALLMNLYMPSLDRKLIAYRKKIEDNFAVI
FT                   FAEIERYLLTGEQDWSGKEIPETHQLITEAKNLAYRDVQNHILRYENLHYHYFKMREKQ
FT                   FEIIERLLPKVTSISITVDQGKMIAEFIHDLREAIHPGNTAYKFLKRLADMRKEFEEMP
FT                   LPATREEFEARAALFHLLGEMEQYLVIKSYFKGIKAQKSLG"
FT   gene            complement(469722..470444)
FT                   /locus_tag="BSn5_02515"
FT   CDS_pept        complement(469722..470444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02515"
FT                   /product="High affinity arginine ABC transporter
FT                   (ATP-binding protein)"
FT                   /note="COG1126 ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02515"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93137"
FT                   /protein_id="ADV93137.1"
FT                   /translation="MIKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLR
FT                   CLNLLEKPNGGTITIKDTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVN
FT                   VKKETKQAAQEKAEDLLRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEP
FT                   TSALDPEMVKEVLQVMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKE
FT                   FFMSPKSKRAQDFLEKIL"
FT   gene            complement(470437..471096)
FT                   /locus_tag="BSn5_02520"
FT   CDS_pept        complement(470437..471096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02520"
FT                   /product="High affinity arginine ABC transporter
FT                   (permease)"
FT                   /note="COG0765 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93138"
FT                   /protein_id="ADV93138.1"
FT                   /translation="MNLDFSATIPQIPFILEGLAITLKIVVVSAIIGLILGIVLSLCKI
FT                   STFRPFIWIADFYTSVFRGTPLVLQLMIVYFGLPQLLGFQIDQFWAAVVALSLNSAAYV
FT                   SEIIRAGINAIDKGQKEAAVALGVPYGKMMKDLLLPQAFKNISPAIVNELITLTKESAI
FT                   VTVIGLGDVMRRAYQAGAATYNYLEPLIIAGLIYYVLVLILTFIGKAVERKLKSND"
FT   gene            complement(471177..471944)
FT                   /locus_tag="BSn5_02525"
FT   CDS_pept        complement(471177..471944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02525"
FT                   /product="High affinity arginine ABC transporter binding
FT                   lipoprotein"
FT                   /note="COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02525"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93139"
FT                   /protein_id="ADV93139.1"
FT                   /translation="MKKWLLLLVAACITFALTACGSSNSGSESGKKKLIMGTSADYKPF
FT                   EYKEGDNIVGFDVELAKALAKKAGYEIEVQDMDFNSLITALKSKQVDLVLSGMTPTPER
FT                   KKQVDFSDVYYTANHMIVSKKDSGIQSLKDLKGKTVGVQLGSIQEEKGKELSPEYGFKT
FT                   EDRNRISDLVQEIKSDRFDAAIIEDIVAEGYFKSNDDLQGFVIPDAKAEEAGSAIAFRK
FT                   DSELTDKFNKALKEMEDNGELEKLKKKWFTGEK"
FT   gene            complement(472211..472648)
FT                   /locus_tag="BSn5_02530"
FT   CDS_pept        complement(472211..472648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02530"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93140"
FT                   /protein_id="ADV93140.1"
FT                   /translation="MNMDFNLFMNDIVRQARQEITAAGYTELKTAEEVDEALTKKGTTL
FT                   VMVNSVCGCAGGIARPAAYHSVHYDKRPDQLVTVFAGQDKEATARARDYFEGYPPSSPS
FT                   FAILKDGKIMKMVERHEIEGHEPMAVVAKLQEAFEEYCEEV"
FT   gene            472809..473702
FT                   /locus_tag="BSn5_02535"
FT   CDS_pept        472809..473702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02535"
FT                   /product="putative diacylglycerol kinase"
FT                   /note="COG1597 Sphingosine kinase and enzymes related to
FT                   eukaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02535"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93141"
FT                   /protein_id="ADV93141.1"
FT                   /translation="MSHRKALLIHNGNAGNKNIEKALGAVVPVLSHDLDEVIIKQTKKK
FT                   DDAYHFCQSIDDSVDTVFILGGDGTIHQCINAISALERKPAVGILPGGTCNDFSRVLGI
FT                   PQNLAKAAEALMAGKKTSVDVCQMNDRYFLNFWGIGLIAETSNQINETEKALLGKISYF
FT                   TSALRTVSSAASFPMTLKIDGEEIKEEAVMLLVMNGQYIGTNRIPLPDASIEDGLLDVL
FT                   ICRNTNLTALRELMSMEQGSIDRFTGELSYVQASRIEIETDTAKKADMDGEVYTHTPAV
FT                   IQVLPQHIDMLVPANE"
FT   gene            473803..474972
FT                   /locus_tag="BSn5_02540"
FT   CDS_pept        473803..474972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02540"
FT                   /product="multidrug-efflux transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93142"
FT                   /protein_id="ADV93142.1"
FT                   /translation="MEKKNITLTILLTNLFIAFLGIGLVIPVTPTIMNELHLSGTAVGY
FT                   MVACFAITQLIVSPIAGRWVDRFGRKIMIVIGLLFFSVSEFLFGIGKTVEMLFISRMLG
FT                   GISAAFIMPGVTAFIADITTIKTRPKALGYMSAAISTGFIIGPGIGGFLAEVHSRLPFF
FT                   FAAAFALLAAILSILTLREPERNPENQEIKGQKTGFKRIFAPMYFIAFLIILISSFGLA
FT                   SFESLFALFVDHKFGFTASDIAIMITGGAIVGAITQVVLFDRFTRWFGEIHLIRYSLIL
FT                   STSLVFLLTTVHSYVAILLVTVTVFVGFDLMRPAVTTYLSKIAGNEQGFAGGMNSMFTS
FT                   IGNVFGPIIGGMLFDIDVNYPFYFATVTLAIGIALTIAWKAPAHLKAST"
FT   gene            475045..475881
FT                   /locus_tag="BSn5_02545"
FT   CDS_pept        475045..475881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02545"
FT                   /product="transcriptional regulator (MerR family) protein"
FT                   /note="COG0789 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02545"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93143"
FT                   /protein_id="ADV93143.1"
FT                   /translation="MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYY
FT                   TDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQT
FT                   ISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESAD
FT                   GFTNNSYGATFSFQPYTSIAEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAY
FT                   NFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIAE"
FT   gene            complement(475936..477210)
FT                   /locus_tag="BSn5_02550"
FT   CDS_pept        complement(475936..477210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02550"
FT                   /product="branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2"
FT                   /note="COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93144"
FT                   /protein_id="ADV93144.1"
FT                   /translation="MAIEQMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKV
FT                   NAEVPSSFSGTITELVGEEGQTLQVGEVICKIETEGANPAEQKQEQPAASKAAETPAAK
FT                   SAEAADQPNKKRYSPAVLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNP
FT                   EEPKTAAPAPKSASKPEPKEETSYPASAAGDKEIPVTGVRKAIASNMKRSKTEIPHAWT
FT                   MMEVDVTNMVAYRNSIKDSFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQ
FT                   KKDINISIAVATEDSLFVPVIKNADEKTIKGIAKEITGLAKKVRDGKLTADDMQGGTFT
FT                   VNNTGSFGSVQSMGIINYPQAAILQVESIVKRPVVMANGMIAVRDMVNLCLSLDHRVLD
FT                   GLVCGRFLGRVKQILESIDEKTSVY"
FT   gene            complement(477233..478216)
FT                   /locus_tag="BSn5_02555"
FT   CDS_pept        complement(477233..478216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02555"
FT                   /product="branched-chain alpha-keto acid dehydrogenase E1
FT                   subunit"
FT                   /note="COG0022 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dehydrogenase (E1) component, eukaryotic type,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02555"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93145"
FT                   /protein_id="ADV93145.1"
FT                   /translation="MSVMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLY
FT                   EQFGEERVMDTPLAESAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYR
FT                   SNNDWSCPIVVRAPYGGGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVR
FT                   DEDPVLFFEHKRAYRLIKGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAE
FT                   RLEKDGISAHVVDLRTVYPLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHC
FT                   LFDLDAPIKRLAGPDIPAMPYAPTMEKYFMVNPDKVEAAMRELAEF"
FT   gene            complement(478230..479222)
FT                   /locus_tag="BSn5_02560"
FT   CDS_pept        complement(478230..479222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02560"
FT                   /product="branched-chain alpha-keto acid dehydrogenase E1
FT                   subunit"
FT                   /note="COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dehydrogenase (E1) component, eukaryotic type,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93146"
FT                   /protein_id="ADV93146.1"
FT                   /translation="MSINRHQALGLTDQEAVDMYRTMLLARKIDERMWLLNRSGKIPFV
FT                   ISCQGQEAAQVGAAFALDREMDYVLPYYRDMGVVLAFGMTAKDLMMSGFAKAADPNSGG
FT                   RQMPGHFGQKKNRIVTGSSPVTTQVPHAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFH
FT                   EGANFAAVHKLPVIFMCENNKYAISVPYDKQVACENISDRAIGYGMPGVTVNGNDPLEV
FT                   YQAVKEARERARRGEGPTLIETISYRLTPHSSDDDDSSYRGREEVEEAKKSDPLLTYQA
FT                   YLKETGLLSDEIEQTMLDEIMAIVNEATDEAENAPYAAPESALDYVYAK"
FT   gene            complement(479244..480668)
FT                   /locus_tag="BSn5_02565"
FT   CDS_pept        complement(479244..480668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02565"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02565"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93147"
FT                   /protein_id="ADV93147.1"
FT                   /translation="MATEYDVVILGGGTGGYVAAIRAAQLGLKTAVVEKEKLGGTCLHK
FT                   GCIPSKALLRSAEVYRTAREADQFGVETAGVSLNFEKVQQRKQAVVDKLAAGVNHLMKK
FT                   GKIDVYTGYGRILGPSIFSPLPGTISVERGNGEENDMLIPKQVIIATGSRPRMLPGLEA
FT                   DGKSVLTSDEALQMEELPQSIIIVGGGVIGIEWASMLHDFGVKVTVIEYADRILPTEDL
FT                   EISKEMESLLKKKGIQFITGAKVLPDTMTKTSDDISIQAEKDGETVTYSAEKMLVSIGR
FT                   QTNIEGIGLENTDIVTENGMISVNESCQTKESHIYAIGDVIGGLQLAHVASHEGIIAVE
FT                   HFAGLNPHPLDPTLVPKCIYSSPEAASVGLTEDEAKANGHNVKIGKFPFMAIGKALVYG
FT                   ESDGFVKIVADRDTDDILGVHMIGPHVTDMISEAGLAKVLDATPWEVGQTIHPHPTLSE
FT                   AIGEAALAADGKAIHF"
FT   gene            complement(480689..481780)
FT                   /locus_tag="BSn5_02570"
FT   CDS_pept        complement(480689..481780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02570"
FT                   /product="butyrate kinase"
FT                   /EC_number="2.7.2.7"
FT                   /note="COG3426 Butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93148"
FT                   /protein_id="ADV93148.1"
FT                   /translation="MKVLHDEKRILTINPGSTSTKIGVFHNERSIFEKTLRHNIEELQR
FT                   FDRIIDQYEFRKNHILETLHEQGINISKFDAVCARGGLLRPIEGGTYVVNDEMIEDLKS
FT                   GYAGQHASNLGGIIAREIADGLNIPSYIVDPVVVDEMSVLAKVSGMPEIERKSIFHALN
FT                   QKAVARKAAASLGKRYENMKMIITHMGGGITIGVHDRGRVVDVNNGLHGEGPFSPERAG
FT                   TVPAGDLVDLCFSGEYTKEEIMKKLVGTGGLLGYLGTNDAVKVEQMIQGGDEKARFIYD
FT                   AMAYQVAKEIGAASAALKGEVEAIVLTGGLAYGKSFVSAIRSYIDWISDVLVYPGENEL
FT                   QSLAQGALRVLQGEEQSKQYRIE"
FT   gene            complement(481799..482893)
FT                   /locus_tag="BSn5_02575"
FT   CDS_pept        complement(481799..482893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02575"
FT                   /product="leucine dehydrogenase"
FT                   /note="COG0334 Glutamate dehydrogenase/leucine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02575"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93149"
FT                   /protein_id="ADV93149.1"
FT                   /translation="MELFKYMEKYDYEQLVFCQDEQSGLKAIIAIHDTTLGPALGGTRM
FT                   WTYENEEAAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFGRYIQ
FT                   GLNGRYITAEDVGTTVEDMDIIHDETDYVTGISPAFGSSGNPSPVTAYGVYRGMKAAAK
FT                   AAFGTDSLEGKTIAVQGVGNVAYNLCRHLHEEGANLIVTDINKQSVQRAVEDFGARAVD
FT                   PDDIYSQDCDIYAPCALGATINDDTIKQLKAKVIAGAANNQLKETRHGDQIHEMGIVYA
FT                   PDYVINAGGVINVADELYGYNAERALKKVEGIYGNIERVLEISQRDGIPAYLAADRLAE
FT                   ERIERMRRSRSQFLQNGHSVLSRR"
FT   gene            complement(482905..483804)
FT                   /locus_tag="BSn5_02580"
FT   CDS_pept        complement(482905..483804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02580"
FT                   /product="phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="COG0280 Phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93150"
FT                   /protein_id="ADV93150.1"
FT                   /translation="MKLKDLIGKASIHKNKTIAVAHAEDEEVIRAVKLAAEHLSARFLL
FT                   TGDSTKLNELTSFMQGHQVEIVHADTPEESAKLAVRAVHHKTADVLMKGNVPTSVLLKA
FT                   VLNRQEGLRSASVLSHVAVFDIPDFDRLMFVTDSAMNIAPSLEELRQILQNAVHVAHAV
FT                   GNNMPKAAALAAVETVNPKMEATVNAAALAQMYKRGQIKGCIVDGPLALDNAVSQIAAA
FT                   QKKISGDVAGNADILLVPTIEAGNILYKSLIYFAKASVAAVITGAKAPIALTSRADSAE
FT                   NKLYSIALAICASEEYTH"
FT   gene            complement(483929..486007)
FT                   /locus_tag="BSn5_02585"
FT   CDS_pept        complement(483929..486007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02585"
FT                   /product="transcriptional regulator"
FT                   /note="COG3829 Transcriptional regulator containing PAS,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02585"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93151"
FT                   /protein_id="ADV93151.1"
FT                   /translation="MQKVLIVGAGKRGTALLHILIKTAIIDIIAVVDKDSEAPGLKEAE
FT                   QYGIAVSSDWKPYIQQKPDIVIHTTGDQAVFDELLQRKHEDTIVMPGKMAYIVFQLMEE
FT                   KQHLIQMLKEQTYKYDRIFNSTHDGMIFIDINEEIILFNHMAEKMVGKKREEVIGRPIK
FT                   EVIPSTKMPRILKTRVPEYNQKQLLGDHLQIVTTRLPIIDEGGRLLGALCVFKDITDAV
FT                   ELAEEVTNLKQVRTMLEAIIQSSDEAISVVDENGIGLLINKAYTKMTGLSEKEVIGKPA
FT                   NTDISEGESMHLKVLETRRPVRGVRMKVGPNEKEVIVNVAPVIVDGILKGSVGVIHDVS
FT                   EIKMLTAELNRARQIIRTLEAKYTFDDIIGKSEQMLVALEQAKLGAKTPATILLRGESG
FT                   TGKELFAHAIHNESDRKYNKFIRVNCAALSENLLESELFGYEDGAFSGAKRGGKKGLFE
FT                   EANNGSIFLDEIGELTQNMQAKLLRVLQEKEIVRVGGTKAIPVNVRVIAATNVNIEKAM
FT                   ADGTFREDLYYRINRYPISIPPLRQRLEDIEALSVRLIQKINRDYGRNVKGLSQQALRA
FT                   LSAYHWPGNVRELENVLGRAMIFLNPHMEWIEKDHLPVFELEQKENDTDQGTGFDFPDI
FT                   EGEKLSVAVEKFEAHLIQQTLEKHHFNRTKTAKALGVSIRNLYYKMDKYGLANEGMQ"
FT   gene            486160..486396
FT                   /locus_tag="BSn5_02590"
FT   CDS_pept        486160..486396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02590"
FT                   /product="hypothetical protein"
FT                   /note="COG4232 Thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93152"
FT                   /protein_id="ADV93152.1"
FT                   /translation="MSRLLALLILVIPGAISALGIKLMRDTLFGHTIKPFSALWLQGLS
FT                   GFIFFAIGLYVLAGFILYRDRKRNQVSPRFRKR"
FT   gene            complement(486438..487343)
FT                   /locus_tag="BSn5_02595"
FT   CDS_pept        complement(486438..487343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02595"
FT                   /product="2-methylisocitrate lyase"
FT                   /note="COG2513 PEP phosphonomutase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02595"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93153"
FT                   /protein_id="ADV93153.1"
FT                   /translation="MSWIVNKQSSQEELAGRFRKLMSAPDILQIPGAHDGMAALLAKEA
FT                   GFSAIYLSGAAYTASRGLPDLGIITSAEIAERAKDLVRAADLPLLVDIDTGFGGVLNAA
FT                   RTAREMLEARVAAVQIEDQQLPKKCGHLNGKQLVPIKEMAQKIKAIKQAAPSLIVVART
FT                   DARAQEGLAAAIKRSEAYIEAGADAIFPEALQAENEFRQFAERIPVPLLANMTEFGKTP
FT                   YYRADEFEDMGFHMVIYPVTSLRAAAKACERMFGLMKEHGSQKEGLHDMQTRKELYDTI
FT                   SYYDYEALDKTIAKTVLPDE"
FT   gene            complement(487360..488796)
FT                   /gene="prpD"
FT                   /locus_tag="BSn5_02600"
FT   CDS_pept        complement(487360..488796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="BSn5_02600"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /note="COG2079 Uncharacterized protein involved in
FT                   propionate catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93154"
FT                   /protein_id="ADV93154.1"
FT                   /translation="MKGAGRMPKTDRVIEEITDYVLEKEITSAEAYTTAGHVLLDTLGC
FT                   GILALRYPECTKLLGPIVPGTTVPNGSKVPGTSYVLDPVRAAFNIGCMIRWLDYNDTWL
FT                   AAEWGHPSDNLGGILAAADYVSRVRLSEGKEPLTVRDVLEMMIKAHEIQGVLALENSLN
FT                   RVGLDHVLFVKVATTAVAAKLLGGGREEIKNALSNAWIDNAALRTYRHSPNTGSRKSWA
FT                   AGDATSRGVHLALMSLKGEMGYPTALSAPGWGFQDVLFNKKEIKLARPLDAYVMENVLF
FT                   KVSYPAEFHAQTAAESAVILHPQVKNRIDEIDRVVIRTHESAIRIIDKKGPLHNPADRD
FT                   HCLQYITAIGLLFGDITAQHYEAETASDPRIDKLRDKMEVTENKTYTEDYLKPDKRSIS
FT                   NAVQVHFKDGTSTEMVECEFPLGHRFRREEAVPKLLEKFSDNLKTHFPDKQHKHIYERC
FT                   TSYETLQTMRVNEFVDMFCM"
FT   gene            complement(488793..489911)
FT                   /locus_tag="BSn5_02605"
FT   CDS_pept        complement(488793..489911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02605"
FT                   /product="citrate synthase 3"
FT                   /EC_number="2.3.3.1"
FT                   /note="COG0372 Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02605"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93155"
FT                   /protein_id="ADV93155.1"
FT                   /translation="MEEKQHYSPGLDGVIAAETHISYLDTQSSQILIRGYDLIELSETK
FT                   SYLELVHLLLEGRLPEESEMETLERKINSASSLPADHLRLLELLPEDTHPMDGLRTGLS
FT                   ALAGYDRQIDDRSPSANKERAYQLLGKMPALTAASYRIINKKEPILPLQTLSYSANFLY
FT                   MMTGKLPSSLEEQIFDRSLVLYSEHEMPNSTFAARVIASTHSDLYGALTGAVASLKGNL
FT                   HGGANEAVMYLLLEAKTTSDFEQLLQTKLKRKEKIMGFGHRVYMKKMDPRALMMKEALQ
FT                   QLCDKAGDHRLYEMCEAGERLMEKEKGLYPNLDYYAAPVYWMLGIPIPLYTPIFFSART
FT                   SGLCAHVIEQHANNRLFRPRVSYMGPRYQTKS"
FT   gene            complement(489945..491084)
FT                   /locus_tag="BSn5_02610"
FT   CDS_pept        complement(489945..491084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02610"
FT                   /product="short chain acyl-CoA dehydrogenase"
FT                   /note="COG1960 Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93156"
FT                   /protein_id="ADV93156.1"
FT                   /translation="MHVTQEQVMMRKMVRDFARKEIAPAAEIMEKTDEFPFQLIKKMGK
FT                   HGLMGIPVPEQYGGAGADVVSYILAIHEISRISAAVGVILSVHTSVGTNPILYFGNEEQ
FT                   KMKYIPNLASGDHLGAFALTEPHSGSDAGSLRTTAIKKNGKYLLNGSKIFITNGGAADI
FT                   YITFALTAPDQGRHGISAFIVEKNTPGFTVGKKERKLGLYGSNTTELIFDNAEVPEANL
FT                   LGKEGDGFHIAMANLNVGRIGIAAQALGIAEAALEHAVDYAKQRVQFGRPIAANQGISF
FT                   KLADMATRAEAARHLVYHAADLHNRGLNCGKEASMAKQFASDAAVKAALDAVQIYGGYG
FT                   YMKDYPVERLLRDAKVTQIYEGTNEIQRLIISKYLLGGT"
FT   gene            complement(491112..491975)
FT                   /locus_tag="BSn5_02615"
FT   CDS_pept        complement(491112..491975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02615"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /note="COG1250 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02615"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93157"
FT                   /protein_id="ADV93157.1"
FT                   /translation="MEIKQIMVAGAGQMGSGIAQTAADAGFYVRMYDVNPEAAEAGLKR
FT                   LKKQLARDAEKGKRTETEVKSVINRISISQTLEEAEHADIVIEAIAENMAAKTEMFKTL
FT                   DRMCPPHTILASNTSSLPITEIAAVTNRPQRVIGMHFMNPVPVMKLVEVIRGLATSEET
FT                   ALDVMALAEKMGKTAVEVNDFPGFVSNRVLLPMINEAIYCVYEGVAKPEAIDEVMKLGM
FT                   NHPMGPLALADFIGLDTCLSIMEVLHSGLGDSKYRPCPLLRKYVKAGWLGKKSGRGFYD
FT                   YEEKTS"
FT   gene            complement(492000..493181)
FT                   /locus_tag="BSn5_02620"
FT   CDS_pept        complement(492000..493181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02620"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="COG0183 Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93158"
FT                   /protein_id="ADV93158.1"
FT                   /translation="MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQRAGVSG
FT                   DDVEGNVMGMVVQAGSGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRA
FT                   QDADILVAGGMESMSNIPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNT
FT                   AAKEYAISRREQDEWALRSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVDKDEAIRR
FT                   DTSLDQLAKLAPIYASDGSITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFST
FT                   TGMPAHELAAAPGFAINKLLKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNV
FT                   NGGAIALGHPIGASGARILMTLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH"
FT   gene            complement(493308..494039)
FT                   /locus_tag="BSn5_02625"
FT   CDS_pept        complement(493308..494039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02625"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="COG0584 Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02625"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93159"
FT                   /protein_id="ADV93159.1"
FT                   /translation="MTKIFAHRGASGQFPENTMLAFEKGIEAGADGIELDVQLTKDGRI
FT                   VVIHDERLNRTTSLKGFVKDTAYDEVKTANAAAGHDQAYSDIKVPLLEDVLSWAVKKDF
FT                   LINIELKNSVIRYEGMEEKVLEAVKRFNVEDRVILSTFNHDSLALCARLAPHIERAVLT
FT                   SDVLYQADRYIASIPASGYHPKLNSPGVTDEVLKKMRNGLIKVRPYTVNRPEDMKRLIE
FT                   AGADGMFTDFPEKASALLKNE"
FT   gene            complement(494118..494732)
FT                   /locus_tag="BSn5_02630"
FT   CDS_pept        complement(494118..494732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02630"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /note="COG0860 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93160"
FT                   /protein_id="ADV93160.1"
FT                   /translation="MLWRSLALCGLALTLAPCAQAAEPIEGKTVYIDAGHGGEDSGAVG
FT                   NGLFEKDINLSVSEHVTDKLKEEGANPVASRSDDHFLTLEERVAKASANQADLFVSIHV
FT                   NSGVASASGTETYFQSDYEGESSRRLASDIQSELVSSLQTRDRGVKESDFYVITYSQMP
FT                   SVLAELGFITNSSDADKLGSEEYQQKAADAIVNGIDSYYDQ"
FT   gene            complement(494753..495145)
FT                   /locus_tag="BSn5_02635"
FT   CDS_pept        complement(494753..495145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02635"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02635"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93161"
FT                   /protein_id="ADV93161.1"
FT                   /translation="MKIMELARLHSRCLYKFAILVKDKSQTSGRGGHVKQTVLLLFTAL
FT                   FLSGCSVASADDSVPRFTEEGKYIGSADPHTIAVSLNGEETMIQVPKDKRDECESLPDQ
FT                   THVLVKYTKKDNGTLQLEDIQLRKNS"
FT   gene            495354..495506
FT                   /locus_tag="BSn5_02640"
FT   CDS_pept        495354..495506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93162"
FT                   /protein_id="ADV93162.1"
FT                   /translation="MKEVKAMKKFVLLLAAAVITCSIGHQISGGYKGPEKERRKHHSAL
FT                   KIFSR"
FT   gene            495579..496697
FT                   /locus_tag="BSn5_02645"
FT   CDS_pept        495579..496697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02645"
FT                   /product="putative NADH-dependent flavin oxidoreductase"
FT                   /note="COG1902 NADH:flavin oxidoreductases, Old Yellow
FT                   Enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02645"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93163"
FT                   /protein_id="ADV93163.1"
FT                   /translation="MNPKYKPLFEPFTFKSGVTINNRIAVAPMTHYASNEDGTISEAEL
FT                   DYIIPRSKEMGMVITACANVTPDGKAFPGQPAIHDDSNIPGLKKLTQAIQAQGAKAVVQ
FT                   IHHGGIECPSELVPQQDVVGPSDVFDNGKQIARALKEEEVENIVKAFGEATRRAIEAGF
FT                   DGVEIHGANGYLIQQFYSPKTNQRTDRWGGSDEKRLAFPLAIVDEVKKAASEHAKGAFL
FT                   VGYRLSPEEPETPGLTMTETYTLVDALGDKELDYLHISLMDVNSKARRGADPTRTRMDL
FT                   LNERVGNKVPLIAVGSIHSADDALAVIENGIPLVAMGREILVDPDWTVKVKEGREKQIE
FT                   TVIKGTDKEKYHLPEPLWQAIVNTPGWVPYKD"
FT   gene            complement(496740..496853)
FT                   /locus_tag="BSn5_02650"
FT   CDS_pept        complement(496740..496853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93164"
FT                   /protein_id="ADV93164.1"
FT                   /translation="MKKKKARKREGFFLDFLFEVGGELFLLLFRCVHKLFI"
FT   gene            complement(497162..497965)
FT                   /locus_tag="BSn5_02655"
FT   CDS_pept        complement(497162..497965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02655"
FT                   /product="response regulator"
FT                   /note="COG0784 FOG: CheY-like receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02655"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93165"
FT                   /protein_id="ADV93165.1"
FT                   /translation="MEKIKVCVADDNRELVSLLSEYIEGQEDMEVIGVAYNGQECLSLF
FT                   KEKDPDVLVLDIIMPHLDGLAVLERLRESDLKKQPNVIMLTAFGQEDVTKKAVDLGASY
FT                   FILKPFDMENLVGHIRQVSGNASSVTHRAPSSQSSIIRSSQPEPKKKNLDASITSIIHE
FT                   IGVPAHIKGYLYLREAISMVYNDIELLGSITKVLYPDIAKKFNTTASRVERAIRHAIEV
FT                   AWSRGNIDSISSLFGYTVSMTKAKPTNSEFIAMVADKLRLEHKAS"
FT   gene            complement(498090..498263)
FT                   /locus_tag="BSn5_02660"
FT   CDS_pept        complement(498090..498263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93166"
FT                   /protein_id="ADV93166.1"
FT                   /translation="MEKKKQADCRSFRQFFYFDPSSLLRIHTVKYTKEDFSTNSRFLVC
FT                   QISFLVEKQRKT"
FT   gene            complement(498241..499521)
FT                   /locus_tag="BSn5_02665"
FT   CDS_pept        complement(498241..499521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02665"
FT                   /product="regulatory membrane-associated serine protease"
FT                   /note="COG0750 Predicted membrane-associated Zn-dependent
FT                   proteases 1"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02665"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93167"
FT                   /protein_id="ADV93167.1"
FT                   /translation="MPDNIRKAVGLILLVSLLSVGLCKPLKEYLLIPTQMRVFETQTQA
FT                   IETSLSVNAQTSESSEAFTVKKDPHEIKVTGKKSGESELVYDLAGFPIKKTKVHVLPDL
FT                   KVIPGGQSIGVKLHSVGVLVVGFHQINTSEGKKSPGETAGIEAGDIIIEMNGQKIEKMN
FT                   DVAPFIQKAGKTGESLDLLIKRDKQKIKTKLIPEKDEGEGKYRIGLYIRDSAAGIGTMT
FT                   FYEPKTKKYGALGHVISDMDTKKPIVVENGEIVKSTVTSIEKGTGGNPGEKLARFSSER
FT                   KTIGDINRNSPFGIFGTLHQPIQNNISDQALPVAFSTEVKKGPAEILTVIDDDKVEKFD
FT                   IEIVSTTPQKFPATKGMVLKITDPRLLKETGGIVQGMSGSPIIQNGKVIGAVTHVFVND
FT                   PTSGYGVHIEWMLSEAGIDIYGKEKAS"
FT   gene            complement(499695..501425)
FT                   /locus_tag="BSn5_02670"
FT   CDS_pept        complement(499695..501425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02670"
FT                   /product="factor for double strand breaks DNA repair and
FT                   genetic recombination"
FT                   /note="COG0497 ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93168"
FT                   /protein_id="ADV93168.1"
FT                   /translation="MLAELSIKNFAIIEELTVSFERGLTVLTGETGAGKSIIIDAISLL
FT                   VGGRGSSEFVRYGEAKAELEGLFLLESGHPVLGVCAEQGIDVSDEMIVMRRDISTSGKS
FT                   VCRVNGKLVTIASLREIGRLLLDIHGQHDNQLLMEDENHLQLLDKFAGAEVESALKTYQ
FT                   EGYQRYMKLLKKLKQLSESEQEMAHRLDLIQFQLEEIESAKLELNEDEQLQEERQQISN
FT                   FEKIYESLQNAYNALRSEQGGLDWVGMASAQLEDISDINEPLKKMSESVSNSYYLLEDA
FT                   TFQMRNMLDELEFDPERLNYIETRLNEIKQLKRKYGATVEDILEYASKIEEEIDQIENR
FT                   DSHLQSLKKELDSVGKDVAVEAENVSQIRKTWAKKLADEIHRELKSLYMEKSTFDTEFK
FT                   VRTASRNEEAPLVNGQPVQLTEQGIDLVKFLISTNTGEPLKSLSKVASGGELSRVMLAI
FT                   KSIFSSQQDVTSIIFDEVDTGVSGRVAQAIAEKIHKVSIGSQVLCITHLPQVAAMADTH
FT                   LYIAKELKDGRTTTRVKPLSKQEKVAEIGRMIAGVEVTDLTKRHAKELLKQADQVKTTG
FT                   "
FT   gene            complement(501462..501911)
FT                   /locus_tag="BSn5_02675"
FT   CDS_pept        complement(501462..501911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02675"
FT                   /product="arginine repressor"
FT                   /note="COG1438 Arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02675"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93169"
FT                   /protein_id="ADV93169.1"
FT                   /translation="MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDI
FT                   KELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQ
FT                   AIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL"
FT   gene            complement(502009..502854)
FT                   /locus_tag="BSn5_02680"
FT   CDS_pept        complement(502009..502854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02680"
FT                   /product="putative methyltransferase with RNA binding
FT                   domain"
FT                   /note="COG1189 Predicted rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93170"
FT                   /protein_id="ADV93170.1"
FT                   /translation="MTSKKERLDVLLVERGLAETREKAKRAIMAGIVYSNENRLDKPGE
FT                   KIDRDLPLTVKGNPLRYVSRGGLKLEKALKEFPVSVKDKIMIDIGSSTGGFTDCALQNG
FT                   AKQSYAVDVGYNQLAWKLRQDERVVVMERTNFRYATPADFTKGMPEFATIDVSFISLRL
FT                   ILPVLRTLLVPGSDCMALVKPQFEAGRESVGKKGIVRDPKVHADVLKRMISFSAAEGYI
FT                   CKGLSFSPITGGDGNIEFLLHLHWPGEGQEGQELPEEEIMRVVEEAHKTLKEKKADVPE
FT                   "
FT   gene            complement(502851..504752)
FT                   /locus_tag="BSn5_02685"
FT   CDS_pept        complement(502851..504752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02685"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="COG1154 Deoxyxylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02685"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93171"
FT                   /protein_id="ADV93171.1"
FT                   /translation="MDLLSIQDPSFLKNMSIDELEKLSDEIRQFLITSLSASGGHIGPN
FT                   LGVVELTIALHKEFNSPKDKFLWDVGHQSYVHKLLTGRGKEFATLRQYKGLCGFPKRSE
FT                   SEHDVWETGHSSTSLSGAMGMAAARDIKGTDEYIIPIIGDGALTGGMALEALNHIGDEK
FT                   KDMIVILNDNEMSIAPNVGAIHSMLGRLRTAGKYQWVKDELEYLFKKIPAVGGKLAATA
FT                   ERVKDSLKYMLVSGMFFEELGFTYLGPVDGHSYHELIENLQYAKKTKGPVLLHVITKKG
FT                   KGYKPAETDTIGTWHGTGPYKINTGDFVKPKAAAPSWSGLVSGTVQRMAREDGRIVAIT
FT                   PAMPVGSKLEGFAKEFPDRMFDVGIAEQHAATMAAAMAMQGMKPFLAIYSTFLQRAYDQ
FT                   VVHDICRQNANVFIGIDRAGLVGADGETHQGVFDIAFMRHIPNMVLMMPKDENEGQHMV
FT                   HTALSYDEGPIAMRFPRGNGLGVKMDEQLKTIPIGTWEVLRPGNDAVILTFGTTIEMAI
FT                   EAAEELQKEGLSVRVVNARFIKPIDEKMMKSILKEGLPILTIEEAVLEGGFGSSILEFA
FT                   HDQGEYHTPIDRMGIPDRFIEHGSVTALLEEIGLTKQQVANRIRLLMPPKTHKGIGS"
FT   gene            complement(504927..505817)
FT                   /locus_tag="BSn5_02690"
FT   CDS_pept        complement(504927..505817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02690"
FT                   /product="geranyltranstransferase"
FT                   /note="COG0142 Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93172"
FT                   /protein_id="ADV93172.1"
FT                   /translation="MTNKLTSFLADRKKTIENQLSVYTEKLDMPDSLKKSMLYSLQAGG
FT                   KRLRPLIVLAVLNAYGKSEKDGIPVGCAVEMIHTYSLIHDDLPCMDDDDLRRGKPTNHK
FT                   VFGEATAVLAGDGLLTESFKLITSHVSDEVSAEKRLRLVNELISAAGTEGMVGGQVADM
FT                   EAENRQVTLEELESIHERKTAKLLGFCVIAGAILADAPEEDIETLRTFSSHIGIGFQIR
FT                   DDILDLEGSEEKIGKRVGSDTTNDKSTYPSLLSLEGAKHKLDVHIKEAKRLIGGLSLQK
FT                   DLLYELCDLIAARDH"
FT   gene            complement(505807..506061)
FT                   /locus_tag="BSn5_02695"
FT   CDS_pept        complement(505807..506061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02695"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COG1722 Exonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02695"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93173"
FT                   /protein_id="ADV93173.1"
FT                   /translation="MTDVKKNENMTFEEAMKGLESIVSKLEEGDVPLEQAINYFQEGMA
FT                   LSKMCHEKLQKVEKQMDFILKEDGELAPFSVQEEDEGDK"
FT   gene            complement(506058..507404)
FT                   /gene="xseA"
FT                   /locus_tag="BSn5_02700"
FT   CDS_pept        complement(506058..507404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="BSn5_02700"
FT                   /product="exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COG1570 Exonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93174"
FT                   /protein_id="ADV93174.1"
FT                   /translation="MGEAAYVTVSALTKYIKRKFDVDPHLENIWIKGELSNVKIHTRGH
FT                   IYFTLKDENARMQSVMFARQSERLPFKPENGMKVLVRGGISVYEPSGNYQLYAKEMQPD
FT                   GVGALYLAYEELKKKLAGEGLFDDRYKKQIPAFPATIGVVTSPTGAAVRDVITTLKRRY
FT                   PLVKVIVLPALVQGENASRSIVTRIEEANEKEICDVLIVGRGGGSIEELWAFNEEIVAR
FT                   AIFASNIPIISAVGHETDFTISDFVADIRAATPTGAAEIAVPHTTDLIERTKTAEVRMT
FT                   RAMQQHLGQKKERIQTLQSSYAFRFPKRLYAQKEQQFDLAYQQFQAQLTALLDRKSRQL
FT                   ERETYRLEALHPHEQLKQARTRYQEQTNQLRKNMNIQMKQLHSQFQTVLGKLNALSPLQ
FT                   VMERGYSLAYKEDKLIKSVSQIEEQDRLEVKLKDGVLTCEVLEKRGEEK"
FT   gene            complement(507542..508393)
FT                   /locus_tag="BSn5_02705"
FT   CDS_pept        complement(507542..508393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02705"
FT                   /product="bifunctional 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/ 5,10-methylene-tetrahydrofolate
FT                   cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="COG0190 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02705"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93175"
FT                   /protein_id="ADV93175.1"
FT                   /translation="MTATIIDGKETAREKREQLAKEVEELKKQGVTPGLAVILIGDDPA
FT                   SHSYVRGKKKAAETMGMNFKLDQFDSSLTEAELLSIIDQYNQDPEFHGILVQLPLPDHI
FT                   SEKAVIERISPDKDVDGFHPLNVGKMLLGEDTFLPCTPHGIVELLKKTNIDLSGKEVVV
FT                   VGRSNIVGKPVGQLLLNENATVTYCHSRTENITEHTKKADILVVAVGRANFISADQIKE
FT                   GAVVIDVGVNRLENGKLCGDVEFEGAKEKASFITPVPGGVGPMTITMLAHNTVKSAKRT
FT                   LS"
FT   gene            complement(508405..508800)
FT                   /gene="nusB"
FT                   /locus_tag="BSn5_02710"
FT   CDS_pept        complement(508405..508800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="BSn5_02710"
FT                   /product="transcription antitermination protein NusB"
FT                   /note="COG0781 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93176"
FT                   /protein_id="ADV93176.1"
FT                   /translation="MKRRTAREKALQALFQIDVSDIAVNEAIEHALDEEKTDPFFEQLV
FT                   HGVLEHQDQLDEMISKHLVNWKLDRIANVDRAILRLAAYEMAYAEDIPVNVSMNEAIEL
FT                   AKRFGDDKATKFVNGVLSNIKSDIEQS"
FT   gene            complement(509064..509471)
FT                   /locus_tag="BSn5_02715"
FT   CDS_pept        complement(509064..509471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02715"
FT                   /product="hypothetical protein"
FT                   /note="COG1302 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02715"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93177"
FT                   /protein_id="ADV93177.1"
FT                   /translation="MKDNSLLKMDHEDTHLGKVEIAPEVIEVIAGIAASEVDGVAEMRG
FT                   NFATGVVERFGKVNHGKGVKVDLADDGITIDVYCVVTFGVSIPKVAASVQENIRQTLLN
FT                   MTSLSINEINIHIVGIQFDTKAQEVQIDEEM"
FT   gene            complement(509492..510844)
FT                   /locus_tag="BSn5_02720"
FT   CDS_pept        complement(509492..510844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02720"
FT                   /product="acetyl-CoA carboxylase biotin carboxylase
FT                   subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0439 Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93178"
FT                   /protein_id="ADV93178.1"
FT                   /translation="MIKKLLIANRGEIAVRIIRACRELGIETVAVYSEADKDALHVQMA
FT                   DEAFCIGPKASKDSYLNVTNIVSVAKLTGTDAIHPGYGFLAENADFAELCEEVNVTFVG
FT                   PSADAISKMGTKDVARETMKQAGVPIVPGSQGIIENVEEAVSLANEIGYPVIIKATAGG
FT                   GGKGIRVARTEEELINGIKITQQEAATAFGNPGVYIEKYIEDFRHVEIQVLADNYGNTI
FT                   HLGERDCSIQRRLQKLLEESPSPALDSEIREQMGDAAVKAAKAVGYTGAGTVEFIYDYN
FT                   EQRYYFMEMNTRIQVEHPVTEMVTGTDLIKEQIKVASGMELSLKQEDVEFEGWAIECRI
FT                   NAENPSKNFMPSPGEIKMYLPPGGLGVRVDSAAYPGYSIPPYYDSMIAKVITYGKTRDE
FT                   AIARMKRALSEFVIEGIETTIPFHLKLLEHETFVSGEFNTKFLETYDVMGS"
FT   gene            complement(510856..511335)
FT                   /locus_tag="BSn5_02725"
FT   CDS_pept        complement(510856..511335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02725"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0511 Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02725"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93179"
FT                   /protein_id="ADV93179.1"
FT                   /translation="MLNIKEIHELIKAIDESTIDEFVYENEGVSLKLKKHEAGTVQVMQ
FT                   QAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHKITSPMVGTFYASSSPEAGPYV
FT                   TAGSKVNENTVVCIVEAMKLFNEIEAEVKGEIVEVLVENGQLVEYGQPLFLVKAE"
FT   gene            complement(511492..512148)
FT                   /locus_tag="BSn5_02730"
FT   CDS_pept        complement(511492..512148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02730"
FT                   /product="stage III sporulation ratchet engulfment protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93180"
FT                   /protein_id="ADV93180.1"
FT                   /translation="MLKKQTVWLLTMLSLVVVLSVYYIMSPESKNAVEMQSEKSASDSG
FT                   EVATEKAPAKQDKKEKSGTETEKGKEDGTKGTKDSSADKETSAEASEKGTVVTETADDD
FT                   LFTTYRLDLEDARSKEREELNAIVSSDDATAKEKSEAYDKMTALSEVEGTEKQLETLIK
FT                   TQGYEDALVNAEGDKINITVKSDKHSKSKATAIIDLVAKEIKTMKDVAVTFEPSK"
FT   gene            complement(512149..512838)
FT                   /locus_tag="BSn5_02735"
FT   CDS_pept        complement(512149..512838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02735"
FT                   /product="stage III sporulation protein AG"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02735"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93181"
FT                   /protein_id="ADV93181.1"
FT                   /translation="MNKNGLWNVLKKQFLPGQMKDGEKPKLTKYHYFLFVFVLGVSFML
FT                   VSQLFSSPEKTENAKTITAVSSQHSADSKEKTAEVFKASKSDKPKDSIDDYEKEYENQL
FT                   KEILETIIGVDDVSVVVNVDATSLKVYEKNKSNKNTTTEETDKEGGTRSVTDQTSEEEI
FT                   VMIKNGDKETPVVVQTKKPDIRGVLVVAQGVDNVQIKQTIIEAVTRVLDVPSHRVAVAP
FT                   KKIKEDS"
FT   gene            complement(512831..513451)
FT                   /locus_tag="BSn5_02740"
FT   CDS_pept        complement(512831..513451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02740"
FT                   /product="stage III sporulation protein AF"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93182"
FT                   /protein_id="ADV93182.1"
FT                   /translation="MSFLTEWLTTIVLFILFAIVIDMLLPSSSMQKYAKMVVSLLLIVV
FT                   MLTPIFKLFKTDPEVIFEYLTKNGQSESADIKNQINSKKIEIQASQRAYILEEMAVQLK
FT                   KKAEERFSHDEYKVGRIKLTAGEKVDSEEDIKTISVYMAPSSEKTVQTVAPVHIDTDHA
FT                   YVTKEAAEQREAKQIQTQLADIWEIGSEKITVHMEGGESVGNE"
FT   gene            complement(513465..514664)
FT                   /locus_tag="BSn5_02745"
FT   CDS_pept        complement(513465..514664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02745"
FT                   /product="stage III sporulation protein AE"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02745"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93183"
FT                   /protein_id="ADV93183.1"
FT                   /translation="MKRFQWVLLLAVLIIAGRAEIVQAAGNAEQTEDHAETAEQLAERT
FT                   AASLETDKIGEFWNDIMTEYGGLLPESQKGSLMEFINGDKSFSPQEWLKALFSYLFHEV
FT                   LANGKLLGTLILLTIFCVILQLLQNAFQQSTVSKVAYSIVYMVLIILALNSFHVAINYA
FT                   TEAIQTMTSFILALIPLLLALLASSGGAVSAAFFHPVILFLMNTSGLLIQNIVMPLIFL
FT                   SAILSIVSTMTEQYKVTQLANLLRNIAIGALAVFLTIFLGVISVQGASAAVTDGITLRT
FT                   AKFITGNFIPVLGRMFTDATDTVISASLLLKNTVGILGVAILICIAAFPAIKVLSLAFI
FT                   YKLAAAILQPLGGGPVITCLDVISKSVIYIFAALAIVSLMFFLSLTVIITAGNLTMMMK
FT                   "
FT   gene            complement(514683..515084)
FT                   /locus_tag="BSn5_02750"
FT   CDS_pept        complement(514683..515084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02750"
FT                   /product="stage III sporulation protein AD"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93184"
FT                   /protein_id="ADV93184.1"
FT                   /translation="MQIDIVQIVGLGLIATFLSLIVKEQKPTFAFLIVVFAGCAIFLYL
FT                   VDQIYDIIRMIEKIAINANVNMVYVETILKIIGIAYIAEFGAQLTKDAGQGAIASKIEL
FT                   AGKILILVMAVPILTVIIETILGLIPSMS"
FT   gene            complement(515091..515297)
FT                   /locus_tag="BSn5_02755"
FT   CDS_pept        complement(515091..515297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02755"
FT                   /product="stage III sporulation protein AC"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02755"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93185"
FT                   /protein_id="ADV93185.1"
FT                   /translation="MGVDVNVIFQIAGVGIVVAFLHTILDQMGKKEYAQWVTLLGFIYI
FT                   LFMVATIVDDLFKKIKAVFLFQG"
FT   gene            complement(515320..515835)
FT                   /locus_tag="BSn5_02760"
FT   CDS_pept        complement(515320..515835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02760"
FT                   /product="stage III sporulation protein SpoAB"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93186"
FT                   /protein_id="ADV93186.1"
FT                   /translation="MLKLLGAVFIVVATTWTGFEMAKIYTERPRQIRQLRAALQSLEAE
FT                   IMYGHTPLHTASQQIAKQLAQPVSALFSAFSDQLDKGSDSAKTAWEQSLKKVWDTLSLK
FT                   KSEYEVLKQFGETLGIHDRISQQKHIKLALSHLEASEADAEQAQAKNEKMIKSLGFLAG
FT                   LLLILLLM"
FT   gene            complement(515829..516752)
FT                   /locus_tag="BSn5_02765"
FT   CDS_pept        complement(515829..516752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02765"
FT                   /product="stage III sporulation protein AA"
FT                   /note="COG3854 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02765"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93187"
FT                   /protein_id="ADV93187.1"
FT                   /translation="MNEIAEVLPESMKNALSEIPEQQWLEIEEVRIRINRPVELIRRGQ
FT                   PVYLSYAGTAEDAHLILSRLSNYSMYTLEEELKKGYVTIRGGHRVGLAGRVITENGGVK
FT                   GLRDIASFNIRIARQKLGIAEPLLPYLYQSSWLNTLIIGPPQTGKTTLLRDLARLSSTG
FT                   KKPMLPVKTGIVDERSEIAGCLRGIPQHQFGQRIDVLDACPKAEGLMMMIRSMSPEVMI
FT                   VDEIGRMEDTDALLEALHAGVSVIVSAHGWSISDLMKRPSLKRLWEERAFDRYLELSRA
FT                   KGPGTVSQIYDKDGNVLSRTTGVKTC"
FT   gene            complement(516828..517109)
FT                   /locus_tag="BSn5_02770"
FT   CDS_pept        complement(516828..517109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93188"
FT                   /protein_id="ADV93188.1"
FT                   /translation="MKFLLGNINSTVLTMAGLRVLSSMIELTAAIVMLVTNDVRKAVVV
FT                   NSILAIVGPLIFIITMTVGIYQIAGQLSYAKLILIFTGVVLILAGVHK"
FT   gene            complement(517254..517811)
FT                   /locus_tag="BSn5_02775"
FT   CDS_pept        complement(517254..517811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02775"
FT                   /product="elongation factor P"
FT                   /note="COG0231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02775"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93189"
FT                   /protein_id="ADV93189.1"
FT                   /translation="MISVNDFRTGLTIEVDGGIWRVVDFQHVKPGKGAAFVRSKLRNLR
FT                   TGAIQEKTFRAGEKVAKAQIETKTMQYLYANGDQHVFMDTSSYEQLELSATQIEEELKY
FT                   LLENMSVHIMMYQDETLGIELPNTVELKVVETEPGIKGDTASGGTKPAKTETGLVVNVP
FT                   FFVNEGDTLVVNTSDGSYVSRA"
FT   gene            complement(517836..518897)
FT                   /locus_tag="BSn5_02780"
FT   CDS_pept        complement(517836..518897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02780"
FT                   /product="putative aminopeptidase"
FT                   /note="COG0006 Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93190"
FT                   /protein_id="ADV93190.1"
FT                   /translation="MKLEKLRNLFGQLGIDGMLITSSTNVRYMTGFTGSAGLAVISGDK
FT                   AAFITDFRYTEQAKVQVKGFEIIEHGGSLIQTTADTVESFGIKRLGFEQNSMTYGTYAS
FT                   YNAVISDAELVPVAESVEKLRLIKSSEEIKILEEAAKIADDAFRHILTFMKPGISEIAV
FT                   ANELEFYMRSQGADSSSFDMIVASGLRSSLPHGVASDKLIESGDLVTLDFGAYYKGYCS
FT                   DITRTVAVGQPSDQLKEIYQVVFDAQALGVAHIKPGMTGKEADALTRDHIAAKGYGDYF
FT                   GHSTGHGLGMEVHESPGLSVRSSAILEPGMVVTVEPGIYIPETGGVRIEDDIVITENGN
FT                   RTITHSPKELIIL"
FT   gene            complement(518894..519340)
FT                   /locus_tag="BSn5_02785"
FT   CDS_pept        complement(518894..519340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02785"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="COG0757 3-dehydroquinate dehydratase II"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02785"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93191"
FT                   /protein_id="ADV93191.1"
FT                   /translation="MPHFLILNGPNVNRLGSREPEVFGRQTLTDIETDLFQFAEALHIQ
FT                   LTFFQSNHEGDLIDAIHEAEEQYSGIALNPGALSHYSYAIRDAVSSISLPVVEVHLSNL
FT                   YAREEFRHQSVIAPVAKGQIVGLGAEGYKLAVRYLLSQQGGESR"
FT   gene            complement(519427..519960)
FT                   /locus_tag="BSn5_02790"
FT   CDS_pept        complement(519427..519960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02790"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93192"
FT                   /protein_id="ADV93192.1"
FT                   /translation="MTSEKDTEQNEELNEKQKPPVSMAGRVAATGFCGGVLWSFVAYIA
FT                   YLFHFSEISPNMILQPFVLGEWKKHGLGTVISIILIGVISIGAAFLYFLLLKRLKTMWP
FT                   GILYGLVLWLLVFFVFNPIFPDVRTVTELTSDTIITTICIYLLYGLFVGYSISFEYNEL
FT                   NSEKLARALGMHRE"
FT   gene            520190..521146
FT                   /locus_tag="BSn5_02795"
FT   CDS_pept        520190..521146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02795"
FT                   /product="hypothetical protein"
FT                   /note="COG3872 Predicted metal-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02795"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93193"
FT                   /protein_id="ADV93193.1"
FT                   /translation="MSKHKVPPAYGGQAVVEGVMFGGKHHYVTAIRRTDGSIDFFKLPR
FT                   KHNPKLNIVKKIPFLRGIAAIIEASANGTKHLNFSSERYGLDPSEDETLEQEEKKSSGL
FT                   SMYLSLAVIGVLSFLFSKFVFTLVPVFLAELTRPIFSSDTAQIAFESLFKLILLLGYIY
FT                   FLSMTPLIKRVFQYHGAEHKVINCYEQNLPITVENVQNQSRLHYRCGSSFILFTIIVGM
FT                   FVYLLVPTDPLWLRVIDRVALIPVVLGISFEVLQLTNKVRDIPGLKLLGYPGLWLQLLT
FT                   TKEPKDDQVEVAIESFNELLRLEALSEQNQKPSHNVI"
FT   gene            521186..521581
FT                   /locus_tag="BSn5_02800"
FT   CDS_pept        521186..521581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93194"
FT                   /protein_id="ADV93194.1"
FT                   /translation="MNHRVQPIIAVLIALGAFGFLYVLVTNPGEMAKMAVTVIVAGIII
FT                   YFIVKYVMNRNAGSEGAAFKKAAKQSRRRMKEQKAKHRAGHKGRVSHLRSVPSASKPKP
FT                   MILKKKSQTQLTVIEGKKNKKKNRALF"
FT   gene            complement(521578..522453)
FT                   /locus_tag="BSn5_02805"
FT   CDS_pept        complement(521578..522453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02805"
FT                   /product="hypothetical protein"
FT                   /note="COG1752 Predicted esterase of the alpha-beta
FT                   hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02805"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93195"
FT                   /protein_id="ADV93195.1"
FT                   /translation="MYIDGVFSGGGVKGIALAGAYEALEEKGFRFKRVAGTSAGAIIAA
FT                   FIASGYTSKEIHALIEEVDGEKLLDQRYSFLPLKMLQWVSIYWRLGLYKGDTIEKWIAD
FT                   LLRAKGIRVFGDLQKGSLRLIASDLTNGTMIVLPDDLARYGLNPDMFPVARAVRMSCSI
FT                   PYFFEPIKLKTDTGTATVVDGGVLSNFPIWLFSKERKRPVIGVTLAPRERERPKKNIRN
FT                   AFELFGALFETMKDAHDARHIASRYEQNIIFLPVDGVMATDFHLTQQKKLALIELGKRR
FT                   TELFLKQWTY"
FT   gene            complement(522579..523007)
FT                   /locus_tag="BSn5_02810"
FT   CDS_pept        complement(522579..523007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02810"
FT                   /product="manganese transport transcriptional regulator"
FT                   /note="COG1321 Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93196"
FT                   /protein_id="ADV93196.1"
FT                   /translation="MTTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQK
FT                   LDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHH
FT                   LSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEHHNQ"
FT   gene            complement(523107..523943)
FT                   /locus_tag="BSn5_02815"
FT   CDS_pept        complement(523107..523943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02815"
FT                   /product="lipoate-protein ligase A"
FT                   /note="COG0095 Lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02815"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93197"
FT                   /protein_id="ADV93197.1"
FT                   /translation="MQKETWRFIDSGNASPAFNMALDEALLYWHSEKKIPPVIRFYGWN
FT                   PATLSVGYFQNIKKEINFEAVHKYNLGFVRRPTGGRGVLHDQELTYSVIVSEEHPEMPA
FT                   TVTEAYRVISEGILQGFRNLGLDAYFAIPRTEKEKESLKNPRSSVCFDAPSWYELVVEG
FT                   RKVAGSAQTRQKGVILQHGSILLDLDEDKLFDLFLYPSERVRERMQRNFKNKAVAINEL
FT                   TEKRVTMDEARKAFKEGFETGLNIHLEPYELSQEELDFVHHLAETKYASDEWNYKR"
FT   gene            524134..524514
FT                   /locus_tag="BSn5_02820"
FT   CDS_pept        524134..524514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02820"
FT                   /product="putative sulfur transferase"
FT                   /note="COG0607 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93198"
FT                   /protein_id="ADV93198.1"
FT                   /translation="MSNMIVLIIFAAFIIYMIASYVYQQRIMKTLTEEEFRAGYRKAQL
FT                   IDVREPNEFEGGHILGARNIPLSQLKQRKNEIRTDKPVYLYCQNSVRSGRAAQTLRKNG
FT                   CTEIYNLKGGFKKWGGKIKAKK"
FT   gene            complement(524549..526015)
FT                   /locus_tag="BSn5_02825"
FT   CDS_pept        complement(524549..526015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02825"
FT                   /product="glycine dehydrogenase subunit 2"
FT                   /EC_number="1.4.4.2"
FT                   /note="COG1003 Glycine cleavage system protein P
FT                   (pyridoxal-binding), C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02825"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93199"
FT                   /protein_id="ADV93199.1"
FT                   /translation="MSNQDQALIFELSREGRIGYSLPELDVPEIELGDLLSDTYIRDED
FT                   AALPEVSELDIMRHYTALSKRNHGVDSGFYPLGSCTMKYNPKINEKIARIPGFAAIHPL
FT                   QDEDTVQGALELLYDLSKHLEEITGMDEVTLQPAAGAHGEWTGLMMIRAYHEARGDFKR
FT                   TKVIVPDSAHGTNPASATVAGFETVTVKSNEKGLVDLEDLKRAVNEETAALMLTNPNTL
FT                   GLFEEQITEMAEIVHQAGGKLYYDGANLNAVLSKARPGDMGFDVVHLNLHKTFTGPHGG
FT                   GGPGSGPVGVKQDLIPYLPKPVLVKKEGRFTFDYDRPHAIGRVKPYYGNFGINVRAYTY
FT                   IRSMGPDGLKAVTENAVLNANYMMRKLAPYYDLPFDRHCKHEFVLSGKRQKKLGVRTLD
FT                   IAKRLLDFGYHPPTIYFPLNVEECIMIEPTETESKETLDAFIDAMIQIAKEAEENPELV
FT                   QEAPHTTIVKRMDETKAARHPVLRYEAVER"
FT   gene            complement(526008..527354)
FT                   /locus_tag="BSn5_02830"
FT   CDS_pept        complement(526008..527354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02830"
FT                   /product="glycine dehydrogenase subunit 1"
FT                   /EC_number="1.4.4.2"
FT                   /note="COG0403 Glycine cleavage system protein P
FT                   (pyridoxal-binding), N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93200"
FT                   /protein_id="ADV93200.1"
FT                   /translation="MKHRYLPATEKDKQEMLATIGVSSIDDLFADIPENVKYKKEYQIK
FT                   KAKSETELTRELTKLASKNRDTVQYASFLGAGVYDHYQPVIVDHVISRSEFYTAYTPYQ
FT                   PEISQGELQAIFEFQTMICELTGMDIANSSMYDGGTALAEAAMLASGHTKKKKIVVSKT
FT                   VHPESREVLKTYAKGQYIDVVEVPAADGVTDLDALRQTVCENTAAVIVQYPNFFGRIEP
FT                   LKEIEPIAHQGKSMFIVSANPLALGLLTPPGKFQSDIVVGDAQPFGIPSAYGGPHCGFF
FT                   AVTKKLMRKVPGRLVGQTEDENGKRGFVLTLQAREQHIRRDKATSNICSNQALNALAAS
FT                   VAMTALGKNGVKDIARQNLLKANYAKQEAKKAGLTVMFDGPMFNEFVIKLDEPVRAVNK
FT                   RLLAKGMIGGYDLGLTYPELDCHMLIAVTELRTKEEIDALIQELGDRHE"
FT   gene            complement(527384..528472)
FT                   /gene="gcvT"
FT                   /locus_tag="BSn5_02835"
FT   CDS_pept        complement(527384..528472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="BSn5_02835"
FT                   /product="glycine cleavage system aminomethyltransferase T"
FT                   /EC_number="2.1.2.10"
FT                   /note="COG0404 Glycine cleavage system T protein
FT                   (aminomethyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02835"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93201"
FT                   /protein_id="ADV93201.1"
FT                   /translation="MLKRTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAG
FT                   LFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALTPGRAQYTAMCYPDGGTVDDLLIYQKE
FT                   ENRYLLVINASNIDKDLAWMKEHAAGDVQIDNQSDQIALLAVQGPKAEAVLKNLTDADV
FT                   SALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIP
FT                   CGLGARDTLRFEAKLPLYGQELTRDITPIEAGIGFAVKHNKESDFFGKSVLSEQKENGA
FT                   KRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTV
FT                   VDVEIRKKLVKAKVVKTPFYKR"
FT   gene            528914..530587
FT                   /locus_tag="BSn5_02840"
FT   CDS_pept        528914..530587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02840"
FT                   /product="putative RNA polymerase-associated helicase
FT                   protein"
FT                   /note="COG0553 Superfamily II DNA/RNA helicases, SNF2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93202"
FT                   /protein_id="ADV93202.1"
FT                   /translation="MNTEMIYDAKWPEEFAERLKNDGPWANWELYKLSAEIQKTLAIPD
FT                   FEGLRAPLYLPSFTPLPHQLEVAQKVVEKMNGKAILADEVGLGKTVEAGLILKEYMIRG
FT                   LAKKILILVPASLVSQWVKELQEKFLIPAVEQKKSYVWEQCDIVVSSIDTAKRSPHREI
FT                   VLSIPYDLVIIDEAHKLKNSKTKNYEFVRNLVKKYCLLLTATPIQNRIEEIFNLVSLLK
FT                   PGHLGSQNHFQEEFAKKKSSLEAHEHLKDLVNKVMIRNRRHDTGLNWKQRHVETVPIQF
FT                   SPSEQALYDEISRLKESINKPASMFSIMTLQRECCSSREAVYMTLKKMLDQKEKQAPAI
FT                   DEDTISVLIDRINQVTQNSKALQVVDLIKKIDDKVIIFTEYRATQIYLQWFLQQNGISS
FT                   VPFRGGFKRGKKDWMKDLFRGKIQVLIATEAGGEGINLQFCNHMINYDLPWNPMRLEQR
FT                   IGRIHRLGQERDVHIYNMATKHTVEEHILKLLYEKIHLFEKVVGELDDILTKIQVNNFE
FT                   EHLHDILYHSATEEEMKIKMDNLTSFLSYKKQQPAEKRGS"
FT   gene            530608..531402
FT                   /locus_tag="BSn5_02845"
FT   CDS_pept        530608..531402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02845"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93203"
FT                   /protein_id="ADV93203.1"
FT                   /translation="MRQQEVHDFLLRFFQANSCQIIDQGLGYMTVQLTVEMDKQIMNRP
FT                   FYWHWREKTGGDPNPMKITFITDKENAPKDLDGEFIYFGAPRLFQIFKAVKQNGRFTRM
FT                   YEKIESAGAKVPLQPWLGINVTISYQSDMKKDKLLSLGLHLVSGTIIEDFQSKLTQFSL
FT                   TSQICDYCFTISPMIKPESGLKRMENYISKSAMQEPSDWAEQAVNRWKNDMTLLDKFYE
FT                   HIEEKPEEYHLEKQALKTLYQPKISVEIENGGLFYLQNNISS"
FT   gene            531585..531758
FT                   /locus_tag="BSn5_02850"
FT   CDS_pept        531585..531758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02850"
FT                   /product="antagonist of SinR"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93204"
FT                   /protein_id="ADV93204.1"
FT                   /translation="MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHP
FT                   GPAARSHTVNPF"
FT   gene            531792..532127
FT                   /locus_tag="BSn5_02855"
FT   CDS_pept        531792..532127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02855"
FT                   /product="transcriptional regulator SinR"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02855"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93205"
FT                   /protein_id="ADV93205.1"
FT                   /translation="MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQ
FT                   FLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKW
FT                   RKSQKEE"
FT   gene            complement(532220..533005)
FT                   /locus_tag="BSn5_02860"
FT   CDS_pept        complement(532220..533005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02860"
FT                   /product="major biofilm matrix component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93206"
FT                   /protein_id="ADV93206.1"
FT                   /translation="MGMKKKLSLGVASAALGLALVGGGTWAAFNDIKSKDATFASGTLD
FT                   LSAKENSASVNLSNLKPGDKLTKDFQFENNGSLAIKEVLMALNYGDFKANGGSNTSPED
FT                   FLSQFEVTLLTVGKEGGNGYPKNIILDDANLKDLYLMSAKNDAAAAEKIKKQIDPKFLH
FT                   ASGKVNVATIDGKTAPEYDGVPKTPTDFDQVQMEIQFRDDKTKDENGLMVQNKYQGNSI
FT                   KLQFSFEATQWNGLTIKKDHTDKDGYVKENEKAHSEDKN"
FT   gene            complement(533069..533641)
FT                   /locus_tag="BSn5_02865"
FT   CDS_pept        complement(533069..533641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02865"
FT                   /product="type I signal peptidase"
FT                   /note="COG0681 Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02865"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93207"
FT                   /protein_id="ADV93207.1"
FT                   /translation="MKLISNILYVIIFTLIIVLTLVVISTRSSGGEPAVFGYTLKSVLS
FT                   GSMEPEFNTGSLILVKEIADVKELQKGDVITFMQDANTAVTHRIVDITKQGDHLLFKTK
FT                   GDNNAAADSAPVSDENVRAQYTGFQLPYAGYMLHFASQPIGTAVLLIVPGVMLLVYAFV
FT                   TISSAIREIERKTKALETDTKDSTMST"
FT   gene            complement(533625..534386)
FT                   /locus_tag="BSn5_02870"
FT   CDS_pept        complement(533625..534386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02870"
FT                   /product="lipoprotein for biofilm formation"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93208"
FT                   /protein_id="ADV93208.1"
FT                   /translation="MFRLFHNQQKAKTKLKVLLIFQLSVIFSLTAAICLQFSDDTSAAF
FT                   HDIETFDVSLQTCKDFQHTDKNCHYDKRWDQSDLHISDQTDTKGTVCSPITLFAVLENI
FT                   GEKLKKSKWKWELHKLENARKPLKDGNVIEKGFVSNQIGDSLYKIETKKKMKPGIYAFK
FT                   VYKPAGYPANGSTFEWSEPMTLAKCDEKPTVPKKETKSDVKKENETTQKDIQEKTMKEE
FT                   TSQEAVTKENETQSDQKESGEEDEKSNEADQ"
FT   gene            534661..534984
FT                   /locus_tag="BSn5_02875"
FT   CDS_pept        534661..534984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02875"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02875"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93209"
FT                   /protein_id="ADV93209.1"
FT                   /translation="MIKQCVICLSLLVFGTTAAHAEETPLVTARHMSKWEEIAVKEAKK
FT                   RYPLAQVLFKQKVWDRKRKDEAVKQYHLTLREGSKEFGVFVTISFDPYSQKVNKIAILE
FT                   EYQ"
FT   gene            complement(535026..535205)
FT                   /locus_tag="BSn5_02880"
FT   CDS_pept        complement(535026..535205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93210"
FT                   /protein_id="ADV93210.1"
FT                   /translation="MKTNDYVKYMTQQFVKYIDTPRDERKERKEVRKETKTPASQQWFG
FT                   ILPYGFRLWLKRKK"
FT   gene            complement(535276..535650)
FT                   /locus_tag="BSn5_02885"
FT   CDS_pept        complement(535276..535650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02885"
FT                   /product="component of the DNA transport platform"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02885"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93211"
FT                   /protein_id="ADV93211.1"
FT                   /translation="MYRTRGFIYPAILFVSALVLLIVNFAAAQYISRCMFEKETKELYI
FT                   GENLLQNGVLLSIRHVLEERKGQEGTEQFPYGRVSYYIHDTSIKEQKEINLRVSTESGT
FT                   ERTAQIVFDQKQKKLLRWTE"
FT   gene            complement(535651..535998)
FT                   /locus_tag="BSn5_02890"
FT   CDS_pept        complement(535651..535998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02890"
FT                   /product="component of the DNA transport platform"
FT                   /note="COG4940 Competence protein ComGF"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93212"
FT                   /protein_id="ADV93212.1"
FT                   /translation="MFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLIC
FT                   TNLSRQDIRFDIYHSMIRKRVDGKGHVPILDHITAMKADFENGVVLLKIESEDQKVYQT
FT                   AFPVYSYLGGR"
FT   gene            complement(536060..536407)
FT                   /locus_tag="BSn5_02895"
FT   CDS_pept        complement(536060..536407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02895"
FT                   /product="component of the DNA transport platform"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02895"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93213"
FT                   /protein_id="ADV93213.1"
FT                   /translation="MWRENKGFSTIETMSALSLWLFVLLTVVPLWDKLIADEKMAESRE
FT                   IGYQIMNESISKYVMSGEGAASKTITKNNHIYAMKWEEEGDYQNVCIKATAYKEKSYCL
FT                   SILQTEWLHAS"
FT   gene            complement(536391..536822)
FT                   /locus_tag="BSn5_02900"
FT   CDS_pept        complement(536391..536822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02900"
FT                   /product="membrane component of the DNA transport platform"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93214"
FT                   /protein_id="ADV93214.1"
FT                   /translation="MNIKLNEEKGFTLLESLLVLSLASILLIAVFTTLPPAYDNTAVRQ
FT                   AARQLKNDIMLTQQTAISRQQRTKIFFHKKEYQLVIGDTVIERPYARGLSIELLTLKDR
FT                   LEFNEKGHPNAGGKIRVNGHAVYDITVYLGSGRVNVERK"
FT   gene            complement(536812..537108)
FT                   /locus_tag="BSn5_02905"
FT   CDS_pept        complement(536812..537108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02905"
FT                   /product="pilin-like component of the DNA transport
FT                   membrane platform"
FT                   /note="COG4537 Competence protein ComGC"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02905"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93215"
FT                   /protein_id="ADV93215.1"
FT                   /translation="MNEKGFTLVEMLIVLFIISILLLITIPNVTKHNQTIQKKGCEGLQ
FT                   NMVKAQMTAFELDHEGQTPSLADLQSEGYVKKEAVCPNGKRIIITGGEVKVEH"
FT   gene            complement(537122..538159)
FT                   /locus_tag="BSn5_02910"
FT   CDS_pept        complement(537122..538159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02910"
FT                   /product="membrane platform component of the DNA transport
FT                   machinery"
FT                   /note="COG1459 Type II secretory pathway, component PulF"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93216"
FT                   /protein_id="ADV93216.1"
FT                   /translation="MKKIRKVWSLKDQARLLKRLGEMTAGGYTLLDGLRLMELQMNKRQ
FT                   AADLTDTVTCLREGAPFYQVLKSLSFHKEAVGICYFAETHGELPASMIQSGELLERKIA
FT                   QADQLKRVLRYPLFLIFTVAVMFYMLQSIIIPQFSGIYQSMNMETSRSTDMLFAFFQHI
FT                   DLVIILLVLFTAGIGIYYWLVFKKKSPARQMLICIRIPLVGKLVKLFNSYFFSLQLSSL
FT                   LKSGLSIYDSLNAFKHQTFLPFYRCEAEQLIERLKAGKSIESAICGSPFYETDLSKVIS
FT                   HGQLSGRLDRELFTYSQFILQRLEHKAQKWTGILQPMIYGFVAAMILLVYLSMLVPMYQ
FT                   MMNQM"
FT   gene            complement(538146..539216)
FT                   /locus_tag="BSn5_02915"
FT   CDS_pept        complement(538146..539216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02915"
FT                   /product="membrane associated factor for DNA competence"
FT                   /note="COG2804 Type II secretory pathway, ATPase PulE/Tfp
FT                   pilus assembly pathway, ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02915"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93217"
FT                   /protein_id="ADV93217.1"
FT                   /translation="MDSIEKVSKNLIEEAYLTKASDIHIVPRERDAIIHFRVDHALLKK
FT                   RDMKKEECVRLISHFKFLSAMDIGERRKPQNGSLTLKLKEGNVHLRMSTLPTINEESLV
FT                   IRVMPQYNIPSIDKLSLFPKTGATLLSFLKHSHGMLIFTGPTGSGKTTTLYSLVQYAKK
FT                   HFNRNIVTLEDPVETRDEDVLQVQVNEKAGVTYSTGLKAILRHDPDMIILGEIRDAETA
FT                   EIAVRAAMTGHLVLTSLHTRDAKGAIYRLLEFGINMNEIEQTVIAIAAQRLVDLACPFC
FT                   ENGCSSVYCRQSRNTRRASVYELLYGKNLQQCIQEAKGNHANYQYQTLRQIIRKGIALG
FT                   YLTTNNYDRWVYHEKD"
FT   gene            complement(539428..539625)
FT                   /locus_tag="BSn5_02920"
FT   CDS_pept        complement(539428..539625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02920"
FT                   /product="hypothetical protein"
FT                   /note="COG0517 FOG: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93218"
FT                   /protein_id="ADV93218.1"
FT                   /translation="MFHILYSVPRFFTSHIRVTGYDVKALMAEHQIRRLPILEYGQIAG
FT                   IVALGDLSVEKDTGQKAKTA"
FT   gene            complement(539627..540580)
FT                   /locus_tag="BSn5_02925"
FT   CDS_pept        complement(539627..540580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02925"
FT                   /product="putative CorA-type Mg(2+) transporter"
FT                   /note="COG0598 Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02925"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93219"
FT                   /protein_id="ADV93219.1"
FT                   /translation="MKAHTGKDWFWYQMGPQERSKARDLIHFSHWPQCEKWFENNHHVN
FT                   FLRVDTTETENEAVFGSIVYDQGLGEEKDHTVFHFYITRQYFFTINFDFSILREIKGKE
FT                   VVRQMERADNAIEGFLILLGELMNAYLIGVDEFEVKLRKLRWQIKDDNSKSILNRVHLL
FT                   RHELMIWKNLILSAKKIEMALKETFLPQNEGKKDYQRTQLKIDRGFTYISEFEGELNNL
FT                   LHSEEVITSHRGNEIVKALTIFTTLFTPITALGALWGMNFSVMPELNWKYGYLFSLLLI
FT                   VTSTVLIYLYLRKKGWTGDMLQERKKKKKPRKRRTL"
FT   gene            540723..542051
FT                   /locus_tag="BSn5_02930"
FT   CDS_pept        540723..542051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02930"
FT                   /product="putative membrane associated protein"
FT                   /note="COG1253 Hemolysins and related proteins containing
FT                   CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93220"
FT                   /protein_id="ADV93220.1"
FT                   /translation="MPSLEKAVVLEFVNLLAVAILILLTGFFVAVEFSIVKVRRSKIDQ
FT                   LVAKGKKGAKAAKHVITHLDEYLSACQLGITVAALGLGWLGEPTVQTLLRPLFHKAGLN
FT                   ESLTHLLSLVIAFLAVTYLNVVIGELAPKSLAIQKAESITLLFAKPLIWFYKIMFPFIW
FT                   LLNHSARLITGVFGLKPASEHELAYTEEELRVLLAESYKSGEIRKSELKYMNNIFTFDK
FT                   RMAKEIMVPRNEMVSLSLDEDSISNLQETVKQTKYTRYPVVREDKDNVIGVINMKEVLF
FT                   SMLTKDFSIKKHQIEPFVQPVIHIIETIPIYKLLLKMQKERTHMAILIDEYGGTSGLVT
FT                   VEDIIEEIVGEIRDEFDADEVPHIRELGKDHYLLNAKLLISDVNSLLGTDLSDAEVDTL
FT                   GGWFLTQNIDAEPESAIEYDGYSFKVKDINSHHILFIEVKKAE"
FT   gene            complement(542104..542940)
FT                   /locus_tag="BSn5_02935"
FT   CDS_pept        complement(542104..542940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02935"
FT                   /product="component of the piezosome (stressosome)"
FT                   /note="COG1366 Anti-anti-sigma regulatory factor
FT                   (antagonist of anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02935"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93221"
FT                   /protein_id="ADV93221.1"
FT                   /translation="MIALDQHLTEHKEDITQQWLEVCTSTGSWLYSAKDQQKLEQKLKD
FT                   QHELLVTIVAKSLRKEDVEDELNRWSLQCARDRAVHEVTVTQSVGQFNTFRHIMFEWIH
FT                   KFSEASSQDISIQEFYEWSRILNQNIDEIIEVFTEEYHQVTMIQLNAQKEMINELSAPI
FT                   MPITDGIGILPLVGEIDTHRARTILESVLEQCSALKLSYLFLDISGVPIVDTMVAYQIF
FT                   KVIDSTKLLGIETIISGIRPEIAQTVVKLGLDFSNVKTEQSLAKALANKGFKIKEC"
FT   gene            543027..543097
FT                   /locus_tag="BSn5_t20894"
FT   tRNA            543027..543097
FT                   /locus_tag="BSn5_t20894"
FT                   /product="tRNA-Gln"
FT   gene            complement(543164..543544)
FT                   /locus_tag="BSn5_02940"
FT   CDS_pept        complement(543164..543544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02940"
FT                   /product="transcriptional regulator of stress"
FT                   /note="COG1393 Arsenate reductase and related proteins,
FT                   glutaredoxin family"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93222"
FT                   /protein_id="ADV93222.1"
FT                   /translation="MEQQLTFYSYPSCTSCRKTKHWLKAHQIEFNERHLFRETPTREEL
FT                   KYILSLTTEGIDEILATRSQTFKNLNLNIEEMTVNEVLELLIEKPKLLRRPILVDNKKL
FT                   VIGYNPGELLKLSKKKTVHQSA"
FT   gene            543776..544021
FT                   /locus_tag="BSn5_02945"
FT   CDS_pept        543776..544021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02945"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93223"
FT                   /protein_id="ADV93223.1"
FT                   /translation="MNRMFRVLGFWTGIFAVMFYLGDMKDASLLFFGQTILFVFLSYLN
FT                   LTERMYIYIFGAYLTIFFAGFTYYSIFIMVPGGGGH"
FT   gene            complement(544061..544696)
FT                   /locus_tag="BSn5_02950"
FT   CDS_pept        complement(544061..544696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02950"
FT                   /product="putative metal-binding hydrolase"
FT                   /note="COG0491 Zn-dependent hydrolases, including
FT                   glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93224"
FT                   /protein_id="ADV93224.1"
FT                   /translation="MKWRRMPVGPIQANAYFLISDDQCLIFDPGGEGHKINQYIKEKGL
FT                   TPLAILLTHAHFDHIGALDEVREKWDIPVYLHQNEKNWLTDASLNGSGMLRGIEVTAKP
FT                   ADHLIEGDGELNIGPFHLETLFTPGHSPGSVSYYVKDADLVISGDVLFQGGIGRTDLIG
FT                   GDQETLLTSIHEKLLTLPEHTLVLSGHGPETDVLTEQDQNPFLNGFSL"
FT   gene            544853..545026
FT                   /locus_tag="BSn5_02955"
FT   CDS_pept        544853..545026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02955"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93225"
FT                   /protein_id="ADV93225.1"
FT                   /translation="MLLVVIFGLVALFALWGVLRSVRNKNILGFLLAGATLFVFGWFTV
FT                   MTVINSGYPTAH"
FT   gene            complement(545058..545372)
FT                   /locus_tag="BSn5_02960"
FT   CDS_pept        complement(545058..545372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02960"
FT                   /product="hypothetical protein"
FT                   /note="COG0011 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93226"
FT                   /protein_id="ADV93226.1"
FT                   /translation="MAIADVTIIPIGTETPSVSAYVADVQKILEGYQAEGKIKYQLTPM
FT                   NTLIEGELSDLFAVIQAIHEAPFQKGLHRVATNIRIDDRRDKKTTLESKIESVNKHFQP
FT                   "
FT   gene            complement(545375..546427)
FT                   /locus_tag="BSn5_02965"
FT   CDS_pept        complement(545375..546427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02965"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02965"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93227"
FT                   /protein_id="ADV93227.1"
FT                   /translation="MRSVFILLAVLLFSLSACEPSHQQQKQASAAKDEKKDIIPLSAEK
FT                   ADGAEGWLNNSTILYTASNPTKTELFAYRIFTGKAKKLYQTDGQIVDVQINAREQMILL
FT                   QITHSQKTAVVLLNAEGETLYEKDYETYELEAAWNQYDPYQMMVTEFNENWDFHTYQVN
FT                   AKKDESFLSPVQVPFIHWTSKNTFDYVKEGRDDKTGPLYTFDTASKTEQKLEDNVLFFD
FT                   SFHQMSFTVKSASGGKGTYQFKTPQSTSPVTAKWPLQAKYTSLAPMEYDYDEAGGLFYT
FT                   FKQSGDAYKLAAINVASGETKDLVSLREMEPIQISPNGKYALYGFHFEQIILLKSHETK
FT                   QLIIDQKEME"
FT   gene            complement(546495..547622)
FT                   /locus_tag="BSn5_02970"
FT   CDS_pept        complement(546495..547622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02970"
FT                   /product="putative gamma-D-glutamyl-L-diamino acid
FT                   endopeptidase"
FT                   /note="COG2866 Predicted carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93228"
FT                   /protein_id="ADV93228.1"
FT                   /translation="MAFITVKPEIKNNLANVAKELKIDEELLKSANRSAQKHQLYCPGY
FT                   VIEEHSGKELQTIQDIKRFLQPRQLKLSDSWIEQEKIYDDSAVEKEIKKIIDVFPFVSC
FT                   REIGRSVLGRPIWELKAGGEHAVKKVHMNASFHANEWITTSVLLKWFKEYCMSLCCNSP
FT                   FFGFSPIKLFNSTSLSLVPLVNPDGVDLVLNGSEVMGARRDELERLNEHRPNFNEWKAN
FT                   INGVDLNKQFPSLWEIEKYRKPTAPSYRDFPGISPLTEPESIAMYRLITENPPDRLLAL
FT                   HTQGEEIYWGYKGLEPEESAAVIKEFEELSGNIYKGVRDIDSYAGFRDWFIHHYFKEGY
FT                   TVELGKGQNPLPFQQFSHIYNATSGILWRALFFHE"
FT   gene            complement(547708..549624)
FT                   /locus_tag="BSn5_02975"
FT   CDS_pept        complement(547708..549624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02975"
FT                   /product="putative anion transporter and exported enzyme"
FT                   /note="COG1368 Phosphoglycerol transferase and related
FT                   proteins, alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02975"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93229"
FT                   /protein_id="ADV93229.1"
FT                   /translation="MRKTFFSKISFMLIAILLMWLKTYAVYKTSFHIKIDNLTQEFILF
FT                   INPLSFLLLIFGLSLFLKGKNRNRYIIAMSCLVTFVLLANMVFYRFYNDFLTIPVLFQT
FT                   SNMGDLGSSIGTLLEPTDLLLAVDIAVLIWLHIRQKAFQSDIPSTKNERAAYFLFVASV
FT                   YFFNLGLSEAERPQLLTRSFDREMLVKNISLFNFHIYDGVLQSKQSAQRALADSNSLTE
FT                   IENYVTANAKDANKRLFGAAKGRNVILVSLESTQSFVINEKLNGEEITPFLNDFIKQSY
FT                   NFNNVYHQTGQGKTSDSEFIVDNSLYPLGRGAVFFTNAGNQYMAAPEILKNSGYYSAVL
FT                   HANNKSFWNRDLMYDSFGYDSFFDINSYDVTDENSVGWGLKDKEFFEQSSELMKNLPQP
FT                   FYSRLITLTNHFPFDLDEEDQLIDEYDSSSQTLNKYFPTVRYQDEALKRFIEKLKEDGL
FT                   YDNSVIVLYGDHYGISENHNEAMGQFLGKEITPFEEVQLQKVPLVIHIPGITDKKPQTI
FT                   ETVGGQIDIMPTLMNLLGIDTKDQIQFGNDLLSDEKLDFTVLRDGSFITDQVVYTDGAC
FT                   YDKETGKPLEETKQCEAFADKAKQELSLSDEIIYGDLLRFYDQKRLDNSSKRKEKQMLD
FT                   QAS"
FT   gene            complement(549741..550706)
FT                   /locus_tag="BSn5_02980"
FT   CDS_pept        complement(549741..550706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02980"
FT                   /product="glucose kinase"
FT                   /note="COG1940 Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93230"
FT                   /protein_id="ADV93230.1"
FT                   /translation="MDEIWFAGIDLGGTTIKLAFINQYGEIQHKWEVPTDKTGDTITVT
FT                   IAKTIDGKLDELQKPKHIIKYIGMGAPGPVDMAAGVVYETVNLGWKNYALKNHLETETG
FT                   IPAVIENDANIAALGEMWKGAGDGAKDVILVTLGTGVGGGIIANGEIVHGINGAGGEIG
FT                   HICSIPEGGAPCNCGKTGCIETIASATGIVRIAKEKIANAKKTTRLQATEQLSARDVFE
FT                   AAGENDEIALEVVDYVAKHLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRK
FT                   CAFPRAAQAADISIAALGNDAGVIGGAWIAKNEWLKHQNC"
FT   gene            complement(550717..550932)
FT                   /locus_tag="BSn5_02985"
FT   CDS_pept        complement(550717..550932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02985"
FT                   /product="hypothetical protein"
FT                   /note="COG4483 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02985"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93231"
FT                   /protein_id="ADV93231.1"
FT                   /translation="MNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEK
FT                   EQWARAAAVLRKELEQTKNGRDFYKG"
FT   gene            complement(551042..552565)
FT                   /locus_tag="BSn5_02990"
FT   CDS_pept        complement(551042..552565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02990"
FT                   /product="membrane endopeptidase"
FT                   /note="COG0705 Uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93232"
FT                   /protein_id="ADV93232.1"
FT                   /translation="MFLLEYTYWKIAAHLVNSGYGVIQAGESDEIWLEAPDKSSHDLVR
FT                   LYKHDLDFRQEMVRDIEEQAERVERVRHQLGRRRMKLLNVFFSTEAPVDDWEEIAKKTF
FT                   EKGTVSVEPAIVRGTMLRDDLQAVFPSFRTEDCSEEHASFENAQMARERFLSLVLKQEE
FT                   QRKTEAAVFQNGKPIFTYLFIALQILMFFLLEINGGSTNTETLVAFGAKENSLIAQGEW
FT                   WRLLTPIVLHIGIAHLAFNTLALWSVGTAVERMYGSRRFLLIYLAAGITGSIASFVFSP
FT                   YPSAGASGAIFGCLGALLYVALSNRKMFLRTIGTNIIVIIIINLGFGFAVSNIDNSGHI
FT                   GGLIGGFFAAAALGLPKAGAFGKRLLSAVLLIALAVGFLYYGLHSPSHQESALIQQASE
FT                   LYQEGKYEEVTELLNGEAAQKDASADLLKILAVSDIQIGEYDQAVSLLERAVKKEPKDH
FT                   ASYYNLALLYAEKNELAQAEKAIQTAVKLKPKEQRYKELQRQIENNKES"
FT   gene            complement(552655..552828)
FT                   /locus_tag="BSn5_02995"
FT   CDS_pept        complement(552655..552828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_02995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_02995"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93233"
FT                   /protein_id="ADV93233.1"
FT                   /translation="MKKLLIYAIFAVSAVMFYQNRYRLMNTVLSQPGIRRSFIHLFLRI
FT                   PFIRNKFIQQAF"
FT   gene            complement(552895..553458)
FT                   /locus_tag="BSn5_03000"
FT   CDS_pept        complement(552895..553458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03000"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="COG0212 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93234"
FT                   /protein_id="ADV93234.1"
FT                   /translation="MKSQLRKKTLEALSALSNEDILQKTERTYKYLFSLPEWQNAGTIA
FT                   VTISRGLEIPTRPVIEQAWEEGKQVCIPKCHPDTKKMQFRTYQTDDQLETVYAGLLEPV
FT                   IEKTKEVNPSQIDLMIVPGVCFDVNGFRVGFGGGYYDRYLSEYEGKTVSLLLECQLYAH
FT                   VPSLPHDIPVHKLITEDRIISCFS"
FT   gene            complement(553543..553692)
FT                   /gene="rpmG"
FT                   /locus_tag="BSn5_03005"
FT   CDS_pept        complement(553543..553692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BSn5_03005"
FT                   /product="50S ribosomal protein L33"
FT                   /note="COG0267 Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03005"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93235"
FT                   /protein_id="ADV93235.1"
FT                   /translation="MRVNITLACTECGERNYISKKNKRNNPDRVEFKKYCPRDKKSTLH
FT                   RETK"
FT   gene            complement(553776..554843)
FT                   /locus_tag="BSn5_03010"
FT   CDS_pept        complement(553776..554843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03010"
FT                   /product="putative glycosyltransferase"
FT                   /note="COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93236"
FT                   /protein_id="ADV93236.1"
FT                   /translation="MLSPEHPDEPKSGLGVHLNRLISYLNPHINITVFTPSGQLFSYAK
FT                   FEDYIADANFTMVRHVLSHNKRFDLIHAHDDTTAPAAQYLKQRLGLPLTATIHGLERER
FT                   KKVCREAPHPYRLKTERLLIESADALIVLSTFMKRSLNKAAHKKITVIPSPASMEEEKG
FT                   KIQRSINRRFLFSYGRFVPEKGFSQLLKVFAILKQRQPDLYLVLAGEGPSLSCYEKLAA
FT                   AYNLKDRVMFLPFLNRKDIRTLLSQCEMAVFPSSYEPFGLAAQESMEQGVLTVVSQSGG
FT                   FCDYAVHDKTAIIANFTLVQEAADLLDSFLKDREKARRIKEAGRQQVFKLHHPRLIMSS
FT                   YLQLYERIFNNSAIH"
FT   gene            555502..555855
FT                   /locus_tag="BSn5_03025"
FT   CDS_pept        555502..555855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03025"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93237"
FT                   /protein_id="ADV93237.1"
FT                   /translation="MEIAIIALFIVSIALIAFSYSQRDPMKDVEQELETLQLSAMQEIY
FT                   KLKKKMTVLEEELLETNLVIRKSKQNDINQKIAKQILSKYNNGMSAEAIAKAEHVSVED
FT                   VNTIIKDNEKVLV"
FT   gene            555852..556316
FT                   /locus_tag="BSn5_03030"
FT   CDS_pept        555852..556316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93238"
FT                   /protein_id="ADV93238.1"
FT                   /translation="MTKRGIQAFAGGIILATAVLAAVFYLTDEDQAAAVKDNKTVTEQD
FT                   VNNYLDSKKMVSVNRDEYQKLLDSKEKSLTDDSSSDTKTDKVKTYKLKIKDGMSTADVS
FT                   AILEKEGIISSAQDFNDYVIDAGYHKEIRAGEFKVKSDMSFKKIVKTLTR"
FT   gene            complement(556345..557127)
FT                   /locus_tag="BSn5_03035"
FT   CDS_pept        complement(556345..557127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03035"
FT                   /product="phosphate ABC transporter ATP-binding protein"
FT                   /note="COG1117 ABC-type phosphate transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03035"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93239"
FT                   /protein_id="ADV93239.1"
FT                   /translation="MSIATEAVMKQEVYQVNGMNLWYGQHHALKNINLSIYENEVTAII
FT                   GPSGCGKSTFIKTLNLMIQMTPNVKLAGELNYNGSNILKDKVDIVDLRKNIGMVFQKGN
FT                   PFPQSIFDNVAYGPRVHGTKNKKKLQEIVEKSLKDVALWDEVKDRLHTSALSLSGGQQQ
FT                   RLCIARALATNPDILLMDEPTSALDPISTRKIEELILELKNKYTIVIVTHNMQQAARVS
FT                   DQTAFFYMGELVECDNTNKMFSNPKDQRTLDYISGKFG"
FT   gene            complement(557138..557947)
FT                   /locus_tag="BSn5_03040"
FT   CDS_pept        complement(557138..557947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03040"
FT                   /product="phosphate ABC transporter ATP-binding protein"
FT                   /note="COG1117 ABC-type phosphate transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93240"
FT                   /protein_id="ADV93240.1"
FT                   /translation="MSEQMVKEKPERAVIVPKQNHVLEVKDLSIFYGNKQAVHHVNMDI
FT                   EKNAVTALIGPSGCGKSTFLRNINRMNDLIPSARAEGEILYEGLNILGGNINVVSLRRE
FT                   IGMVFQKPNPFPKSIYANITHALKYAGERNKAVLDEIVEESLTKAALWDEVKDRLHSSA
FT                   LSLSGGQQQRLCIARTLAMKPAVLLLDEPASALDPISNAKIEELITGLKREYSIIIVTH
FT                   NMQQALRVSDRTAFFLNGELVEYGQTEQIFTSPKKQKTEDYINGKFG"
FT   gene            complement(557968..558852)
FT                   /locus_tag="BSn5_03045"
FT   CDS_pept        complement(557968..558852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03045"
FT                   /product="phosphate ABC transporter"
FT                   /note="COG0581 ABC-type phosphate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03045"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93241"
FT                   /protein_id="ADV93241.1"
FT                   /translation="MNRKITDKLATGMFGLCAAIIAAILVGLFSYIIINGVSQLSFQFI
FT                   TTKSSAIAAGGGIRDQLFNSFYILFITMLITIPLGVGGGVFMAEYAPNNKVTDFIRTCI
FT                   EVLSSLPSIVIGMFGLLMFVNLTGWGYTIIGGALALTVFNLPVMVRVTEDAIRSVPKDL
FT                   KEASLALGVSRWHTVKTVLIPSAIPSIITGAILASGRVFGEAAALLFTAGLTTPRLNFT
FT                   EWNPFSETSPLNIFRPAETLAVHIWNVNTQGMIPDAEAIANGGSAVLVISVLVFNLAAR
FT                   WLGTMIYKKLTAN"
FT   gene            complement(558852..559781)
FT                   /locus_tag="BSn5_03050"
FT   CDS_pept        complement(558852..559781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03050"
FT                   /product="phosphate ABC transporter permease"
FT                   /note="COG0573 ABC-type phosphate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93242"
FT                   /protein_id="ADV93242.1"
FT                   /translation="MINNRENMSVSERLISSRQNRQLDEVRGRMIVTACALIMIAASVA
FT                   ITIFLGVKGLQSFLVNGVSPIEFLTSLNWNPTDTDPKYGVLPFIFGSFAVTILSALIAA
FT                   PLGIAGAIFMTEIAPNWGKKVLQPVIELLVGIPSVVYGFIGLTVLVPFIAQFKSSGTGH
FT                   SLLAGTIVLSVMILPTITSISADAMASLPKSLREGSYALGATRWQTIRKVLVPAAFPTL
FT                   MTAVVLGMARAFGEALAVQMVIGNTRVLPESLFDTAGTLTTIITLNMGHTTYGSVENNT
FT                   LWSMGLVLLVMSFLFILLIRYLSSRRKV"
FT   gene            complement(559850..560752)
FT                   /locus_tag="BSn5_03055"
FT   CDS_pept        complement(559850..560752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03055"
FT                   /product="phosphate ABC transporter (binding lipoprotein)"
FT                   /note="COG0226 ABC-type phosphate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03055"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93243"
FT                   /protein_id="ADV93243.1"
FT                   /translation="MKKNKLVLMLLMAAFMMIAAACGNAGESKKSNSDSAKGEEKASGS
FT                   LTISGSSAMQPLVLAAAEKFMEENPDADIQVQAGGSGTGLSQVSEGAVQIGNSDVFAEE
FT                   KEGIDAKALVDHQVAVVGMAAAVNPDAGVKDISKDELKKIFTGKIKNWKELGGKDQKIT
FT                   LVNRPDSSGTRATFVKYALDGAEPAEGITEDSSNTVKKIIADTPGAIGYLAFSYLTDDK
FT                   VTALSIDGVKPEAKNVATGEYPIWAYQHSYTKGEATGLAKEFLDYLKSEDIQKSIVTDQ
FT                   GYIPVTDMKVTRDAKGKQS"
FT   gene            complement(560907..563057)
FT                   /locus_tag="BSn5_03060"
FT   CDS_pept        complement(560907..563057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03060"
FT                   /product="transpeptidase (penicillin-binding protein 2A)"
FT                   /note="COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93244"
FT                   /protein_id="ADV93244.1"
FT                   /translation="MRRNKPKKQNHKEKKKSLPIRLNILFLAAFVIFTWIIVELGIKQI
FT                   VQGDDYKNQANKQEQSEVSSAVPRGKIYDRNFNAIVTNKALNAITYTRSKSTTQEQRLK
FT                   IAKKLSDMIKVDTKKVTERDKKDYWILTRPKEAKKLISSKERQQVEDKKISDDDLYQLQ
FT                   LKRITDKQLNELTDKDMQILAIKRQMDSGYALTPQYIKNEDVSAKEMAVVSEHLDELPG
FT                   VDVTSDWEREYPYKNLLRSVLGSVSSSNEGLPSNLLDHYLSLGYSRNDRVGKSYLEYQY
FT                   ESLLQGQKAKVENITDSNGNVTGTKTVSEGKAGKDLVLTIDIDLQKEVEKIIEKNLKSA
FT                   KARPSTQLLDRAFVVMMDPRNGEVLSMAGKQIKQENGKYKIDDYALGTMTSSYAMGSAV
FT                   KGATVLTGLQTGAINLNTVFQDEPLYIGQDKNGKKSWTTLGPVNIQRALEQSSNVFMFK
FT                   TAIALGKGEYKPHQALPIDTTAFDTFRNYFSQFGLGVKTGIDLPNEMTGYKGTDRLTGF
FT                   LLDYAIGQYDTYTPLELAQYVSTIANGGYRLKPQLVKEVREPDAKRGIGAVVQSVQPEV
FT                   LNKIDMKSEYIKEVQAGFRRVMTKGTAASQFASASYQPAGKTGTAQSFYDGPDKSKTGT
FT                   ATYNTTLVAYAPADNPEIAISVVVPWAYIDYSAKYTITNEIGREVMDKYFELKSKQDKE
FT                   DTQQKNKNKIEENAENTTSSDN"
FT   gene            complement(563171..564463)
FT                   /locus_tag="BSn5_03065"
FT   CDS_pept        complement(563171..564463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03065"
FT                   /product="putative efflux transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03065"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93245"
FT                   /protein_id="ADV93245.1"
FT                   /translation="MSKLKKVIGDVDVNKGLLFLLTIGGLYSLGIALSNTFVNVYLWKQ
FT                   SGKFIDLAIYNLSIVTMQPITFYLAGRLAKKIDRVFILRFGVIFLAAFYLSVLLAGETA
FT                   ASRLVLIGAVLGVGYGFYWLAFNVLTFEITEPDTRDFFNGFMGILSSSAGMIGPIVAGF
FT                   VISRLENNTGYTVIFSLSLSLFALAVVMSFFLKRRESKGRFMLSKVFGERHSNMNWRRI
FT                   TNAHFFQGLREGIFVFLISVFVFIETNSELALGTFGLVNSAVSFFAYYFASRLIKKKAR
FT                   KKSILLGGLILYGALFLILFHMSFSTLLTYGVFIAIGYPLLLVPYVSLTYDVIGRARHA
FT                   RKARIEYIVLREMFLNAGRIVSILCFLLIVALLKEDVGIPLSLAILGIGHPLIYYFVKD
FT                   IRFKEKEGENETMEEDGQKRVTEPTLLKGER"
FT   gene            complement(564570..565178)
FT                   /locus_tag="BSn5_03070"
FT   CDS_pept        complement(564570..565178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03070"
FT                   /product="superoxide dismutase"
FT                   /note="COG0605 Superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93246"
FT                   /protein_id="ADV93246.1"
FT                   /translation="MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEG
FT                   NTALANKSVEELVADLDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEE
FT                   INSVFGSFDKFKEQFAAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGL
FT                   DVWEHAYYLNYQNRRPDYISAFWNVVNWDEVARLYSEAK"
FT   gene            complement(565357..565839)
FT                   /locus_tag="BSn5_03075"
FT   CDS_pept        complement(565357..565839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03075"
FT                   /product="putative integral inner membrane protein"
FT                   /note="COG2839 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03075"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93247"
FT                   /protein_id="ADV93247.1"
FT                   /translation="MDMLYWLLIAAVFIIAFIGLVYPVIPSVVFIVAGFVLYGFLFSFS
FT                   PYSYMFWLVEAVFAAVLFAADYVSNLLGVKRFGGSKAAIWGSTIGLLIGPFVIPVAGII
FT                   LGPFIGAVCAELIVHQKDLKSAFKIGLGSLIGFLTGVIAKGIIQLLMIGYFLWTVL"
FT   gene            565949..566710
FT                   /locus_tag="BSn5_03080"
FT   CDS_pept        565949..566710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03080"
FT                   /product="factor involved in motility"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93248"
FT                   /protein_id="ADV93248.1"
FT                   /translation="MNVFQLFIKSTYSPRDIAKTRFQGIGKAILYVFLLSVLFAIPTAY
FT                   YVSTGTVKSMNGFKTVLNKDFPDFTISNGKLQTDEKKATESQANGFVIVFDPTDSYGTE
FT                   QIEAKQNAIGILQNKFVLAIDGQAQEMSYSMMPSELQKKDVIAGLNQNKAMIVTVLSAL
FT                   IFLVTAAGKFIEVSFLALIGLIIKNSQKKHLSYHQLWKLSAYSITLSTVFFTIMRALEA
FT                   TVPSEFLLNWFVNFVILFLVLKEIPSKKAAV"
FT   gene            566805..567104
FT                   /locus_tag="BSn5_03085"
FT   CDS_pept        566805..567104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03085"
FT                   /product="factor involved in motility"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03085"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93249"
FT                   /protein_id="ADV93249.1"
FT                   /translation="MKRLTLVCSIVFILFILFYDLKIGTIPIQDLPVYEASAKTAVQEP
FT                   AYKTVKVKPGDTVMSIVGSAGSPDDIVKDFEALNPNVKANAIQAGTAYKFPVYP"
FT   gene            567233..568360
FT                   /gene="ispG"
FT                   /locus_tag="BSn5_03090"
FT   CDS_pept        567233..568360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="BSn5_03090"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="COG0821 Enzyme involved in the deoxyxylulose pathway
FT                   of isoprenoid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93250"
FT                   /protein_id="ADV93250.1"
FT                   /translation="MSEITHRTKTRPVKVGPLTIGGNNEVVIQSMTTTKTHDVEATVAE
FT                   INRLAEAGCQIVRVACPDERAANAIADIKKRISIPLVVDIHFDYKLALKAIEGGADKIR
FT                   INPGNIGRREKVEAVVKAAKDKGIPIRIGVNAGSLEKRILEKYGYPTADGMVESALHHI
FT                   KILEDLDFHDIIVSMKASDVNLAIEAYEKAAKAFDYPLHLGITESGTLFAGTVKSAAGL
FT                   GAILSKGIGNTMRISLSADPVEEVKVARELLKSFGLASNAATLISCPTCGRIEIDLISI
FT                   ANEVEEYISKIKAPIKVAVLGCAVNGPGEAREADIGIAGARGEGLLFRKGKIVRKVPEE
FT                   TMVEELKKEIDILAEEHYAKLEAEKAKLKEETQKA"
FT   gene            complement(568386..568769)
FT                   /locus_tag="BSn5_03095"
FT   CDS_pept        complement(568386..568769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03095"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03095"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93251"
FT                   /protein_id="ADV93251.1"
FT                   /translation="MANDYEKRDNNSYYVDHGSEGTNINRDNDGFFEETAAEIAEPYRA
FT                   ADRSNDQDNDRSGGNVNEGRGIGYIALALSIISLFVLPVLLGAAGIIVGYIARRRGAQG
FT                   LGAWAMGIGVVSLVLGIFIIPFF"
FT   gene            568908..569489
FT                   /locus_tag="BSn5_03100"
FT   CDS_pept        568908..569489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03100"
FT                   /product="putative nucleotidase"
FT                   /note="COG5663 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93252"
FT                   /protein_id="ADV93252.1"
FT                   /translation="MLRLGIDIDGTITAQDTFVPYLNRSFNLSISLNDMTDYDLTKLLN
FT                   ITQEEFWDWMNQNEAIIYKEALLAQHAKQSLDLLKEEHKLIYITARRTHLTDITYEWFD
FT                   RQNIHYDHIELVGGHHKVEAVKNHNIDLFFEDHHGNAMMIAKEAGIPVILFNSPYNQLP
FT                   IDSNIIRVNNWLEAVKWINNNKHHLIRVNN"
FT   gene            complement(569517..569963)
FT                   /locus_tag="BSn5_03105"
FT   CDS_pept        complement(569517..569963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03105"
FT                   /product="transcriptional regulator (Fur family) protein"
FT                   /note="COG0735 Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03105"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93253"
FT                   /protein_id="ADV93253.1"
FT                   /translation="MNVQEALNLLKENGYKYTNKREDMLQLFADSDRYLTAKNVLSALN
FT                   DDYPGLSFDTIYRNLSLYEELGILETTELSGEKLFRFKCSFTHHHHHFICLACGKTKEI
FT                   ESCPMDKLCDDLDGYQVSGHKFEIYGTCPDCTAENQDNTTASYI"
FT   gene            complement(570101..570982)
FT                   /locus_tag="BSn5_03110"
FT   CDS_pept        complement(570101..570982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03110"
FT                   /product="putative integral inner membrane protein"
FT                   /note="COG1284 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93254"
FT                   /protein_id="ADV93254.1"
FT                   /translation="MTPTKQHKKETFTHFIFRVFMILVGAASAAVSIELFLIPNDFIDG
FT                   GIIGVSLILDHLFMSNPFLNFAFFVVILNIPFMIFGYKYIGKTFLVSTFIGIVGLAVIE
FT                   SSLHHVEAITTQPILATVFGGLLLGFGVGLVIRNGGSMDGTEILGILLTKKLPFSVGEF
FT                   VMFINVFIFIWAVFVFGPEQAMYSFMTYYIAMKTIDAVIQGLDETKAVIIVSEQYDEIS
FT                   DAILHRLGRGTTKLKGKGGYTDEEKDVIYAVVTRLEVTKLKSIVFEVDQNAFITIMNTH
FT                   ETRGGKFKNAIH"
FT   gene            571098..571352
FT                   /locus_tag="BSn5_03115"
FT   CDS_pept        571098..571352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03115"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93255"
FT                   /protein_id="ADV93255.1"
FT                   /translation="MILFQRIILQRLNQATADDLLKYSKQYGISLTRSQAVEVANLLYG
FT                   KNVNIFNESERMRLLKQVETITSKETAQTVNELFKQFTS"
FT   gene            complement(571379..572272)
FT                   /locus_tag="BSn5_03120"
FT   CDS_pept        complement(571379..572272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03120"
FT                   /product="endonuclease IV"
FT                   /EC_number="3.1.21.2"
FT                   /note="COG0648 Endonuclease IV"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93256"
FT                   /protein_id="ADV93256.1"
FT                   /translation="MLRIGSHVSMSGKHMLLAASQEAVSYGANTFMIYTGAPQNTRRKK
FT                   IEDLNIEAGRAHMQENGIDEIIVHAPYIINIGNTTNPSTFELGVDFLRSEIERTAAIGA
FT                   KQIVLHPGAHVGAGAEAGIKKIIEGLNEVIDPNQNVQIALETMAGKGSECGRSFEELAQ
FT                   IIEGVTHNEQLSVCFDTCHTHDAGYNIVEDFDGVLNEFDKIIGIDRIKVLHINDSKNVK
FT                   GARKDRHENIGFGEIGFDALQYVVHHEQLKDIPKILETPYVGEDKKNKKPPYRFEIEML
FT                   KEKQFDDTLLEKILQQ"
FT   gene            complement(572282..573598)
FT                   /locus_tag="BSn5_03125"
FT   CDS_pept        complement(572282..573598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03125"
FT                   /product="ATP-dependent RNA helicase; cold shock"
FT                   /note="COG0513 Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03125"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93257"
FT                   /protein_id="ADV93257.1"
FT                   /translation="MKETKFELYELKPFIIDAVHRLGFYEPTDIQKRLIPAVLKKESVI
FT                   GQSQTGTGKTHAYLLPLLNKIDPAKDVVQVVITAPTRELANQIYQEALKITQGEEGSQI
FT                   RSKCFIGGTDKQKSIDKLKIQPHLVVGTPGRIADLIKEQALSVHKAESLVIDEADLMLD
FT                   MGFLADVDYIGSRMPEDLQMLVFSATIPEKLKPFLKKYMENPKYAHVEPKQVTAAKIEH
FT                   ILIPSKHRDKDKLLFDIMSHLNPYLGIVFANTKNTADHIAQYLTGKGMKIGLLHGGLTP
FT                   RERKKVMKQINDLEFTYIIATDLAARGIDIKGVSHVINYELPDDLDFYVHRVGRTARAG
FT                   SSGQAMTIYELTDEDALVRLEKMGIEFDYLELEKGEWKKGDDRQRRKKRKKTPNEADEI
FT                   AHRLVKKPKKVKPGYKRKMSYEMEKIKKKQRRNQSKKRK"
FT   gene            573767..574510
FT                   /locus_tag="BSn5_03130"
FT   CDS_pept        573767..574510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93258"
FT                   /protein_id="ADV93258.1"
FT                   /translation="MFSPQQPMRNYPQPGPPRPMPNQRMMGRRPPNMRGPSFGAQQQGF
FT                   QQAGQFLPQANAGARNSAGAGGGLKGMLSRFLPGGGGAGSAGVPGVPGAGAAASGGAGL
FT                   QGIQNIANPASLSSMLGNVQKVLGMAQQVTPMIQQYGPLVRNLPAMMKLYSQLSKSDDT
FT                   ETEANEESEKQSVSEESSEKEKETETKTSDGNKKSKPKSSSLPMKSKTTDNKEQESKTS
FT                   APKKKEAASPAPKRTSGSSKPRLYI"
FT   gene            574633..575577
FT                   /gene="ispH"
FT                   /locus_tag="BSn5_03135"
FT   CDS_pept        574633..575577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="BSn5_03135"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="COG0761 Penicillin tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03135"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93259"
FT                   /protein_id="ADV93259.1"
FT                   /translation="MDVIKISPRGYCYGVVDAMVIAKNASLDKSLPRPIYILGMIVHNK
FT                   HVTDAFEEEGIFTLDGSNRLDILKQVDKGTVIFTAHGVSPEVRRIAEEKGLVAIDATCP
FT                   DVTKTHNLILEMKEKGYHVIYIGKKGHPEPEGAVGVAPEIVHLVETEEDVKNLDIQAEK
FT                   LIVTNQTTMSQWDVHDIMELVKEKYPHVEYHQEICLATQVRQEAVSEQAKKADLTIVVG
FT                   DPKSNNSNRLAQVSEEIAGTKAYRIGDLSELKLEWLKGVNTVAVTAGASTPTPITKEVI
FT                   RFLEQFDHEDPSTWTTEHNIPLKKILPKVKAKN"
FT   gene            complement(575600..576721)
FT                   /locus_tag="BSn5_03140"
FT   CDS_pept        complement(575600..576721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03140"
FT                   /product="hypothetical protein"
FT                   /note="COG0327 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93260"
FT                   /protein_id="ADV93260.1"
FT                   /translation="MAKSVNGQQIIQLFEQFSPKAYAVEGDKIGLQIGTLNKPIKNVMV
FT                   TLDVLESVIDEAIEKEVDLIIAHHPPIFRPLKHISTDQPAGRLIEKCLKHDIAVYAAHT
FT                   NLDVADGGVNDLLAEALELSETEVLVPTYTDPLKKLAVYVPKEYEEQVRAALGNAGAGH
FT                   IGEYSHCAFSSEGIGSFKPLDGAKPFIGEVGELELVHEVRLETVFPKSVEKAVINAMIK
FT                   SHPYEEVAYDIYPIEQTPAEKGLGRVGTLKNEMTLKEFALFVKDKLDVNGVRMVGDADS
FT                   MVKKVAVLGGDGNKYIHHAKRKGADVYVTGDLYFHVAHDAMMLGLNVVDPGHYAEKIMK
FT                   EGVTRKLTSMCNDKKFGVNIFVSETDTNPFTFL"
FT   gene            complement(576714..577364)
FT                   /locus_tag="BSn5_03145"
FT   CDS_pept        complement(576714..577364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03145"
FT                   /product="tRNA: m1A22 methyltransferase"
FT                   /note="COG2384 Predicted SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03145"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93261"
FT                   /protein_id="ADV93261.1"
FT                   /translation="MADIGSDHAYLPCYAVLNHKASGAIAGEITDGPFLSAKRQVEKSG
FT                   LNSHISVRQGDGLEVIKKGEADAITIAGMGGALIAHILEAGKDKLTGKERFILQPNIHA
FT                   VHIREWLYKEGYALIDEVILEEDGKCYEVLVAEAGDRDAAYDGISLSAGMLVGPFLAKE
FT                   KNAVFLKKWTQELQHTQSIYEQISQAADTEQNKQKLKELADRMELLKEVIDHG"
FT   gene            complement(577621..577983)
FT                   /locus_tag="BSn5_03150"
FT   CDS_pept        complement(577621..577983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03150"
FT                   /product="cytochrome c550"
FT                   /note="COG2010 Cytochrome c, mono- and diheme variants"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93262"
FT                   /protein_id="ADV93262.1"
FT                   /translation="MKWNPLIPFLLIAVLGIGLTFFLSVKGLDDSREIASGGESKSAEK
FT                   KDANASPEEIYKANCIACHGENYEGVSGPSLKGVGDKKDVAEIKTKIEKGGNGMPSGLV
FT                   PADKLDDMAEWVSKIK"
FT   gene            complement(578312..579427)
FT                   /locus_tag="BSn5_03155"
FT   CDS_pept        complement(578312..579427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03155"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="COG0568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03155"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93263"
FT                   /protein_id="ADV93263.1"
FT                   /translation="MADKQTHETELTFDQVKEQLTESGKKRGVLTYEEIAERMSSFEIE
FT                   SDQMDEYYEFLGEQGVELISENEETEDPNIQQLAKAEEEFDLNDLSVPPGVKINDPVRM
FT                   YLKEIGRVNLLSAKEEIAYAQKIEEGDEESKRRLAEANLRLVVSIAKRYVGRGMLFLDL
FT                   IQEGNMGLMKAVEKFDYRKGYKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKL
FT                   IRVQRQLLQDLGREPTPEEIAEDMDLTPEKVREILKIAQEPVSLETPIGEEDDSHLGDF
FT                   IEDQEATSPSDHAAYELLKEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFG
FT                   VTRERIRQIEAKALRKLRHPSRSKRLKDFLE"
FT   gene            complement(579626..581437)
FT                   /gene="dnaG"
FT                   /locus_tag="BSn5_03160"
FT   CDS_pept        complement(579626..581437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="BSn5_03160"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COG0358 DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93264"
FT                   /protein_id="ADV93264.1"
FT                   /translation="MGNRIPDEIVDQVQKSADIVEVIGDYVQLKKQGRNYFGLCPFHGE
FT                   STPSFSVSPDKQIFHCFGCGAGGNVFSFLRQMEGYSFAESVSHLADKYQIDFPDDITVH
FT                   SGARPESSGEQKMAEAHELLKKFYHHLLINTKEGQEALDYLLSRGFTKELINEFQIGYA
FT                   LDSWDFITKFLVKRGFSEAQMEKAGLLIRREDGSGYFDRFRNRVMFPIHDHHGAVVAFS
FT                   GRALGSQQPKYMNSPETPLFHKSKLLYNFYKARLHIRKQERAVLFEGFADVISAVSSGV
FT                   KESIATMGTSLTDDHVKILRRNVEEIILCYDSDKAGYEATLKASELLQKKGCKVRVAMI
FT                   PDGLDPDDYIKKFGGEKFKNDIIDASVTVMAFKMQYFRKGKNLSDEGDRLAYIKDVLKE
FT                   ISTLSGSLEQEVYVKQLASEFSLSQESLTEQLSVFSKQNKPADNSGETKTRRAHLTTKA
FT                   RQKRLRPAYENAERLLLAHMLRDRSVIKKVIDRVGFQFNIDEHRALAAYLYAFYEEGAE
FT                   LTPQHLMARVTDDHISQLLSDILMLQVNQELSEAELSDYVKKVLNQRNWSMIKEKEAER
FT                   AEAERQKDFLRAASLAQEIVTLNRSLK"
FT   gene            complement(581471..581965)
FT                   /locus_tag="BSn5_03165"
FT   CDS_pept        complement(581471..581965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03165"
FT                   /product="hypothetical protein"
FT                   /note="COG1671 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03165"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93265"
FT                   /protein_id="ADV93265.1"
FT                   /translation="MEGWRITLLNEQEKTIFVDADACPVKDEILQTASEYEVQVLFVAS
FT                   FEHYQLSRSNEEKWKYVDPHKEAADLYIANHVKPGDIVVTQDIGLASLLLNRNVSVMSE
FT                   RGRLYKEDTIDFALEGRHFSGKQRRKGVYAKGPKKLNKEDRERFIALLQKILSNDEGIL
FT                   H"
FT   gene            complement(582219..583031)
FT                   /locus_tag="BSn5_03170"
FT   CDS_pept        complement(582219..583031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03170"
FT                   /product="PEP synthetase regulatory protein"
FT                   /note="COG1806 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93266"
FT                   /protein_id="ADV93266.1"
FT                   /translation="MNNRIIYVVSDSVGETAELVVKAALSQFNGSADDTHVRRIPYVED
FT                   IGTINEVISLAKADGGIICFTLVVPEIREYLIAEAEKANVLYYDIIGPLIDKMETAYGL
FT                   TAKYEPGRVRQLDEDYFKKVEAIEFAVKYDDGRDPRGILKADIVLIGVSRTSKTPLSQY
FT                   LAHKRLKVANVPIVPEVDPPEELFNVDPKKCIGLKISPDKLNHIRKERLKSLGLNDKAI
FT                   YANINRIKEELEYFEKIVDRIGCQVVDVSNKAVEETANIIHHLKTKNI"
FT   gene            complement(583057..583695)
FT                   /locus_tag="BSn5_03175"
FT   CDS_pept        complement(583057..583695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03175"
FT                   /product="negative regulator of gluconeogenesis"
FT                   /note="COG0517 FOG: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03175"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93267"
FT                   /protein_id="ADV93267.1"
FT                   /translation="MSTIELNKRQEHILQIVKENGPITGEHIAEKLNLTRATLRPDLAI
FT                   LTMSGFLEARPRVGYFYTGKTGTQLLADKLKKLQVKDFQSIPVVIHENVSVYDAICTMF
FT                   LEDVGTLFVVDRDAVLVGVLSRKDLLRASIGQQELTSVPVHIIMTRMPNITVCRREDYV
FT                   MDIAKHLIEKQIDALPVIKDTDKGFEVIGRVTKTNMTKILVSLSENEIL"
FT   gene            complement(583828..585867)
FT                   /gene="glyS"
FT                   /locus_tag="BSn5_03180"
FT   CDS_pept        complement(583828..585867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="BSn5_03180"
FT                   /product="glycyl-tRNA synthetase subunit beta"
FT                   /EC_number="6.1.1.14"
FT                   /note="COG0751 Glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93268"
FT                   /protein_id="ADV93268.1"
FT                   /translation="MSKQDLLLEIGLEEMPARFLNESMVQLGDKLTGWLKEKNITHGEV
FT                   KLFNTPRRLAVFVKDVAEKQDDIKEEAKGPAKKIALDADGNWTKAAIGFSKGQGANVED
FT                   LYIKEVKGIEYVFVQKFQAGQETKSLLPELSGLITSLHFPKNMRWGNEDLRYIRPIKWI
FT                   VALFGQDVIPFSITNVESGRTTQGHRFLGHEVSIESPSAYEEQLKEQHVIADPSVRKQM
FT                   IQSQLETMAAENNWSIPVDEDLLDEVNHLVEYPTALYGSFESEFLSIPEEVLVTTMKEH
FT                   QRYFPVKDKNGDLLPHFITVRNGNSHAIENVARGNEKVLRARLSDASFFYKEDQKLNID
FT                   ANVKKLENIVFHEELGSLADKVRRVTSIAEKLAVRLQADEDTLKHVKRAAEISKFDLVT
FT                   HMIYEFPELQGIMGEKYARMLGEDEAVAAAVNEHYMPRSAGGETPSTFTGAVVAMADKL
FT                   DTIASFFSIGVIPTGSQDPYGLRRQASGIVAILLDRNWGISFEELLTFVQTDKEIELLD
FT                   FFTQRLKYVLNAEQIRHDVIDAVLESSELEPYSALHKAQVLEQKLGAPGFKETAEALGR
FT                   VISISKKGVRGDIQPDLFENEYEAKLFDAYQTAKQNLQENFSKKDYEAALASLAALKEP
FT                   IDAYFDHTMVIADNEALKANRLAQMVSLADEIKSFANMNALIVK"
FT   gene            complement(585860..586747)
FT                   /gene="glyQ"
FT                   /locus_tag="BSn5_03185"
FT   CDS_pept        complement(585860..586747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="BSn5_03185"
FT                   /product="glycyl-tRNA synthetase subunit alpha"
FT                   /EC_number="6.1.1.14"
FT                   /note="COG0752 Glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03185"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93269"
FT                   /protein_id="ADV93269.1"
FT                   /translation="MNIQDMILTLQKHWSSQGCVLMQAYDVEKGAGTMSPYTFLRSIGP
FT                   EPWKVAYVEPSRRPADGRYGENPNRLYQHHQFQVIIKPSPDNIQELYLDSLRALGIDPL
FT                   EHDIRFVEDNWENPSLGCAGLGWEVWLDGMEITQFTYFQQVGGLECKPVSVEITYGIER
FT                   LASYIQDKENVFDLEWTSGFTVKDLFMMAEYEHSVYTFETSDVDMLFQLFSTYEKEAIK
FT                   QMDNGLVHPAYDYVLKCSHTFNLLDAKGAISVTERTGYIARVRNLARKVAKTYYEEREK
FT                   LGFPMLKGEGSSHE"
FT   gene            complement(587045..587812)
FT                   /gene="recO"
FT                   /locus_tag="BSn5_03190"
FT   CDS_pept        complement(587045..587812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="BSn5_03190"
FT                   /product="DNA repair protein RecO"
FT                   /note="COG1381 Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93270"
FT                   /protein_id="ADV93270.1"
FT                   /translation="MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKPNSR
FT                   LSAVSQPFLYGSFLMQKTSGLGTLQQGEMILSMRGIREDLFLTAYAAYVAELVDRGTEE
FT                   KKPNPYLFEFILESLKQLNEGTDPDVITFIVQMKMLGVMGLYPELNHCVHCKSQDGTFH
FT                   FSVRDNGFICHRCFEKDPYRIPIKPQTARLLRLFYYFDLSRLGNVSLKEETKAELKQVI
FT                   DLYYEEYSGLYLKSKRFLDQMESMKHLMGENKS"
FT   gene            complement(587849..587992)
FT                   /locus_tag="BSn5_03195"
FT   CDS_pept        complement(587849..587992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03195"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93271"
FT                   /protein_id="ADV93271.1"
FT                   /translation="MLNFTWNVFSQTGNVDTYLLFKELEKENMERPEELEDELARFDYP
FT                   IL"
FT   gene            complement(588140..589045)
FT                   /gene="era"
FT                   /locus_tag="BSn5_03200"
FT   CDS_pept        complement(588140..589045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="BSn5_03200"
FT                   /product="GTPase Era"
FT                   /note="COG1159 GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93272"
FT                   /protein_id="ADV93272.1"
FT                   /translation="MTNESFKSGFVSIIGRPNVGKSTFLNRVIGQKIAIMSDKPQTTRN
FT                   KVQGVLTTGTSQTIFIDTPGIHKPKHKLGDFMMKVAQNTLKEVDLILFMINAEEGYGKG
FT                   DEFIIEKLQTMSTPVFLIVNKIDKIHPDQLLLLIDEYRKRYPFKEIVPISALEGNNIET
FT                   LLAQIEAYLPEGPQFYPSDQVTDHPERFIISELIREKVLHLTREEIPHSIAVAIESIKG
FT                   QDNGSVHVAATIVVERDSQKGIVIGKKGSLLKEVGKRARADIEALLGSRVYLELWVKVQ
FT                   KDWRNKMSQLRDFGFKEDEY"
FT   gene            complement(589026..589436)
FT                   /locus_tag="BSn5_03205"
FT   CDS_pept        complement(589026..589436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03205"
FT                   /product="cytidine deaminase"
FT                   /note="COG0295 Cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03205"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93273"
FT                   /protein_id="ADV93273.1"
FT                   /translation="MNRQELITEALKARDMAYAPYSKFQVGAALLTKDGKVYRGCNIEN
FT                   AAYSMCNCAERTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELCTKDVIVV
FT                   LTNLQGQIKEMTVEELLPGAFSSEDLHDERKL"
FT   gene            complement(589555..589926)
FT                   /locus_tag="BSn5_03210"
FT   CDS_pept        complement(589555..589926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03210"
FT                   /product="Undecaprenol kinase"
FT                   /note="COG0818 Diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93274"
FT                   /protein_id="ADV93274.1"
FT                   /translation="MDSKDHRNELKRFFKSFVHAGRGIWETARTERNFQFHAAAACAVL
FT                   ICGFLVELSMIEWMIIFLLIGGMFSLELLNTAIEHTVDLITDKHHPLAKAAKDAAAGAV
FT                   CVFAVISCIIGLLIFLPKL"
FT   gene            complement(589907..590380)
FT                   /locus_tag="BSn5_03215"
FT   CDS_pept        complement(589907..590380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03215"
FT                   /product="metal-binding heat shock protein"
FT                   /note="COG0319 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03215"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93275"
FT                   /protein_id="ADV93275.1"
FT                   /translation="MSLLIDIVDETGSVSEEMLKEVENLLQFAAEREGVQDQAEVSVTI
FT                   VSNDDIHQINKEYRGKDAPTDVISFALEEEGEGEIEIVGAEMPPVLGDIIISADRTREQ
FT                   AEEYNHSFKRELGFLAVHGFLHLLGYDHMTKEEEEEMFTKQKELLDAYGLKRS"
FT   gene            complement(590381..592513)
FT                   /locus_tag="BSn5_03220"
FT   CDS_pept        complement(590381..592513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03220"
FT                   /product="putative membrane associate hydrolase"
FT                   /note="COG1480 Predicted membrane-associated HD superfamily
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93276"
FT                   /protein_id="ADV93276.1"
FT                   /translation="MKKKAKTKSSSKKWSSFKNARSMHVLLYLLLAAIMFALLFVHVKP
FT                   ETLDLDLFSVSDKTIYAPATVEDQKATEEKKQAAEDAVEDQYTLKKEYTDNRIDLVSSI
FT                   FDSISEVKKSSEEGSKSPSEKSMVKSVKDKLTSDVNDSISEDSIKTLLKADSEDFSFVR
FT                   DTVITAVNTVMSSEIPSDKLSDAKDKVEKELKSNSIPSKYLGAATEIGRFAIIPNYVFD
FT                   PKATEAKRQEASDNVQQVQIKQGQVLVEENDLIDREVYRKLELTGLLNNSNLFKPISGL
FT                   LIMIGLFIATLVYYFEKQKQNLKFKNQSILLFSIITTLLLVIMEVVSLFQKMEYNNIGY
FT                   LVPIAAGAILIKLLMNERIAILGSIILAICGSMMFNQGVTGTFNYVIGIYYLISGISGV
FT                   LFLGKHNARSKILQTGLFVAFINMVVVLSLLLIQNTALSGLEIGTLMLMGVVSGFASSV
FT                   LIIGLMPFFETGFGILSTMRLLELSNPNHPLLRKILTETPGTYHHSVMVANLSEAACEA
FT                   VGANGLLARVGAYYHDLGKTKRPQYFIENQMNIDNPHDKLSPQLSKNIIISHTTDGANM
FT                   LRSYKFPKELVDIAEQHHGTSLLKFFYYKAKEKGDQITEEEFRYPGPKPQSKEAAIISV
FT                   ADSVEAAVRSMHNPNPERIEKLVRGIISDKLQDGQFSECDLTFKELDTIAKTLCATLKG
FT                   IFHSRIEYPEATKKVK"
FT   gene            complement(592497..592595)
FT                   /locus_tag="BSn5_03225"
FT   CDS_pept        complement(592497..592595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03225"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93277"
FT                   /protein_id="ADV93277.1"
FT                   /translation="MLNDPIARYRVIFMIAYGLDVSRGGSCVEKEG"
FT   gene            complement(592595..593554)
FT                   /locus_tag="BSn5_03230"
FT   CDS_pept        complement(592595..593554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03230"
FT                   /product="PhoH family protein"
FT                   /note="COG1702 Phosphate starvation-inducible protein PhoH,
FT                   predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93278"
FT                   /protein_id="ADV93278.1"
FT                   /translation="MTEHLLAMNQKLKNPDEALSLFGNQDSFLKLMEKDLNVNIITRGE
FT                   TIYVSGDDESFQIADRLLGSLLALIRKGIEISERDVIYAIKMAKKNELEYFESMYEEEI
FT                   TKNAKGKSIRVKTMGQREYVAAMKRNDLVFGIGPAGTGKTYLAVVKAVHALKNGHIKKI
FT                   ILTRPAVEAGESLGFLPGDLKEKVDPYLRPLYDALHDVLGADHTERLMERGIIEIAPLA
FT                   YMRGRTLDDAYVILDEAQNTTPAQMKMFLTRLGFGSKMIITGDVSQIDLPKGVKSGLAV
FT                   AKEMLKGIDGISMIELDQTDVVRHPLVAKIIEAYDKQN"
FT   gene            complement(593551..594747)
FT                   /locus_tag="BSn5_03235"
FT   CDS_pept        complement(593551..594747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03235"
FT                   /product="sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03235"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93279"
FT                   /protein_id="ADV93279.1"
FT                   /translation="MKNKWLSFFSGKVQLELTGRGIERLLNECTRQGIPVFHVKKKKEA
FT                   VSLYIQLQDVHAFRRVRSKFKCKARFINRKGFPFLLLKSKLNIGFTIGFAIFFILLFLL
FT                   SNMVWKIDVTGAKPETEHQMRQHLNEIGVKKGRLQFLMMSPEKIQKSLTNGIDNITWVG
FT                   VDLKGTTIHMKVVEKNEPEKEKYVSPRNIVAKKKATITRMFVQKGQPMAAIHDHVEKGQ
FT                   LLVSGLIGSEDHQQEVASKAEIYGETWYRSEVTVPLETLFNVYTGKVRTKHKLSFGSLA
FT                   IPIWGMTFKKEELKHPKTEQEKHSLHFLGFKLPVSYVKEQTRESEEALRKYTKEEAVQE
FT                   GIKLGKQDVEDKIGENGEVKSEKVLHQTVENGKVKLIILYQVIEDIVQTTPIVRETEE"
FT   gene            complement(594766..595047)
FT                   /locus_tag="BSn5_03240"
FT   CDS_pept        complement(594766..595047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93280"
FT                   /protein_id="ADV93280.1"
FT                   /translation="MGQRKNRMKAWLTRALEIPPDVMMDLPRITMVGRLHIYIENHRGL
FT                   LLFSENEVRLMLKQGQCIISGKNFVIKAILPEEILLEGTIDVVRYVES"
FT   gene            complement(595104..595523)
FT                   /locus_tag="BSn5_03245"
FT   CDS_pept        complement(595104..595523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03245"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93281"
FT                   /protein_id="ADV93281.1"
FT                   /translation="MEDLLTNPLIIAAIIGIISAIFGKKSKEEKQNSQKSKKPQHVQSA
FT                   SPQKKQSKEDAPAPIPNRMEQARREAEERRRETARNLKGLERDLAAAKQKTVYTKQKML
FT                   QVNKDTVVQGIVLGEVFGPPRAKKPHRTMRPARKN"
FT   gene            complement(595548..596543)
FT                   /locus_tag="BSn5_03250"
FT   CDS_pept        complement(595548..596543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03250"
FT                   /product="hypothetical protein"
FT                   /note="COG4864 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93282"
FT                   /protein_id="ADV93282.1"
FT                   /translation="MDPSTLMILAIVAVAIIVLAVFFTFVPVMLWISALAAGVKISIFT
FT                   LVGMRLRRVIPNRVVNPLIKAHKAGLNVGTNQLESHYLAGGNVDRVVNALIAAQRANIE
FT                   LTFERCAAIDLAGRDVLEAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIERL
FT                   VGGAGEETIVARVGEGIVSTIGSSDNHKKVLENPDMISQTVLGKGLDSGTAFEILSIDI
FT                   ADVDIGKNIGAILQTDQAEADKNIAQAKAEERRAMAVAQEQEMRARVEEMRAKVVEAEA
FT                   EVPLAMAEALREGNIGVMDYMNIKNIDADTEMRDSFGKLTKDPSDEDRKS"
FT   gene            complement(596565..597878)
FT                   /locus_tag="BSn5_03255"
FT   CDS_pept        complement(596565..597878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03255"
FT                   /product="putative membrane bound hydrolase"
FT                   /note="COG1030 Membrane-bound serine protease (ClpP class)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03255"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93283"
FT                   /protein_id="ADV93283.1"
FT                   /translation="MLQIKGFRAALLGIFLLSLLGVQLNAKAEKQAVYVIPVEKNVEQG
FT                   LASFLSRSLQDAKDAHADHIILDINTPGGLVKSAIDMADLITESEIPVTAYVNKRALSA
FT                   GAYIALQADHIYMAPGGKMGAAAIVDGQGNAADQKAQSLWLAEMEDAAVKNNRDPKYAL
FT                   AMADPDIDAKEVGAPKGDLLILNADKAIEVGYSEGTADNLSTLVKKLGFEKAQISYAKE
FT                   SFAEKTARWLTNPVIVPILLTIAFLGLTVELFSPGVGLPGTAGLIALLLFFYGHLAAGL
FT                   AGYETVLLFIAGVILILLEIFLPGGIIGLLGLGAIIASLFLAAGSFTVMAVSLLIASAV
FT                   SITAFILLTRVLGKRMKFFKKLILNDSTNTESGYVSNQTRTDLMGKVGITFTPLRPSGT
FT                   VIIDDERLDVVSEGSFTEKDKKVKVIKVEGSRIVVREI"
FT   gene            complement(598010..598456)
FT                   /locus_tag="BSn5_03260"
FT   CDS_pept        complement(598010..598456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03260"
FT                   /product="hypothetical protein"
FT                   /note="COG1610 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93284"
FT                   /protein_id="ADV93284.1"
FT                   /translation="MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKLKKDSL
FT                   TEDEELTVLSRELKQRKDSLQEFSNANRLDLVDKVQKELDILEVYLPEQLSEEELRTIV
FT                   NETIAEVGASSKADMGKVMGAIMPKVKGKADGSLINKLVSSQLS"
FT   gene            complement(598471..598644)
FT                   /gene="rpsU"
FT                   /locus_tag="BSn5_03265"
FT   CDS_pept        complement(598471..598644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="BSn5_03265"
FT                   /product="30S ribosomal protein S21"
FT                   /note="COG0828 Ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03265"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93285"
FT                   /protein_id="ADV93285.1"
FT                   /translation="MSKTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKR
FT                   KKKSEAARKRKF"
FT   gene            598817..599740
FT                   /locus_tag="BSn5_03270"
FT   CDS_pept        598817..599740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03270"
FT                   /product="putative Na+/anion cotransporter"
FT                   /note="COG1283 Na+/phosphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93286"
FT                   /protein_id="ADV93286.1"
FT                   /translation="MLILISFTALILFFLAGMNMLRKGLISMAYSKIEERLLLFTDHPL
FT                   KAFLISIVFTGILQSSSAFMVIVIGFVSAGVLSFKRTIPMILGTNVGSTFTTEFIAIKM
FT                   DILIWVLLIGGLLFFLTGRYPLKQLGTSFLGLGIIFFCISGFSHLAGPLTKLKTGADVL
FT                   YHVNDSNWSALLIGMVLTAIIHSSSVCIGILMSFMNEGIIGLTQAMSVVLGSNIGTCIT
FT                   AVMAAVSGGYAAKQTAYAHVVFNVLGVALVLPFLTAATGFVEQLSPDPAQRIAHFSLLF
FT                   NVVTALLFLPLTNLFYRLIHLLIPAK"
FT   gene            complement(599776..601131)
FT                   /locus_tag="BSn5_03275"
FT   CDS_pept        complement(599776..601131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03275"
FT                   /product="ribosomal protein S12 methylthiotransferase"
FT                   /note="COG0621 2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03275"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93287"
FT                   /protein_id="ADV93287.1"
FT                   /translation="MATVAFHTLGCKVNHYETEAIWQLFKEAGYERRDFEQTADVYVIN
FT                   TCTVTNTGDKKSRQVIRRAIRQNPDGVICVTGCYAQTSPAEIMAIPGVDIVVGTQDREK
FT                   MLGYIDQYREERQPINGVSNIMKARVYEELDVPAFTDRTRASLKIQEGCNNFCTFCIIP
FT                   WARGLLRSRDPEEVIKQAQQLVDAGYKEIVLTGIHTGGYGEDMKDYNFAKLLSELDTRV
FT                   EGVKRIRISSIEASQITDKVIEVLDRSDKIVNHLHIPIQSGSNTVLKRMRRKYTMEFFA
FT                   DRLNKLKKALPGLAVTSDVIVGFPGETEEEFMETYNFIKEHKFSELHVFPYSKRTGTPA
FT                   ARMEDQVDENVKNERVHRLIALSDQLAKEYASQYENEVLEIIPEEAYKETEEENMFVGY
FT                   TDNYMKVVFKGTEDMIGKIVKVKILKAGYPYNEGQFVRVVEDEITEHMRLSS"
FT   gene            complement(601131..601901)
FT                   /locus_tag="BSn5_03280"
FT   CDS_pept        complement(601131..601901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03280"
FT                   /product="16S ribosomal RNA methyltransferase RsmE"
FT                   /note="COG1385 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93288"
FT                   /protein_id="ADV93288.1"
FT                   /translation="MQRYFIELTKQQIEEAPAFSITGEDVHHIVNVMRMNEGDQIICCS
FT                   QDGFEAKCELQSVSKDKVSCLVIEWTNENRELPIKVYIASGLPKGDKLEWIIQKGTELG
FT                   AHAFIPFQAARSVVKLDDKKAKKKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQQLLQR
FT                   MQDFDKCVVAYEESSKQGEISAFSAIVSSLPKGSSLLIVFGPEGGLTEAEVERLTEQDG
FT                   VPCGLGPRILRTETAPLYALSAISYQTELLRGDQ"
FT   gene            complement(601924..602859)
FT                   /gene="prmA"
FT                   /locus_tag="BSn5_03285"
FT   CDS_pept        complement(601924..602859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="BSn5_03285"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG2264 Ribosomal protein L11 methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03285"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93289"
FT                   /protein_id="ADV93289.1"
FT                   /translation="MKWSELSIHTTHEAVEPISNILHEAGASGVVIEDPLDLIKERENV
FT                   YGEIYQLDPNDYPDEGVIVKAYLPVNSFLGETVDGIKETINNLLLYNIDLGRNHITISE
FT                   VNEEEWATAWKKYYHPVKISEKFTIVPTWEEYTPVHTDELIIEMDPGMAFGTGTHPTTV
FT                   LCIQALERFVQKGDKVIDVGTGSGILSIAAAMLEAESVHAYDLDPVAVESARLNLKLNK
FT                   VSDIAQVKQNNLLDGIEGEHDVIVANILAEVILRFTSQAYSLLKEGGHFITSGIIGHKK
FT                   QEVKEALEQAGFTIVEILSMEDWVSIIAKK"
FT   gene            complement(602884..604011)
FT                   /locus_tag="BSn5_03290"
FT   CDS_pept        complement(602884..604011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03290"
FT                   /product="chaperone protein DnaJ"
FT                   /note="COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93290"
FT                   /protein_id="ADV93290.1"
FT                   /translation="MSKRDYYEVLGVSKSASKDEIKKAYRKLSKKYHPDINKEAGSDEK
FT                   FKEVKEAYETLSDDQKRAHYDQFGHTDPNQGFGGGGFGGGDFGGFGFDDIFSSIFGGGT
FT                   RRRDPNAPRQGADLQYTMTLSFEDAAFGKETTIEIPREETCETCKGSGAKPGTNPETCS
FT                   HCGGSGQLNVEQNTPFGKVVNRRVCHHCEGTGKIIKNKCADCGGKGKIKKRKKINVTIP
FT                   AGVDDGQQLRLSGQGEPGINGGPAGDLFVVFHVRAHEFFERDGDDIYCEMPLTFAQAAL
FT                   GDEVEVPTLHGKVKLKIPAGTQTGTKFRLRGKGVQNVRGYGQGDQHIVVRVVTPTNLTD
FT                   KQKDIIREFAEVSGNLPDEQEMSFFDKVKRAFKGD"
FT   gene            complement(604211..606046)
FT                   /gene="dnaK"
FT                   /locus_tag="BSn5_03295"
FT   CDS_pept        complement(604211..606046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="BSn5_03295"
FT                   /product="molecular chaperone DnaK"
FT                   /note="COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03295"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93291"
FT                   /protein_id="ADV93291.1"
FT                   /translation="MSKVIGIDLGTTNSCVAVLEGGEPKVIANAEGNRTTPSVVAFKNG
FT                   ERQVGEVAKRQSITNPNTIMSIKRHMGTDYKVEIEGKDYTPQEVSAIILQHLKSYAESY
FT                   LGETVSKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKTDEDQT
FT                   ILVYDLGGGTFDVSILELGDGVFEVRSTAGDNRLGGDDFDQVIIDHLVSEFKKENGIDL
FT                   SKDKMALQRLKDAAEKAKKDLSGVSSTQISLPFITAGEAGPLHLELTLTRAKFEELSSH
FT                   LVERTMGPVRQALQDAGLSASEIDKVILVGGSTRIPAVQEAIKKETGKEAHKGVNPDEV
FT                   VALGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQTAVDIHVLQGERPMSADNKTLGRFQLTDIPPAPRGVPQIEVSFDIDKNGIVNVRA
FT                   KDLGTGKEQNITIKSSSGLSDEEIERMVKEAEENADADAKKKEEIEVRNEADQLVFQTE
FT                   KTLKDLEGKVDEEQVKKANDAKDALKAAIEKNEFEEIKAKKDELQTIVQELSMKLYEEA
FT                   AKAQQAQGGANAEGKADDNVVDAEYEEVNDDQNKK"
FT   gene            complement(606070..606633)
FT                   /locus_tag="BSn5_03300"
FT   CDS_pept        complement(606070..606633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03300"
FT                   /product="heat shock protein GrpE"
FT                   /note="COG0576 Molecular chaperone GrpE (heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93292"
FT                   /protein_id="ADV93292.1"
FT                   /translation="MSEEKQTVEQNETEEQEIIEEQAAADEQQEETNESELLQNQINEL
FT                   QGLLEEKENKLLRVQADFENYKRRSRLEMEASQKYRSQNIVTDLLPALDSFERALQVEA
FT                   DNEQTKSLLQGMEMVHRQLVEALKKEGVEAIEAVGQEFDPNLHQAVMQAEDENYGSNIV
FT                   VEEMQKGYKLKDRVIRPSMVKVNQ"
FT   gene            complement(606705..607736)
FT                   /gene="hrcA"
FT                   /locus_tag="BSn5_03305"
FT   CDS_pept        complement(606705..607736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="BSn5_03305"
FT                   /product="heat-inducible transcription repressor"
FT                   /note="COG1420 Transcriptional regulator of heat shock
FT                   gene"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03305"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93293"
FT                   /protein_id="ADV93293.1"
FT                   /translation="MLTNRQLLILQVIINDFIKSAQPVGSRTLSKKDEITFSSATIRNE
FT                   MADLEELGFIEKTHSSSGRVPSEKGYRYYVDHLLSPVKLTKSDLDQIHSIFKEKIFELE
FT                   KTVQKSAQILSDLTNYTSIVLGPKLSENYLKQIQIIPIQPDMAVAILVTNTGHVENKTI
FT                   NFPTKMDLSDIEKLVNILNDRLSGVPMDELNERIFKEVVMYLRQHIKNYDNILDALRST
FT                   FHSTNHVEKLFFGGKINMLNQPEFHDITRVRSLLSLIEKEQDVLKLVQSPHTGISIKIG
FT                   KENDYEEMENCSLITASYSVDQKQIGSIAIIGPTRMNYSRVVSLLQHVTSDLSKALTSL
FT                   YDE"
FT   gene            complement(607817..608956)
FT                   /locus_tag="BSn5_03310"
FT   CDS_pept        complement(607817..608956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03310"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="COG0635 Coproporphyrinogen III oxidase and related
FT                   Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93294"
FT                   /protein_id="ADV93294.1"
FT                   /translation="MKSAYIHIPFCEHICHYCDFNKYFIQSQPVDEYLNALEQEMINTI
FT                   AKTGQPDLKTIFIGGGTPTSLSEEQLKKLMDMINRVLKPSSDLSEFAVEANPDDLSAEK
FT                   LKILKEAGVNRLSFGVQTFEDDLLEKIGRVHKQKDVFTSFERAREIGFENISLDLMFGL
FT                   PGQTLKHLEHSINTALSLDAEHYSVYSLIVEPKTVFYNLMQKGRLHLPPQEQEAEMYEM
FT                   VMSQMEAHGIHQYEISNFAKAGMESKHNLTYWSNEQYFGFGAGAHGYIGGTRTVNVGPV
FT                   KHYIDLIAEKGFPYRDTHEVTTEEQIEEEMFLGLRKTAGVSKKRFAEKYGRSLDGLFPS
FT                   VLKDLAEKGLIHNSESAVYLTHQGKLLGNEVFGAFLGEL"
FT   gene            complement(609009..610847)
FT                   /locus_tag="BSn5_03315"
FT   CDS_pept        complement(609009..610847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03315"
FT                   /product="GTP-binding protein LepA"
FT                   /note="COG0481 Membrane GTPase LepA"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03315"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93295"
FT                   /protein_id="ADV93295.1"
FT                   /translation="MTDKEKRLERQSRIRNFSIIAHIDHGKSTLADRILEKTSAITQRE
FT                   MKEQLLDSMDLERERGITIKLNSVQLKYKAKDGEEYIFHLIDTPGHVDFTYEVSRSLAA
FT                   CEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPSAEPERVRQEVEDVIGL
FT                   DASEAVLASAKAGIGIEEILEQIVEKVPAPTGDPEAPLKALIFDSLYDAYRGVVAYIRV
FT                   VEGTVKPGQKIKMMATGKEFEVTEVGVFTPKATPTNELTVGDVGFLTASIKNVGDTRVG
FT                   DTITSAANPAEEALPGYRKLNPMVYCGLYPIDTAKYNDLREALEKLELNDSSLQYEAET
FT                   SQALGFGFRCGFLGMLHMEIIQERIEREFNIDLITTAPSVIYDVYMTDGEKVVVDNPSN
FT                   MPDPQKIERVEEPYVKATMMVPNDYVGAVMELCQGKRGNFIDMQYLDANRVSIIYDMPL
FT                   AEIVYEFFDQLKSSTKGYASFDYELIGYKPSKLVKMDIMLNGEKIDALSFIVHRDYAYE
FT                   RGKVIVEKLKELIPRQQFEVPVQAAIGQKIVARSTIKAMRKNVLAKCYGGDISRKRKLL
FT                   EKQKEGKRRMKQVGSVEVPQEAFMAVLKMDDSPKKQ"
FT   gene            complement(610981..611319)
FT                   /locus_tag="BSn5_03320"
FT   CDS_pept        complement(610981..611319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93296"
FT                   /protein_id="ADV93296.1"
FT                   /translation="MIAYFGKCLLLVTIMFLGVLFGMQQANNGMLSMKGYHDPSLKGAF
FT                   TLTDGKDNEKEASILGETVTAKDLEEKQKELEKVETFNMFSKAGKALSDTVTNTAQSMY
FT                   EWIRDMNQ"
FT   gene            complement(611336..612541)
FT                   /locus_tag="BSn5_03325"
FT   CDS_pept        complement(611336..612541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03325"
FT                   /product="stage II sporulation protein P"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03325"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93297"
FT                   /protein_id="ADV93297.1"
FT                   /translation="MRNKRRNRQIVVAVNGGKAVKAIFLFIVSLIVIFVLSGVLTSLRP
FT                   ELRPSSDSFYGIAEELPGDVFAHLLRMENHYFASDLSQTDSSFHLSRLSLKLATSINLE
FT                   DPRSFLGRELPGFAQFDTEILLAGQGTDYTNMPAESPPPSKVMEEEREANLAEIEKQQT
FT                   QSDNAQKDPPKQTTGDKKVVFIYHTHNTESYLPLLKGETDPDMARHSKANVTLVGDMFG
FT                   QALESQGIGATVNKTDIQSKLNKKGLNYARSYDESRPVVKDALASNKNLQYIIDIHRDS
FT                   RRKKDTTATIKGKSYARVAFVVGKKSKNFEENYKIASELHKLMEKKYPGLSTGVFSKGS
FT                   PGDNGVYNQDLTDRALLLEFGGVDNNLEELQRAANAAADVFSEMYWDAEKVNAASGETK
FT                   KQ"
FT   gene            complement(612604..613710)
FT                   /locus_tag="BSn5_03330"
FT   CDS_pept        complement(612604..613710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03330"
FT                   /product="germination protease"
FT                   /EC_number="3.4.24.78"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93298"
FT                   /protein_id="ADV93298.1"
FT                   /translation="MKNSELDVNQYLIRTDLAVETKEAMANQQAVPTKEIKGFIEKERD
FT                   HGGIKIRTVDVTKEGAELSGKKEGRYLTLEAQGIRENDSEMQEKVSAVFAEEFSAFLEN
FT                   LNISKDASCLIVGLGNWNVTPDALGPMAVENLLVTRHLFKLQPENVQEGYRPVSAFAPG
FT                   VMGITGIETSDIIKGVIEQSKPDFVIAIDALAARAVERVNTTIQISDTGIHPGSGVGNK
FT                   RKDLSKDTLGVPVIAIGVPTVVDAVTIASDTVDYILKHFGREMKDNRPSRSLVPAGMTF
FT                   GKKKVLTEDDLPDQKQRQSFLGIVGTLQEDEKRQLIHEVLSPLGHNLMVTPKEVDSFID
FT                   DMANVLANGLNTALHEKVSQENKGSYNH"
FT   gene            613914..614180
FT                   /gene="rpsT"
FT                   /locus_tag="BSn5_03335"
FT   CDS_pept        613914..614180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="BSn5_03335"
FT                   /product="30S ribosomal protein S20"
FT                   /note="COG0268 Ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03335"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93299"
FT                   /protein_id="ADV93299.1"
FT                   /translation="MPNIKSAIKRTKTNNERRVHNATIKSAMRTAIKQVEASVANNEAD
FT                   KAKTALTEAAKRIDKAVKTGLVHKNTAARYKSRLAKKVNGLSA"
FT   gene            complement(614195..615238)
FT                   /gene="holA"
FT                   /locus_tag="BSn5_03340"
FT   CDS_pept        complement(614195..615238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="BSn5_03340"
FT                   /product="DNA polymerase III subunit delta"
FT                   /note="COG1466 DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93300"
FT                   /protein_id="ADV93300.1"
FT                   /translation="MVFDVWKSLKKGEVHPVYCLYGKETYLLQETVSRIRQTVVDQETK
FT                   DFNLSVFDLEEDPLDQAIADAETFPFMGERRLVIVKNPYFLTGEKKKEKIEHNVSALES
FT                   YIQSPAPYTVFVLLAPYEKLDERKKLTKALKKHAFMMEAKELNAKETTDFTVNLAKTEQ
FT                   KTIGTEAAEHLVLLVNGHLSSIFQEIQKLCTFIGDREEITLDDVKMLVARSLEQNIFEL
FT                   INKIVNRKRTESLQIFYDLLKQNEEPIKIMALISNQFRLILQTKYFAEQGYGQKQIASN
FT                   LKVHPFRVKLAMDQARLFSEEELRSIIEQLAVMDYEMKTGKKDKQLLLELFLLQLLKRN
FT                   EKNDPHY"
FT   gene            615468..615602
FT                   /locus_tag="BSn5_03345"
FT   CDS_pept        615468..615602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03345"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93301"
FT                   /protein_id="ADV93301.1"
FT                   /translation="MNDFEKNVQSKRNDAVDSAVGFVVSFGFFAFLFVMATVIHLVGS"
FT   gene            complement(615642..617969)
FT                   /locus_tag="BSn5_03350"
FT   CDS_pept        complement(615642..617969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03350"
FT                   /product="DNA channel for uptake in competent cells"
FT                   /note="COG0658 Predicted membrane metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93302"
FT                   /protein_id="ADV93302.1"
FT                   /translation="MNSRLLLPMAAASATAGITAAAYFPAIFLFILFLLIILIKTRHAF
FT                   LIIVCFFSFILFFVLYAVTDSQNVSSYRQGTYQFKAVIDTIPKIDGDRMSMVVKTPDKE
FT                   KWAAAYRILSAGEKEQLLYIEPGMSCELTGTLEEPNHATVPGAFDYNEYLYRQHIHWNY
FT                   SVTSIQNCSEPENFKYKVLSLRKHTISFTNSLLPPDSAGIVQALTVGDRFYVEDEVLTA
FT                   YQKLGVVHLLAISGLHVGILTAGLFYIMIRLGITREKASILLLLFLPLYVMLTGAAPSV
FT                   LRAALMSGVYLAGSLVKWRVHSATAICLSYIVLLLFNPYHLFEAGFQLSFAVSFSLILS
FT                   SSIFQQVKTSLGQLTIVSLIAQLGSLPILLYHFHQFSIISVPMNMLMVPFYTFCILPGA
FT                   VAGVLLLSLSASFGRLFFSWFDLLISWTNRLITNIADVDVFTIMIAHPAPVLLFLFTVA
FT                   IILLLMAIEKRSLSQLMITGGICCTVMFLLFIYPCLSSEGEVDMIDIGQGDSMFVGAPH
FT                   QRGRVLIDTGGTLSYSSEPWREKQHPFSLGEKVLIPFLTAKGIKQLDALILTHADQDHI
FT                   GEAETLLKHHKVKRLVIPKGFVSEPKDEKVLQTAREEGVTIEEVKRGDVLQIKDLQFHV
FT                   LSPETPDPASKNNSSLVLWMETGVLSWILTGDLEKEGEQEVMDVFPNIKADVLKVGHHG
FT                   SKGSTGEEFIQQLQPKTAIISAGKNNRYHHPHQKVLQLLQRHSIRVLRTDQNGTIQYRY
FT                   KNRVGTFSVYPPYDTSDITETN"
FT   gene            complement(617969..618538)
FT                   /locus_tag="BSn5_03355"
FT   CDS_pept        complement(617969..618538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03355"
FT                   /product="putative enzyme associated to DNA transport
FT                   (competence)"
FT                   /note="COG2131 Deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03355"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93303"
FT                   /protein_id="ADV93303.1"
FT                   /translation="MERISWNQYFMAQSHLLALRSTCPRLSVGATIVRDKRMIAGGYNG
FT                   SIAGGVHCADEGCLMIDDHCARTIHAEMNAILQCSKFGVPTDGAEIYVTHYPCIQCCKS
FT                   IIQAGIKTVYYAEDYKTHPYAQELFEQAGVTVEQVELDEMIVDLKNREKLSFVADLIGK
FT                   LADAGLAEEELKKIHEQANTLFTSYV"
FT   gene            complement(618605..619222)
FT                   /locus_tag="BSn5_03360"
FT   CDS_pept        complement(618605..619222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03360"
FT                   /product="membrane bound high-affinity DNA-binding
FT                   receptor"
FT                   /note="COG1555 DNA uptake protein and related DNA-binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93304"
FT                   /protein_id="ADV93304.1"
FT                   /translation="MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETE
FT                   NTVVKQEANNDESNETIVIDIKGAVQHPGVYEMRTGDRVSQAIEKAGGTSEQADEAQVN
FT                   LAEILQDGTVVYIPKKGEETAVQQGGGGSVQSDGGKGALVNINTATLEELQGISGVGPS
FT                   KAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVK"
FT   gene            619306..620127
FT                   /locus_tag="BSn5_03365"
FT   CDS_pept        619306..620127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03365"
FT                   /product="late competence protein ComER"
FT                   /note="COG0345 Pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03365"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93305"
FT                   /protein_id="ADV93305.1"
FT                   /translation="MKIGFIGTGNMGTILIESFIESKAADPSNITITNRTIEKALHIKK
FT                   RYNSINVTESLEKLVSENEMIFICVKPLDIYPLLAIALPYLRKDHILISITSPVQTEQL
FT                   EQYVPCQVARVIPSITNRALAGVSLVTFGTSCGESAKTKINELMQHISHPLQIESDITR
FT                   VASDIVSCGPAFMSYLIQRFIDAAVSETSVSKQDAILMCKEMLVGMGKLLETELYTLPA
FT                   LQEKVCVKGGVTGEGIKALESGVQDMFHRVFQNTHMKYEEDISAVKKQFHV"
FT   gene            complement(620193..620936)
FT                   /locus_tag="BSn5_03370"
FT   CDS_pept        complement(620193..620936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03370"
FT                   /product="hypothetical protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93306"
FT                   /protein_id="ADV93306.1"
FT                   /translation="MIYQGFASVYDELMSHAPYDQWTKWIEASLPEKGRILDLACGTGE
FT                   ISIRLAEKGFEVTGIDLSEEMLSFAQQKVSSSQPILFLQQDMREITGFDGQFDAVVICC
FT                   DSLNYLKTKNDVIETFKSVFRVLKPEGILLFDVHSSYKIAEVFPDSTFADQDEDISYIW
FT                   QSFAGSGELSVIHDMSFFVWNGEAYDRFDETHEQRTFPVEEYEEMLKSCGFQLHRVTAD
FT                   FTDTEPSAQSERLFFKAQKSKTIVS"
FT   gene            complement(620933..621289)
FT                   /locus_tag="BSn5_03375"
FT   CDS_pept        complement(620933..621289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03375"
FT                   /product="hypothetical protein"
FT                   /note="COG0799 Uncharacterized homolog of plant Iojap
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03375"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93307"
FT                   /protein_id="ADV93307.1"
FT                   /translation="MNQKSILKIAAAACDDKRAEDILALDMEGISLVADYFLICHGNSD
FT                   KQVQAIAREIKDQADENGIQVKKMEGFDEARWVLVDLGDVIVHVFHKDERSYYNLEKLW
FT                   GDAPLADLDLGMNQ"
FT   gene            complement(621307..621867)
FT                   /locus_tag="BSn5_03380"
FT   CDS_pept        complement(621307..621867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03380"
FT                   /product="putative hydrolase"
FT                   /note="COG1713 Predicted HD superfamily hydrolase involved
FT                   in NAD metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93308"
FT                   /protein_id="ADV93308.1"
FT                   /translation="MNREEALACVKQQLTEHRYIHTVGVMNTAIELAERFGADSKKAEI
FT                   AAIFHDYAKFRPKEEMKQIIAREKMPAHLLDHNPELWHAPVGAYLVQREAGVQDEDILD
FT                   AIRYHTSGRPGMTLLEKVIYVADYIEPNRAFPGVDEVRKLAETDLNQALIQSIKNTMVF
FT                   LMKKNQPVFPDTFLTYNWLVSGS"
FT   gene            complement(621857..622426)
FT                   /gene="nadD"
FT                   /locus_tag="BSn5_03385"
FT   CDS_pept        complement(621857..622426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="BSn5_03385"
FT                   /product="nicotinic acid mononucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="COG1057 Nicotinic acid mononucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03385"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93309"
FT                   /protein_id="ADV93309.1"
FT                   /translation="MKKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMPNQIPPHK
FT                   QNEDYTDSFHRVEMLKLAIQSNPSFKLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFI
FT                   IGADMIEYLPKWYKLDELLNLIQFIGVKRPGFHVETPYPLLFADVPEFEVSSTMIRERF
FT                   KSKKPTDYLIPDKVKKYVEENGLYES"
FT   gene            complement(622438..622728)
FT                   /locus_tag="BSn5_03390"
FT   CDS_pept        complement(622438..622728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03390"
FT                   /product="putative RNA-binding protein"
FT                   /note="COG1534 Predicted RNA-binding protein containing KH
FT                   domain, possibly ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93310"
FT                   /protein_id="ADV93310.1"
FT                   /translation="MLTGKQKRFLRSKAHHLTPIFQVGKGGVNDNMIKQIAEALEAREL
FT                   IKVSVLQNCEEDKNDVAEALVKGSRSQLVQTIGNTIVLYKESKENKQIELP"
FT   gene            complement(622722..623564)
FT                   /gene="aroE"
FT                   /locus_tag="BSn5_03395"
FT   CDS_pept        complement(622722..623564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="BSn5_03395"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="COG0169 Shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03395"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93311"
FT                   /protein_id="ADV93311.1"
FT                   /translation="MKKLYGVIGNPIGHSMSPDIHNASLKDLGLDGHYHAFKVEENDLE
FT                   DAVKGIRALGVQGINVTVPHKISIMDYLDHIDESAKLLGAVNTVRREGDKLVGYNTDGE
FT                   GFVKSLMKVLDKPISELSFLMIGAGGAARAIFTTIVRNTPKKFDICNRTLEKAKRLTEA
FT                   TPSFHNKEVLSIKEAEERLEQYDVIIHTTSVGMYPNVDDVPLSLQRAASSAVVCDIVYN
FT                   PIQTALLKEASQKGLKTLDGVGMFVEQAALSFQLWTGQEPDIEKMRSIVIGKLGGTEC"
FT   gene            complement(623582..624682)
FT                   /locus_tag="BSn5_03400"
FT   CDS_pept        complement(623582..624682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03400"
FT                   /product="GTPase YqeH"
FT                   /note="COG1161 Predicted GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93312"
FT                   /protein_id="ADV93312.1"
FT                   /translation="MEKVVCIGCGVTIQTEDKTGLGYAPPASLTKENVICQRCFRLKNY
FT                   NEIQDVSLTDDDFLNILHGIGETDSLVVKIVDIFDFNGSWINGLQRLVGGNPILLVGNK
FT                   ADILPKSLKRERLIQWMKREAKELGLKPVDVFLVSAGRGQGIREVIDAIEHYRNGKDVY
FT                   VVGCTNVGKSTFINRIIKEVSGEEDIITTSQFPGTTLDAIEIPLDDGSSLYDTPGIINN
FT                   HQMAHYVNKKDLKILSPKKELKPRTFQLNDQQTLYFGGLARFDYVSGERSPFICYMPNE
FT                   LMIHRTKLENADALYEKHAGELLTPPGKDEMDEFPELVAHTFTIKDKKTDIVFSGLGWV
FT                   TVHDADKKVTAYAPKGVHVFIRRSLI"
FT   gene            complement(624686..625204)
FT                   /locus_tag="BSn5_03405"
FT   CDS_pept        complement(624686..625204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03405"
FT                   /product="putative hydrolase"
FT                   /note="COG2179 Predicted hydrolase of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03405"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93313"
FT                   /protein_id="ADV93313.1"
FT                   /translation="MLKKFFLPDEFVKNIFHITPEKLKERNVKGIITDLDNTLVEWDRP
FT                   NATPRLIEWFEEMKEHGIKVTIVSNNNERRVKLFSEPLGIPFIYKARKPMGKAFNRAVR
FT                   NMELKKEDCVVIGDQLLTDVLGGNRNGYHTILVVPVASSDGFITRFNRQVERRILSALK
FT                   RKGHIQWEE"
FT   gene            625566..625706
FT                   /locus_tag="BSn5_03410"
FT   CDS_pept        625566..625706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03410"
FT                   /product="check point factor coupling initiation of
FT                   sporulation and replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03410"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93314"
FT                   /protein_id="ADV93314.1"
FT                   /translation="MRKLSDELLIESYFKATEMNLNRDFIELIENEIKRRSLGHIISVS
FT                   S"
FT   gene            complement(625845..625937)
FT                   /locus_tag="BSn5_03415"
FT   CDS_pept        complement(625845..625937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03415"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93315"
FT                   /protein_id="ADV93315.1"
FT                   /translation="MYWAGRAYGYAFIVVLVVVLLVVGGIYWLA"
FT   gene            complement(626012..626743)
FT                   /locus_tag="BSn5_03420"
FT   CDS_pept        complement(626012..626743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03420"
FT                   /product="putative lipoprotein; putative esterase"
FT                   /note="COG2755 Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93316"
FT                   /protein_id="ADV93316.1"
FT                   /translation="MKHFIILFLLLFVTAGCAGRGYEDVVAFGDSNTRGSNWDYRDYPK
FT                   AQQWVNILKTAERGNLDILNAGIGGQTTEDARLRFQTDVLDQKPKYLFIMFGTNDAAIL
FT                   TEGKPRVSKQRFRENLVYFIEESRKHGIKPILMTCIPIIEGNGKHHLFYYSRYQAAAFK
FT                   PKGGARKWHNSYNDITRDVSKRLDVPLVDNWKHFIEADGGKATDEALIQSGLIDPSGNH
FT                   MTPKGARIVYEGIQDGQILQR"
FT   gene            complement(626774..626995)
FT                   /locus_tag="BSn5_03425"
FT   CDS_pept        complement(626774..626995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03425"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93317"
FT                   /protein_id="ADV93317.1"
FT                   /translation="MQDLTDNLFPVRIQVIFFFFGLCVFQIGKKGILKNHQLRRNESRM
FT                   IFTEGDTLTIGKNSDSKKLFIERRETEV"
FT   gene            complement(626996..627748)
FT                   /locus_tag="BSn5_03430"
FT   CDS_pept        complement(626996..627748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03430"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /note="COG5632 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03430"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93318"
FT                   /protein_id="ADV93318.1"
FT                   /translation="MVTIKKDFIPVSNDNRPGYALTPAYITVHNTANTAKGADAKMHAN
FT                   FVKNPSTSESWHFTVDDSVIYQHLPIDENGWHAGDGTNGTGNRKSIGIEICENADGDFE
FT                   KATSNAQWLIRKLMKENNIPLHRVVPHKKWSGKECPRKLLNHWNSFINGISSSDTPPKE
FT                   SSPSYPLPSGVIKLTSPYRKGTNILQLQKALAALHFYPDKGAKNNGIDGVYGPKTANAV
FT                   KRFQLMNGLTADGIYGPKTKAKLKSKLK"
FT   gene            627935..628561
FT                   /locus_tag="BSn5_03435"
FT   CDS_pept        627935..628561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03435"
FT                   /product="hypothetical protein"
FT                   /note="COG0398 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03435"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93319"
FT                   /protein_id="ADV93319.1"
FT                   /translation="MLKKVIGILVIIAIIAVGFFQKEAWLDAIKTGGMFSVLFSMLLIA
FT                   ADVFFPIVPFALIAALNGAVFGTANGIWITLTGSMLGTILLFFLARYSFRDWARKKVQA
FT                   YPAIQSYEASFNKNAFTAVLLGRLIPVIPSLIMNVICGLSQVRWHVFFFASLIGKIPNI
FT                   IVVTIAGANFTSNKLLSISIYGTYILIIMVVIYKKFPHLLKVPKK"
FT   gene            complement(628580..629473)
FT                   /locus_tag="BSn5_03440"
FT   CDS_pept        complement(628580..629473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03440"
FT                   /product="6-phosphogluconate dehydrogenase-like protein"
FT                   /note="COG1023 Predicted 6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03440"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93320"
FT                   /protein_id="ADV93320.1"
FT                   /translation="MKIGLIGLGKMGINLGKQFIDRNHQAVGYDVNQAAVDELKAYGAE
FT                   GTTNLKEFISLLDPPRILWVMVPHGIVDAVLRDVSPLLSKGDMIIEAGNSHYKESIRRY
FT                   NQMKEAGIHYLDAGTSGGMEGARHGACFMVGGDHEAWEIVEPLFRDTAVENGYLYTGEA
FT                   GSGHFLKMIHNGIEYGMMAAIGEGFEVLENSQFDFDYEKVARVWNHGSVIRSWLMGLTE
FT                   RAFAKDAKLDQIKGIMHSSGEGKWTVETALDLQTATPVIAMSLMMRYRSLTDDTFTGKV
FT                   VAALRNEFGGHATEKK"
FT   gene            629728..630447
FT                   /locus_tag="BSn5_03445"
FT   CDS_pept        629728..630447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03445"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93321"
FT                   /protein_id="ADV93321.1"
FT                   /translation="MQNQSHTLIGVTKTAVFFLYAALAIIGFAIGYFIPQIAKWALSLP
FT                   WIPLEGPLRLITSFQGSTASFITALLGMCAGIWFAHSVIAMLLSVKITDHTVEFIKGKK
FT                   VQTIHSDDIALVFMDHKRLVLLGTAGYELVREEIDEKPVNVEKAFRQHHYEWATDGDPF
FT                   KDQFRRWIPDAPDLSQGAHALLKARHKALQDEEKDDIEEFRLELAQLGIVVRDEGTRQY
FT                   WRKAETYPPKIQLGEGL"
FT   gene            complement(630480..630890)
FT                   /locus_tag="BSn5_03450"
FT   CDS_pept        complement(630480..630890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03450"
FT                   /product="nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03450"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93322"
FT                   /protein_id="ADV93322.1"
FT                   /translation="MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETG
FT                   SHIRDAIAEGHPDICTIDRDGADKRREESLKGIPTKPGYDRDEWPMAVCEEGGAGADVR
FT                   YVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ"
FT   gene            631089..631556
FT                   /locus_tag="BSn5_03455"
FT   CDS_pept        631089..631556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03455"
FT                   /product="sporulation sigma factor SigK"
FT                   /note="COG1191 DNA-directed RNA polymerase specialized
FT                   sigma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03455"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93323"
FT                   /protein_id="ADV93323.1"
FT                   /translation="MTGVFAALGFVVKELVFLVSYVKNNAFPQPLSSSEEKKYLELMAK
FT                   GDEHARNMLIEHNLRLVAHIVKKFENTGEDAEDLISIGTIGLIKGIESYSAGKGTKLAT
FT                   YAARCIENEIVITKGGCIHPSLIRFNIYGVRIHNGNFFHDKVNNCFFIFKS"
FT   gene            complement(631464..632861)
FT                   /locus_tag="BSn5_03460"
FT   CDS_pept        complement(631464..632861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03460"
FT                   /product="site-specific DNA recombinase"
FT                   /note="COG1961 Site-specific recombinases, DNA invertase
FT                   Pin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03460"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93324"
FT                   /protein_id="ADV93324.1"
FT                   /translation="MLKYADEGFSGELLERPALNRLREDASKGLISQVICYDPDRLSRK
FT                   LMNQLIIDDELRKRNIPLIFVNGEYANSPEGQLFFAMRGAISEFEKAKIKERTSSGRLQ
FT                   KMKKGMIIKDSKLYGYKFVKEKRTLEIFEEEAKIIRMIFNYFTDHKSPFFGRVNGIALH
FT                   LTQMGVKTKKGAKVWHRQVVRQILMNSSYKGEHRQYKYDTEGSYVSKQAGNKSIIKIRP
FT                   EEEQITVAIPAIIPAEQWDYAQELLGQSKRKHLSISPHNYLLSGLVRCGKCGNTMTGKK
FT                   RKSHGKDYYVYTCRKNYSGAKDRGCGKEMSENKLNRHVWGEIFKFITNPQKYASFKEIE
FT                   QTNHLSDELELIQKEIEKTKKGRKRLLTLISLSDDDDLDIDEIKTQIIELQKKQNQLTE
FT                   KCNEIQSKMKVLDDTSSSENALKRAIDYFQSIGADNLTLEDKKTIINFIVKEVTVVDSD
FT                   TVYIETY"
FT   gene            complement(632866..633060)
FT                   /locus_tag="BSn5_03465"
FT   CDS_pept        complement(632866..633060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03465"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93325"
FT                   /protein_id="ADV93325.1"
FT                   /translation="MKVIIIEGPQADKCINDCYHYLIKLYRKEIQGDSNICKGIDRGTS
FT                   DQGIEHRQPDRGLYKESRD"
FT   gene            complement(633415..633834)
FT                   /locus_tag="BSn5_03470"
FT   CDS_pept        complement(633415..633834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03470"
FT                   /product="arsenate reductase"
FT                   /note="COG0394 Protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03470"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93326"
FT                   /protein_id="ADV93326.1"
FT                   /translation="MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLN
FT                   PNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFD
FT                   DPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK"
FT   gene            complement(633846..634886)
FT                   /locus_tag="BSn5_03475"
FT   CDS_pept        complement(633846..634886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03475"
FT                   /product="arsenical-resistance protein"
FT                   /note="COG0798 Arsenite efflux pump ACR3 and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03475"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93327"
FT                   /protein_id="ADV93327.1"
FT                   /translation="MKRLSFLDRYLTIWIFLAMALGIGLGFIFPSFVGGLNKLQVGTTS
FT                   IPLAIGLVLMMYPPLAKVRYEEIGRVFKDIKVLILSLVQNWIIGPTLMFILAIIFLPDK
FT                   PEYMIGLIMIGLARCIAMVIVWNDLSKGDTEYAAGLVAFNSIFQMLFFSVYAYIFVTVI
FT                   PQWLGMEGAVVNITMAEVAKSVFIYLGVPFIAGMVTRYIFVKVKGKEWYEKVFIPKISP
FT                   ITLIALLFTIIVMFSLKGDVIVSLPLDVVRVAIPLLIYFVLMFFVSFFLGKKIGANYAV
FT                   TTTLAFTAGSNNFELAIAVAVGVFGIHSGAAFAAVIGPLVEVPVMIALVKVALWFQRKY
FT                   FGSHSM"
FT   gene            complement(634909..635349)
FT                   /locus_tag="BSn5_03480"
FT   CDS_pept        complement(634909..635349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03480"
FT                   /product="putative thiol lyase"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03480"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93328"
FT                   /protein_id="ADV93328.1"
FT                   /translation="MKYVHVGVNVVSLEKSINFYEKVFGVKAVKVKTDYAKFLLETPGL
FT                   NFTLNVADEVKGNQVNHFGFQVDSLEEVLKHKKRLEKEGFFAREEMDTTCCYAVQDKFW
FT                   ITDPDGNEWEFFYTKSNSEVQKQDSSSCCVTPPSDITTNSCC"
FT   gene            complement(635410..635727)
FT                   /locus_tag="BSn5_03485"
FT   CDS_pept        complement(635410..635727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03485"
FT                   /product="transcriptional regulator (ArsR family) protein"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03485"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93329"
FT                   /protein_id="ADV93329.1"
FT                   /translation="MDETKSELLRKYEQKFKALADQKRLEIMYELCQRGKTCVCDLTEI
FT                   FEVTQSKLSYHLKILLDANLITKETKGTWSYYDLNDEEVNGLLSEELCCIFRKKGEGDC
FT                   C"
FT   gene            complement(636099..636863)
FT                   /locus_tag="BSn5_03490"
FT   CDS_pept        complement(636099..636863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03490"
FT                   /product="hypothetical protein"
FT                   /note="COG3403 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03490"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93330"
FT                   /protein_id="ADV93330.1"
FT                   /translation="MTELYAKSDLEKIKETLPGWQLDSFNYLNEKIGDKENKFPCIPGR
FT                   QAFLSDQLRIAFVGDPRNPETAKELAPLLTRYGTISRETGKYASLTVIFHTPEELLTDY
FT                   KIEDYESLFWQLLNSLSMEDPADWPDDIPENPDNFQWEYCFNGEPYFVLCATPAHSKRK
FT                   SRSFPYFMLTFQPRWVFEDLNDTTAFGRNMSKQIRKRLEAYDEVPIHPHLGWYGKKDNL
FT                   EWKQYFLRDDENQVSQCPFMKMKNLFKKKRSD"
FT   gene            complement(637177..637647)
FT                   /locus_tag="BSn5_03495"
FT   CDS_pept        complement(637177..637647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03495"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93331"
FT                   /protein_id="ADV93331.1"
FT                   /translation="MNSRGLSFFFLIILMLLLTSCTVDPNAADQYVQSKQLDVEIILPS
FT                   SLSKNKEQNLKMKLTQEGKKVEYATNVKFEIWKENHKEHLEVVEAEYENNGIYVATKTF
FT                   TDDGLYNIKADVKTRDAHVMPTRQVIVGKLLEEDKNVFKPDNKKHQEHQNHH"
FT   misc_feature    complement(637676..639039)
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|172056330|ref|YP_001812790.1| PepSY-associated TM helix
FT                   domain-containing protein"
FT   gene            complement(639581..640174)
FT                   /locus_tag="BSn5_03510"
FT   CDS_pept        complement(639581..640174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03510"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93332"
FT                   /protein_id="ADV93332.1"
FT                   /translation="MKKKAEERKNQILRAAFQAVSTQGYNSVTLQSIADHAGVSKGVVH
FT                   YYFDNKEDTLSQLLEWITNKIYKHELKAVDSESTPLDKLKAYVNSIFVSPEENEKFYKV
FT                   YLDFLSQATRNETYRKINHSFYQQCWGITSNIIIFGQETGVFDQSIDVEKASKTMRSIV
FT                   DGLLIQWLMSEDINSHEYYKEICYQSFLSLLKLT"
FT   gene            640332..641327
FT                   /locus_tag="BSn5_03515"
FT   CDS_pept        640332..641327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03515"
FT                   /product="YhfP"
FT                   /note="COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03515"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93333"
FT                   /protein_id="ADV93333.1"
FT                   /translation="MKDEFKALVVNKVDDEFSIKVKNVSPAFLPESDVHIQVHYSGINY
FT                   KDGLAGNPNGKIVRKYPFIPGIDLAGVVISSNDPRFKEGDKVIATSYDIGVSHFGGFSE
FT                   YASLPGDWIVPLPDNLTLKEAMIVGTAGFTAALSIQRLEENNLSPEKGKVLVTGATGGV
FT                   GSFAVSFLNSLGYQVEASTGKESEYDYLRKLGASTIISRDMTYGGKVKALGSQKWAAAV
FT                   DPVGGEPLASILSQIQYGGSVAVSGLTAGTKLPTTVFPFILRGVNLLGIDSVSCPMETR
FT                   LKTWHRVATDFKPSSLEEFISQEITLDQLPNVLPEILEGQVRGRTIVNIV"
FT   gene            complement(641858..642580)
FT                   /locus_tag="BSn5_03520"
FT   CDS_pept        complement(641858..642580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03520"
FT                   /product="collagen triple helix repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93334"
FT                   /protein_id="ADV93334.1"
FT                   /translation="MCAQLNACGGSSRGPTGPTGATGATGPTGATGITGATGPAGVTGA
FT                   TGITGPTGATGPTGATGATGATGATGATGITGATGITGATGPTGVTGATGITGPTGTGG
FT                   SVTGNSMYASNTVGSTIAVVLGGSPVPLPNNQSLDGFTVNGGNNMFTVPVAGRYYLSYQ
FT                   INTTLSLLAGSRLMRNGDPIPGSIISPAVSTSSYNDDVFATLDAGDRISLQLFGVVATV
FT                   ILLGGGSTGAALTIIRLN"
FT   gene            complement(642631..642978)
FT                   /locus_tag="BSn5_03525"
FT   CDS_pept        complement(642631..642978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03525"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93335"
FT                   /protein_id="ADV93335.1"
FT                   /translation="MAILGGCSNEQTGFVNDAVCFTIDLGDTGAVATPVWEDATSFVIN
FT                   GTIMVENNGIVGVGPTASLTVNGTAVAGFTVAPGESRSITLNDINSIGIVGAGGTGTAN
FT                   VTVSFSLNYQY"
FT   gene            complement(643055..643720)
FT                   /locus_tag="BSn5_03530"
FT   CDS_pept        complement(643055..643720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03530"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93336"
FT                   /protein_id="ADV93336.1"
FT                   /translation="MTCCIIEKLKRIQSEKQIKVDECFAVTPVFLINQEGEHFIASGIS
FT                   NGELFQTCYFKVISVNELRKCVVLELLVPCCMKTLCANKVLYRSDSRILIDISFFCGIG
FT                   EVKIPVYDYLILKPSIKDKFEICFLTNENKTGVLWNNESNFANTATVTLHHKDTKNSSI
FT                   KIILQTKENIYSLGVNKGESCSITVKDLECLKIESSKRKSKGQIDVQLNHIIKSIKYF"
FT   gene            644028..645155
FT                   /locus_tag="BSn5_03535"
FT   CDS_pept        644028..645155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03535"
FT                   /product="response regulator aspartate phosphatase"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03535"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93337"
FT                   /protein_id="ADV93337.1"
FT                   /translation="MISITSAEVGMKINEWHRHIQKFNVTDAEMLKAEIERDIEVMEED
FT                   QDLLIYYQLMAFRHKIMLEYTMPSDENRMELSEYLKKIEGHKKKLDNMRAYYYNFFRGM
FT                   YEFRNGEYTKAITYYKKAERKIPTISDKIEKAEFYFKLSEVYYHMKMTHISMHYAELSY
FT                   NIYKKHELYSVRRIQCHFVIAGNYDDLENHEKALPHLQEALKGAELLKSKNTHIYATAF
FT                   FNLGNCYHKMDNLNKAARYIEQALVQYRKINSDVLPQAYHDLALIYFKQGKKEQAMDCF
FT                   RKGIRSAVDFKDELFMNLFEALDVLYIRNGDTPKLLNIFSRLENGKGYPYLEELALLGG
FT                   NLFDYNGKIEDSIICFKKMVYAQKQISKGECMYEI"
FT   gene            645145..645279
FT                   /locus_tag="BSn5_03540"
FT   CDS_pept        645145..645279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03540"
FT                   /product="regulator of the activity of phosphatase RapE"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03540"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93338"
FT                   /protein_id="ADV93338.1"
FT                   /translation="MKSKLFISLSAVLIGLAFFGSMSNGEMKEASRNVTLAPTHEFLV"
FT   gene            645389..645802
FT                   /locus_tag="BSn5_03545"
FT   CDS_pept        645389..645802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03545"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93339"
FT                   /protein_id="ADV93339.1"
FT                   /translation="MDLFDECLEALGKNKEILSEELTANYYELLSNSFPFTSWGQIKWK
FT                   EVCCHQSIVYEDEIYDWLAKHHFKDRNIIILWGYGEQPALKTSLEHALNVIDDVTAVGS
FT                   DTFMFSEFGYVIEFFHDGDVTIGKSPFIERINK"
FT   gene            645918..647513
FT                   /locus_tag="BSn5_03550"
FT   CDS_pept        645918..647513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03550"
FT                   /product="putative phage DNA manipulating enzyme; skin
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93340"
FT                   /protein_id="ADV93340.1"
FT                   /translation="MKVFEAKTLLTEAEKRAKEYKDLKSKMVKLKKAFKAVADLDDSEF
FT                   SGKGANNIKSFYEDQAGIADQWIDLIEMKISFLTSIPGFLEDANLSDAYIEETFLAHEL
FT                   ANASTKSKSIMSEQKKAMQDILNDINDILPLDLFSTETFKNELSSAEKKRKEAIEKMDE
FT                   VDENLTSEYGLSEANEQMIQADYQALMNATAKGKSASPIHYNAMAYRDSEIHKMTEDVK
FT                   KQSTDYISFKDQQAEQRRIAKEQEELANRPWYEKSWDAVCNFTGEVSGYYDYKRAADGV
FT                   DPVTGEKLTAGQRVAAGAMAAAGYIPIVGWAGKLAKGGKAVYSTSKALYRADKALDVYK
FT                   TPKTFHALQNSSKGLYGLASANGFSEAITGRDMFGNKVSKERQEQSLSGAMAMLVPFGA
FT                   RGINKKLNAKSSSRVSETSTNTSKKPKVPKTYKRPTYFRKGVRDKVWENAKDSTGSVKD
FT                   PLTKQVMKKDEPWDMGHKPGYEFRKHQQSAMERNISRKQFLDEHNNPDHYQPELPSSNR
FT                   SHKGEDMTDDYFGD"
FT   gene            647528..648106
FT                   /locus_tag="BSn5_03555"
FT   CDS_pept        647528..648106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03555"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93341"
FT                   /protein_id="ADV93341.1"
FT                   /translation="MGVTQENKVIARTVLGAFGGKPKVTKYWDDNKSSSIDILSVSDQP
FT                   QEGITSYSTLGLSDHSINYEVNGTPLRIEIVAAMESASDIYANVLSTCAFNIINSNFTC
FT                   APGVIFKNVISMYDQETDMKHIMFVPPFLWEEDLELLEFSNKNVTWLMALPISEGELQV
FT                   AEKHGSDYLQDLLESKQIDIFDIKRESVV"
FT   gene            648224..648370
FT                   /locus_tag="BSn5_03560"
FT   CDS_pept        648224..648370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93342"
FT                   /protein_id="ADV93342.1"
FT                   /translation="MINEEKHTNPQANNNIFGRIDTWYSVHRSSNLRENKERPAYYVAG
FT                   PYL"
FT   gene            complement(648367..648729)
FT                   /locus_tag="BSn5_03565"
FT   CDS_pept        complement(648367..648729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03565"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93343"
FT                   /protein_id="ADV93343.1"
FT                   /translation="MVTVEERLDNLEKKVEKQAFQLRLVQQLAADYDRFGLFDQVLAYD
FT                   LSEKQYQELRELTSQYTDKIKNGEEVSLHNFTEEFKRILKDIEKEVDFEKFISLWLKGP
FT                   EEGFGFSKALHNHFFN"
FT   gene            complement(648745..649224)
FT                   /locus_tag="BSn5_03570"
FT   CDS_pept        complement(648745..649224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03570"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93344"
FT                   /protein_id="ADV93344.1"
FT                   /translation="MFKKLLLATSALTFSLSLVLPLDGHAKAQEVTLQAQQEVTYQTPV
FT                   KLSELPTNTTEQSGEFHTNGIKKWIAKEAMKATASALRHGGRIVGEVVDELGGSAGKTF
FT                   AKHTDDVADALDELVKRGDVVEDAIIDTVSSYLIDAGVKSSTARTIASVFTFLAF"
FT   gene            complement(649389..650207)
FT                   /locus_tag="BSn5_03575"
FT   CDS_pept        complement(649389..650207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03575"
FT                   /product="N-acetylmuramoyl-L-alanine amidase; skin element"
FT                   /note="COG5632 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03575"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93345"
FT                   /protein_id="ADV93345.1"
FT                   /translation="MAIKVVKNLVSKSKYGLKCPNPMKAEYITIHNTANDASAANEISY
FT                   MKNNSSSTSFHFAVDDKQVIQGIPTNRNAWHTGDGTNGTGNRKSIGVEICYSKSGGVRY
FT                   KAAEKLAIKFVAQLLKERGWGIDRVRKHQDWNGKYCPHRILSEGRWIQVKTAIEAELKK
FT                   LGGKTNSSKASVAKKKTTNTSSKKTSYALPSGIFKVKSPMMRGEKVTQIQKALAALYFY
FT                   PDKGAKNNGIDGVYGPKTADAIRRFQSMYGLTQDGIYGPKTKAKLEALLK"
FT   gene            complement(650252..650674)
FT                   /locus_tag="BSn5_03580"
FT   CDS_pept        complement(650252..650674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03580"
FT                   /product="putative holin; skin element"
FT                   /note="COG4824 Phage-related holin (Lysis protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03580"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93346"
FT                   /protein_id="ADV93346.1"
FT                   /translation="MEETSLFINFETLDLARVYLFGGVKYLDLLLVLSIIDVLTGVIKA
FT                   WKFKKLRSRSAWFGYVRKLLNFFAVILANVIDTVLNLNGVLTFGTVLFYIANEGLSITE
FT                   NLAQIGVKIPSSITDRLQTIENEKEQSKNNADKAAG"
FT   gene            complement(650719..651612)
FT                   /locus_tag="BSn5_03585"
FT   CDS_pept        complement(650719..651612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03585"
FT                   /product="putative phage-related lytic exoenzyme; skin
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03585"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93347"
FT                   /protein_id="ADV93347.1"
FT                   /translation="MASYSFQFSTDATGKPGAAKPYREGNRDFVVPVASISGNSELLTN
FT                   AVLKATEVYTQYGQDRLGQVLISKVKGHAYSDREGTLFIEESNDMNSWTTISSLVVKAN
FT                   TLGETEWIHLTKRYFRFRYANGNLQQSEFLLYQSLGAGEEDININHTVPITAVAPFSVQ
FT                   LDKSGLTNDGRLKVQTEGLNLSSLDTQSKTMDIVFHDKTETIGEGNPFTVGSFKTLLIE
FT                   VYGTAETSELKFWGKSLSGTKRALRGQKVDDGTFATSTKGKSEAWSFSITGFKEIVMEL
FT                   TALTNGNFSVRGTAVS"
FT   gene            complement(651700..651864)
FT                   /locus_tag="BSn5_03590"
FT   CDS_pept        complement(651700..651864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93348"
FT                   /protein_id="ADV93348.1"
FT                   /translation="MNYWVLALHYNWASSEMVKQAIHLKDCSPEDLQEGIEKKLITAEQ
FT                   YKEITGEAI"
FT   gene            complement(651861..652196)
FT                   /locus_tag="BSn5_03595"
FT   CDS_pept        complement(651861..652196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03595"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93349"
FT                   /protein_id="ADV93349.1"
FT                   /translation="MNIGEAILFKYPTADPTKDFIVQNNGDGTPSYIAEWNIRAPIPTE
FT                   AELKTWWEELQSTSAYEPPVQVDLLARELSQEKLARKQLEELNQTLGSELSKIKLQLLT
FT                   LQGGQGS"
FT   gene            complement(652206..653306)
FT                   /locus_tag="BSn5_03600"
FT   CDS_pept        complement(652206..653306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03600"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93350"
FT                   /protein_id="ADV93350.1"
FT                   /translation="MAYDAKTDWLPDDPINEDDVNRWEKGIQDAHKDLAVHKNDMNNPH
FT                   NTTKAQIGLGNVDNVQQASKKEFEEHRNDLQRHITPVERENWNAKETIVGAQEKADKAL
FT                   SDAKYYVDTNYKNNNLTLITGDNAIQDARTGGEEYPLGLTLMDIGQGNTTGYPLGYGIV
FT                   KNEKYNNYRFTQYFYGTGNESGTYYDSTGVWIRHWWSGSGWTPWQKISGFAHANIGTTG
FT                   VQYLKKIDHTKIAFNRVIKDSHNAFDTKNNRFIAPNDGMYLIGASIYTLNYTSYINFHL
FT                   KVYLNGKAYKTLHHVRGDFQEKDNGMNLGLNGNATVPMNKGDYVEIWCYCNYGGDETLK
FT                   RAVDDKNGVFNFFDIQELGGRNYPRF"
FT   gene            complement(653309..653581)
FT                   /locus_tag="BSn5_03605"
FT   CDS_pept        complement(653309..653581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03605"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93351"
FT                   /protein_id="ADV93351.1"
FT                   /translation="MITQLYRERTAADLKNRISKVLLNGNETEIVELTIQGAVVTVLTQ
FT                   REEDIKHIKSVQILDDQNNVITERTTDLDVSNNRTLDFRITFEVV"
FT   gene            complement(653578..654156)
FT                   /locus_tag="BSn5_03610"
FT   CDS_pept        complement(653578..654156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03610"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93352"
FT                   /protein_id="ADV93352.1"
FT                   /translation="MSKLDEMTAYLPPFLTKLKEMAELLKAEAPEFEKQNNSIFDLTDQ
FT                   LFVTTATWGLERWEKILNVPRESGDTDEIRRLRLISKMSNIPPATYRAIEHALNRFLKN
FT                   PSAQVRLLPGEYRFKVDIDIDDMQHMSELIETLENMKPAHLAYTLRAALNEPLQIKDTV
FT                   ILNNRRYRKASELKVGYSVTLNNNEVVLV"
FT   gene            complement(654140..655186)
FT                   /locus_tag="BSn5_03615"
FT   CDS_pept        complement(654140..655186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03615"
FT                   /product="putative phage capsid assembly protein; skin
FT                   element"
FT                   /note="COG3299 Uncharacterized homolog of phage Mu protein
FT                   gp47"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03615"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93353"
FT                   /protein_id="ADV93353.1"
FT                   /translation="MFEDQTYESIMDRMLNSISADIDKREGSVIYNALAPVAAELAKSY
FT                   IWLDTVLELVFSDTAQGEFLDRRATEAGIERTAATKAVRAGEFTEGVTIPVGSRFYVDN
FT                   LYFQYTADGTLECETAGEAGNANISGQNLLSLDTIPGLQKAIVKEILIPGREEEDDDSL
FT                   RARYFTRVRREAVSANKAHYKQWAEEVDGVGKVKVFPLWNGDGTVKIVVTNANLEPASD
FT                   ILISKVKNYIDPEPGQGEGQAPIGAFVTVESAVWKEVEISAEVLPEVNSSIDQVKQEIE
FT                   SGVLNLFKKIAFEDNVIRLSQINNIVYNSPSVSDYADIKINGVAENLVLSAVEIPKLGQ
FT                   VNIIEQTR"
FT   gene            complement(655179..655604)
FT                   /locus_tag="BSn5_03620"
FT   CDS_pept        complement(655179..655604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03620"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93354"
FT                   /protein_id="ADV93354.1"
FT                   /translation="MALSPEIEFEDIEDDSEVIETSQTYKIDFENGRITNEIITGLEAI
FT                   KQFVYLSLHTERYAYSVYSHDIGNELQDVLADNETTDAYKKMEIPRLIEEALIYDDRIS
FT                   AVTDFEIEKQGESFRVSFTVETDEGTLEIEEVLGEDV"
FT   gene            complement(655617..655880)
FT                   /locus_tag="BSn5_03625"
FT   CDS_pept        complement(655617..655880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03625"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93355"
FT                   /protein_id="ADV93355.1"
FT                   /translation="MRLSEAIKHLAVRAVDSESPVDILPAEVVSVSPVEIRLNENDKLI
FT                   IPADLIIVPKRLRAGEEALNTGERVMIVSLKGGQSFFILDKI"
FT   gene            complement(655877..656857)
FT                   /locus_tag="BSn5_03630"
FT   CDS_pept        complement(655877..656857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03630"
FT                   /product="hypothetical protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03630"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93356"
FT                   /protein_id="ADV93356.1"
FT                   /translation="MIELFVIKETEWLELVTESVSLEGQRYQAPRSITAKIITKQGTHS
FT                   YYSVSEGDTVLFKWKGKELFRGIVFSRNPEEHWMTFTAYDMLQYLVKNKDVYVFSNQRA
FT                   DEIIKRLARDFQIPTTSIANTGYTIKSLVFKDDTSLYDMILKALKQTKSQTGRNYQLYS
FT                   AKGKLGLRAWPDLSEVWVLETGVNITGYQYSTSINDTATKVKLRRQKDNKTYTATASDS
FT                   SGISKYGVLQYVETVSDNINQAQLQERAKVKQAQKKGVKKELKSIQAIGIPDLQSGLPI
FT                   YISIPEVGVKKTYWIDTDKHEFKGSTHTMTIDVVEKNSIPDGVSS"
FT   gene            complement(656870..657529)
FT                   /locus_tag="BSn5_03635"
FT   CDS_pept        complement(656870..657529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03635"
FT                   /product="hypothetical protein"
FT                   /note="COG1652 Uncharacterized protein containing LysM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03635"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93357"
FT                   /protein_id="ADV93357.1"
FT                   /translation="MTKSIYEFWISQGKDKLRLPVLPEQIDISNTIQNESVKVASFGEI
FT                   TFIDKPGAKEISFSSFFPKKHSPLAEYKGFPSPENAIAKIEKWVKSKKPVQFLITGTKI
FT                   NLTCSIEVFSYTEGQKDIGDRDYEIKLKEYKTASPRKIKQKKKTKKKRPSKSAPKTYTV
FT                   KKGDTLWDLAGKFYGDSTKWRKIWKVNKKAMIKRSKRNIRQPGHWIFPGQKLKIPQ"
FT   gene            complement(657522..662279)
FT                   /locus_tag="BSn5_03640"
FT   CDS_pept        complement(657522..662279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03640"
FT                   /product="putative lytic transglycosylase"
FT                   /note="COG5280 Phage-related minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03640"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93358"
FT                   /protein_id="ADV93358.1"
FT                   /translation="MAKLTATFELHDKISRKLRMIQGNAERLKRAANGPLIFEAEDRTE
FT                   RVMRQIDRSANRLTARARLLEMGLDDRVSNGLHSIRQQAEDLTEGSHEVTVSVNDQATP
FT                   RFRLIRGGLTDLNSSHAEPTVSVRDHASNQLDEIRRHVTDVDSEHAEPTVSIKDRASAA
FT                   LDAIEAKIDSLKGATITLAVAGGFSAGSIMGSGKSTMSQDAYVSATSNVNKKDVAKMTD
FT                   QIYFNNKAGSSREEVSLSLRNLSQQTGASKKALAELTESSSKIAQLMNADQAEVDRAFS
FT                   SMYNNLKLSGKQSGDLIAYVYRNAGDQADDLLDTMNEYSSTFKDLKLTGGQIANAMIKG
FT                   TKGGARNFDNLADSMREFNIRRTEMSDSQVDAFKTLFGAKETKKMFKGFKDGSISGEES
FT                   LFRVAKALSKVKDKTKRAAIATELIGTQYEDLKQPILDMAEGIGTSAKTSGELERSFTK
FT                   LRDNNPMTPVNDAMRDFESISKDMGTSLLTGLGPAFDKISSFINSKEGQEKLKEIKKDI
FT                   ADLGEEIGDKLNVAIEWSVNHWDDLKTAIKVVIPSLIGLIGYLKILRPLLKGIGTVGSD
FT                   AAGVIRKLIPKRTPKAGTNTQSERRNRNSNRNASTRGRESKTATGPTSLPRSGSLTYCC
FT                   CSDGGKNDRIRRRRGKRVLGRRGNPNRMNPSDSSIAVSSERLERRRSGRTVGTNPTRDS
FT                   RSAIITTRSELYSAGRAAGGTSKFGKVLSPLKSVGKFAKGVPLLGTALAATDLIGMNKD
FT                   NVGEKIGSAGGGLAGAATGAAIGSVIPGVGTAIGGLVGGIAGTMGGSSLGKAFDGSEVK
FT                   KKLNSTLFDQKWWSEKWSGIKSNAKTSINGLSDTWSNVKEKVKSTLFNSEWWSEKWSGV
FT                   KSWAQNKWNSASSVWESVKGKIKSTLFSEKWWSGKWEGVKSWAQSKWDSASSVWQSVKG
FT                   KLKSTLFSEKWWSGKWESVKSWSKNKWDNAKSIWKSVKSSISETLFSKKWWSEKWQSVK
FT                   ELGSSILGGVKEVGGKVASSAKKTAGKAWGYVKSGVNYLFGSGKEKPKKHATGGYITKP
FT                   TISWIGEAGKEFVIPVENNKGRGKMLLSQAASKLGMSVVDDIASASSAGGEPATSPLVR
FT                   SAAVTASVSPIIDTSSLDEQATSFGQQFTKSFDQGIRDNVVSMEAWKQKNVGQPMNNLI
FT                   SYSPNYGKQVVNGYAKGQNSTSTGTDGFLQTKVKMPFQNTVNKSSSWGSGTIKGFASGQ
FT                   NSSQTGTDQYVSTHINKPFIRSKESSNGWGSGMIGNFVSGMTSKASEVNEAAKELAKKV
FT                   EKAFREELDIHSPSRVMMSLGRFASIGIVKGLDSVDVKKFAEKQAGSLAAAYSGMGAVS
FT                   GNVKQWLMAAIMATKTPMSWLPGLMTIAQHESGGNPKAINLWDSNAKAGHPSQGLMQTI
FT                   PSTFNAHKLPGMNNILNPIHNAAAAIGYIKSRYGSINNVPGIRSMRHGGPYVGYANGGL
FT                   ITKEQIARVGEGNKREWIIPEERGIRGRYLLAQAAKALGMEVTDPSEKGQTELSSGQVT
FT                   AATTGRNQTTFKAAGGKEVIIQFNGDQHFHNDQDMNSLVAKIKQALVDELEQDINIGTK
FT                   GVVAFD"
FT   gene            complement(662282..662419)
FT                   /locus_tag="BSn5_03645"
FT   CDS_pept        complement(662282..662419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03645"
FT                   /product="Phage-like element PBSX protein xkdN"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03645"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93359"
FT                   /protein_id="ADV93359.1"
FT                   /translation="MHELKYAPSELRELYEAPKAFKALLYGLIGFKLELLEKEAKKGGN
FT                   "
FT   gene            complement(662461..662910)
FT                   /locus_tag="BSn5_03650"
FT   CDS_pept        complement(662461..662910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03650"
FT                   /product="XkdN1"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93360"
FT                   /protein_id="ADV93360.1"
FT                   /translation="MSEKQNEKVYDLSFFMPGQTIEAEEVEVPISKRFVDKEGNVVPFI
FT                   FKAITTERIDELEKENTTYKNVKGRGRVKELDSQRFYARIAVETTVYPNFKAKELREAY
FT                   KTEDPVEVAKRVLSVGGEYANWLNKAIEINGFDDDLEDLEEAAKN"
FT   gene            663127..663336
FT                   /locus_tag="BSn5_03655"
FT   CDS_pept        663127..663336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03655"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93361"
FT                   /protein_id="ADV93361.1"
FT                   /translation="MTTVQFLQVLAPIALKVVADRYFRKKDTNESKDIAVSKVCLCQQT
FT                   RRVISPNKRYKRNIRPNRRFKRKR"
FT   gene            complement(664179..664622)
FT                   /locus_tag="BSn5_03660"
FT   CDS_pept        complement(664179..664622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03660"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93362"
FT                   /protein_id="ADV93362.1"
FT                   /translation="MALKAQNTISGKEGRLFLDGEEMAHIKTFEANVEKNKSEVNIMGR
FT                   RMTGHKTTGANGTGTATFYKVTSQFVLIMMDYVKKGSDPYFTLQAVLDDASSGRGTERV
FT                   TLYDVNFDSAKIAGLDVDSEALEEEVPFTFEDFDVPEKLKETF"
FT   gene            complement(664625..666025)
FT                   /locus_tag="BSn5_03665"
FT   CDS_pept        complement(664625..666025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03665"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93363"
FT                   /protein_id="ADV93363.1"
FT                   /translation="MNGGTFTPGKEKERAGIYFNFKTTAENRVSAGERGTVALPIASSW
FT                   GEVKKFISISSIEDLNKKVGLNIDDPSLLLLREAMKKASTVLLYRLTEGLRASADISEG
FT                   VKATALYGGTKGNDIIISITENVIDSSKVDVTTYLDQSEVDKQTVSKAEELKQNNYVTF
FT                   TGKGDLTVTIPLTGTAPEDVSGALPATSGIRLSGGTDKTPTNADYTAFLEAAETEYFDT
FT                   IALPVEDNEQLKATFVAFIKRLRDNQGQKVQGVLSNYKGDHEGIINVTGGVLLQDGTEI
FT                   TPEKATAWVAGASAGATFNQSLTFVEYEGAVDVLNRIDNDEIVERLSNGEFLFTYDSRD
FT                   KSVSVEKDINSLTSLTAEKNKMFQKNKIVRVLDAINNDLTSQLKALIKSRKASGSDVPA
FT                   TNDGLQFVKTLITQYLSVLQDNGGITDFDSENDITIALNNDRDGFLIDLAVQPVDAAEK
FT                   FYFNVEVK"
FT   gene            complement(666026..666214)
FT                   /locus_tag="BSn5_03670"
FT   CDS_pept        complement(666026..666214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93364"
FT                   /protein_id="ADV93364.1"
FT                   /translation="MATKKEKAENAFYIKDLREHSRELFGVRPEVFDGALFHVHKTSIT
FT                   KSEAKKLITQFLQKEVK"
FT   gene            complement(666214..666651)
FT                   /locus_tag="BSn5_03675"
FT   CDS_pept        complement(666214..666651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03675"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93365"
FT                   /protein_id="ADV93365.1"
FT                   /translation="MNQEVGSIMGYLYKLYPVQVYEEGIPQDFAVPSLYFPPASTVDGA
FT                   DTVSTFQKAYVLNVKLFHENAQKAHNEAERIADTLRSRRGIIPLIQESGEDTGDFIRLS
FT                   RIETRVSDDYATIVLNWTSRYWYEQEEQRSIDGFKFKSGVK"
FT   gene            complement(666664..667167)
FT                   /locus_tag="BSn5_03680"
FT   CDS_pept        complement(666664..667167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03680"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93366"
FT                   /protein_id="ADV93366.1"
FT                   /translation="MKIKGLDQFIQSLNRASRGELKGKYEEWLEAMGFEFLDIIQDEII
FT                   RTKTVDTRRLLNSFQKGDQGNIFSMTKGSLKLDVGTNLEYASYVNDGHFTIDPSKNQDR
FT                   RWVPGRWKGDRFEYDPAERNSGMMLRFQWIDGSGFWDNAMAIFQLMFERSLERKLQQWI
FT                   DEEF"
FT   gene            complement(667164..667526)
FT                   /locus_tag="BSn5_03685"
FT   CDS_pept        complement(667164..667526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03685"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93367"
FT                   /protein_id="ADV93367.1"
FT                   /translation="MSYQSLLTHRCDIYHLQEKKENRQQKFGVPVEDVQPAFSYPDEPD
FT                   IENQPCYFTEKSQSIIQQEPNVAIYQSFLVHFPATADIRVNDRAVWDGTAYKLQKPRKV
FT                   RNHHWEVTAVREVEYL"
FT   gene            complement(667523..667918)
FT                   /locus_tag="BSn5_03690"
FT   CDS_pept        complement(667523..667918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03690"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93368"
FT                   /protein_id="ADV93368.1"
FT                   /translation="MLLITPDELKSYSVFESVKTRPDELLKQDILEATADIILKVGHDF
FT                   TDAEYIPLPETVRLALLKLSQFYALINGDESIIKGYTTEKIGDYSYTLGDGSSLQKPDV
FT                   YALIKDYVKPADPDLEGIEAKVRMRSI"
FT   gene            complement(667923..668234)
FT                   /locus_tag="BSn5_03695"
FT   CDS_pept        complement(667923..668234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03695"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93369"
FT                   /protein_id="ADV93369.1"
FT                   /translation="MYTAKLIKGKTYNVMGVTFRSGVSQTVSKKLYEYLNENPYFVLDK
FT                   DLKNQKDDPINYTESELKGMNKAEHESIISNLGGNPSDFKNADERIAYILNEIDNKGE"
FT   gene            complement(668245..669180)
FT                   /locus_tag="BSn5_03700"
FT   CDS_pept        complement(668245..669180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03700"
FT                   /product="putative phage capsid protein; skin element"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03700"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93370"
FT                   /protein_id="ADV93370.1"
FT                   /translation="MRNQEVINKAEMTLSTLESGGIMNPTQASTFIRMVQDTPTILRDA
FT                   RVIQMDHDTQKIEKIGFGQRILRAAQEGVALIKDQKSVPSTSTVNLSTKEVIAEVNITY
FT                   DTLENNIEKDGLQNTIMQMIAERAAVDIEELLVNGDTSSSDSYLAQLDGIRKQATSHIV
FT                   DAAGEELTRQTFKRGYKAVPPKYLRIPQEFRFYTSPGIEVEWKDRVADRQTNLGDAAVQ
FT                   GGLSSAFGVPVKGIANLQPYTIGEGDTATDVSDIILTHPKNIILGFSRNIRIEVDKDIR
FT                   RRMFIIVLTAKLDSVFEEEDAVAKIVKVKE"
FT   gene            complement(669199..670173)
FT                   /locus_tag="BSn5_03705"
FT   CDS_pept        complement(669199..670173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03705"
FT                   /product="putative DNA wielding protein; skin element"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03705"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93371"
FT                   /protein_id="ADV93371.1"
FT                   /translation="MPRELVNAKITHVSYVDKAANQKQFFFMKSEKQPDFQKEVEVLTK
FT                   EADEQKLVYGIVYEPDTVDAHGDFMTAAEIEKAAHGFLKDAREIDKQHDFQGGVGEVVE
FT                   SYVAPADFEMNGETIKKGSWVLVTKASEEVWEQIKKGEITGYSMAGTAETIEKQEEKPV
FT                   SQDKTDEKGLFNLLKNFFVGKQQQSYEEPVTKAGRKFSASNLQEIKNAHTALGNLLSQV
FT                   ETEEGEEEMTSEEVTKSIQEALEPIKKRLETLEKEEELKKKDKEKIEEDAEKEGEKLKK
FT                   AISEAVQPLADRIEAIEKSRGTSKQTEESGSEQVQKSIWSGLF"
FT   gene            complement(670179..670745)
FT                   /locus_tag="BSn5_03710"
FT   CDS_pept        complement(670179..670745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03710"
FT                   /product="hypothetical protein"
FT                   /note="COG0677 UDP-N-acetyl-D-mannosaminuronate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03710"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93372"
FT                   /protein_id="ADV93372.1"
FT                   /translation="MSWLEFFSTIFNSWPIAIVIIVILLRKTLMSKLGKLLSLTYKDIN
FT                   INFQEELEKVSKSLGESESDSDSEDENVLEKAREEVEFITDIAELSPSAGIIASWVSFE
FT                   TTIDGLIESKGVIPEGLSWSEKKRALEKLYKIDLNIYNSINHLRKFMLDVNHYSKKADD
FT                   SLSLIEAIDYYELILKTSKKIIERR"
FT   gene            complement(670788..671705)
FT                   /locus_tag="BSn5_03715"
FT   CDS_pept        complement(670788..671705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03715"
FT                   /product="putative phage head morphogenesis protein; skin
FT                   element"
FT                   /note="COG2369 Uncharacterized protein, homolog of phage Mu
FT                   protein gp30"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03715"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93373"
FT                   /protein_id="ADV93373.1"
FT                   /translation="MNKADKLLDSLNAFIQKAKENQYKQLGEMVPDFPGKSNIPKYVEE
FT                   YEKGIARLLRRQRKKFLDGVNGFIGKDSKETLEALLVFFTQNLFAEDDFEEEFQELTEG
FT                   FLQQTIEELAEVIMDSIDPEVPFKVLSTRTVNWIKDWSKKLAGIMKLNTHEAVENVLTD
FT                   AIEKGLSIQDIELTLKDMLQFDRDRARTTAITEVLAASSAAQHESYAQSPAVKKKKWRH
FT                   SGGKKNNLRENHIDLDGTVIGVDEEFHIPGSGETCMFPRDPKLSAGERVNCHCVLSPVV
FT                   DNEILGLSADEKEEIRREALANME"
FT   gene            complement(671702..673234)
FT                   /locus_tag="BSn5_03720"
FT   CDS_pept        complement(671702..673234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03720"
FT                   /product="putative phage capsid protein; skin element"
FT                   /note="COG5518 Bacteriophage capsid portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03720"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93374"
FT                   /protein_id="ADV93374.1"
FT                   /translation="MSKQSVKARVIKASPPTESTKQIYEDEFADSYDSNILPPPYNLKE
FT                   LKMIAEYSTILQQCVDAYRTNIVGFGFDFEYSFDVNSPDVTNEEKTEAESEWTKLEEFV
FT                   KYLHFDESAETLLGFVIEDREKTGNGFIEVIRNGENKPAGIEYMDVQNVRVCKLSEPIE
FT                   VDFTYFEQGQMKSIKREKRFRKYVQMIDGRMVYFKEYGDPRTLNLESGQYDEQTPFEKQ
FT                   ANEVVHFKIGSGTYGKPRWIGHIVNLYGARKAEELNFMYFKQGRHIPAAITIENGMLSE
FT                   DSYTQLQDYMNGLEGVENAHKFLLLEAEGIAKGKNIHGDEEIAPVKVDIKSLAEILQED
FT                   ALFLEYDQKSRDKIRSAFRLPPLYTGEAQDYNRATADTARKITEEQVFQPERKLITGKL
FT                   NALFLNDLEIHKVRLMLKGPDFRDPLEIAKVLTPFITAGAVSPNDLRDLAGRVLGKTLE
FT                   EWPEEEYNRPLGKTNESSASDSLAALFKSKNGTPDMIGLLKDMRDVLEDLKR"
FT   gene            complement(673238..674533)
FT                   /locus_tag="BSn5_03725"
FT   CDS_pept        complement(673238..674533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03725"
FT                   /product="putative phage-related terminase large subunit;
FT                   skin element"
FT                   /note="COG1783 Phage terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03725"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93375"
FT                   /protein_id="ADV93375.1"
FT                   /translation="MIKQVNPHFKEFLFDWNQKFQFLVGGYGSSKSYHVALKIILKLLK
FT                   EKRTALVIREVYDTHRDSTFSLFDELVSDLKLDHIVRCVSSPMQIRFSNGSRIIFKGMD
FT                   KPAKLKSINNISLIWIEECSEVKYEGFKELLGRLRHPTLPLHMILSTNPVGEDNWTFKH
FT                   FFKDDREKRFVLDDKELYEKRIIVSNDTYYHHSTADDNLFLPESYVQQLEELKEYDPDL
FT                   YRIARKGHFGVNGIRVLPQFEEWPHEEVLKAIADINRPLKRVGMDFGFVESYNAVVRVA
FT                   VDPEKKYLYIYWEYYKNGLTDDKTAEELKEFVETKELIKSDSAEPKTIRFFQQHGFNMV
FT                   GARKYQGSRLQYTKKIKRFKKIICSDSCENTIYELKPLTYATDKLGNIIEDEFTIDPHT
FT                   LSAIWYALDDYEVTDLKEESKGRPQRSRPGRR"
FT   gene            complement(674526..675245)
FT                   /locus_tag="BSn5_03730"
FT   CDS_pept        complement(674526..675245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03730"
FT                   /product="putative phage-related terminase small subunit;
FT                   skin element"
FT                   /note="COG5484 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03730"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93376"
FT                   /protein_id="ADV93376.1"
FT                   /translation="MIEKHIQAYRDYLKGMKYKDLAEKYGVSVNTIKSWKQRHGWQRKK
FT                   GAPLKKGVHTKKVGAPLGNKNALGNNGGAPHRNQNAATHGFYSKFLPEETLSIMEGIQE
FT                   RSPVDMIWDQIQIQYAAIIRAQKIMFVSDKGEMIKELKKKKSVLSETNEVEEEEYEFQF
FT                   SWDRHATFLNAQSRAMAELRNLIKQFDELAHNEDERRLKLEQMRLNINKKKLEIEELTE
FT                   EDKPFEITIVNKGDDSD"
FT   gene            complement(675309..676109)
FT                   /locus_tag="BSn5_03735"
FT   CDS_pept        complement(675309..676109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03735"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93377"
FT                   /protein_id="ADV93377.1"
FT                   /translation="MSILKQLVFFLWGGIKKILKFLFVPYRNLSLRYAQYLLWEFSIGI
FT                   ILAIIFSQYRESILQYTMFIFVHLFFFSALYWWLTFMYFRRNKKGSKLERDIKYEGFLH
FT                   EYSDINEVIEAVHNLKIKIIDWARNDQNTENDENVKNDEKKVLKKVKLLRIYYKSSSAK
FT                   KVLEYLTNTSIGIILGLISGLILKPEVMDFIKNIFKDSFNHISDSIINYVNGGTLLITG
FT                   LMIVSKILVQNHRVTRMYQLYDEVLDSVVEDLEEELKTEDNLGA"
FT   gene            complement(676152..676385)
FT                   /locus_tag="BSn5_03740"
FT   CDS_pept        complement(676152..676385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03740"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93378"
FT                   /protein_id="ADV93378.1"
FT                   /translation="MTRTINVNQQHLLEQLAGGSVNRQCTLEALIDILIDKKVFTEEEF
FT                   VKYQMHHLEQSADEHSAELLGVSKEDYIKSRK"
FT   gene            complement(676527..676982)
FT                   /locus_tag="BSn5_03745"
FT   CDS_pept        complement(676527..676982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03745"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93379"
FT                   /protein_id="ADV93379.1"
FT                   /translation="MNRKDIENLINSYHWMVKEVYRLQRVLYGSTIPMRNWGVAQYGLE
FT                   AAMPKGSPGKSQAELRQMDMREERLFKRLKYYEERVYAVELGAEKIKGEQHKVIYDCMM
FT                   EGMSYRAIGLHLGISRETVRKMKDELISQLCQDCHSERLLNLKKSVV"
FT   gene            complement(677137..678279)
FT                   /locus_tag="BSn5_03750"
FT   CDS_pept        complement(677137..678279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03750"
FT                   /product="cytosine-specific methyltransferase"
FT                   /note="COG0270 Site-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03750"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93380"
FT                   /protein_id="ADV93380.1"
FT                   /translation="MKKNFKAISLFSGAGGMDIGFQKAGVDVVWANEIDKDACNTYELN
FT                   NPDTYLRRGDISEVYEELKNYNGIDLLFGGPPCQGFSVAGKMDPTDIRNTLVWNFLDVL
FT                   KIVKPKAFVIENVKALGTLKKWENVRERIFKLSNDMGYSCNAYILNSSHFGVPQKRERI
FT                   FFVGFLEKNVDSNLFISRLEKKRKKPKSVREAISHLGPAGTDKNPLTCTAKITLAANPV
FT                   LRKSPYAGMIFNGMGRPLNLEEASNTLPASMGGNKTPIIDEDLLYHGSEINWVVEYHKS
FT                   LMENKTKAKYEEAPKHLRRLTIKEAALLQTFPEDYVFSGSKTAIYRQIGNAVPCLLAEV
FT                   VARTVIEGLEDDQPFNPEQLTFESVQEKALYSESHLKIFN"
FT   gene            678366..679481
FT                   /locus_tag="BSn5_03755"
FT   CDS_pept        678366..679481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03755"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93381"
FT                   /protein_id="ADV93381.1"
FT                   /translation="MKITDNDIKSARKIIEDAFEIANSENFSPKSKFSHEVFRILSSGH
FT                   LTFKYIMINALLSKATFSDINPLCLQKKSELEGAYDARSICHKVLVPFEKEKLKGILGG
FT                   SNEPFLNKPARFPELSPDNAVRRGKDKQLLNLLCDFLPKITTDKIAFYALVDAIYYALK
FT                   QIKDKEETMASLKIKTPSLFQIENFVEELLKNSYQGECLALAVGTLTNILVDSLEGTNH
FT                   AIVNVVNQSGASSKEIGDIEVYHNKSILYAIEAKDKNYAPQDVQHAVNKAANSGCKRLM
FT                   FVTGPRANLVHTSKTHTELINNAKEKGVYLTFLNYCDFTKIILALIPEKTLEDFFHVLI
FT                   RVSKESRLKTETLEYFFKVAYDNNIIEKHLV"
FT   gene            complement(679648..679854)
FT                   /locus_tag="BSn5_03760"
FT   CDS_pept        complement(679648..679854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03760"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93382"
FT                   /protein_id="ADV93382.1"
FT                   /translation="MYNPREINIKKDFTIQQKIDPGKVQIIVLDGNQGTAHVLDAPEHG
FT                   KTVIQTVKGSFTRVDHEIGFKVM"
FT   gene            complement(679936..680364)
FT                   /locus_tag="BSn5_03765"
FT   CDS_pept        complement(679936..680364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03765"
FT                   /product="putative Holliday junction resolvase; skin
FT                   element"
FT                   /note="COG4570 Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03765"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93383"
FT                   /protein_id="ADV93383.1"
FT                   /translation="MDCIKFTVYGEPVAQGRPRGSIRNGKVHMRDPAKSKYFKQYVALV
FT                   ASQHRPEKVITGPVSMDVKVYRPMPKSVSNSSKRKEKAEKGLLRPTTKPDVDNYVKGVK
FT                   DALNHLIYKDDSQVVDLKVSKFYSEEPRVEIKIEEVSA"
FT   gene            complement(680372..680467)
FT                   /locus_tag="BSn5_03770"
FT   CDS_pept        complement(680372..680467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03770"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93384"
FT                   /protein_id="ADV93384.1"
FT                   /translation="MLKAVVSLLTILLSASRIEKEIQLWEQLDGR"
FT   gene            complement(680460..680603)
FT                   /locus_tag="BSn5_03775"
FT   CDS_pept        complement(680460..680603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03775"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93385"
FT                   /protein_id="ADV93385.1"
FT                   /translation="MKEKMNVKATGGLYIFGPSNPTEGKDLTPTIRLLKEKIKQMERML
FT                   SA"
FT   gene            complement(680600..681460)
FT                   /locus_tag="BSn5_03780"
FT   CDS_pept        complement(680600..681460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03780"
FT                   /product="hypothetical protein"
FT                   /note="COG1484 DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03780"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93386"
FT                   /protein_id="ADV93386.1"
FT                   /translation="MGTKQAASVEKAEFNCPYCNDRGIVVYRVHKDTPWHLDEQLDLMV
FT                   PDEMVLEDDFLLGKVCTPDKASEWKDTYSKQCECVRRKKIARLMSASGITEEFEKLLFG
FT                   NFITDGKPDMIKDAYECAVEYYKDFQKIKGERQNSIALLGQPGSGKTHLLTAIMNNLIK
FT                   KKSVHCMYFPYVEGMGDLKADFDNLEAKLDAMRKVEVLFLDDLFKPINGQPRATDWQVE
FT                   QIQSVLNYRYLNHKPLLISSELTIDEILDIDEALGSRIHQMCRDYIVIIKGDRMQLNHR
FT                   LGDWE"
FT   gene            complement(681423..682124)
FT                   /locus_tag="BSn5_03785"
FT   CDS_pept        complement(681423..682124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03785"
FT                   /product="putative DNA-binding protein; skin element"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03785"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93387"
FT                   /protein_id="ADV93387.1"
FT                   /translation="MDIKAMGYVVIPRLPFKEFRDEKIYDHLFKRAEYRPNQELELGQT
FT                   IIKIVELAKDFNWSAAQIKYSLDRMEKQGYIKLHRLPQKRGFIVTILHYADYIQLGNYM
FT                   KKKALEPAEIEHQEVDDKMKNAFELYENKVARSVGPIEAQRIGYMVDDYGEEKVMEAIK
FT                   TAFQLKGKSASLSYVQAILSNPFTQKRKEKQYGYKQSSQYRHRISNDHAGTSGKVSPLF
FT                   GNKTGRIRRKG"
FT   gene            complement(682177..683031)
FT                   /locus_tag="BSn5_03790"
FT   CDS_pept        complement(682177..683031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03790"
FT                   /product="putative DNA recombination protein; skin element"
FT                   /note="COG3723 Recombinational DNA repair protein (RecE
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03790"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93388"
FT                   /protein_id="ADV93388.1"
FT                   /translation="MATNQSIKNNIQKKQKSAPVQQQGATMKGLLSSPSVIKRFEEVLG
FT                   KRATQFTASILSLYNSEQMLQKTDPMSVISSAMVAATLDLPIDKNLGYAWIVPYGGKAQ
FT                   FQLGYKGYIQLALRTGQYKSINCIPIHEGELQKWNPLTEEIEIDFEKRESDAVSGYAAY
FT                   FELINGFRKTVYWTKAQVEKHKKKFSKSDFGWKNDWDAMALKTVLKAVLSKWGILSVEM
FT                   QKAVIEEDKTRERIDITNEADSSEIIDSEPSNKDEPEKTSEQEADPFDGKPVDIKEDEL
FT                   PFD"
FT   gene            complement(683034..683990)
FT                   /locus_tag="BSn5_03795"
FT   CDS_pept        complement(683034..683990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03795"
FT                   /product="putative nuclease; skin element"
FT                   /note="COG5377 Phage-related protein, predicted
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03795"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93389"
FT                   /protein_id="ADV93389.1"
FT                   /translation="MTRRAEVLAKTSEMSRDEWLIERRKGIGGSDASIILGLNKWKTPF
FT                   ELWLDKTGQVPVSESQSEAAYFGSLLEDIVAKEFEIRSGKKVRRKKAILRHPEHDFILA
FT                   NVDRMIVGEKAILECKTTSAYNLKEWEDEEIPESYIVQVQHYLGVLGPEYQKAYFAVLI
FT                   GGNKFVWKEIERDDELIDMIFEAEIEFWNEKVLGGQAPALDGSSAAEEYLKKRYAETEN
FT                   NKAIDLTATNRERIQQYLHLKEQLSELQSQAKELENQIKHEMKDAEYGFIGNYQAYWKP
FT                   VVSNRVDTKKLKEQFPDIYEEVKKETHFRRFRIKEVS"
FT   gene            complement(684094..684288)
FT                   /locus_tag="BSn5_03800"
FT   CDS_pept        complement(684094..684288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03800"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93390"
FT                   /protein_id="ADV93390.1"
FT                   /translation="MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILR
FT                   ENLERYLREQLGFEFKNAQ"
FT   gene            complement(684418..684675)
FT                   /locus_tag="BSn5_03805"
FT   CDS_pept        complement(684418..684675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03805"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93391"
FT                   /protein_id="ADV93391.1"
FT                   /translation="MNTNHFLKSDVPIAKRKIESAEELSIMLSEALRDGDYEEAISLAG
FT                   SIKVLTEDISRLANKGRLYETALKMQQQGINLTVVSRCIG"
FT   gene            complement(684672..685241)
FT                   /locus_tag="BSn5_03810"
FT   CDS_pept        complement(684672..685241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03810"
FT                   /product="putative transcriptional regulator; skin element"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03810"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93392"
FT                   /protein_id="ADV93392.1"
FT                   /translation="MENNPYNMRNLPQIMRSARKAAGLSQYQIGKLIGGKDQRYVSDVE
FT                   NGLAKLTPELCIKWFEKCDAYEHIDLVHYLFKLHPTAAAPIDPALNECASNAVINMVHQ
FT                   LEEALQATKHLARWLTDNRPGKTEELPMADIKQIFDLIAANKTLIYSLVRTHGLKMQEL
FT                   ADRWTRKALVDQVAMAKQEGRQAVSV"
FT   gene            complement(685315..685455)
FT                   /locus_tag="BSn5_03815"
FT   CDS_pept        complement(685315..685455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03815"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93393"
FT                   /protein_id="ADV93393.1"
FT                   /translation="MKVILKKGPLFEQAEAKAYKYLSGILVQRMNEHQEKLAQKNKKES
FT                   A"
FT   gene            complement(685485..685712)
FT                   /locus_tag="BSn5_03820"
FT   CDS_pept        complement(685485..685712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03820"
FT                   /product="putative transcriptional regulator; skin element"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03820"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93394"
FT                   /protein_id="ADV93394.1"
FT                   /translation="MRKWLKKNRLEKGFTQEEVAKAAQIGRAYYTMIENGTRKPSVIVS
FT                   KKIGEKLGFDWTIFFEDVCNETKHNSKDSA"
FT   gene            685892..686242
FT                   /locus_tag="BSn5_03825"
FT   CDS_pept        685892..686242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03825"
FT                   /product="putative transcriptional regulator (Xre family);
FT                   skin element"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03825"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93395"
FT                   /protein_id="ADV93395.1"
FT                   /translation="MFSENLKKCRKQKKLTQQNMADKLGITRPAYTAYELGSREPDYKT
FT                   LINISNILDVSLDYLLKGESNEKVFQDEAKKVLNDPETFLAAKDGEVTDEILQAALEII
FT                   TEQLKERRKSDK"
FT   gene            complement(686509..686676)
FT                   /locus_tag="BSn5_03830"
FT   CDS_pept        complement(686509..686676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03830"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93396"
FT                   /protein_id="ADV93396.1"
FT                   /translation="MKNNDKKKEVQRKYREEIKKKKQKNEDNKNFIKETIIVVTIIVLF
FT                   IFFTYTLQGF"
FT   gene            complement(687032..687568)
FT                   /locus_tag="BSn5_03835"
FT   CDS_pept        complement(687032..687568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03835"
FT                   /product="hypothetical protein"
FT                   /note="COG0563 Adenylate kinase and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03835"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93397"
FT                   /protein_id="ADV93397.1"
FT                   /translation="MKKNIHILGASGVGTSTLGAALSKRLPHTHLDTDNYYWLDKFTKK
FT                   REIPERRKLLEKDLTINEKWILSGAVCGWGDNLKSYFDLVVFLWIPQDIRLERLRHREF
FT                   QRYGNEVLAGGSKYEQSKTFLEWASLYDNAGMEVRSRALHEHWMADLSCPVLKIEDDCS
FT                   VNERVDRVLDYLSSN"
FT   gene            687837..688355
FT                   /locus_tag="BSn5_03840"
FT   CDS_pept        687837..688355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03840"
FT                   /product="hypothetical protein"
FT                   /note="COG2856 Predicted Zn peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03840"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93398"
FT                   /protein_id="ADV93398.1"
FT                   /translation="MRYTNSHLEDWIENLYKKIDITEPEQINFERIAEALDIRLSFKPV
FT                   TSFALKHSGIYNICLDSRKSRTEQWYDFAHEFCHIYRHEGDKKTMPATWTDYLEWQSNY
FT                   FTYHFCIPTFMLRNINLSYIQSHAIENIAWLFKVSPSFAKKRLSIYYRKLTQPLFNQTV
FT                   TGNLCTPLL"
FT   gene            688373..688753
FT                   /locus_tag="BSn5_03845"
FT   CDS_pept        688373..688753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03845"
FT                   /product="sporulation sigma factor SigK"
FT                   /note="COG1191 DNA-directed RNA polymerase specialized
FT                   sigma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03845"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93399"
FT                   /protein_id="ADV93399.1"
FT                   /translation="MHLRALKKTKKDVSLHDPIGQDKEGNEISLIDVLKSENEDVIDTI
FT                   QLNMELEKVKQYIDILDDREKEVIVGRFGLDLKKEKTQREIAKELGISRSYVSRIEKRA
FT                   LMKMFHEFYRAEKEKRKKAKGK"
FT   gene            complement(689323..690003)
FT                   /locus_tag="BSn5_03850"
FT   CDS_pept        complement(689323..690003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03850"
FT                   /product="Transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03850"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93400"
FT                   /protein_id="ADV93400.1"
FT                   /translation="MKKQQPQISEEKILETSWELLGEGGIETFSMRRLANRLGIQAPSL
FT                   YWYFKSKQKLYQRLANQVSKMILEEFHSEGDWKEQLMGLAITVRNVLSRYPCSTQLMMM
FT                   TLPHEPDIIRFTNRMLLCVESTPLKQEQKMQVVTTLVNYVFYFVLDDYQHERNVTAILK
FT                   DQEEHPGEEMIRLLDSMSETDAGLFRRMFTNGLFELMGTDRAFEFGLKLILYGIERVIK
FT                   EQER"
FT   gene            690134..691477
FT                   /locus_tag="BSn5_03855"
FT   CDS_pept        690134..691477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03855"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /note="COG0534 Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03855"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93401"
FT                   /protein_id="ADV93401.1"
FT                   /translation="MDTENLYFFEKAPIAKAVAHFAIPMMLGTSMSVIYSILNAFFLGT
FT                   LHNTAILTALALTLPLFAIIMALGNLIGMGSGTFISRLLGEKKYDDVKHVSSFAFYSSL
FT                   VLGLIVMAVGLPLIDPIVHGLGATSDSFGFTKDYVMVMLIGSPFVVLFFTLENIVRSEG
FT                   SAITSMTGMILSVVVNIMLDALVIFVCHWGVIGVASATVISNLAASSFYAFHMGYKSQF
FT                   LTVSVKWFKVGLDILSNVLKIGIPVFIMSIFLGAMSLIFNHFLVEYGDKAVAAYGISSR
FT                   LFQFPEFILMGLCEGVVPLIAFSFTADKLRMKNTIGFTLKAIVTLAVMFGVIVYLISDH
FT                   LIGLFTNDPQLIKIGSYILHVTFLSIFITGMSSLFTGIFQATAQGTAAFVMSFIQGITL
FT                   IPVLFIANQVNGFHGVVWSLVIADTVAFLVGAIMLYALRNKLQPELNS"
FT   gene            complement(692001..693098)
FT                   /locus_tag="BSn5_03860"
FT   CDS_pept        complement(692001..693098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03860"
FT                   /product="exported mannan endo-1,4-beta-mannosidase"
FT                   /note="COG4124 Beta-mannanase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03860"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93402"
FT                   /protein_id="ADV93402.1"
FT                   /translation="MYKKIAVFILLSFIIVSSFSQSALAHTVYPVNPNAQATTKELMNW
FT                   LAHLPNRSENRILSGAFGGFTNASFSMKEANRIKNATGQLPAIYGCDYSSGWLEKPYIS
FT                   DITETIDYSCNSDLISYWKSGGIPQISLHLANPASSTIGKNASHISNSEYEKILDSSTT
FT                   EGKRLEAVLSKVADGLDQLKNEGVPVLFRPLHEMNGEWFWWGLTEYNKKDSQRFSLYKQ
FT                   LYQKIYHYMTDTRGLDNLIWVYSPDANRDFKTDFYPGSSYVDIVGLDAYFSDDFTIQGY
FT                   DELTALNKPFAFTEIGTQKQDGNLDYAVFLNTVKQKYPKTVYFLTWDEVHSPSVNKGGS
FT                   NFYNDSWTLNKGEVWAGSSLTPIVE"
FT   gene            complement(693463..693564)
FT                   /locus_tag="BSn5_03865"
FT   CDS_pept        complement(693463..693564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03865"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93403"
FT                   /protein_id="ADV93403.1"
FT                   /translation="MLLFLFIKDFVPKVTFAAMNRDQNDLFFDYFLK"
FT   gene            complement(693874..694650)
FT                   /locus_tag="BSn5_03870"
FT   CDS_pept        complement(693874..694650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03870"
FT                   /product="YrkJ"
FT                   /note="COG0730 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03870"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93404"
FT                   /protein_id="ADV93404.1"
FT                   /translation="MDIAFITTLFIIGFIGAFISGMIGIGGAVINYPMLLYIPSLVGVM
FT                   SLTAHEVSGIGAIQVFFATLGGVWAYRKSGLLNKALIIYMGSSILLGSVLGSYFSHYIS
FT                   EKGINFIYGILAIIAVILMFIPKRGQAHREGEEVIFNKWLASSLAFIIGGVSGILGAGG
FT                   AFILVPIMLSILNIPVRITVASSLAITFLSSIGATVGKVMTGQVLFVPALVLMIASFIA
FT                   SPIGASVGQKANTKFLQWILALLISATAIKIWLELL"
FT   gene            complement(694711..694938)
FT                   /locus_tag="BSn5_03875"
FT   CDS_pept        complement(694711..694938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03875"
FT                   /product="hypothetical protein"
FT                   /note="COG0425 Predicted redox protein, regulator of
FT                   disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03875"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93405"
FT                   /protein_id="ADV93405.1"
FT                   /translation="MKSDKVLDAKGLACPMPIVRTKKAMNELEPGQILEVHATDKGAKN
FT                   DLAAWSKSGGHDLLEQTDEGDVLKFWIQKG"
FT   gene            complement(694972..696099)
FT                   /locus_tag="BSn5_03880"
FT   CDS_pept        complement(694972..696099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03880"
FT                   /product="putative hydrolase"
FT                   /note="COG0607 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03880"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93406"
FT                   /protein_id="ADV93406.1"
FT                   /translation="MTVKAMTPKEVTKKIFNKEPLFILDVRNENDFSDWKIEGHDFDHL
FT                   NVPYFDLLDGVEDILEKIPSDKEVLVVCAKEGSSVMVSEMLSEAGHSVSYLKGGMKAWS
FT                   EHLEPVKVGDLKDGGEMYQFVRIGKGCLSYMVISNGEAAIIDATRMVDFFMDFAKEKGA
FT                   TITHVFDTHLHADHISGGRVIAEKTKATYWLPPKDAEEVVFDYQPLEEGNDMIIGNTTI
FT                   KIQPIYSPGHTIGSTSFIVDDLYLLSGDILFIDSIGRPDLAGMAEDWVGDLRKTLYSRY
FT                   KALSKDLIVLPAHFMIIDELNEDGSVGKKLSTLFSENHGLNIADETEFRHLVTDHLPPQ
FT                   PNAYQEIRETNMGKISPDEEKQREMEIGPNRCAIR"
FT   gene            complement(696136..696237)
FT                   /locus_tag="BSn5_03885"
FT   CDS_pept        complement(696136..696237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03885"
FT                   /product="peroxiredoxin family protein"
FT                   /note="COG2044 Predicted peroxiredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03885"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93407"
FT                   /protein_id="ADV93407.1"
FT                   /translation="MGLTKDDFMEGIEVGGAVTFLDFTKDADVSLTF"
FT   gene            complement(696441..696995)
FT                   /locus_tag="BSn5_03890"
FT   CDS_pept        complement(696441..696995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03890"
FT                   /product="putative rhodanese-related sulfur transferase"
FT                   /note="COG0425 Predicted redox protein, regulator of
FT                   disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03890"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93408"
FT                   /protein_id="ADV93408.1"
FT                   /translation="MKATIVLDAKGLACPMPIVKTKKRMKDLKAGEVLEIQATDKGSTA
FT                   DLEAWAKSTGHEYLGTEAEGEILRHFLRKGGEHSSENASSIPEISLEAFKQKVDSDESL
FT                   NILDVREIEEYEKAHIPGVVHIPLGEVEKRSNELNKNDEIYIICHSGRRSEMAAHTMKK
FT                   QGFKKVINVVPGMREWTGKTE"
FT   gene            complement(697184..697666)
FT                   /locus_tag="BSn5_03895"
FT   CDS_pept        complement(697184..697666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03895"
FT                   /product="hypothetical protein"
FT                   /note="COG2210 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03895"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93409"
FT                   /protein_id="ADV93409.1"
FT                   /translation="MTEQTKRTTIVLFSGDYDKAMAAYIIANGAAAYDHEVTIFHTFWG
FT                   LNALRKEELIPMKKGFLEKMFGKMMPRGADKMGLSKMNFAGMGPKMIKNVMKKHNVLTL
FT                   PQLIEMAQEQGVKLVACTMTMDLLGLQEKELLDDIDYAGVAAYLADAEEGSVNLFI"
FT   gene            complement(697813..698073)
FT                   /locus_tag="BSn5_03900"
FT   CDS_pept        complement(697813..698073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03900"
FT                   /product="YrkD"
FT                   /note="COG1937 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03900"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93410"
FT                   /protein_id="ADV93410.1"
FT                   /translation="MEYDQKIKNRLRRIEGQIKGVLTMMEQGKDCREVVTQLAASRNAI
FT                   DRAMGLIVSTNLEHCVRESLEKGEDTQNLVKEAVDLLVKSR"
FT   gene            complement(698095..698412)
FT                   /locus_tag="BSn5_03905"
FT   CDS_pept        complement(698095..698412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03905"
FT                   /product="hypothetical protein"
FT                   /note="COG0607 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03905"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93411"
FT                   /protein_id="ADV93411.1"
FT                   /translation="MIIIATYRRYYPITGISCIHKDKLKAMDITILDIRHYNDVPNFSD
FT                   NIILNIPYAYLKRFYLEIPRDKIHIIARDRVELNLGVRFLKRKGIHVNSYELAACKCKN
FT                   K"
FT   gene            complement(698796..699356)
FT                   /locus_tag="BSn5_03910"
FT   CDS_pept        complement(698796..699356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03910"
FT                   /product="putative dioxygenase; cupin family protein"
FT                   /note="COG0662 Mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03910"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93412"
FT                   /protein_id="ADV93412.1"
FT                   /translation="MYYNPFSPQCYYYVTVPMYNDGRSVYWTIPNEMENVHRGADLRFS
FT                   YEDRNLLLKDYGPKPFVVNINRATKQNNTFRTALWTGKHFQVTLMSLGIGEDIGLEIHP
FT                   NVDQFLRIEQGRGIVKMGKSKDHLNFQRNVYDDSAMVVPAGTWHNVINTGNTPLKLYSI
FT                   YAPPNHPFGTVHETKADAVAAED"
FT   gene            complement(699900..700721)
FT                   /locus_tag="BSn5_03915"
FT   CDS_pept        complement(699900..700721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03915"
FT                   /product="transcriptional regulator"
FT                   /note="COG0789 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03915"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93413"
FT                   /protein_id="ADV93413.1"
FT                   /translation="MSEDVKKYFTTGEFSKLCRVKKQTLFHYDEIGLFSPEIKKENGYR
FT                   YYSYHQFEIFQVISLFKELGVPLKEIKCLIKGKTPDKILHVLKEKSIEIDKKINELKQL
FT                   QTILQTKVTLTEQALETDFSSISFEYLNEETFMLSRKTLNLPERKYVAAISELIHEVQQ
FT                   YELDEGYPIGGIFAREQILEKDFYNYSYFYIKVKDGAENINYHVRPKGLYAVGYEIGGN
FT                   TEEAYRRIIEFIERNGMQIGENAYEEYMLDEMVVDGYENTYAKILLQVKEV"
FT   gene            700838..702040
FT                   /locus_tag="BSn5_03920"
FT   CDS_pept        700838..702040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03920"
FT                   /product="efflux transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93414"
FT                   /protein_id="ADV93414.1"
FT                   /translation="MKKSINEQKTIFIILLSNIFVAFLGIGLIIPVMPSFMKIMHLSGS
FT                   TMGYLVAAFAISQLITSPFAGRWVDRFGRKKMIILGLLIFSLSELIFGLGTHVSIFYFS
FT                   RILGGVSAAFIMPAVTAYVADITTLKERSKAMGYVSAAISTGFIIGPGAGGFIAGFGIR
FT                   MPFFFASAIALIAAVTSVFILKESLSTEERHQLSSHTKESNFIKDLKRSIHPVYFIAFI
FT                   IVFVMAFGLSAYETVFSLFSDHKFGFTPKDIATIITISSIVAVVIQVLLFGKLVNKLGE
FT                   KRMIQLCLITGAILAFVSTVMSGFLTVLLVTCFIFLAFDLLRPALTAHLSNMASNQQGF
FT                   VAGMNSTYTSLGNIFGPALGGILFDLNIHYPFLFAGFVMIVGLGLTMVWKEKKNDAAAL
FT                   N"
FT   gene            702209..702667
FT                   /locus_tag="BSn5_03925"
FT   CDS_pept        702209..702667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03925"
FT                   /product="spermine/spermidine acetyltransferase"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03925"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93415"
FT                   /protein_id="ADV93415.1"
FT                   /translation="MSIKIKGVTDDNRAAILDLHVSQNQLSYIESTKICLEDANECHYY
FT                   KPVGLYYEGDLVGFAMYGLFPEYDEDNKNGRVWLDRFFIDERYQGKGLGKKMLKALIQH
FT                   LAELYKCKRIYLSIFENNIHAIRLYQRFGFQFNGELDFNGEKVMVKEL"
FT   gene            complement(702816..704120)
FT                   /locus_tag="BSn5_03930"
FT   CDS_pept        complement(702816..704120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03930"
FT                   /product="putative membrane associated protein"
FT                   /note="COG1253 Hemolysins and related proteins containing
FT                   CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03930"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93416"
FT                   /protein_id="ADV93416.1"
FT                   /translation="MTTINLIIFTLLIVLTAFFVATEFAIVKIRSSKIDQLILEEKKGA
FT                   ISAKKVITHLDEYLSACQLGITVTALGIGWVGESTFEVILHPLFAHFHVSETVSHVLIL
FT                   VIAFVMATFLHVVVGELAPKTLAIQKAETITLLTAKPIIWFYRILFPFIWFLNGSARFI
FT                   VGLFGLKPASEHELAHSEEELRILLSESYKSGEINQNELKYVNNIFEFDERIAKEIMIP
FT                   RREIVAISSEDSYETIVKTIKTESYTRYPVLNGDKDSIIGFINAKEFLSAYIDTDQKIK
FT                   EDFKLENHINPVIHVIESVPIHDLLVKMQKERTHIAILVDEYGGTSGLVTAEDILEEIV
FT                   GEIRDEFDKDEVPNIRKVNDNHYILDSKVLIEDVNDLLGTTLASDEVDTIGGWFMTQQI
FT                   DAAVGSVIEADGYIFKVYKTVGRHINYLEIVWKKE"
FT   gene            complement(704383..704526)
FT                   /locus_tag="BSn5_03935"
FT   CDS_pept        complement(704383..704526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03935"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93417"
FT                   /protein_id="ADV93417.1"
FT                   /translation="MFEGLLFFISAGIVCELAAINRNGRKNIKQQAELIQILKENLNKD
FT                   IK"
FT   gene            complement(704544..705509)
FT                   /locus_tag="BSn5_03940"
FT   CDS_pept        complement(704544..705509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03940"
FT                   /product="putative efflux transporter"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93418"
FT                   /protein_id="ADV93418.1"
FT                   /translation="MKKGQLFIGALTCLVASMSWGAMFPVADHALEFVDPFYFSFIRYG
FT                   VVTIMLVILLLVREGKKSFYLEGKAKWIILFGVMAFTVYNVLIFLGQRLMGKSGIMTAS
FT                   IAEALMPMLSIVILWGYKHVKPKKYTMISILIAFLGASMVITKGNISFFFSLGDHLFSI
FT                   LFIFIGVLGWVVYTMGGQIFREWSTLRYSTLTCLFGTAITGIMTAILTAQGYVSVPSIK
FT                   VIAAIKYDFLFMITLPGIIALLSWNYGIKILSSINGILFINFVPITTLLIMVIKGYNIT
FT                   AFDIVGTLFVIIGLILNNIYQRKEDYKQVLQKEKTNLTIT"
FT   gene            705635..706501
FT                   /locus_tag="BSn5_03945"
FT   CDS_pept        705635..706501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03945"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03945"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93419"
FT                   /protein_id="ADV93419.1"
FT                   /translation="MELRDLQIFKCVAHHKSITGAAKELNYVQSNVTARIKQLENELKT
FT                   PLFNRHKKGVSLSPEGRKMIEYVNKILKDVEELEQVFLDTDIPSGILKIGTVETVRILP
FT                   TIIASYYKKYPNVDLSLQAGLTEELIKKVMNHELDGAFISGPLKHSILEQYDVYTEKLT
FT                   LVTSNKTFNIEDFSTTPILVFNQGCGYRSRLEQWLKDEGVLPNRMMEFNILETILNSVA
FT                   LGLGITVVPESAVMHLAVQGKVYCHPLPEKDSCISTIFIRHKDAYLTNSMRSLLKTIVE
FT                   HKNMSMA"
FT   gene            complement(706624..707661)
FT                   /locus_tag="BSn5_03950"
FT   CDS_pept        complement(706624..707661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03950"
FT                   /product="putative oxidoreductase"
FT                   /note="COG2072 Predicted flavoprotein involved in K+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93420"
FT                   /protein_id="ADV93420.1"
FT                   /translation="MYDTIVIGAGQAGISIGYYLKQSDQKFIILDKSHGVGESWKDRYD
FT                   SLVLFTSRMYSSLPGMHLEGEKHGFPSKNEIVAYLKKYVKKFEIPIQLRTEVISVLKIK
FT                   NYFLIKTNREEYQTKNLVIATGPFHTPNIPSISKDLSDNINQLHSSQYKNSKQLAYGNV
FT                   LVVGGGNSGAQIAVELSKERVTYLACSNKLVYFPLMIGKRSIFWWFDKLGVLHASHTSI
FT                   VGKFIQKKGDPVFGHELKHAIKQKEIILKKRVIAAKQNEIIFKDSSTLEVNNIIWATGF
FT                   RNPLCWINIKGVLDQEGRIIHHRGVSPVEGLYFIGLPWQHKRGSALLQGVGNDAEYIVK
FT                   QMNGE"
FT   gene            complement(707749..708696)
FT                   /locus_tag="BSn5_03955"
FT   CDS_pept        complement(707749..708696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03955"
FT                   /product="potassium/proton-divalent cation antiporter"
FT                   /note="COG1230 Co/Zn/Cd efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03955"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93421"
FT                   /protein_id="ADV93421.1"
FT                   /translation="MGHNHSHNHNEGANKKVLLISFIMITGYMIIEAIGGFLTNSLALL
FT                   SDAGHMLSDSISLMVALIAFTLAEKKANHNKTFGYKRFEILAAVINGAALILISLYIIY
FT                   EAIERFSNPPKVATTGMLTISIIGLVVNLLVAWIMMSGGDTKNNLNIRGAYLHVISDML
FT                   GSVGAILAAILIIFFGWGWADPLASIIVAILVLRSGYNVTKDSIHILMEGTPENIDVYD
FT                   IIRTIEGTEGIQNIHDLHIWSITSGLNALSCHAVVDDQLTISESENILRKIEHELEHKG
FT                   ITHVTIQMETEAHNHDNAILCQPKMEKPRDHHHH"
FT   gene            complement(709006..709374)
FT                   /locus_tag="BSn5_03960"
FT   CDS_pept        complement(709006..709374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03960"
FT                   /product="putative tautomerase"
FT                   /note="COG1942 Uncharacterized protein, 4-oxalocrotonate
FT                   tautomerase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93422"
FT                   /protein_id="ADV93422.1"
FT                   /translation="MPLLRFDLIEGRDQSSLKKLLDVAHNVVVEAFDVPQQDRYQIVHE
FT                   HPENHMIIEDTGLGFNRTKNLVVLSVTSKSRPEEKKQKFYRLLAERLESECGIASTDLI
FT                   VSIVENDNADWSFGLGEA"
FT   gene            709949..710596
FT                   /locus_tag="BSn5_03965"
FT   CDS_pept        709949..710596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03965"
FT                   /product="transcriptional regulator (LysR family) protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03965"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93423"
FT                   /protein_id="ADV93423.1"
FT                   /translation="MGESSAPSGPLRIGSMETTAAVWLPQLLAHYNNLYPNVDLNLVTG
FT                   PTEQQIQAVLHYELNGAFISGPIEHPDLVQEKVLDEEMVLVTSASHPVISSIQDVQTQT
FT                   MLVFRKGCSYRAKLNHILQEEGLLPIKLMEFGILEAIIGCVSAGLGISLLPRSIIASHE
FT                   KEGRIRSHTISDKYSFVSTMFIRRKDTLITPALSAFLTHMRDHFQIKRPDQS"
FT   gene            710827..711027
FT                   /locus_tag="BSn5_03970"
FT   CDS_pept        710827..711027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03970"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93424"
FT                   /protein_id="ADV93424.1"
FT                   /translation="MRLEVKGYYFLKRQSLSQLLNIHLQISGDNGKIDIFGWTGAEHPI
FT                   VTVEVSTDGGDPADLSDIAVD"
FT   gene            complement(711028..712350)
FT                   /locus_tag="BSn5_03975"
FT   CDS_pept        complement(711028..712350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03975"
FT                   /product="low-affinity branched-chain amino acid
FT                   transporter"
FT                   /note="COG1114 Branched-chain amino acid permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03975"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93425"
FT                   /protein_id="ADV93425.1"
FT                   /translation="MSKKVSVSYIIIIGLMLFALFFGAGNLIFPPMLGQLAGKNVWIAN
FT                   AGFLVTGVGLPLLAITAFVFSGKQNLQSLASRVHPVFGIVFTTILYLAIGPFFAIPRSG
FT                   NVSFEIGVKPFLSNDAGPVSLIIFTILFFGLACVLSLNPSKIIDIVGEFLTPIKLTFIG
FT                   LLVVVALIRPIGTIQAPSKGYTSQAFFKGFQEGYLTLDALVAFVFGIIIVNALKEQGAS
FT                   TKKQLMGVCAKAAAIAAVLLAVMYTALSYMGASSVEELGILENGAEVLAKVSSYYFGSY
FT                   GSILLGLMITVACLTTSVGLITACSSFFHELFPNISYKKIAVVLSVFSTLVANIGLTQL
FT                   IKVSMPVLLTMYPIAISLIFLTFLHSVFKGKTEVYQGSLLFAFIISLFDGLKEAGIQIE
FT                   VVNRIFTQILPMYNIGLGWLIPAIAGGICGYILSIFRTKTS"
FT   gene            complement(712515..712847)
FT                   /locus_tag="BSn5_03980"
FT   CDS_pept        complement(712515..712847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03980"
FT                   /product="branched-chain amino acid transporter"
FT                   /note="COG1687 Predicted branched-chain amino acid
FT                   permeases (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03980"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93426"
FT                   /protein_id="ADV93426.1"
FT                   /translation="MTMTMTQQMITIAMVVLGTMLTRFLPFMIFPSGKPTPKYVQYLGK
FT                   VLPSAVIGLLVIYCLKDVSLLSGSHGIPELVGAAAVVLLHLWKKNMLLSIAGGTVVYMV
FT                   LVQLVF"
FT   gene            complement(712844..713608)
FT                   /locus_tag="BSn5_03985"
FT   CDS_pept        complement(712844..713608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03985"
FT                   /product="branched-chain amino acid transporter"
FT                   /note="COG1296 Predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03985"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93427"
FT                   /protein_id="ADV93427.1"
FT                   /translation="MNKNKESLHLSSPAINTHMNKRSQIWAAFRSAFPYTIPIFAGFLF
FT                   LGIAYGIFMHSLGFSAIYPIIMSFMIFAGSMEFVAANFLLGAFNPMNALFLTLMVNARH
FT                   LFYGISMLDKYRGTGKKKLYLIFGMCDESFSINYTANVPANVDKGWFMFFVTLLNHLYW
FT                   VAGAAIGGIFGSYVKFNTEGLDFVMTALFIVIFIEQWMKEKKHYSALSGLGLSVACLIL
FT                   FGGNQFIIPAMLAILGVLTVLRKPLEKAEVSV"
FT   gene            complement(713621..714094)
FT                   /locus_tag="BSn5_03990"
FT   CDS_pept        complement(713621..714094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03990"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="COG1522 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03990"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93428"
FT                   /protein_id="ADV93428.1"
FT                   /translation="MGIMLDETDKAILRELQEDASISNLNLSKKIGLSPSACLARTKNL
FT                   VEAGIIKKFTTIVDEKKLGIEVTALALINLSPLNRETIHSFLEDINKFPQVQECYTLTG
FT                   SHDYMLKIVAKDMESYRNFIIDSLMQNPAISGVDTSIVMSTEKRTVSVPIDEM"
FT   gene            complement(714509..714661)
FT                   /locus_tag="BSn5_03995"
FT   CDS_pept        complement(714509..714661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_03995"
FT                   /product="putative ribonuclease inhibitor"
FT                   /note="COG2732 Barstar, RNAse (barnase) inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_03995"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93429"
FT                   /protein_id="ADV93429.1"
FT                   /translation="MRKIMIDGKDFENIEVLHDVLKDKSLWDCLTGWVDLPLTLVLKNF
FT                   EFIHF"
FT   gene            complement(714932..716164)
FT                   /locus_tag="BSn5_04000"
FT   CDS_pept        complement(714932..716164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04000"
FT                   /product="cytochrome P450"
FT                   /note="COG2124 Cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04000"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93430"
FT                   /protein_id="ADV93430.1"
FT                   /translation="MSSKEKKSVTILTESQLSSRAFKDEAYEFYKELRKSQPLYPLSLG
FT                   ALGKGWLISRYDDAIHLLKNEKLKKNYENVFTAKEKRPALLKNEETLTKHMLNSDPPDH
FT                   NRLRTLVQKAFTHRMILQLEDKIQHIADSLLDKVQPNKFMNLVDDYAFPLPIIVISEML
FT                   GIPLEDRQKFRVWSQAIIDFSDAPERLQENDHLLGEFVEYLESLVRKKRREPAGDLISA
FT                   LIQAESEGTQLSTEELYSMIMLLIVAGHETTVNLITNMTYALMCHHDQLEKLRQQPDLM
FT                   NSAIEEALRFHSPVELTTIRWTAEPFILHGQEIKRKDVIIISLASANRDEKIFPNADIF
FT                   DIERKNNRHIAFGHGNHFCLGAQLARLEAKIAISTLLRRCPNIQLKGEKKQMKWKGNFL
FT                   MRALEELPISF"
FT   gene            complement(716165..716299)
FT                   /locus_tag="BSn5_04005"
FT   CDS_pept        complement(716165..716299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04005"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93431"
FT                   /protein_id="ADV93431.1"
FT                   /translation="MTVSYLLFQNEGTAFWPLSSMDHFTNRPDFIFKDYHNLSKMEVE"
FT   gene            complement(716357..716560)
FT                   /locus_tag="BSn5_04010"
FT   CDS_pept        complement(716357..716560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04010"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93432"
FT                   /protein_id="ADV93432.1"
FT                   /translation="MHKVLTRAYFKKHFFFVGIQNGEMVVAALLKHRDKPDIKLDRLYS
FT                   SRGDNINQNGAEKFSKSLKEPA"
FT   gene            complement(716545..716694)
FT                   /locus_tag="BSn5_04015"
FT   CDS_pept        complement(716545..716694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04015"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93433"
FT                   /protein_id="ADV93433.1"
FT                   /translation="MFLYRQARADEVSKVAKLFHQSFNQYPFMDLLVKREKKIIHLFLK
FT                   CIKY"
FT   gene            complement(716793..717359)
FT                   /locus_tag="BSn5_04020"
FT   CDS_pept        complement(716793..717359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04020"
FT                   /product="putative hydrolase"
FT                   /note="COG1335 Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04020"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93434"
FT                   /protein_id="ADV93434.1"
FT                   /translation="MEEKKKALIIVDVQKAFDDKKWGERNNVKAEENISKILKLWREKG
FT                   WTVIYIQHTSDKPHSLFHPKNEGFAIKEIVKPMDEEVIITKTVNSSFIGTNLEEFLKLN
FT                   EITTVVITGLTTPHCVSTTTRMSGNLGFDTYLISDATAAFGMRDQNDTYYDAATIHNIS
FT                   LATLHDEFATILTTDQLINDFIKTH"
FT   gene            complement(717590..717979)
FT                   /locus_tag="BSn5_04025"
FT   CDS_pept        complement(717590..717979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04025"
FT                   /product="putative integral inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04025"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93435"
FT                   /protein_id="ADV93435.1"
FT                   /translation="MFFIEELEKLNQTNLLLRFTLEIAALISLGVFAWISFNGYFKYIL
FT                   TWVLPIAVMIVWSVFAVPNDPSRRGQTVIAVNGVTRLVIELLIFAMAVAALYFSHLKPV
FT                   GIVFLCLIILHYIFSAERIKWLLNQ"
FT   gene            complement(718770..719273)
FT                   /locus_tag="BSn5_04030"
FT   CDS_pept        complement(718770..719273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04030"
FT                   /product="hypothetical protein"
FT                   /note="COG2318 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04030"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93436"
FT                   /protein_id="ADV93436.1"
FT                   /translation="MFQTLDHFLKSWEFEADATQKLLNSLTDESLKQEITSQNWTLGRI
FT                   AWHTVAAIRIITSNTDLTFHAPAEDYPVPTSAQFIADSYHQASNAFVQALKTQWTDHTL
FT                   QERINFIGQQLPNGSLLMFLIQHQNHHRGQMTVLMRQAGLTVPGIYGPAKEEWAKFGLE
FT                   APKM"
FT   gene            complement(719499..720353)
FT                   /locus_tag="BSn5_04035"
FT   CDS_pept        complement(719499..720353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04035"
FT                   /product="aminoglycoside 6-adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04035"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93437"
FT                   /protein_id="ADV93437.1"
FT                   /translation="MRSEQEMMDIFLDFALNDERIRLVTLEGSRTNRNIPPDNFQDYDI
FT                   SYFVTDVDSFKENDQWLEIFGKRIMMQKPEDMELFPPELGNWFSYIILFEDGNKLDLTL
FT                   IPIREAEDYFANNDGLVKVLLDKDSFINYKVTPNDHQYWMKKPTAREFDDCCNEFWMVS
FT                   TYVVKGLARNEILFAIDHLNEIVRPNLLRMMAWHIASQKGYSFSMGKNYKFMKRYLSNK
FT                   EWEELMSTYSVNGYQEMWKSLFTCYALFRKYSKAVSESLAYKYPDYDEGITKYTEGIYC
FT                   SVK"
FT   gene            720746..721789
FT                   /locus_tag="BSn5_04040"
FT   CDS_pept        720746..721789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04040"
FT                   /product="putative anionic nitroalkane dioxygenase"
FT                   /note="COG2070 Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04040"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93438"
FT                   /protein_id="ADV93438.1"
FT                   /translation="MNEFMKKFSLTKPIIQAPMAGGITKPRLASAVSNQGALGSLASGY
FT                   LTPDLLEQQIKEMFELTDAPFQINVFVPLGLEMPPEDQVKKWKENIPLANQVNQFTSVQ
FT                   EEWDDFYQKIDLILKYKVKACSFTFDLPPEDAVKELKTAGCCLIGTASTVEEALLMEER
FT                   GMDIVVLQGSEAGGHRGAFLPSKGESAVGLMALIPQAADALSVPVIAAGGMIDHRGVKA
FT                   ALTLGAQGVQIGSAFLICHESNAHPVHKQKILEANEADTKLTTLFSGKEARGIVNKWME
FT                   EKEQFETQTLPYPYQNTLTKAMRQKASLQNNHDQMSLWAGQGIRSLTEEISVKQLLNQL
FT                   CQEDIKI"
FT   gene            complement(721797..721958)
FT                   /locus_tag="BSn5_04045"
FT   CDS_pept        complement(721797..721958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04045"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93439"
FT                   /protein_id="ADV93439.1"
FT                   /translation="MLVMYCGEIIKIAPYQWDDFSFENVEYLDFQSQGMKLRKKSKLPV
FT                   EVCFLLYQ"
FT   gene            722115..722912
FT                   /locus_tag="BSn5_04050"
FT   CDS_pept        722115..722912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04050"
FT                   /product="glutamate racemase"
FT                   /note="COG0796 Glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04050"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93440"
FT                   /protein_id="ADV93440.1"
FT                   /translation="MKIGFFDSGIGGMTVLYEAIKVLPYEDYIFYADTLNVPYGEKSKG
FT                   KVKEYIFNAAEFLASQNIKALVIACNTATSIAIEDLRRNFDFPIIGIEPAVKPAINKCT
FT                   EERKRVLVVATNLTLKEEKFHNLVKEIDHHDLVDCLALPGLVEFAENFDFSEDKIIKYL
FT                   KNELSSFDLKQYGTIVLGCTHFPFFKNSFEKLFGIKVDMISGSVGTAKQLKKVLADRNQ
FT                   LGKGSGSITFFNSGHKIVDQVVISKYKRLFEILDETQRSHVGH"
FT   gene            723294..724001
FT                   /locus_tag="BSn5_04055"
FT   CDS_pept        723294..724001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04055"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04055"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93441"
FT                   /protein_id="ADV93441.1"
FT                   /translation="MMKKGLLAGALTATVLFGTCAVDVPGIISPKTAEAASQLTDGIGG
FT                   RAYLNSTGAIFVTKIQLPSSIQVSNGTAYIYSGFSGGTESDIGFQYSDKYNVWKPYMKV
FT                   GSKGQDQVQYLEGGSQFTNTKGFRPGSTVQLTIYKNLNGNTRATYWGTNNAGYNGRLIS
FT                   EISKTNVGSISKWKALATVATTGSRQSIKSNFSTSFTNITIDNKAITPVIDTQDFAKVT
FT                   VSGNSVSLSVVKN"
FT   gene            724468..725169
FT                   /locus_tag="BSn5_04060"
FT   CDS_pept        724468..725169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04060"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="COG2186 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04060"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93442"
FT                   /protein_id="ADV93442.1"
FT                   /translation="MIFIKFNPVSNKKLYIQIYNQILSEIQLGSFKVGDKLPSERELCE
FT                   QFGVSRAPVRQALSALEMNGVIYSRQGEGVFVKNTTITNGISASMESASPEDIVEARMN
FT                   IEPLIIKFAALRATDEDIRELRKTIKKMEEETLSGVYVPETDEQLHMGIAKASHNDLFI
FT                   TFMSAITNAMKQQEMWRFIRDRTVTRSEYREVNFQEHKLIIKAIEDRNEKEAVERMTAH
FT                   MQNLYDRYWKS"
FT   gene            complement(725269..725445)
FT                   /locus_tag="BSn5_04065"
FT   CDS_pept        complement(725269..725445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04065"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93443"
FT                   /protein_id="ADV93443.1"
FT                   /translation="MKMIGGNKTMVQKSKVQQDTIVCQVCEKVIDTADSSEGVKVLYGI
FT                   CQRCLGSGDQKAK"
FT   gene            complement(725690..727030)
FT                   /locus_tag="BSn5_04070"
FT   CDS_pept        complement(725690..727030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04070"
FT                   /product="major facilitator superfamily transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04070"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93444"
FT                   /protein_id="ADV93444.1"
FT                   /translation="MDQLALERSTTRKVTIRLIPFLFLCFIIAILDRVNIGFAALQMNE
FT                   DLGFSNAVFGLGAGIFFLGYFILEVPGSAIMTKIGARKWISRIMITWAIIAILMAFVQE
FT                   PWQFYTARFLLGAAEASFYPCMVFYLSGFYQTKHHAKAIAGFMLAIPGANALGSPLSTF
FT                   LLGIEWLDISGWQWLFILEAIPALILGVIAFFYLDDKIEDVKWLDKDEKQWLINVTTKE
FT                   RMEKEQVKHYTFTQALKDRDVLILSIGYFCWMIGYYGINMFLPTISQGLSETISLSTQG
FT                   MGWLLGFMYFCAMVVMIFVGNHSDKKNERLWHVAVCLTVSAVAMVISSYVANSSVILAF
FT                   VFLTIALCGAFGAYSPFWAIPPSFLTGAAAGGAIALINSIGNLGGFFGPYIVGYIKDMT
FT                   GSFNISIIFLGLSMILASFILVFLVKQSGKALKVKNATYKSSIEKSG"
FT   gene            complement(727199..727957)
FT                   /locus_tag="BSn5_04075"
FT   CDS_pept        complement(727199..727957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04075"
FT                   /product="short chain dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04075"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93445"
FT                   /protein_id="ADV93445.1"
FT                   /translation="MFTLNNQVAIVTGSGSKKGIGRTIALTLAKQGASIVVADMNQTGI
FT                   QDTVEAITESGGRAVGVEVNVTNKESVDHMIAKTLEAFGRIDILVNNAGISQKVTVQDM
FT                   TLEDMTRVFNVNMFGLFLCTQAVLETMKKQQYGRIINLSSVSAKRGGGVFGGAHYSASK
FT                   AAVLGFSKNLAREVGKDGITVNCVAPGLVNTDIWKSLSEEDAKKVIDNIPVGRPGETKE
FT                   IAAAITFLAAKEAAYITGEEIDINGGSHMD"
FT   gene            complement(727980..728933)
FT                   /locus_tag="BSn5_04080"
FT   CDS_pept        complement(727980..728933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04080"
FT                   /product="transketolase, pyrimidine binding domain
FT                   (C-terminal subunit)"
FT                   /note="COG3958 Transketolase, C-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04080"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93446"
FT                   /protein_id="ADV93446.1"
FT                   /translation="MSQTEKALITKKATREAFGDEIVQLGKENKNIYVIDIDIGKSCKT
FT                   GEFIKQLPHQHVNVGIAEQNGAGLAAGLATTGKIPFVSTYAVFGSLRMAEQIRQEVCYP
FT                   NLNVKIACSHGGLTPGNDGGSHQAIEDMGVLRSFPNMTVIMGADYHSTRKLIRQAANMY
FT                   GPMYLRFTRDAVPVIYDENEEFIIGKAKQLKHGKDIAIIANGDTVYLALEAVKQLEEQG
FT                   IYATLLDMHTIKPLDREAVVECLDLGNIVTVEDHNILNGLGSAVCEVAAEEGRGRVKRI
FT                   GVQDRFGESAPYEKLLEINGITIENIIKTAKDMLRI"
FT   gene            complement(728930..729766)
FT                   /locus_tag="BSn5_04085"
FT   CDS_pept        complement(728930..729766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04085"
FT                   /product="transketolase, thiamine diphosphate binding
FT                   domain (N-terminal subunit)"
FT                   /note="COG3959 Transketolase, N-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04085"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93447"
FT                   /protein_id="ADV93447.1"
FT                   /translation="MKKASLAELQAKAIELRKTAVTMIYEAQSGHPGGSLSAADIITAL
FT                   YFKEMNIDPKNPKWEDRDRFVLSKGHVAPIQYAALALRGFVPYESVYKLRRYGSPFQGH
FT                   PDMKKCPGIDISTGSLGQGLSCAVGMALAGKRDGKDYRVFAMVGDGECQEGQIWEAVQT
FT                   AVKYSLDNLIVFVDNNRLQIDGYCDEVMPLQDIEKKFEVFGFETKRIDGHSMKEIVEIL
FT                   DKVTKTKNGKPKCIVADTIKGKGVSYMENICSWHGVAPNEKEYEQALEELAGGLRS"
FT   gene            complement(730188..730757)
FT                   /locus_tag="BSn5_04090"
FT   CDS_pept        complement(730188..730757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04090"
FT                   /product="hypothetical protein"
FT                   /note="COG1853 Conserved protein/domain typically
FT                   associated with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04090"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93448"
FT                   /protein_id="ADV93448.1"
FT                   /translation="MRAPIDEPIWYAYPGMVAVVTAQYEGEKNAMSSGWHTYIGSSPGM
FT                   YGISVNKETYTYKLIEKSGIFGVNFLPGRCSGLIQALGTRSGRDINKFEAFHIQYEKGL
FT                   KAEVPILTDAYFAYECKVHSVSTLGDQEWIVGEVLQRYQDKELFLKNGMPDLEKLDIPL
FT                   HIGGANYRILNSQAEERQHVFYPKTD"
FT   gene            complement(731305..732153)
FT                   /locus_tag="BSn5_04095"
FT   CDS_pept        complement(731305..732153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04095"
FT                   /product="BmrR"
FT                   /note="COG0789 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04095"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93449"
FT                   /protein_id="ADV93449.1"
FT                   /translation="MKEYFTIGETARLNNISIQTLRYYDRIGIFKPYYTDQDNGYRYYH
FT                   VKQFFYLDVIKYLKYIRTPLEEIKRFSSYTCTPEDMQYFLEEKESVIVQEMEKLERARQ
FT                   LLHRRRKQLNEQLEICSKKDEGFVYFRYIDKQTILKVETPQVNPHNQSDLYYRKLADVV
FT                   EKIGDVIDNYYGFIYDFKPYKDSREIYCNSIYTTVCSGKKIDIGEKNMRLDTIPSGEYV
FT                   CIAFNWSAKNYDEYYQKLYQYIESHGIQTDGKVYQVSLPIDYNSLREENFLTELRVLKN
FT                   N"
FT   gene            complement(732632..733000)
FT                   /locus_tag="BSn5_04100"
FT   CDS_pept        complement(732632..733000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04100"
FT                   /product="hypothetical protein"
FT                   /note="COG2315 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04100"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93450"
FT                   /protein_id="ADV93450.1"
FT                   /translation="MKNREEAIDYCLSFKNVYEDYPFRDKNWTLMRHIENRKVFAWIFK
FT                   KNDYIWINLKCEPGFLDFWRQKYTSVVPAFHLNKEHWNSIILDGTVSDKDIYDMITQSY
FT                   MLTKTKYATGPRERGCNM"
FT   gene            733402..733689
FT                   /locus_tag="BSn5_04105"
FT   CDS_pept        733402..733689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04105"
FT                   /product="hypothetical protein"
FT                   /note="COG0671 Membrane-associated phospholipid
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04105"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93451"
FT                   /protein_id="ADV93451.1"
FT                   /translation="MPHILISQKSGYSVIDGLGPLTNVYRMKAGATTTINRVPANATIK
FT                   KYNDKGTNSGSTSSSLGSIVSLVNTLRGPYSSTNPAKGYFHFVNAITLFY"
FT   gene            733715..733843
FT                   /locus_tag="BSn5_04110"
FT   CDS_pept        733715..733843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04110"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93452"
FT                   /protein_id="ADV93452.1"
FT                   /translation="MKKKLPLAERENRQKAAGEESAANTGAFKHFTSIKDRRHFPH"
FT   gene            complement(733908..734663)
FT                   /locus_tag="BSn5_04115"
FT   CDS_pept        complement(733908..734663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04115"
FT                   /product="putative lipoprotein"
FT                   /note="COG3443 Predicted periplasmic or secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04115"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93453"
FT                   /protein_id="ADV93453.1"
FT                   /translation="MNILFSKRLGILTIGSLLVLAGCQTSGSSAGESNQTTSSSAVEED
FT                   SSKTQEQTSDSHTQEHSHDHSHAHDEETEKIYEGYFKNSQVKDRLLSDWEGDWQSVYPY
FT                   LQDGTLDEVFSYKSEHEGGKTAEEYKEYYKKGYQTDVDRIVIQKDTVTFFKNGKEYSGK
FT                   YTYDGYEILTYDAGNRGVRYIFKLAKKAEGLPQYIQFSDHSIYPTKASHYHLYWGDDRE
FT                   ALLDEVKNWPTYYLSKMDGHDIAHEMMAH"
FT   gene            complement(734796..735326)
FT                   /locus_tag="BSn5_04120"
FT   CDS_pept        complement(734796..735326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04120"
FT                   /product="RNA polymerase sigma factor SigZ"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04120"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93454"
FT                   /protein_id="ADV93454.1"
FT                   /translation="MNIEDLWDQFHQPLKTYISQRVNDQSIVDDLLQIVFMKIQVHLPN
FT                   LIDEQKIDSWIYRITRNTIIDFYRTKKTSEILPDDLHFNNRAEEENFTKEAAVCIRSTI
FT                   KRLPEKYREALELTEFQGLSQKELSEKLGISYSGAKSRVQRGRGKLKQLLEGCCHIEAD
FT                   RYGNIVDFRILKE"
FT   gene            735462..736442
FT                   /locus_tag="BSn5_04125"
FT   CDS_pept        735462..736442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04125"
FT                   /product="putative oxidoreductase"
FT                   /note="COG0667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04125"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93455"
FT                   /protein_id="ADV93455.1"
FT                   /translation="MEYTYLGRTGLRVSRLCLGTMNFGVDTDEKTAFRIMDEALDNGIQ
FT                   FFDTANIYGWGKNAGLTESIIGKWFAQGGQRREKVVLATKVYEPISDPNDGPNDMRGVS
FT                   LYKIRRHLEGSLKRLQTDHIELYQMHHIDRRTPWDEIWEAFESQVRSGKVDYIGSSNFA
FT                   GWHLVKAQAEAEKRRFMGLVTEQHKYSLLERTAEMEVLPAARDLGLGVVAWSPLAGGLL
FT                   GGKALKSNAGTRTAKRADLIEKHRLQLEKFSDLCKELGEKEANVALAWVLANPVLTAPI
FT                   IGPRTVEQLRDTIKAVEISLDKEILRMLNDIFPGPGGETPEAYAW"
FT   gene            complement(736718..738034)
FT                   /locus_tag="BSn5_04130"
FT   CDS_pept        complement(736718..738034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04130"
FT                   /product="putative citrate transporter"
FT                   /note="COG2851 H+/citrate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04130"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93456"
FT                   /protein_id="ADV93456.1"
FT                   /translation="MLTILGFSMVTVFTILIMTKKVSPIVALTITPIVFALIGGFGKDI
FT                   GDMILEGIQTVASSAALLLFAILFFGILIDAGLFDPLIEKILSIVKGDPVKIAIGSAVL
FT                   AMLIALDGDGTTTYMITVSAMLPLYKRIGMNPMVMATLAMLSLSIVSGMTPWGGPATRA
FT                   ISVLGLDPSDFFVPLLPTMLGGIACVIFLAFLMGRKERNRIGIVQLEPRHITKDSSQSY
FT                   MAASLESEQLKRPRLIYLNLFLVISIMVFIVLGTKHPSVLFLIGFVLALTINYPNVKMQ
FT                   KERIAEHSGNAITVVLLVFSAGVFAGILSGTKMVDAIAGSLISVIPSSMGGFFPVIVAL
FT                   TSIPFTFVLSNDAYYFGMVPIFAEAASAYGIEPVEIARASIMGQPVHLMSPLVASTLLL
FT                   VSMLKMDLGSFQRFAVKWAVITSLVITLLAIITGAITIL"
FT   gene            complement(738149..739018)
FT                   /locus_tag="BSn5_04135"
FT   CDS_pept        complement(738149..739018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04135"
FT                   /product="putative transcriptional regulator (LysR family)
FT                   protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04135"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93457"
FT                   /protein_id="ADV93457.1"
FT                   /translation="MDEKDWILLKILREEQSVTKTAERLFTSQPSITYRLNKIEEIFGI
FT                   ELFTKRHKGITFTAEGEHLVAYARRMLQELQDTKDHISNLSKEVQGHLRLGVSSNFAQY
FT                   KLPKLLREFSTMYPNVQYSVQTGWSTDVMKLLDAGIVQVGILRGSHRWKGVEERLTREK
FT                   LHIISKKPITIEQLPFLPFIKYKTDASLKTIIEDWMHTNLKQAPIIAMEVDRQETCKEM
FT                   VKHGLGYSIAPEICLQESDHLYTMELYNAKGKPLMRDTWLMYDQKSLGIKLVKAFIDFL
FT                   KGEQMVTI"
FT   gene            739161..740264
FT                   /locus_tag="BSn5_04140"
FT   CDS_pept        739161..740264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04140"
FT                   /product="hypothetical protein"
FT                   /note="COG2828 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04140"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93458"
FT                   /protein_id="ADV93458.1"
FT                   /translation="MVKTNVTIMRGGTSKGIFFHESAMPNNKNEWEPFLLDIMGSPDKR
FT                   QIDGLGGGNSLTSKVAIIKKAHTSDIDVHYTFGQVSISEEKVDFKGNCGNISAAVGPFA
FT                   IEEGLVKATEPMTAVRILNTNTNKMIIAEVQVEDGQVKYDGDVTISGVPGSGSPIYLNF
FT                   HDAAGSVTGHLLPTGNSSEFLDTSQGQIEVSIIDYANPLVFVEASSIGLDGTELAEEFT
FT                   DLQLAQFEELRSIAAEKCGFASRFSATKLSPAVPKLAIVSKPEKYKDSTGAWHSNVEMD
FT                   LHIRMMSMQKPHQALAVTGAICTTRALSVEGAIPARIAKNHSTKVRLAHSSGIIETMVE
FT                   PTGIKIVRTARRIMDGTVYTHGDYQMM"
FT   gene            complement(740546..741361)
FT                   /locus_tag="BSn5_04145"
FT   CDS_pept        complement(740546..741361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04145"
FT                   /product="chitosanase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04145"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93459"
FT                   /protein_id="ADV93459.1"
FT                   /translation="MKISMQKAAISLLVFTMFFTLMMSETVFAAGLNKDQKRRAEQLTS
FT                   IFENGTTEIQYGYVERLDDGRGYTCGRAGFTTATGDALEVVEVYTKAVPNNKLKKYLPE
FT                   LRRLAKEESDDTSNLKGFASAWKSLANDKEFRAAQDKVNDRLYYQPAMKRSDNAGLKTA
FT                   LARAVMYDTVIQHGDGDDPDSFYALIKRTNKKAGGSPKDGIDEKKWLNKFLDVRYDDLM
FT                   NPANHDTRDEWRESVARVDVLRSIAKENNYNLNGPIHVRSNEYGNFVIK"
FT   gene            741804..742067
FT                   /locus_tag="BSn5_04150"
FT   CDS_pept        741804..742067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04150"
FT                   /product="hypothetical protein"
FT                   /note="COG0568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04150"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93460"
FT                   /protein_id="ADV93460.1"
FT                   /translation="MTYVKATAILPEKLISEIQKYVQGKTLYIPKTESSHQKWGACSGT
FT                   RKLIDDRNASIKKAFKNGKTIHNLSDEYHLSIETIKKIVYSK"
FT   gene            742204..743019
FT                   /locus_tag="BSn5_04155"
FT   CDS_pept        742204..743019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04155"
FT                   /product="putative hydrolase"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04155"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93461"
FT                   /protein_id="ADV93461.1"
FT                   /translation="MTINNGTLQVPGANIHYKVRGAGPIILLVHGGGGDADKFHHIANH
FT                   LANRYTVVTYDRRGHSRSNLANQIEDYRVETHSDDAHSLLAKITNKPAYVFGSSSGAVI
FT                   GLDLCIRHPEQVHVMIPHEPILLQLLHGNELKQAEQFMEDLKKNHRSEVIKLMSRLETD
FT                   EQSKAVLTKRLLGNSTYFTEYEIQGILNYTLDFEALKTVFTSSPMKVLPAGGSASRELF
FT                   PYRCANALAEQLKTELVEFPGNHTGYTIYHKEFSERLHDMLEKEKKHTC"
FT   gene            complement(743427..743783)
FT                   /locus_tag="BSn5_04160"
FT   CDS_pept        complement(743427..743783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04160"
FT                   /product="hypothetical protein"
FT                   /note="COG4991 Uncharacterized protein with a bacterial SH3
FT                   domain homologue"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04160"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93462"
FT                   /protein_id="ADV93462.1"
FT                   /translation="MTKLKMLSMLTVMIASLFIFSSQALAVQYFTVSTSSGAPVNMRSG
FT                   PGTNYPIMLSIPSGSRVPYYCYAYGTTVTGKYGTSNIWDQIQWKDSRGVVNIGYVSDTY
FT                   VYTGSDGPVGYKCN"
FT   gene            complement(743836..744171)
FT                   /locus_tag="BSn5_04165"
FT   CDS_pept        complement(743836..744171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04165"
FT                   /product="hypothetical protein"
FT                   /note="COG4991 Uncharacterized protein with a bacterial SH3
FT                   domain homologue"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04165"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93463"
FT                   /protein_id="ADV93463.1"
FT                   /translation="MLTVMIASVFIFSSHALAAQYYTVSTSSGAPVNMRSGPGTSWGIV
FT                   TTIPSGTRIPIYCYKTGTTVTGKYGTSNIWNYTERTLASGEIVPGFVSDTYMYTGSDGP
FT                   VVPKCSW"
FT   gene            744369..744485
FT                   /locus_tag="BSn5_04170"
FT   CDS_pept        744369..744485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04170"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93464"
FT                   /protein_id="ADV93464.1"
FT                   /translation="MVVRLDIDGVLHLAFVQSVITIDNQEKGHGSSGFVSTN"
FT   gene            complement(744705..745091)
FT                   /locus_tag="BSn5_04175"
FT   CDS_pept        complement(744705..745091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04175"
FT                   /product="putative lyase"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04175"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93465"
FT                   /protein_id="ADV93465.1"
FT                   /translation="MKLLQIRLLVNDFKKSVEFYKDSLGLPISWLENEMEYALFDNGET
FT                   KIELLSRETMAEIVGEEKKSLEGEAQSKFLLQFKVEDVDKTYDDLHEKGVKCVNKPHDR
FT                   KEWSARVAHFRDPDHNLIEIYKML"
FT   gene            745365..745610
FT                   /locus_tag="BSn5_04180"
FT   CDS_pept        745365..745610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04180"
FT                   /product="putative spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04180"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93466"
FT                   /protein_id="ADV93466.1"
FT                   /translation="MDHQTLAAHEAVDLHEIVNFKTLCIAKSKLMQGLVFDQELKDLMQ
FT                   KDVQQSIQDLTELQAVYERASFQAPVPQSRPTPIIN"
FT   gene            745628..745996
FT                   /locus_tag="BSn5_04185"
FT   CDS_pept        745628..745996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04185"
FT                   /product="putative spore coat protein"
FT                   /note="COG5577 Spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04185"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93467"
FT                   /protein_id="ADV93467.1"
FT                   /translation="MNNDHLDPINSLNVPELADTTFAMDFLIRAKEGVRNTAVALTETA
FT                   SPDVRALLRKQLMQGIAMHQEITELMISKKWFHPYELSEQYKLDQLSAKNTIMVGNMNL
FT                   FPDETNRKGMFDRTPDEH"
FT   gene            746015..747151
FT                   /locus_tag="BSn5_04190"
FT   CDS_pept        746015..747151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04190"
FT                   /product="putative oxidoreductase"
FT                   /note="COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04190"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93468"
FT                   /protein_id="ADV93468.1"
FT                   /translation="MKAVTYQGIKNVVVKDVPDPKIEKSDDMIIKVTSTAICGSDLHLI
FT                   HGFIPNMQEDYVIGHEPMGIVEEVGSGVTKLKKGDRVIIPFNIACGECFFCKNQLESQC
FT                   DQSNDNGEMGAYFGYSGQTGGYPGGQAEYLRVPFANFTHFKIPESCEEPDEKLSVIADA
FT                   MTTGFWSVDNAGVKKGDTVIVLGCGPVGLFAQKFCWLKGAKRVIAVDYVNYRLQHAKRT
FT                   NKVEIVNFEDHENTGNYLKEITKGGADVVIDAVGMDGKMSDLEFLASGLKLHGGTMSAL
FT                   VIASQAVRKGGTIQITGVYGGRYNGFPLGDIMQRNINIRSGQAPVIHYMPYMFELVSTG
FT                   KIDPGDVVSHVLPLSEAKHGYDIFDSKMDDCIKVVLKP"
FT   gene            747170..747367
FT                   /locus_tag="BSn5_04195"
FT   CDS_pept        747170..747367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04195"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93469"
FT                   /protein_id="ADV93469.1"
FT                   /translation="MEYALHEVLEVQEMTAFKTLCLTKSKTMKALVSDPKLKEIMQQDV
FT                   DITTRQLQEFASILSNAKHE"
FT   gene            747383..747682
FT                   /locus_tag="BSn5_04200"
FT   CDS_pept        747383..747682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04200"
FT                   /product="putative spore coat protein"
FT                   /note="COG5577 Spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04200"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93470"
FT                   /protein_id="ADV93470.1"
FT                   /translation="MNPIIEYLTGMNVLTDQIIAMDLLISAKNGVRNYAMAATEAGTPE
FT                   VKEVLIRHLEEALDMHEQLSSYMMEKGWYHPWNPDEQVKLNLKNIDTAIQLPTL"
FT   gene            complement(747641..747850)
FT                   /locus_tag="BSn5_04205"
FT   CDS_pept        complement(747641..747850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04205"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93471"
FT                   /protein_id="ADV93471.1"
FT                   /translation="MVTNSYLIGEFANIIGDQMGKSGLSPKKTVLMAIQLEAEEQLWPI
FT                   NTVPQQISHCMLKGWQLNGCINIF"
FT   gene            complement(747938..748360)
FT                   /locus_tag="BSn5_04210"
FT   CDS_pept        complement(747938..748360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04210"
FT                   /product="putative transcriptional regulator (MerR family)
FT                   protein"
FT                   /note="COG0789 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04210"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93472"
FT                   /protein_id="ADV93472.1"
FT                   /translation="MNIAQVAKQFGLTAATLRYYERVGLIPPVKRKNSGIRDYDEEDIK
FT                   WIEFIKCMRNAGLSIEALIEYTTLFTEGDRTVEARKNILADERQRLIEKRKEIEKTIKR
FT                   LDTKIKDYDGKLRENEAKLKSRPKTESLHGSVEQRR"
FT   gene            748543..748737
FT                   /locus_tag="BSn5_04215"
FT   CDS_pept        748543..748737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04215"
FT                   /product="carboxymuconolactone decarboxylase"
FT                   /note="COG0599 Uncharacterized homolog of
FT                   gamma-carboxymuconolactone decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04215"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93473"
FT                   /protein_id="ADV93473.1"
FT                   /translation="MANKHTAGREQLGEFAPKFAELHDDVLFGDIWAREEELSSRDRSM
FT                   ITVSALIADCFSAYKSGSF"
FT   gene            748868..749917
FT                   /locus_tag="BSn5_04220"
FT   CDS_pept        748868..749917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04220"
FT                   /product="putative dehydrogenase"
FT                   /note="COG1064 Zn-dependent alcohol dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04220"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93474"
FT                   /protein_id="ADV93474.1"
FT                   /translation="MCNQHQTRVLSVSHAKAKFEQTTIERRGLRPHDVLIDIKFSGICH
FT                   SDIHSAFDEWGGGIFPMVPGHEIAGVVTAVGAEVTKFAVGDRVGVGCFVDSCGECEYCL
FT                   NGEEQFCTKGVVQTYNSVDYDGNPTYGGYSQKIVVTDRFVVRIPDRLEMDVASPLLCAG
FT                   ITTYSPLKHWNVGPGKKVAIVGVGGLGHLAIQFAHAMGAEVTVLSRSMNKKEEALELGA
FT                   NHYFATSDPATFTALAGRFDVILNTVSANLDVDAYLSMLRIDGTLVNVGAPAKPDTYSV
FT                   FSLIMGRRSIAGSLVGGIQETQEMLDFAAEHGIEPKIEVIGADQVDEAYERILRSDVRY
FT                   RFVIDISTL"
FT   gene            750050..750559
FT                   /locus_tag="BSn5_04225"
FT   CDS_pept        750050..750559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04225"
FT                   /product="general stress protein"
FT                   /note="COG0693 Putative intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04225"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93475"
FT                   /protein_id="ADV93475.1"
FT                   /translation="MSKKIAVLVTDQFEDIEYTSPVKAYEEAGYSVVAIDLEAGKEVTG
FT                   KHGEKVKIDKAISDVDASDFDALLIPGGFSPDLLRADDRPGEFAKAFVENKKPVFAICH
FT                   GPQVLIDTDLLKGKDITGYRSIRKDLINAGANYKDAEVVVSHNIVTSRTPDDLEAFNRE
FT                   SLNLLK"
FT   gene            complement(750603..752636)
FT                   /locus_tag="BSn5_04230"
FT   CDS_pept        complement(750603..752636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04230"
FT                   /product="levanase"
FT                   /note="COG1621 Beta-fructosidases (levanase/invertase)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04230"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93476"
FT                   /protein_id="ADV93476.1"
FT                   /translation="MKKRLIQVIIMFTLLLTMAFSADAADSSYYDEDYRPQYHFTPEAN
FT                   WMNDPNGMVYYAGEYHLFYQYHPYGLQWGPMHWGHAVSKDLVTWEHLPVALYPDEKGTI
FT                   FSGSAVVDKNNTSGFQTGKEKPLVAIYTQDREGHQVQSIAYSNDKGRTWTKYAGNPVIP
FT                   NPGKKDFRDPKVFWYEKEKKWVMVLAAGDRILIYTSKNLKQWTYASEFGQDQGSHGGVW
FT                   ECPDLFELPVDGNPNRKKWVMQVSVGNGAVSGGSGMQYFVGDFDGTHFKNENPPNKVLW
FT                   TDYGRDFYAAVSWSDIPSTDSRRLWLGWMSNWQYANDVPTSPWRSATSIPRELKLKAFT
FT                   EGVRVVQTPVKELETIRGTSKKWKNLTISPASHNVLAGQSGDAYEINAEFKVSSGSAAE
FT                   FGFKVRTGENQFTKVGYDRRNAKLFVDRSESGNNTFNPAFNTGKETAPLKPVNGKVKMR
FT                   IFVDRSSVEVFGNDGKQVITDIILPDRSSKGLELYAAKGGVKVKSLTIHPLKKVWGTSP
FT                   FMSNLTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGA
FT                   LMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGD
FT                   RFKIYLDDRLVIDAHDSAFSEGQFGLNVWDATAVFQNVTKES"
FT   gene            complement(752793..753620)
FT                   /locus_tag="BSn5_04235"
FT   CDS_pept        complement(752793..753620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04235"
FT                   /product="phosphotransferase system (PTS) fructose-specific
FT                   enzyme IID component"
FT                   /note="COG3716 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04235"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93477"
FT                   /protein_id="ADV93477.1"
FT                   /translation="MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIK
FT                   KLYGPGAKRNEALQRHLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGL
FT                   MGPIAGVGDPIFWGTIRPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGY
FT                   VKGMEILQDLAGNRIQKLTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQ
FT                   TVQNVLDSIMPGALPLGLTLLVAWMLRKGVNPLLIICGIFVIGILGYWAGFLA"
FT   gene            complement(753642..754451)
FT                   /locus_tag="BSn5_04240"
FT   CDS_pept        complement(753642..754451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04240"
FT                   /product="PTS system mannose-specific transporter subunit
FT                   IIC"
FT                   /note="COG3715 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04240"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93478"
FT                   /protein_id="ADV93478.1"
FT                   /translation="MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLK
FT                   TGIILGGTLELMALGWMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAG
FT                   QALTIFVRTITVFFIHRADQYAKAGNIKGIEIMHITAMVFQALRVMIPTLIVALISVSA
FT                   VQAFLGNIPDVITKGLQIGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLV
FT                   GFGALGLCLALLYQQVMQKQSAHGAVAAASDSGSVAVYDDDDDDLDA"
FT   gene            complement(754468..754956)
FT                   /locus_tag="BSn5_04245"
FT   CDS_pept        complement(754468..754956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04245"
FT                   /product="phosphotransferase system (PTS) fructose-specific
FT                   enzyme IIB component"
FT                   /note="COG3444 Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04245"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93479"
FT                   /protein_id="ADV93479.1"
FT                   /translation="MNIVLARIDDRFIHGQILTRWIKVHAADRIIVVSDDIAQDEMRKT
FT                   LILSVAPSNVKASAVSVSKMAKAFHSPRYEGVTAMLLFENPSDIVSLIEAGVPIKTVNV
FT                   GGMRFENHRRQITKSVSVTEQDIKAFETLSDKGVKLELRQLPSDASEDFVQILRNVTK"
FT   gene            complement(754956..755396)
FT                   /locus_tag="BSn5_04250"
FT   CDS_pept        complement(754956..755396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04250"
FT                   /product="phosphotransferase system (PTS) fructose-specific
FT                   enzyme IIA component"
FT                   /note="COG2893 Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04250"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93480"
FT                   /protein_id="ADV93480.1"
FT                   /translation="MISVIISGHGDFPIALKESSGMIFGEENNLIAVPFFKGEGIQTLQ
FT                   EKYHQALKDIPEEHEVLFLVDIFGGTPYNAAASFIAEDQRMDMAAGVNLPILLEVLSQR
FT                   EHLALKDLLNNLKAMSQQSFQVCSEHLEKVKTANQDTREDEL"
FT   gene            complement(755586..758393)
FT                   /locus_tag="BSn5_04255"
FT   CDS_pept        complement(755586..758393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04255"
FT                   /product="transcriptional regulator (NifA/NtrC family)
FT                   protein"
FT                   /note="COG1221 Transcriptional regulators containing an
FT                   AAA-type ATPase domain and a DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04255"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93481"
FT                   /protein_id="ADV93481.1"
FT                   /translation="MRRIDKIYHQLKHNFQDSTLDHLLKIQGNSAKEIAEQLKMERSNV
FT                   SFELNNLVRSKKVIKIKTFPVRYIPVEIAEKLFNKKWDTEMMEVKDLQAFSGNSKQNHQ
FT                   HISTNPLELMIGAKGSLKKAISQAKAAVFYPPNGLHMLLLGPTGSGKSLFANRIYQFAI
FT                   YSDILKAGAPFITFNCADYYNNPQLLLSQLFGHKKGSFTGAAEDKAGLVEQANGGILFM
FT                   DEIHRLPPEGQEMLFYFIDSGSYNRLGESEHKRTSNVLFICATTENPSSALLKTFLRRI
FT                   PMTIHIPSLEERSLKERVDLTTFLLGKEAERIKKNLSVHIDVYNALIHSAKFGNVGQLK
FT                   SNVQLVCAHGFLHNLDRNEVIELTVRDLPDEIKQEWMSSSKNMQRSKAISEYVNITTII
FT                   SPIVEDETTKIDEDLSFNLYHLIEEKVKTLMKEGLSKKDINQYILTDVHLHVRRFFHHQ
FT                   AFQKDSLLTFVEDDVIQMTKQLKEIAEHELDCTFDRKFIYFLSMHIDAFLKRGKQIDVL
FT                   NTQETDEIRDTHVKEYRVAMIFKDKIQEYFKVAIPEIEVIYLTMLIHSIKSLKENKRVG
FT                   IIVAAHGNSTASSMVEVATELLGSTPIAAVDMPLTVSPSDILECVAEKMKQVDEGEGVL
FT                   MLVDMGSLAMLESRLEEKTGISIKTISNVTTSMVLDAVRKVNYLNLNLQAIYQSVTKDF
FT                   IELWERQPAASGKKKALVSICTTGSGTAKKLEDILTTIVNKASDTPIHILTVSSIKLAN
FT                   SIKEIEKEYEILATVGTKDPKINAPHVSLEVLIEGEGEKLIQQAITKGSIPLSNGLNEA
FT                   NIIVRELCEDSLKKYLVFLNPHHVIEMLLEWLQTVQDELGVIFNNAVLIKVIMHTAFAF
FT                   ERVIKQNPIAFSEEEEINDQLKEMVYVTERTLAPYEEKLGLRISDDEKLFIAAIFAEEV
FT                   HGQLF"
FT   gene            759129..760517
FT                   /locus_tag="BSn5_04260"
FT   CDS_pept        759129..760517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04260"
FT                   /product="d-Serine/d-alanine/glycine permease"
FT                   /note="COG1113 Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04260"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93482"
FT                   /protein_id="ADV93482.1"
FT                   /translation="MIGNSSKDNFGQQQKLSRGLKNRHIQLMAIGGAIGTGLFLGSGKS
FT                   IHFAGPSILFAYLITGVFCFFIMRSLGELLLSNAGYHSFVDFVRDYLGNMAAFITGWTY
FT                   WFCWISLAMADLTAVGIYTQYWLPDAPQWLPGLLALIILLIMNLATVKLFGELEFWFAL
FT                   IKVIAILALIVTGIFLIAKGFSAASGPASLTNLWSHGGMFPNGWHGFILSFQMVVFAFV
FT                   GIELVGLTAGETENPQKVIPKAINQIPVRILLFYVGALFVIMCIYPWNVLNPNESPFVQ
FT                   VFSAVGIVVAASLINFVVLTSAASAANSALFSTSRMVYSLAKDHHAPGLLKKLTSSNVP
FT                   SNALFFSSIAILIGVSLNYLMPEQVFTLITSVSTICFIFIWGITVICHLKYRKTRQHEA
FT                   KANKFKMPFYPLSNYLTLAFLAFILVILALADDTRIALFVTPVWFVLLIILYKVQTRRG
FT                   HKMK"
FT   gene            complement(760611..761243)
FT                   /locus_tag="BSn5_04265"
FT   CDS_pept        complement(760611..761243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04265"
FT                   /product="putative efflux transporter"
FT                   /note="COG1280 Putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04265"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93483"
FT                   /protein_id="ADV93483.1"
FT                   /translation="MHSLLAYIPIAAMMVIIPGADTMLVMKNTLRYGPKAGRYNILGLA
FT                   TGLSFWTVIAILGLSVVIAKSVILFTTIKYLGAAYLIYLGVKSFFAKSMFSLDDMQSQA
FT                   KNMASSPKRYYKTSFMQGSLSNILNPKTVLVYVTIMPQFINLNGNINQQLIILASILTL
FT                   LAVLWFLFLVYIIDYAKKWMKNSKFQKVFQKITGIILVGFGIKTGLS"
FT   gene            761397..762224
FT                   /locus_tag="BSn5_04270"
FT   CDS_pept        761397..762224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04270"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1378 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04270"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93484"
FT                   /protein_id="ADV93484.1"
FT                   /translation="MKENMLDILKNLNFTEYESKAYLALLQESPLTGYAVAKKSGVPRS
FT                   KIYEVLESLVLRGDVFVSHGNTPQYVPVPAKELIKNRRLKAEEHFDQAEKYFEKFEQTA
FT                   NDRENIWNITGRSEILEKVKACILSAKKRILLEIWKEDFKEIESELKQAAEQGVIVTII
FT                   AYGDIVSDFANVYLHDMSSEITEEYDGRWLVYSGDDSEVVAGIVSLGNDSRAAWTMHVG
FT                   LVMPITEVIIHDLYLMEILKKHRELLEESFGKNLIQLRRKFSIHSDFKKHYLE"
FT   gene            762920..763777
FT                   /locus_tag="BSn5_04275"
FT   CDS_pept        762920..763777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04275"
FT                   /product="anti-sigma(V) factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04275"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93485"
FT                   /protein_id="ADV93485.1"
FT                   /translation="MDKRLQQLREEYKNVPIPKELDIIVEKALQQEPKKKRIVMWPTSA
FT                   TIAAAIFFTALVNINPDTAQAMSKIPVIGKIVKAITFIEIKEEKDQSSIDVKTPALSGL
FT                   SNKELENSINEKYLKESQQLYKEFIQSTSKNKKGHLSIYSDYETVTDTPDLLSIRRNIE
FT                   KTQASSYTQSRYITIDKKNDILLTLKSLFKDERYIKVISQNIREQMKQQMKEDPNKIYW
FT                   LTDEDAEPFKTILPDQTFYITEDHKLVISFDEYEVAPGYMGVTEFTIPTSVISNLLVGE
FT                   RYIR"
FT   misc_feature    763888..765793
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|16079768|ref|NP_390592.1| peptidoglycan
FT                   O-acetyltransferase"
FT   gene            765927..766151
FT                   /locus_tag="BSn5_04290"
FT   CDS_pept        765927..766151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04290"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93486"
FT                   /protein_id="ADV93486.1"
FT                   /translation="MKGNKEHDIQKELKRYEFFFQKRYKVLYTVNDFIIGAMFLVGSFF
FT                   FFYGQLFIENTLSVNTGTSSQQNDRFFTK"
FT   gene            complement(767034..768023)
FT                   /locus_tag="BSn5_04295"
FT   CDS_pept        complement(767034..768023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04295"
FT                   /product="hypothetical protein"
FT                   /note="COG1503 Peptide chain release factor 1 (eRF1)"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04295"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93487"
FT                   /protein_id="ADV93487.1"
FT                   /translation="MILDIKPYNRAGYDCMNLSVTNILFYKNYPHSNSVWKQSGLIYYI
FT                   DEKYGIGNLEGSYLTRVQELEWIHNIKVKTIKHKYKNDFLSGIINLLRENEPVLVPVDT
FT                   YYTRGNMYYQTRHTPHIITIIGYEESLFTYVDDAYGSIAELKPKELIEANSMNLKYMYI
FT                   KLPEENYLTKEILLEPIKHNNNNLRGIISTSNIPDVPGVIKEFGLSGLEKFLDFYYEHN
FT                   IDDTFNQSEEKIMEIYRGLSAVSNSRYKYADYLFDISVYYPEIKNIAEAYLFIGQDWKV
FT                   SANMVLKSTMNNRLNLIQRMLDKVELIMEKEKETLRMSEEIHSIICNK"
FT   gene            complement(768023..768586)
FT                   /locus_tag="BSn5_04300"
FT   CDS_pept        complement(768023..768586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04300"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93488"
FT                   /protein_id="ADV93488.1"
FT                   /translation="MGKYEMINLEELFNNKGISRMNNPQDANFTGFGSSYISENLPSSR
FT                   SVLELYGVPFLFPNKDPLVVDNLEFMNQEIQIKEAYYSNIHVLGAADNGSFIEPIKLVG
FT                   NDIKEVKIGLTDWIESSPKFNNKKGIICEGINSNKSGYTRTVKTNIWYSVVGIPSNSLF
FT                   KSILLVDNPSMHIFSLTLEKDGCL"
FT   gene            complement(768626..769801)
FT                   /locus_tag="BSn5_04305"
FT   CDS_pept        complement(768626..769801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04305"
FT                   /product="Oxidoreductase-like protein"
FT                   /note="COG0673 Predicted dehydrogenases and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04305"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93489"
FT                   /protein_id="ADV93489.1"
FT                   /translation="MLSIALIGMGSAGSRFLRAILYREKIKGDVKLVAICDRNRERLEN
FT                   FYNTNIKTYQKVNDLLINGAYDIIVIATNENSHFNILKDIKKYSTKYKRILVEKLLVEK
FT                   FNQVRDILSIYDENEIAVHFVERHSLILKYLLNWMQTNNLTVKRASFFWGKFRLYDHRP
FT                   TIGVTSEISHPIDLILMISNIKPGTPFEILGGTYVYSDFSISGKQVLDTINVNLKIGNE
FT                   ILVNGSSSFLWEKRRRNVQFYLANSEGIVTYMVVLIFDKPHWDMDICRVYKVNLPYGRK
FT                   RLINTWKVNSNKIISELFCVHKTSIFIDENVNEIKGLRESFTLAKLSSSAYVQEIVSSL
FT                   HSHSELNLIDTPIFGEKTFNLNHYKKVDEAVKDYLTGKIRGNDFAKTDENF"
FT   gene            complement(769835..771073)
FT                   /locus_tag="BSn5_04310"
FT   CDS_pept        complement(769835..771073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSn5_04310"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:BSn5_04310"
FT                   /db_xref="EnsemblGenomes-Tr:ADV93490"
FT                   /protein_id="ADV93490.1"
FT                   /translation="MKMKFKEWFYQNEDRIISNLFSYLSIDTSSPHEHRALNFIRDYLN
FT                   EVGFIIEKQHLHKDLELHSAFVKTNQSVINSERFNIKAFKYSKNNSLKSVLFNIHIDVV
FT                   PATVDFPHAFSPYIKNSYIYGRGACDTKSNLIMLIEAIRFLQENNIKINKEIAIDLVIE
FT                   EEVSSNGTISSILHGVEADSIIVMEPTNLLVYRGHRGCITANITVKGKAVHMGSKEAGV
FT                   NAIESAYNIVNRLKCLELELLEEAKNNQAFSIWDMPVQINIGKINGGEWAGSVPEYCEL
FT                   ICNIG