(data stored in SCRATCH3701 zone)

EMBL: CP002505

ID   CP002505; SV 1; circular; genomic DNA; STD; PRO; 4864217 BP.
AC   CP002505;
PR   Project:PRJNA50601;
DT   03-FEB-2011 (Rel. 107, Created)
DT   08-JAN-2015 (Rel. 123, Last updated, Version 5)
DE   Rahnella sp. Y9602, complete genome.
KW   GSC:MIGS:2.1.
OS   Rahnella sp. Y9602
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Rahnella; unclassified Rahnella.
RN   [1]
RP   1-4864217
RX   DOI; 10.1128/JB.00095-12.
RX   PUBMED; 22461551.
RA   Martinez R.J., Bruce D., Detter C., Goodwin L.A., Han J., Han C.S.,
RA   Held B., Land M.L., Mikhailova N., Nolan M., Pennacchio L., Pitluck S.,
RA   Tapia R., Woyke T., Sobecky P.A.;
RT   "Complete Genome Sequence of Rahnella sp. Strain Y9602, a
RT   Gammaproteobacterium Isolate from Metal- and Radionuclide-Contaminated
RT   Soil";
RL   J. Bacteriol. 194(8):2113-2114(2012).
RN   [2]
RP   1-4864217
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Goodwin L., Pitluck S.,
RA   Lu M., Detter J.C., Han C., Tapia R., Land M., Hauser L., Kyrpides N.,
RA   Ivanova N., Ovchinnikova G., Pagani I., Sobecky P.A., Martinez R.J.,
RA   Woyke T.;
RT   "Complete sequence of chromosome of Rahnella sp. Y9602";
RL   Unpublished.
RN   [3]
RP   1-4864217
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Goodwin L., Pitluck S.,
RA   Lu M., Detter J.C., Han C., Tapia R., Land M., Hauser L., Kyrpides N.,
RA   Ivanova N., Ovchinnikova G., Pagani I., Sobecky P.A., Martinez R.J.,
RA   Woyke T.;
RT   ;
RL   Submitted (28-JAN-2011) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
DR   MD5; 27ddcce0d1016a28aaaef069ca671e1a.
DR   BioSample; SAMN00713582.
DR   EnsemblGenomes-Gn; EBG00001455210.
DR   EnsemblGenomes-Gn; EBG00001455211.
DR   EnsemblGenomes-Gn; EBG00001455212.
DR   EnsemblGenomes-Gn; EBG00001455213.
DR   EnsemblGenomes-Gn; EBG00001455214.
DR   EnsemblGenomes-Gn; EBG00001455215.
DR   EnsemblGenomes-Gn; EBG00001455216.
DR   EnsemblGenomes-Gn; EBG00001455217.
DR   EnsemblGenomes-Gn; EBG00001455218.
DR   EnsemblGenomes-Gn; EBG00001455219.
DR   EnsemblGenomes-Gn; EBG00001455220.
DR   EnsemblGenomes-Gn; EBG00001455221.
DR   EnsemblGenomes-Gn; EBG00001455222.
DR   EnsemblGenomes-Gn; EBG00001455223.
DR   EnsemblGenomes-Gn; EBG00001455224.
DR   EnsemblGenomes-Gn; EBG00001455225.
DR   EnsemblGenomes-Gn; EBG00001455226.
DR   EnsemblGenomes-Gn; EBG00001455227.
DR   EnsemblGenomes-Gn; EBG00001455228.
DR   EnsemblGenomes-Gn; EBG00001455229.
DR   EnsemblGenomes-Gn; EBG00001455230.
DR   EnsemblGenomes-Gn; EBG00001455231.
DR   EnsemblGenomes-Gn; EBG00001455232.
DR   EnsemblGenomes-Gn; EBG00001455233.
DR   EnsemblGenomes-Gn; EBG00001455234.
DR   EnsemblGenomes-Gn; EBG00001455235.
DR   EnsemblGenomes-Gn; EBG00001455236.
DR   EnsemblGenomes-Gn; EBG00001455237.
DR   EnsemblGenomes-Gn; EBG00001455238.
DR   EnsemblGenomes-Gn; EBG00001455239.
DR   EnsemblGenomes-Gn; EBG00001455240.
DR   EnsemblGenomes-Gn; EBG00001455241.
DR   EnsemblGenomes-Gn; EBG00001455242.
DR   EnsemblGenomes-Gn; EBG00001455243.
DR   EnsemblGenomes-Gn; EBG00001455244.
DR   EnsemblGenomes-Gn; EBG00001455245.
DR   EnsemblGenomes-Gn; EBG00001455246.
DR   EnsemblGenomes-Gn; EBG00001455247.
DR   EnsemblGenomes-Gn; EBG00001455248.
DR   EnsemblGenomes-Gn; EBG00001455249.
DR   EnsemblGenomes-Gn; EBG00001455250.
DR   EnsemblGenomes-Gn; EBG00001455251.
DR   EnsemblGenomes-Gn; EBG00001455252.
DR   EnsemblGenomes-Gn; EBG00001455253.
DR   EnsemblGenomes-Gn; EBG00001455254.
DR   EnsemblGenomes-Gn; EBG00001455255.
DR   EnsemblGenomes-Gn; EBG00001455257.
DR   EnsemblGenomes-Gn; EBG00001455258.
DR   EnsemblGenomes-Gn; EBG00001455260.
DR   EnsemblGenomes-Gn; EBG00001455262.
DR   EnsemblGenomes-Gn; EBG00001455264.
DR   EnsemblGenomes-Gn; EBG00001455266.
DR   EnsemblGenomes-Gn; EBG00001455267.
DR   EnsemblGenomes-Gn; EBG00001455269.
DR   EnsemblGenomes-Gn; EBG00001455271.
DR   EnsemblGenomes-Gn; EBG00001455273.
DR   EnsemblGenomes-Gn; EBG00001455274.
DR   EnsemblGenomes-Gn; EBG00001455275.
DR   EnsemblGenomes-Gn; EBG00001455276.
DR   EnsemblGenomes-Gn; EBG00001455277.
DR   EnsemblGenomes-Gn; EBG00001455280.
DR   EnsemblGenomes-Gn; EBG00001455284.
DR   EnsemblGenomes-Gn; EBG00001455288.
DR   EnsemblGenomes-Gn; EBG00001455289.
DR   EnsemblGenomes-Gn; EBG00001455290.
DR   EnsemblGenomes-Gn; EBG00001455292.
DR   EnsemblGenomes-Gn; EBG00001455294.
DR   EnsemblGenomes-Gn; EBG00001455295.
DR   EnsemblGenomes-Gn; EBG00001455297.
DR   EnsemblGenomes-Gn; EBG00001455299.
DR   EnsemblGenomes-Gn; EBG00001455300.
DR   EnsemblGenomes-Gn; EBG00001455302.
DR   EnsemblGenomes-Gn; EBG00001455304.
DR   EnsemblGenomes-Gn; EBG00001455306.
DR   EnsemblGenomes-Gn; EBG00001455308.
DR   EnsemblGenomes-Gn; EBG00001455310.
DR   EnsemblGenomes-Gn; EBG00001455312.
DR   EnsemblGenomes-Gn; EBG00001455314.
DR   EnsemblGenomes-Gn; EBG00001455316.
DR   EnsemblGenomes-Gn; EBG00001455318.
DR   EnsemblGenomes-Gn; EBG00001455319.
DR   EnsemblGenomes-Gn; EBG00001455320.
DR   EnsemblGenomes-Gn; EBG00001455321.
DR   EnsemblGenomes-Gn; EBG00001455323.
DR   EnsemblGenomes-Gn; EBG00001455325.
DR   EnsemblGenomes-Gn; EBG00001455327.
DR   EnsemblGenomes-Gn; EBG00001455329.
DR   EnsemblGenomes-Gn; EBG00001455330.
DR   EnsemblGenomes-Gn; EBG00001455331.
DR   EnsemblGenomes-Gn; EBG00001455332.
DR   EnsemblGenomes-Gn; EBG00001455334.
DR   EnsemblGenomes-Gn; EBG00001455336.
DR   EnsemblGenomes-Gn; EBG00001455338.
DR   EnsemblGenomes-Gn; EBG00001455340.
DR   EnsemblGenomes-Gn; EBG00001455343.
DR   EnsemblGenomes-Gn; EBG00001455345.
DR   EnsemblGenomes-Gn; EBG00001455346.
DR   EnsemblGenomes-Gn; EBG00001455348.
DR   EnsemblGenomes-Gn; EBG00001455350.
DR   EnsemblGenomes-Gn; EBG00001455352.
DR   EnsemblGenomes-Gn; EBG00001455354.
DR   EnsemblGenomes-Gn; EBG00001455356.
DR   EnsemblGenomes-Gn; EBG00001455358.
DR   EnsemblGenomes-Gn; EBG00001455360.
DR   EnsemblGenomes-Gn; EBG00001455361.
DR   EnsemblGenomes-Gn; EBG00001455363.
DR   EnsemblGenomes-Gn; EBG00001455366.
DR   EnsemblGenomes-Gn; EBG00001455367.
DR   EnsemblGenomes-Gn; EBG00001455369.
DR   EnsemblGenomes-Gn; EBG00001455371.
DR   EnsemblGenomes-Gn; EBG00001455373.
DR   EnsemblGenomes-Gn; EBG00001455374.
DR   EnsemblGenomes-Gn; EBG00001455376.
DR   EnsemblGenomes-Gn; EBG00001455378.
DR   EnsemblGenomes-Gn; EBG00001455380.
DR   EnsemblGenomes-Gn; EBG00001455382.
DR   EnsemblGenomes-Gn; EBG00001455383.
DR   EnsemblGenomes-Gn; EBG00001455384.
DR   EnsemblGenomes-Gn; EBG00001455385.
DR   EnsemblGenomes-Gn; EBG00001455386.
DR   EnsemblGenomes-Gn; EBG00001455388.
DR   EnsemblGenomes-Gn; EBG00001455390.
DR   EnsemblGenomes-Gn; EBG00001455393.
DR   EnsemblGenomes-Gn; EBG00001455394.
DR   EnsemblGenomes-Gn; EBG00001455395.
DR   EnsemblGenomes-Gn; EBG00001455396.
DR   EnsemblGenomes-Gn; EBG00001455397.
DR   EnsemblGenomes-Gn; EBG00001455399.
DR   EnsemblGenomes-Gn; EBG00001455401.
DR   EnsemblGenomes-Gn; EBG00001455402.
DR   EnsemblGenomes-Gn; EBG00001455404.
DR   EnsemblGenomes-Gn; EBG00001455405.
DR   EnsemblGenomes-Gn; EBG00001455407.
DR   EnsemblGenomes-Gn; EBG00001455409.
DR   EnsemblGenomes-Gn; EBG00001455411.
DR   EnsemblGenomes-Gn; EBG00001455413.
DR   EnsemblGenomes-Gn; EBG00001455415.
DR   EnsemblGenomes-Gn; EBG00001455417.
DR   EnsemblGenomes-Gn; EBG00001455418.
DR   EnsemblGenomes-Gn; EBG00001455420.
DR   EnsemblGenomes-Gn; EBG00001455422.
DR   EnsemblGenomes-Gn; EBG00001455423.
DR   EnsemblGenomes-Gn; EBG00001455425.
DR   EnsemblGenomes-Gn; EBG00001455427.
DR   EnsemblGenomes-Gn; EBG00001455429.
DR   EnsemblGenomes-Gn; EBG00001455431.
DR   EnsemblGenomes-Gn; EBG00001455433.
DR   EnsemblGenomes-Gn; EBG00001455435.
DR   EnsemblGenomes-Gn; EBG00001455437.
DR   EnsemblGenomes-Gn; EBG00001455438.
DR   EnsemblGenomes-Gn; EBG00001455439.
DR   EnsemblGenomes-Gn; EBG00001455440.
DR   EnsemblGenomes-Gn; EBG00001455441.
DR   EnsemblGenomes-Gn; Rahaq_R0001.
DR   EnsemblGenomes-Gn; Rahaq_R0002.
DR   EnsemblGenomes-Gn; Rahaq_R0003.
DR   EnsemblGenomes-Gn; Rahaq_R0004.
DR   EnsemblGenomes-Gn; Rahaq_R0005.
DR   EnsemblGenomes-Gn; Rahaq_R0006.
DR   EnsemblGenomes-Gn; Rahaq_R0007.
DR   EnsemblGenomes-Gn; Rahaq_R0008.
DR   EnsemblGenomes-Gn; Rahaq_R0009.
DR   EnsemblGenomes-Gn; Rahaq_R0010.
DR   EnsemblGenomes-Gn; Rahaq_R0011.
DR   EnsemblGenomes-Gn; Rahaq_R0012.
DR   EnsemblGenomes-Gn; Rahaq_R0013.
DR   EnsemblGenomes-Gn; Rahaq_R0014.
DR   EnsemblGenomes-Gn; Rahaq_R0015.
DR   EnsemblGenomes-Gn; Rahaq_R0016.
DR   EnsemblGenomes-Gn; Rahaq_R0017.
DR   EnsemblGenomes-Gn; Rahaq_R0018.
DR   EnsemblGenomes-Gn; Rahaq_R0019.
DR   EnsemblGenomes-Gn; Rahaq_R0020.
DR   EnsemblGenomes-Gn; Rahaq_R0021.
DR   EnsemblGenomes-Gn; Rahaq_R0022.
DR   EnsemblGenomes-Gn; Rahaq_R0023.
DR   EnsemblGenomes-Gn; Rahaq_R0024.
DR   EnsemblGenomes-Gn; Rahaq_R0025.
DR   EnsemblGenomes-Gn; Rahaq_R0026.
DR   EnsemblGenomes-Gn; Rahaq_R0027.
DR   EnsemblGenomes-Gn; Rahaq_R0028.
DR   EnsemblGenomes-Gn; Rahaq_R0029.
DR   EnsemblGenomes-Gn; Rahaq_R0030.
DR   EnsemblGenomes-Gn; Rahaq_R0031.
DR   EnsemblGenomes-Gn; Rahaq_R0032.
DR   EnsemblGenomes-Gn; Rahaq_R0033.
DR   EnsemblGenomes-Gn; Rahaq_R0034.
DR   EnsemblGenomes-Gn; Rahaq_R0035.
DR   EnsemblGenomes-Gn; Rahaq_R0036.
DR   EnsemblGenomes-Gn; Rahaq_R0037.
DR   EnsemblGenomes-Gn; Rahaq_R0038.
DR   EnsemblGenomes-Gn; Rahaq_R0039.
DR   EnsemblGenomes-Gn; Rahaq_R0040.
DR   EnsemblGenomes-Gn; Rahaq_R0041.
DR   EnsemblGenomes-Gn; Rahaq_R0042.
DR   EnsemblGenomes-Gn; Rahaq_R0043.
DR   EnsemblGenomes-Gn; Rahaq_R0044.
DR   EnsemblGenomes-Gn; Rahaq_R0045.
DR   EnsemblGenomes-Gn; Rahaq_R0046.
DR   EnsemblGenomes-Gn; Rahaq_R0047.
DR   EnsemblGenomes-Gn; Rahaq_R0048.
DR   EnsemblGenomes-Gn; Rahaq_R0049.
DR   EnsemblGenomes-Gn; Rahaq_R0050.
DR   EnsemblGenomes-Gn; Rahaq_R0051.
DR   EnsemblGenomes-Gn; Rahaq_R0052.
DR   EnsemblGenomes-Gn; Rahaq_R0053.
DR   EnsemblGenomes-Gn; Rahaq_R0054.
DR   EnsemblGenomes-Gn; Rahaq_R0055.
DR   EnsemblGenomes-Gn; Rahaq_R0056.
DR   EnsemblGenomes-Gn; Rahaq_R0057.
DR   EnsemblGenomes-Gn; Rahaq_R0058.
DR   EnsemblGenomes-Gn; Rahaq_R0059.
DR   EnsemblGenomes-Gn; Rahaq_R0060.
DR   EnsemblGenomes-Gn; Rahaq_R0061.
DR   EnsemblGenomes-Gn; Rahaq_R0062.
DR   EnsemblGenomes-Gn; Rahaq_R0063.
DR   EnsemblGenomes-Gn; Rahaq_R0064.
DR   EnsemblGenomes-Gn; Rahaq_R0065.
DR   EnsemblGenomes-Gn; Rahaq_R0066.
DR   EnsemblGenomes-Gn; Rahaq_R0067.
DR   EnsemblGenomes-Gn; Rahaq_R0068.
DR   EnsemblGenomes-Gn; Rahaq_R0069.
DR   EnsemblGenomes-Gn; Rahaq_R0070.
DR   EnsemblGenomes-Gn; Rahaq_R0071.
DR   EnsemblGenomes-Gn; Rahaq_R0072.
DR   EnsemblGenomes-Gn; Rahaq_R0073.
DR   EnsemblGenomes-Gn; Rahaq_R0074.
DR   EnsemblGenomes-Gn; Rahaq_R0075.
DR   EnsemblGenomes-Gn; Rahaq_R0076.
DR   EnsemblGenomes-Gn; Rahaq_R0077.
DR   EnsemblGenomes-Gn; Rahaq_R0078.
DR   EnsemblGenomes-Gn; Rahaq_R0079.
DR   EnsemblGenomes-Gn; Rahaq_R0080.
DR   EnsemblGenomes-Gn; Rahaq_R0081.
DR   EnsemblGenomes-Gn; Rahaq_R0082.
DR   EnsemblGenomes-Gn; Rahaq_R0083.
DR   EnsemblGenomes-Gn; Rahaq_R0084.
DR   EnsemblGenomes-Gn; Rahaq_R0085.
DR   EnsemblGenomes-Gn; Rahaq_R0086.
DR   EnsemblGenomes-Gn; Rahaq_R0087.
DR   EnsemblGenomes-Gn; Rahaq_R0088.
DR   EnsemblGenomes-Gn; Rahaq_R0089.
DR   EnsemblGenomes-Gn; Rahaq_R0090.
DR   EnsemblGenomes-Gn; Rahaq_R0091.
DR   EnsemblGenomes-Gn; Rahaq_R0092.
DR   EnsemblGenomes-Gn; Rahaq_R0093.
DR   EnsemblGenomes-Gn; Rahaq_R0094.
DR   EnsemblGenomes-Gn; Rahaq_R0095.
DR   EnsemblGenomes-Gn; Rahaq_R0096.
DR   EnsemblGenomes-Gn; Rahaq_R0097.
DR   EnsemblGenomes-Gn; Rahaq_R0098.
DR   EnsemblGenomes-Gn; Rahaq_R0099.
DR   EnsemblGenomes-Gn; Rahaq_R0100.
DR   EnsemblGenomes-Gn; Rahaq_R0101.
DR   EnsemblGenomes-Gn; Rahaq_R0102.
DR   EnsemblGenomes-Tr; EBT00001609007.
DR   EnsemblGenomes-Tr; EBT00001609008.
DR   EnsemblGenomes-Tr; EBT00001609009.
DR   EnsemblGenomes-Tr; EBT00001609010.
DR   EnsemblGenomes-Tr; EBT00001609011.
DR   EnsemblGenomes-Tr; EBT00001609012.
DR   EnsemblGenomes-Tr; EBT00001609013.
DR   EnsemblGenomes-Tr; EBT00001609014.
DR   EnsemblGenomes-Tr; EBT00001609015.
DR   EnsemblGenomes-Tr; EBT00001609016.
DR   EnsemblGenomes-Tr; EBT00001609017.
DR   EnsemblGenomes-Tr; EBT00001609018.
DR   EnsemblGenomes-Tr; EBT00001609019.
DR   EnsemblGenomes-Tr; EBT00001609020.
DR   EnsemblGenomes-Tr; EBT00001609021.
DR   EnsemblGenomes-Tr; EBT00001609022.
DR   EnsemblGenomes-Tr; EBT00001609023.
DR   EnsemblGenomes-Tr; EBT00001609024.
DR   EnsemblGenomes-Tr; EBT00001609025.
DR   EnsemblGenomes-Tr; EBT00001609026.
DR   EnsemblGenomes-Tr; EBT00001609027.
DR   EnsemblGenomes-Tr; EBT00001609028.
DR   EnsemblGenomes-Tr; EBT00001609029.
DR   EnsemblGenomes-Tr; EBT00001609030.
DR   EnsemblGenomes-Tr; EBT00001609031.
DR   EnsemblGenomes-Tr; EBT00001609032.
DR   EnsemblGenomes-Tr; EBT00001609033.
DR   EnsemblGenomes-Tr; EBT00001609034.
DR   EnsemblGenomes-Tr; EBT00001609035.
DR   EnsemblGenomes-Tr; EBT00001609036.
DR   EnsemblGenomes-Tr; EBT00001609037.
DR   EnsemblGenomes-Tr; EBT00001609038.
DR   EnsemblGenomes-Tr; EBT00001609039.
DR   EnsemblGenomes-Tr; EBT00001609040.
DR   EnsemblGenomes-Tr; EBT00001609041.
DR   EnsemblGenomes-Tr; EBT00001609042.
DR   EnsemblGenomes-Tr; EBT00001609043.
DR   EnsemblGenomes-Tr; EBT00001609044.
DR   EnsemblGenomes-Tr; EBT00001609045.
DR   EnsemblGenomes-Tr; EBT00001609046.
DR   EnsemblGenomes-Tr; EBT00001609047.
DR   EnsemblGenomes-Tr; EBT00001609048.
DR   EnsemblGenomes-Tr; EBT00001609049.
DR   EnsemblGenomes-Tr; EBT00001609050.
DR   EnsemblGenomes-Tr; EBT00001609051.
DR   EnsemblGenomes-Tr; EBT00001609052.
DR   EnsemblGenomes-Tr; EBT00001609053.
DR   EnsemblGenomes-Tr; EBT00001609054.
DR   EnsemblGenomes-Tr; EBT00001609055.
DR   EnsemblGenomes-Tr; EBT00001609056.
DR   EnsemblGenomes-Tr; EBT00001609057.
DR   EnsemblGenomes-Tr; EBT00001609058.
DR   EnsemblGenomes-Tr; EBT00001609059.
DR   EnsemblGenomes-Tr; EBT00001609060.
DR   EnsemblGenomes-Tr; EBT00001609061.
DR   EnsemblGenomes-Tr; EBT00001609062.
DR   EnsemblGenomes-Tr; EBT00001609063.
DR   EnsemblGenomes-Tr; EBT00001609064.
DR   EnsemblGenomes-Tr; EBT00001609065.
DR   EnsemblGenomes-Tr; EBT00001609066.
DR   EnsemblGenomes-Tr; EBT00001609067.
DR   EnsemblGenomes-Tr; EBT00001609068.
DR   EnsemblGenomes-Tr; EBT00001609069.
DR   EnsemblGenomes-Tr; EBT00001609070.
DR   EnsemblGenomes-Tr; EBT00001609071.
DR   EnsemblGenomes-Tr; EBT00001609072.
DR   EnsemblGenomes-Tr; EBT00001609073.
DR   EnsemblGenomes-Tr; EBT00001609074.
DR   EnsemblGenomes-Tr; EBT00001609075.
DR   EnsemblGenomes-Tr; EBT00001609076.
DR   EnsemblGenomes-Tr; EBT00001609077.
DR   EnsemblGenomes-Tr; EBT00001609078.
DR   EnsemblGenomes-Tr; EBT00001609079.
DR   EnsemblGenomes-Tr; EBT00001609080.
DR   EnsemblGenomes-Tr; EBT00001609081.
DR   EnsemblGenomes-Tr; EBT00001609082.
DR   EnsemblGenomes-Tr; EBT00001609083.
DR   EnsemblGenomes-Tr; EBT00001609084.
DR   EnsemblGenomes-Tr; EBT00001609085.
DR   EnsemblGenomes-Tr; EBT00001609086.
DR   EnsemblGenomes-Tr; EBT00001609087.
DR   EnsemblGenomes-Tr; EBT00001609088.
DR   EnsemblGenomes-Tr; EBT00001609089.
DR   EnsemblGenomes-Tr; EBT00001609090.
DR   EnsemblGenomes-Tr; EBT00001609091.
DR   EnsemblGenomes-Tr; EBT00001609092.
DR   EnsemblGenomes-Tr; EBT00001609093.
DR   EnsemblGenomes-Tr; EBT00001609094.
DR   EnsemblGenomes-Tr; EBT00001609095.
DR   EnsemblGenomes-Tr; EBT00001609096.
DR   EnsemblGenomes-Tr; EBT00001609097.
DR   EnsemblGenomes-Tr; EBT00001609098.
DR   EnsemblGenomes-Tr; EBT00001609099.
DR   EnsemblGenomes-Tr; EBT00001609100.
DR   EnsemblGenomes-Tr; EBT00001609101.
DR   EnsemblGenomes-Tr; EBT00001609102.
DR   EnsemblGenomes-Tr; EBT00001609103.
DR   EnsemblGenomes-Tr; EBT00001609104.
DR   EnsemblGenomes-Tr; EBT00001609105.
DR   EnsemblGenomes-Tr; EBT00001609106.
DR   EnsemblGenomes-Tr; EBT00001609107.
DR   EnsemblGenomes-Tr; EBT00001609108.
DR   EnsemblGenomes-Tr; EBT00001609109.
DR   EnsemblGenomes-Tr; EBT00001609110.
DR   EnsemblGenomes-Tr; EBT00001609111.
DR   EnsemblGenomes-Tr; EBT00001609112.
DR   EnsemblGenomes-Tr; EBT00001609113.
DR   EnsemblGenomes-Tr; EBT00001609114.
DR   EnsemblGenomes-Tr; EBT00001609115.
DR   EnsemblGenomes-Tr; EBT00001609116.
DR   EnsemblGenomes-Tr; EBT00001609117.
DR   EnsemblGenomes-Tr; EBT00001609118.
DR   EnsemblGenomes-Tr; EBT00001609119.
DR   EnsemblGenomes-Tr; EBT00001609120.
DR   EnsemblGenomes-Tr; EBT00001609121.
DR   EnsemblGenomes-Tr; EBT00001609122.
DR   EnsemblGenomes-Tr; EBT00001609123.
DR   EnsemblGenomes-Tr; EBT00001609124.
DR   EnsemblGenomes-Tr; EBT00001609125.
DR   EnsemblGenomes-Tr; EBT00001609126.
DR   EnsemblGenomes-Tr; EBT00001609127.
DR   EnsemblGenomes-Tr; EBT00001609128.
DR   EnsemblGenomes-Tr; EBT00001609129.
DR   EnsemblGenomes-Tr; EBT00001609130.
DR   EnsemblGenomes-Tr; EBT00001609131.
DR   EnsemblGenomes-Tr; EBT00001609132.
DR   EnsemblGenomes-Tr; EBT00001609133.
DR   EnsemblGenomes-Tr; EBT00001609134.
DR   EnsemblGenomes-Tr; EBT00001609135.
DR   EnsemblGenomes-Tr; EBT00001609136.
DR   EnsemblGenomes-Tr; EBT00001609137.
DR   EnsemblGenomes-Tr; EBT00001609138.
DR   EnsemblGenomes-Tr; EBT00001609139.
DR   EnsemblGenomes-Tr; EBT00001609140.
DR   EnsemblGenomes-Tr; EBT00001609141.
DR   EnsemblGenomes-Tr; EBT00001609142.
DR   EnsemblGenomes-Tr; EBT00001609143.
DR   EnsemblGenomes-Tr; EBT00001609144.
DR   EnsemblGenomes-Tr; EBT00001609145.
DR   EnsemblGenomes-Tr; EBT00001609146.
DR   EnsemblGenomes-Tr; EBT00001609147.
DR   EnsemblGenomes-Tr; EBT00001609148.
DR   EnsemblGenomes-Tr; EBT00001609149.
DR   EnsemblGenomes-Tr; EBT00001609150.
DR   EnsemblGenomes-Tr; EBT00001609151.
DR   EnsemblGenomes-Tr; EBT00001609152.
DR   EnsemblGenomes-Tr; EBT00001609153.
DR   EnsemblGenomes-Tr; EBT00001609154.
DR   EnsemblGenomes-Tr; EBT00001609155.
DR   EnsemblGenomes-Tr; EBT00001609156.
DR   EnsemblGenomes-Tr; EBT00001609157.
DR   EnsemblGenomes-Tr; EBT00001609158.
DR   EnsemblGenomes-Tr; EBT00001609159.
DR   EnsemblGenomes-Tr; Rahaq_R0001-1.
DR   EnsemblGenomes-Tr; Rahaq_R0002-1.
DR   EnsemblGenomes-Tr; Rahaq_R0003-1.
DR   EnsemblGenomes-Tr; Rahaq_R0004-1.
DR   EnsemblGenomes-Tr; Rahaq_R0005-1.
DR   EnsemblGenomes-Tr; Rahaq_R0006-1.
DR   EnsemblGenomes-Tr; Rahaq_R0007-1.
DR   EnsemblGenomes-Tr; Rahaq_R0008-1.
DR   EnsemblGenomes-Tr; Rahaq_R0009-1.
DR   EnsemblGenomes-Tr; Rahaq_R0010-1.
DR   EnsemblGenomes-Tr; Rahaq_R0011-1.
DR   EnsemblGenomes-Tr; Rahaq_R0012-1.
DR   EnsemblGenomes-Tr; Rahaq_R0013-1.
DR   EnsemblGenomes-Tr; Rahaq_R0014-1.
DR   EnsemblGenomes-Tr; Rahaq_R0015-1.
DR   EnsemblGenomes-Tr; Rahaq_R0016-1.
DR   EnsemblGenomes-Tr; Rahaq_R0017-1.
DR   EnsemblGenomes-Tr; Rahaq_R0018-1.
DR   EnsemblGenomes-Tr; Rahaq_R0019-1.
DR   EnsemblGenomes-Tr; Rahaq_R0020-1.
DR   EnsemblGenomes-Tr; Rahaq_R0021-1.
DR   EnsemblGenomes-Tr; Rahaq_R0022-1.
DR   EnsemblGenomes-Tr; Rahaq_R0023-1.
DR   EnsemblGenomes-Tr; Rahaq_R0024-1.
DR   EnsemblGenomes-Tr; Rahaq_R0025-1.
DR   EnsemblGenomes-Tr; Rahaq_R0026-1.
DR   EnsemblGenomes-Tr; Rahaq_R0027-1.
DR   EnsemblGenomes-Tr; Rahaq_R0028-1.
DR   EnsemblGenomes-Tr; Rahaq_R0029-1.
DR   EnsemblGenomes-Tr; Rahaq_R0030-1.
DR   EnsemblGenomes-Tr; Rahaq_R0031-1.
DR   EnsemblGenomes-Tr; Rahaq_R0032-1.
DR   EnsemblGenomes-Tr; Rahaq_R0033-1.
DR   EnsemblGenomes-Tr; Rahaq_R0034-1.
DR   EnsemblGenomes-Tr; Rahaq_R0035-1.
DR   EnsemblGenomes-Tr; Rahaq_R0036-1.
DR   EnsemblGenomes-Tr; Rahaq_R0037-1.
DR   EnsemblGenomes-Tr; Rahaq_R0038-1.
DR   EnsemblGenomes-Tr; Rahaq_R0039-1.
DR   EnsemblGenomes-Tr; Rahaq_R0040-1.
DR   EnsemblGenomes-Tr; Rahaq_R0041-1.
DR   EnsemblGenomes-Tr; Rahaq_R0042-1.
DR   EnsemblGenomes-Tr; Rahaq_R0043-1.
DR   EnsemblGenomes-Tr; Rahaq_R0044-1.
DR   EnsemblGenomes-Tr; Rahaq_R0045-1.
DR   EnsemblGenomes-Tr; Rahaq_R0046-1.
DR   EnsemblGenomes-Tr; Rahaq_R0047-1.
DR   EnsemblGenomes-Tr; Rahaq_R0048-1.
DR   EnsemblGenomes-Tr; Rahaq_R0049-1.
DR   EnsemblGenomes-Tr; Rahaq_R0050-1.
DR   EnsemblGenomes-Tr; Rahaq_R0051-1.
DR   EnsemblGenomes-Tr; Rahaq_R0052-1.
DR   EnsemblGenomes-Tr; Rahaq_R0053-1.
DR   EnsemblGenomes-Tr; Rahaq_R0054-1.
DR   EnsemblGenomes-Tr; Rahaq_R0055-1.
DR   EnsemblGenomes-Tr; Rahaq_R0056-1.
DR   EnsemblGenomes-Tr; Rahaq_R0057-1.
DR   EnsemblGenomes-Tr; Rahaq_R0058-1.
DR   EnsemblGenomes-Tr; Rahaq_R0059-1.
DR   EnsemblGenomes-Tr; Rahaq_R0060-1.
DR   EnsemblGenomes-Tr; Rahaq_R0061-1.
DR   EnsemblGenomes-Tr; Rahaq_R0062-1.
DR   EnsemblGenomes-Tr; Rahaq_R0063-1.
DR   EnsemblGenomes-Tr; Rahaq_R0064-1.
DR   EnsemblGenomes-Tr; Rahaq_R0065-1.
DR   EnsemblGenomes-Tr; Rahaq_R0066-1.
DR   EnsemblGenomes-Tr; Rahaq_R0067-1.
DR   EnsemblGenomes-Tr; Rahaq_R0068-1.
DR   EnsemblGenomes-Tr; Rahaq_R0069-1.
DR   EnsemblGenomes-Tr; Rahaq_R0070-1.
DR   EnsemblGenomes-Tr; Rahaq_R0071-1.
DR   EnsemblGenomes-Tr; Rahaq_R0072-1.
DR   EnsemblGenomes-Tr; Rahaq_R0073-1.
DR   EnsemblGenomes-Tr; Rahaq_R0074-1.
DR   EnsemblGenomes-Tr; Rahaq_R0075-1.
DR   EnsemblGenomes-Tr; Rahaq_R0076-1.
DR   EnsemblGenomes-Tr; Rahaq_R0077-1.
DR   EnsemblGenomes-Tr; Rahaq_R0078-1.
DR   EnsemblGenomes-Tr; Rahaq_R0079-1.
DR   EnsemblGenomes-Tr; Rahaq_R0080-1.
DR   EnsemblGenomes-Tr; Rahaq_R0081-1.
DR   EnsemblGenomes-Tr; Rahaq_R0082-1.
DR   EnsemblGenomes-Tr; Rahaq_R0083-1.
DR   EnsemblGenomes-Tr; Rahaq_R0084-1.
DR   EnsemblGenomes-Tr; Rahaq_R0085-1.
DR   EnsemblGenomes-Tr; Rahaq_R0086-1.
DR   EnsemblGenomes-Tr; Rahaq_R0087-1.
DR   EnsemblGenomes-Tr; Rahaq_R0088-1.
DR   EnsemblGenomes-Tr; Rahaq_R0089-1.
DR   EnsemblGenomes-Tr; Rahaq_R0090-1.
DR   EnsemblGenomes-Tr; Rahaq_R0091-1.
DR   EnsemblGenomes-Tr; Rahaq_R0092-1.
DR   EnsemblGenomes-Tr; Rahaq_R0093-1.
DR   EnsemblGenomes-Tr; Rahaq_R0094-1.
DR   EnsemblGenomes-Tr; Rahaq_R0095-1.
DR   EnsemblGenomes-Tr; Rahaq_R0096-1.
DR   EnsemblGenomes-Tr; Rahaq_R0097-1.
DR   EnsemblGenomes-Tr; Rahaq_R0098-1.
DR   EnsemblGenomes-Tr; Rahaq_R0099-1.
DR   EnsemblGenomes-Tr; Rahaq_R0100-1.
DR   EnsemblGenomes-Tr; Rahaq_R0101-1.
DR   EnsemblGenomes-Tr; Rahaq_R0102-1.
DR   EuropePMC; PMC3318479; 22461551.
DR   EuropePMC; PMC3387800.
DR   EuropePMC; PMC5289976; 28217124.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP002505.
DR   SILVA-SSU; CP002505.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4089210
CC   Source DNA and organism available from Robert J. Marinez
CC   (rmartinez@bama.ua.edu)
CC   Contacts: Robert J. Marinez (rmartinez@bama.ua.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Rahnella sp. Y9602
CC   collection_date     :: Missing
CC   lat_lon             :: 36.010 -84.263
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: USA
CC   environment         :: Fresh water, Human intestinal microflora
CC   num_replicons       :: 3
CC   ref_biomaterial     :: Missing
CC   biotic_relationship :: Missing
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Facultative
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi05347
CC   Funding Program     :: DOE-CSP 2010
CC   Isolation Site      :: DOE Field Research Center (FRC), Oak Ridge,
CC                          TN (Area 3)
CC   Host Name           :: Homo sapiens, freshwater
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram-
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454-Titanium, Illumina GAii
CC   ##Genome-Assembly-Data-END##
FH   Key             Location/Qualifiers
FT   source          1..4864217
FT                   /organism="Rahnella sp. Y9602"
FT                   /strain="Y9602"
FT                   /mol_type="genomic DNA"
FT                   /country="USA:DOE Field Research Center, Oak Ridge, TN"
FT                   /lat_lon="36.01 N 84.26 W"
FT                   /db_xref="taxon:741091"
FT   gene            55..1446
FT                   /locus_tag="Rahaq_0001"
FT   CDS_pept        55..1446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   spe:Spro_0032 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71634"
FT                   /db_xref="GOA:A0A0H3F6T3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F6T3"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADW71634.1"
FT                   RTLSS"
FT   gene            1451..2551
FT                   /locus_tag="Rahaq_0002"
FT   CDS_pept        1451..2551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: spe:Spro_0033 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71635"
FT                   /db_xref="GOA:A0A0H3F3A4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3A4"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADW71635.1"
FT   gene            2679..3767
FT                   /locus_tag="Rahaq_0003"
FT   CDS_pept        2679..3767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: spe:Spro_0034 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71636"
FT                   /db_xref="GOA:A0A0H3F937"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F937"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADW71636.1"
FT   gene            3787..6201
FT                   /locus_tag="Rahaq_0004"
FT   CDS_pept        3787..6201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number=""
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: spe:Spro_0035 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71637"
FT                   /db_xref="GOA:A0A0H3F4F8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4F8"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADW71637.1"
FT   gene            6345..7160
FT                   /locus_tag="Rahaq_0005"
FT   CDS_pept        6345..7160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0005"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: pwa:Pecwa_0012 sugar phosphatase; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71638"
FT                   /db_xref="GOA:A0A0H3F448"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F448"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADW71638.1"
FT   gene            7187..8449
FT                   /locus_tag="Rahaq_0006"
FT   CDS_pept        7187..8449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71639"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F6T8"
FT                   /inference="similar to AA sequence:KEGG:Spro_0046"
FT                   /protein_id="ADW71639.1"
FT   gene            complement(8492..8869)
FT                   /locus_tag="Rahaq_0007"
FT   CDS_pept        complement(8492..8869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0007"
FT                   /product="protein of unknown function DUF1375"
FT                   /note="PFAM: protein of unknown function DUF1375; KEGG:
FT                   pct:PC1_0033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71640"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3B1"
FT                   /inference="protein motif:PFAM:PF07119"
FT                   /protein_id="ADW71640.1"
FT   sig_peptide     complement(8789..8869)
FT                   /locus_tag="Rahaq_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.920 at
FT                   residue 27"
FT   gene            9249..9659
FT                   /locus_tag="Rahaq_0008"
FT   CDS_pept        9249..9659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0008"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: ctu:Ctu_00530
FT                   heat shock protein IbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71641"
FT                   /db_xref="GOA:A0A0H3F941"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F941"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADW71641.1"
FT   gene            complement(9661..9756)
FT                   /locus_tag="Rahaq_0009"
FT   CDS_pept        complement(9661..9756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4G4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADW71642.1"
FT                   /translation="MSSSFLDVTVQLPDGEPKLFHFVAVNNDDGR"
FT   gene            9789..10223
FT                   /locus_tag="Rahaq_0010"
FT   CDS_pept        9789..10223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0010"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: eca:ECA4402
FT                   heat shock chaperone IbpB"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71643"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F455"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADW71643.1"
FT   gene            complement(10402..11157)
FT                   /locus_tag="Rahaq_0011"
FT   CDS_pept        complement(10402..11157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpn:MPN083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71644"
FT                   /db_xref="GOA:A0A0H3F6U3"
FT                   /db_xref="InterPro:IPR006473"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F6U3"
FT                   /inference="similar to AA sequence:KEGG:MPN083"
FT                   /protein_id="ADW71644.1"
FT   gene            complement(11516..12766)
FT                   /locus_tag="Rahaq_0012"
FT   CDS_pept        complement(11516..12766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0012"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ypi:YpsIP31758_4140 valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71645"
FT                   /db_xref="GOA:A0A0H3F3B7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3B7"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADW71645.1"
FT                   RGVKILAEEVEKAHAEG"
FT   gene            13018..14229
FT                   /locus_tag="Rahaq_0013"
FT   CDS_pept        13018..14229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hde:HDEF_1127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F947"
FT                   /inference="similar to AA sequence:KEGG:HDEF_1127"
FT                   /protein_id="ADW71646.1"
FT                   MKYL"
FT   gene            complement(14297..15274)
FT                   /locus_tag="Rahaq_0014"
FT   CDS_pept        complement(14297..15274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0014"
FT                   /product="Gluconate 2-dehydrogenase"
FT                   /EC_number=""
FT                   /note="KEGG: yen:YE4159 putative D-isomer specific
FT                   2-hydroxyacid dehydrogenase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; D-isomer specific
FT                   2-hydroxyacid dehydrogenase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71647"
FT                   /db_xref="GOA:A0A0H3F4G7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR023756"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4G7"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71647.1"
FT   gene            complement(15271..16563)
FT                   /locus_tag="Rahaq_0015"
FT   CDS_pept        complement(15271..16563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0015"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   spe:Spro_0058 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71648"
FT                   /db_xref="GOA:A0A0H3F461"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F461"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADW71648.1"
FT   gene            complement(16607..17356)
FT                   /locus_tag="Rahaq_0016"
FT   CDS_pept        complement(16607..17356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0016"
FT                   /product="Xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /note="PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; KEGG: spe:Spro_0060 xylose isomerase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71649"
FT                   /db_xref="GOA:A0A0H3F6U8"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F6U8"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADW71649.1"
FT   gene            complement(17570..18604)
FT                   /locus_tag="Rahaq_0017"
FT   CDS_pept        complement(17570..18604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0017"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: spe:Spro_0061 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71650"
FT                   /db_xref="GOA:A0A0H3F3C2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3C2"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADW71650.1"
FT                   TAAR"
FT   gene            complement(18672..19958)
FT                   /locus_tag="Rahaq_0018"
FT   CDS_pept        complement(18672..19958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0018"
FT                   /product="oligosaccharide/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: oligosaccharide/H+ symporter, major
FT                   facilitator superfamily (MFS); KEGG: ent:Ent638_4076
FT                   galactoside permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71651"
FT                   /db_xref="GOA:A0A0H3F954"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR018457"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F954"
FT                   /inference="protein motif:TFAM:TIGR00882"
FT                   /protein_id="ADW71651.1"
FT   gene            complement(20017..22143)
FT                   /locus_tag="Rahaq_0019"
FT   CDS_pept        complement(20017..22143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0019"
FT                   /product="Alpha-galactosidase"
FT                   /EC_number=""
FT                   /note="KEGG: ddc:Dd586_2554 glycoside hydrolase clan GH-D;
FT                   PFAM: glycoside hydrolase clan GH-D"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71652"
FT                   /db_xref="GOA:A0A0H3F4H2"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4H2"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71652.1"
FT                   DPESALLLGFEEIR"
FT   gene            complement(22284..23324)
FT                   /locus_tag="Rahaq_0020"
FT   CDS_pept        complement(22284..23324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0020"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ent:Ent638_4078 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71653"
FT                   /db_xref="GOA:A0A0H3F465"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F465"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADW71653.1"
FT                   TAHPPR"
FT   gene            complement(23395..24057)
FT                   /locus_tag="Rahaq_0021"
FT   CDS_pept        complement(23395..24057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0021"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: spe:Spro_0062
FT                   putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71654"
FT                   /db_xref="GOA:A0A0H3F6V4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F6V4"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ADW71654.1"
FT   sig_peptide     complement(23995..24057)
FT                   /locus_tag="Rahaq_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.886 at
FT                   residue 21"
FT   gene            complement(24279..24722)
FT                   /locus_tag="Rahaq_0022"
FT   CDS_pept        complement(24279..24722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0022"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ypz:YPZ3_3495 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71655"
FT                   /db_xref="GOA:A0A0H3F3D0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3D0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW71655.1"
FT   gene            complement(24719..25291)
FT                   /locus_tag="Rahaq_0023"
FT   CDS_pept        complement(24719..25291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0023"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number=""
FT                   /note="TIGRFAM: DNA-3-methyladenine glycosylase I; KEGG:
FT                   ypb:YPTS_4132 DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71656"
FT                   /db_xref="GOA:A0A0H3F959"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F959"
FT                   /inference="protein motif:TFAM:TIGR00624"
FT                   /protein_id="ADW71656.1"
FT   gene            25483..27489
FT                   /locus_tag="Rahaq_0024"
FT   CDS_pept        25483..27489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0024"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="KEGG: spe:Spro_0065 outer membrane autotransporter;
FT                   TIGRFAM: outer membrane autotransporter barrel domain
FT                   protein; PFAM: Autotransporter beta- domain protein;
FT                   lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71657"
FT                   /db_xref="GOA:A0A0H3F4H6"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR017186"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4H6"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ADW71657.1"
FT   gene            27568..27816
FT                   /locus_tag="Rahaq_0025"
FT   CDS_pept        27568..27816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0025"
FT                   /product="putative stability protein StbD"
FT                   /note="KEGG: sea:SeAg_B1618 putative stability protein
FT                   StbD"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F473"
FT                   /inference="similar to AA sequence:KEGG:SeAg_B1618"
FT                   /protein_id="ADW71658.1"
FT   gene            27806..28090
FT                   /locus_tag="Rahaq_0026"
FT   CDS_pept        27806..28090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0026"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="KEGG: eic:NT01EI_2009 stability protein StbE;
FT                   TIGRFAM: addiction module toxin, RelE/StbE family; PFAM:
FT                   plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71659"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F6V9"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ADW71659.1"
FT   gene            28128..29126
FT                   /locus_tag="Rahaq_0027"
FT   CDS_pept        28128..29126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0027"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   KEGG: eam:EAMY_3633 glycine tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71660"
FT                   /db_xref="GOA:A0A0H3F3D5"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3D5"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ADW71660.1"
FT   gene            29136..31205
FT                   /locus_tag="Rahaq_0028"
FT   CDS_pept        29136..31205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0028"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, beta subunit; KEGG:
FT                   yen:YE4150 glycyl-tRNA synthetase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71661"
FT                   /db_xref="GOA:A0A0H3F966"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F966"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ADW71661.1"
FT   gene            31416..32138
FT                   /locus_tag="Rahaq_0029"
FT   CDS_pept        31416..32138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_0071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71662"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4I1"
FT                   /inference="similar to AA sequence:KEGG:Spro_0071"
FT                   /protein_id="ADW71662.1"
FT                   KQQTLLQAQKVAQGDFSN"
FT   gene            32316..33110
FT                   /locus_tag="Rahaq_0030"
FT   CDS_pept        32316..33110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0030"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: ypp:YPDSF_4128
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71663"
FT                   /db_xref="GOA:A0A0H3F477"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F477"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADW71663.1"
FT   sig_peptide     32316..32381
FT                   /locus_tag="Rahaq_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 22"
FT   gene            33345..33524
FT                   /locus_tag="Rahaq_0031"
FT   CDS_pept        33345..33524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71664"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F6W3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADW71664.1"
FT                   AMAQVLEEAAKLDW"
FT   gene            33555..35099
FT                   /locus_tag="Rahaq_0032"
FT   CDS_pept        33555..35099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0032"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   vcj:VCD_000629 deoxycytidylate deaminase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71665"
FT                   /db_xref="GOA:A0A0H3F3E1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3E1"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADW71665.1"
FT   gene            35587..37500
FT                   /locus_tag="Rahaq_0033"
FT   CDS_pept        35587..37500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0033"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /note="KEGG: spe:Spro_0072 PTS system mannitol-specific
FT                   transporter subunit IIC; TIGRFAM: PTS system,
FT                   mannitol-specific IIC subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; phosphotransferase system EIIC;
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71666"
FT                   /db_xref="GOA:A0A0H3F995"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F995"
FT                   /inference="protein motif:TFAM:TIGR00851"
FT                   /protein_id="ADW71666.1"
FT                   RG"
FT   gene            37635..38783
FT                   /locus_tag="Rahaq_0034"
FT   CDS_pept        37635..38783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0034"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: spe:Spro_0073
FT                   mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71667"
FT                   /db_xref="GOA:A0A0H3F4K2"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4K2"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ADW71667.1"
FT   gene            38734..39468
FT                   /locus_tag="Rahaq_0035"
FT   CDS_pept        38734..39468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0035"
FT                   /product="mannitol repressor, MtlR"
FT                   /note="PFAM: Mannitol repressor; KEGG: spe:Spro_0074
FT                   mannitol repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71668"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4A1"
FT                   /inference="protein motif:PFAM:PF05068"
FT                   /protein_id="ADW71668.1"
FT   gene            39494..39649
FT                   /locus_tag="Rahaq_0036"
FT   CDS_pept        39494..39649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dze:Dd1591_1426 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71669"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F6Z4"
FT                   /inference="similar to AA sequence:KEGG:Dd1591_1426"
FT                   /protein_id="ADW71669.1"
FT                   QQPQRG"
FT   gene            complement(39599..40207)
FT                   /locus_tag="Rahaq_0037"
FT   CDS_pept        complement(39599..40207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0037"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   yen:YE4145 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71670"
FT                   /db_xref="GOA:A0A0H3F3H4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3H4"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADW71670.1"
FT   gene            40352..41851
FT                   /locus_tag="Rahaq_0038"
FT   CDS_pept        40352..41851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0038"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain protein"
FT                   /note="KEGG: spe:Spro_0076 transcriptional regulator; PFAM:
FT                   regulatory protein GntR HTH; aminotransferase class I and
FT                   II; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71671"
FT                   /db_xref="GOA:A0A0H3F999"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F999"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADW71671.1"
FT   gene            41917..42276
FT                   /locus_tag="Rahaq_0039"
FT   CDS_pept        41917..42276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0039"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yen:YE4143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71672"
FT                   /db_xref="InterPro:IPR021230"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4K5"
FT                   /inference="similar to AA sequence:KEGG:YE4143"
FT                   /protein_id="ADW71672.1"
FT                   EMGLKAVTGFAKKEF"
FT   gene            complement(42448..43119)
FT                   /locus_tag="Rahaq_0040"
FT   CDS_pept        complement(42448..43119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0040"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; 3-alpha domain
FT                   protein; KEGG: spe:Spro_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71673"
FT                   /db_xref="GOA:A0A0H3F4A3"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4A3"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /protein_id="ADW71673.1"
FT                   K"
FT   gene            complement(43223..45169)
FT                   /locus_tag="Rahaq_0041"
FT   CDS_pept        complement(43223..45169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0041"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: spe:Spro_0080 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71674"
FT                   /db_xref="GOA:A0A0H3F6Z8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F6Z8"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADW71674.1"
FT                   VQGKTSQDNWETF"
FT   gene            complement(45441..46061)
FT                   /locus_tag="Rahaq_0042"
FT   CDS_pept        complement(45441..46061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0042"
FT                   /product="Manganese/iron superoxide dismutase-like protein"
FT                   /note="PFAM: Manganese/iron superoxide dismutase-like;
FT                   KEGG: dda:Dd703_0072 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71675"
FT                   /db_xref="GOA:A0A0H3F3H9"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3H9"
FT                   /inference="protein motif:PFAM:PF00081"
FT                   /protein_id="ADW71675.1"
FT   gene            complement(46272..47114)
FT                   /locus_tag="Rahaq_0043"
FT   CDS_pept        complement(46272..47114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0043"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="KEGG: ypy:YPK_0036 formate dehydrogenase accessory
FT                   protein; TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71676"
FT                   /db_xref="GOA:A0A0H3F9A3"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9A3"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ADW71676.1"
FT   gene            47260..50307
FT                   /locus_tag="Rahaq_0044"
FT   CDS_pept        47260..50307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0044"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="KEGG: pay:PAU_00744 FdnG, alpha subunit of formate
FT                   dehydrogenase-N; TIGRFAM: formate dehydrogenase, alpha
FT                   subunit; PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71677"
FT                   /db_xref="GOA:A0A0H3F4L0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4L0"
FT                   /inference="protein motif:TFAM:TIGR01553"
FT                   /protein_id="ADW71677.1"
FT   gene            50320..51231
FT                   /locus_tag="Rahaq_0045"
FT   CDS_pept        50320..51231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0045"
FT                   /product="formate dehydrogenase, beta subunit"
FT                   /note="KEGG: spe:Spro_0085 formate dehydrogenase subunit
FT                   beta; TIGRFAM: formate dehydrogenase, beta subunit; PFAM:
FT                   Formate dehydrogenase transmembrane domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71678"
FT                   /db_xref="GOA:A0A0H3F4A7"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4A7"
FT                   /inference="protein motif:TFAM:TIGR01582"
FT                   /protein_id="ADW71678.1"
FT   gene            51228..51881
FT                   /locus_tag="Rahaq_0046"
FT   CDS_pept        51228..51881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0046"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   ypy:YPK_0040 formate dehydrogenase-O subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71679"
FT                   /db_xref="GOA:A0A0H3F701"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F701"
FT                   /inference="protein motif:TFAM:TIGR01583"
FT                   /protein_id="ADW71679.1"
FT   gene            51878..52783
FT                   /locus_tag="Rahaq_0047"
FT   CDS_pept        51878..52783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0047"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="KEGG: ypb:YPTS_4153 formate dehydrogenase accessory
FT                   protein FdhE; TIGRFAM: formate dehydrogenase accessory
FT                   protein FdhE; PFAM: formate dehydrogenase accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71680"
FT                   /db_xref="GOA:A0A0H3F3I4"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3I4"
FT                   /inference="protein motif:TFAM:TIGR01562"
FT                   /protein_id="ADW71680.1"
FT   gene            52869..53510
FT                   /locus_tag="Rahaq_0048"
FT   CDS_pept        52869..53510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0048"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   spe:Spro_0089 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71681"
FT                   /db_xref="GOA:A0A0H3F9A8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9A8"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ADW71681.1"
FT   gene            53612..55150
FT                   /locus_tag="Rahaq_0049"
FT   CDS_pept        53612..55150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0049"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: ect:ECIAI39_4105
FT                   aldehyde dehydrogenase B"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71682"
FT                   /db_xref="GOA:A0A0H3F4L3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4L3"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADW71682.1"
FT   gene            complement(55280..56518)
FT                   /locus_tag="Rahaq_0050"
FT   CDS_pept        complement(55280..56518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0050"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: spe:Spro_0092 major facilitator transporter;
FT                   manually curated; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71683"
FT                   /db_xref="GOA:A0A0H3F4B0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4B0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADW71683.1"
FT                   RSRQVVLPPNSVV"
FT   gene            56754..57749
FT                   /locus_tag="Rahaq_0051"
FT   CDS_pept        56754..57749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0051"
FT                   /product="acyltransferase 3"
FT                   /note="KEGG: ypy:YPK_0050 acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71684"
FT                   /db_xref="GOA:A0A0H3F704"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR032905"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F704"
FT                   /inference="similar to AA sequence:KEGG:YPK_0050"
FT                   /protein_id="ADW71684.1"
FT   gene            57781..58455
FT                   /locus_tag="Rahaq_0052"
FT   CDS_pept        57781..58455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vsp:VS_0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3I8"
FT                   /inference="similar to AA sequence:KEGG:VS_0293"
FT                   /protein_id="ADW71685.1"
FT                   RR"
FT   gene            complement(58654..59568)
FT                   /locus_tag="Rahaq_0053"
FT   CDS_pept        complement(58654..59568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0053"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: yen:YE4125 putative transcriptional regulator;
FT                   PFAM: helix-turn-helix- domain containing protein AraC
FT                   type; ThiJ/PfpI domain-containing protein; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71686"
FT                   /db_xref="GOA:A0A0H3F9B3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9B3"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADW71686.1"
FT   gene            complement(59604..60158)
FT                   /locus_tag="Rahaq_0054"
FT   CDS_pept        complement(59604..60158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0054"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: yen:YE4124
FT                   isochorismatase family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71687"
FT                   /db_xref="GOA:A0A0H3F4L7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4L7"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADW71687.1"
FT   gene            complement(60290..60886)
FT                   /locus_tag="Rahaq_0055"
FT   CDS_pept        complement(60290..60886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0055"
FT                   /product="ThiJ/PfpI domain-containing protein"
FT                   /note="PFAM: ThiJ/PfpI domain-containing protein; KEGG:
FT                   eca:ECA0102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71688"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4B3"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADW71688.1"
FT   gene            complement(60974..62005)
FT                   /locus_tag="Rahaq_0056"
FT   CDS_pept        complement(60974..62005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0056"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   dda:Dd703_0221 L-idonate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71689"
FT                   /db_xref="GOA:A0A0H3F707"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F707"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADW71689.1"
FT                   LVF"
FT   gene            complement(62128..63330)
FT                   /locus_tag="Rahaq_0057"
FT   CDS_pept        complement(62128..63330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0057"
FT                   /product="benzoate transporter"
FT                   /note="KEGG: yen:YE1971 membrane transporter; TIGRFAM:
FT                   benzoate transporter; PFAM: Benzoate membrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71690"
FT                   /db_xref="GOA:A0A0H3F3J3"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3J3"
FT                   /inference="protein motif:TFAM:TIGR00843"
FT                   /protein_id="ADW71690.1"
FT                   S"
FT   gene            63469..64035
FT                   /locus_tag="Rahaq_0058"
FT   CDS_pept        63469..64035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0058"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: yen:YE1970 putative DNA-binding protein; PFAM:
FT                   helix-turn-helix domain protein; Cupin 2 conserved barrel
FT                   domain protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71691"
FT                   /db_xref="GOA:A0A0H3F9B6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9B6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADW71691.1"
FT   gene            64064..64516
FT                   /locus_tag="Rahaq_0059"
FT   CDS_pept        64064..64516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0059"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sgl:SG1755 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71692"
FT                   /db_xref="GOA:A0A0H3F4M1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW71692.1"
FT   gene            complement(64500..64982)
FT                   /locus_tag="Rahaq_0060"
FT   CDS_pept        complement(64500..64982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0060"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmw:Mmwyl1_1878 GCN5-like N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71693"
FT                   /db_xref="GOA:A0A0H3F4B7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4B7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW71693.1"
FT   gene            complement(64997..65536)
FT                   /locus_tag="Rahaq_0061"
FT   CDS_pept        complement(64997..65536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0061"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mea:Mex_1p4102 ABC transporter, periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F710"
FT                   /inference="similar to AA sequence:KEGG:Mex_1p4102"
FT                   /protein_id="ADW71694.1"
FT                   ISECYVTPYKKPENNK"
FT   sig_peptide     complement(65480..65536)
FT                   /locus_tag="Rahaq_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 19"
FT   gene            65709..66338
FT                   /locus_tag="Rahaq_0062"
FT   CDS_pept        65709..66338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0062"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   yen:YE1848 putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71695"
FT                   /db_xref="GOA:A0A0H3F3J7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034338"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3J7"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADW71695.1"
FT   gene            complement(66330..66776)
FT                   /locus_tag="Rahaq_0063"
FT   CDS_pept        complement(66330..66776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0063"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hch:HCH_01386 histone acetyltransferase HPA2-like
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71696"
FT                   /db_xref="GOA:A0A0H3F9C0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9C0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW71696.1"
FT   gene            complement(66796..67431)
FT                   /locus_tag="Rahaq_0064"
FT   CDS_pept        complement(66796..67431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0064"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pct:PC1_4180 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71697"
FT                   /db_xref="GOA:A0A0H3F4M4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M4"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADW71697.1"
FT   gene            complement(67590..67847)
FT                   /locus_tag="Rahaq_0065"
FT   CDS_pept        complement(67590..67847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0065"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   spe:Spro_4435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71698"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4C0"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ADW71698.1"
FT   sig_peptide     complement(67779..67847)
FT                   /locus_tag="Rahaq_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            68251..68499
FT                   /locus_tag="Rahaq_0066"
FT   CDS_pept        68251..68499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0066"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   spe:Spro_3521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71699"
FT                   /db_xref="GOA:A0A0H3F713"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F713"
FT                   /inference="protein motif:PFAM:PF04226"
FT                   /protein_id="ADW71699.1"
FT   gene            complement(68563..68946)
FT                   /locus_tag="Rahaq_0067"
FT   CDS_pept        complement(68563..68946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfl:PFL_2492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3K1"
FT                   /inference="similar to AA sequence:KEGG:PFL_2492"
FT                   /protein_id="ADW71700.1"
FT   sig_peptide     complement(68854..68946)
FT                   /locus_tag="Rahaq_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.860) with cleavage site probability 0.579 at
FT                   residue 31"
FT   gene            complement(68946..69362)
FT                   /locus_tag="Rahaq_0068"
FT   CDS_pept        complement(68946..69362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afr:AFE_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9C3"
FT                   /inference="similar to AA sequence:KEGG:AFE_0010"
FT                   /protein_id="ADW71701.1"
FT   gene            complement(69596..70294)
FT                   /locus_tag="Rahaq_0069"
FT   CDS_pept        complement(69596..70294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0069"
FT                   /product="urea ABC transporter, ATP-binding protein UrtE"
FT                   /note="TIGRFAM: urea ABC transporter, ATP-binding protein
FT                   UrtE; PFAM: ABC transporter related; KEGG: ebi:EbC_06330
FT                   ABC transporter subunit, ATP-binding subunit; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71702"
FT                   /db_xref="GOA:A0A0H3F4M7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M7"
FT                   /inference="protein motif:TFAM:TIGR03410"
FT                   /protein_id="ADW71702.1"
FT                   AEGVRGLVAI"
FT   gene            complement(70306..71103)
FT                   /locus_tag="Rahaq_0070"
FT   CDS_pept        complement(70306..71103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0070"
FT                   /product="urea ABC transporter, ATP-binding protein UrtD"
FT                   /note="KEGG: spe:Spro_1424 ABC transporter-related protein;
FT                   TIGRFAM: urea ABC transporter, ATP-binding protein UrtD;
FT                   PFAM: ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71703"
FT                   /db_xref="GOA:A0A0H3F4C3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4C3"
FT                   /inference="protein motif:TFAM:TIGR03411"
FT                   /protein_id="ADW71703.1"
FT   gene            complement(71103..72176)
FT                   /locus_tag="Rahaq_0071"
FT   CDS_pept        complement(71103..72176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0071"
FT                   /product="urea ABC transporter, permease protein UrtC"
FT                   /note="KEGG: spe:Spro_1423 inner-membrane translocator;
FT                   TIGRFAM: urea ABC transporter, permease protein UrtC; PFAM:
FT                   inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71704"
FT                   /db_xref="GOA:A0A0H3F717"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F717"
FT                   /inference="protein motif:TFAM:TIGR03408"
FT                   /protein_id="ADW71704.1"
FT                   TLFLPQGVIGLLRKRKS"
FT   gene            complement(72176..73744)
FT                   /locus_tag="Rahaq_0072"
FT   CDS_pept        complement(72176..73744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0072"
FT                   /product="urea ABC transporter, permease protein UrtB"
FT                   /note="KEGG: spe:Spro_1422 inner-membrane translocator;
FT                   TIGRFAM: urea ABC transporter, permease protein UrtB; PFAM:
FT                   inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71705"
FT                   /db_xref="GOA:A0A0H3F3K4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3K4"
FT                   /inference="protein motif:TFAM:TIGR03409"
FT                   /protein_id="ADW71705.1"
FT                   GRVID"
FT   sig_peptide     complement(73679..73744)
FT                   /locus_tag="Rahaq_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.722 at
FT                   residue 22"
FT   gene            complement(73885..75153)
FT                   /locus_tag="Rahaq_0073"
FT   CDS_pept        complement(73885..75153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0073"
FT                   /product="urea ABC transporter, urea binding protein"
FT                   /note="KEGG: ebi:EbC_06370 ABC transporter subunit,
FT                   substrate-binding (UrtA-like); TIGRFAM: urea ABC
FT                   transporter, urea binding protein; PFAM: Extracellular
FT                   ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71706"
FT                   /db_xref="GOA:A0A0H3F9C7"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9C7"
FT                   /inference="protein motif:TFAM:TIGR03407"
FT                   /protein_id="ADW71706.1"
FT   sig_peptide     complement(75070..75153)
FT                   /locus_tag="Rahaq_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 28"
FT   gene            complement(75223..75945)
FT                   /locus_tag="Rahaq_0074"
FT   CDS_pept        complement(75223..75945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0074"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: spe:Spro_1420 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71707"
FT                   /db_xref="GOA:A0A0H3F4N0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4N0"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADW71707.1"
FT                   TLHMLHRARAESDEGNPS"
FT   gene            complement(75974..79603)
FT                   /locus_tag="Rahaq_0075"
FT   CDS_pept        complement(75974..79603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0075"
FT                   /product="urea carboxylase"
FT                   /note="TIGRFAM: urea carboxylase; urea amidolyase related
FT                   protein; PFAM: Allophanate hydrolase subunit 2;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; Allophanate hydrolase
FT                   subunit 1; biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: spe:Spro_1419 UreA carboxylase; SMART:
FT                   Allophanate hydrolase subunit 2; Allophanate hydrolase
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71708"
FT                   /db_xref="GOA:A0A0H3F4C5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4C5"
FT                   /inference="protein motif:TFAM:TIGR02712"
FT                   /protein_id="ADW71708.1"
FT   gene            complement(79613..81463)
FT                   /locus_tag="Rahaq_0076"
FT   CDS_pept        complement(79613..81463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0076"
FT                   /product="allophanate hydrolase"
FT                   /note="KEGG: spe:Spro_1418 allophanate hydrolase; TIGRFAM:
FT                   allophanate hydrolase; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71709"
FT                   /db_xref="GOA:A0A0H3F719"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F719"
FT                   /inference="protein motif:TFAM:TIGR02713"
FT                   /protein_id="ADW71709.1"
FT   gene            81734..82195
FT                   /locus_tag="Rahaq_0077"
FT   CDS_pept        81734..82195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0077"
FT                   /product="RelB/DinJ family addiction module antitoxin"
FT                   /note="KEGG: ecm:EcSMS35_0821 RelB/DinJ family addiction
FT                   module antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3K9"
FT                   /inference="similar to AA sequence:KEGG:EcSMS35_0821"
FT                   /protein_id="ADW71710.1"
FT   gene            82199..82492
FT                   /locus_tag="Rahaq_0078"
FT   CDS_pept        82199..82492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0078"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="KEGG: rpi:Rpic_3179 addiction module toxin,
FT                   RelE/StbE family; TIGRFAM: addiction module toxin,
FT                   RelE/StbE family; PFAM: plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71711"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9D2"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ADW71711.1"
FT   gene            82492..83937
FT                   /locus_tag="Rahaq_0079"
FT   CDS_pept        82492..83937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71712"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4N4"
FT                   /inference="similar to AA sequence:KEGG:Spro_0124"
FT                   /protein_id="ADW71712.1"
FT   gene            84008..84466
FT                   /locus_tag="Rahaq_0080"
FT   CDS_pept        84008..84466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0080"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: spe:Spro_0129 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71713"
FT                   /db_xref="GOA:A0A0H3F4C9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4C9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADW71713.1"
FT   gene            84601..85023
FT                   /locus_tag="Rahaq_0081"
FT   CDS_pept        84601..85023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0081"
FT                   /product="peroxiredoxin, Ohr subfamily"
FT                   /note="KEGG: spe:Spro_0130 OsmC family protein; TIGRFAM:
FT                   peroxiredoxin, Ohr subfamily; PFAM: OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71714"
FT                   /db_xref="GOA:A0A0H3F724"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F724"
FT                   /inference="protein motif:TFAM:TIGR03561"
FT                   /protein_id="ADW71714.1"
FT   gene            85295..86974
FT                   /locus_tag="Rahaq_0082"
FT   CDS_pept        85295..86974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0082"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; protein of unknown function
FT                   DUF1705; KEGG: spe:Spro_0131 phosphoethanolamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71715"
FT                   /db_xref="GOA:A0A0H3F3L2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3L2"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ADW71715.1"
FT   gene            87075..87151
FT                   /locus_tag="Rahaq_R0001"
FT                   /note="tRNA-Pro1"
FT   tRNA            87075..87151
FT                   /locus_tag="Rahaq_R0001"
FT                   /product="tRNA-Pro"
FT   gene            complement(87418..87894)
FT                   /locus_tag="Rahaq_0083"
FT   CDS_pept        complement(87418..87894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psa:PST_3459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71716"
FT                   /db_xref="GOA:A0A0H3F9D7"
FT                   /db_xref="InterPro:IPR021679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9D7"
FT                   /inference="similar to AA sequence:KEGG:PST_3459"
FT                   /protein_id="ADW71716.1"
FT   gene            complement(87901..88245)
FT                   /locus_tag="Rahaq_0084"
FT   CDS_pept        complement(87901..88245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0084"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: amc:MADE_03514 HtaR suppressor protein;
FT                   TIGRFAM: transcriptional regulator, AbrB family; PFAM:
FT                   SpoVT/AbrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71717"
FT                   /db_xref="GOA:A0A0H3F4N7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR031848"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4N7"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADW71717.1"
FT                   LESPLSDDDE"
FT   gene            complement(88327..88524)
FT                   /pseudo
FT                   /locus_tag="Rahaq_0085"
FT   gene            complement(88629..90008)
FT                   /locus_tag="Rahaq_0086"
FT   CDS_pept        complement(88629..90008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0086"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: ebi:EbC_07520
FT                   MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71718"
FT                   /db_xref="GOA:A0A0H3F4D1"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4D1"
FT                   /inference="protein motif:PFAM:PF03972"
FT                   /protein_id="ADW71718.1"
FT                   G"
FT   gene            complement(90028..90807)
FT                   /locus_tag="Rahaq_0087"
FT   CDS_pept        complement(90028..90807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0087"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ebi:EbC_07530 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71719"
FT                   /db_xref="GOA:A0A0H3F726"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F726"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADW71719.1"
FT   gene            complement(90807..91673)
FT                   /locus_tag="Rahaq_0088"
FT   CDS_pept        complement(90807..91673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0088"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ebi:EbC_07540 oligopeptide transport
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71720"
FT                   /db_xref="GOA:A0A0H3F3L6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3L6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADW71720.1"
FT                   YRYGEAC"
FT   gene            complement(91666..92601)
FT                   /locus_tag="Rahaq_0089"
FT   CDS_pept        complement(91666..92601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0089"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ebi:EbC_07550 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71721"
FT                   /db_xref="GOA:A0A0H3F9E0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9E0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADW71721.1"
FT   gene            complement(92598..93683)
FT                   /locus_tag="Rahaq_0090"
FT   CDS_pept        complement(92598..93683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0090"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ebi:EbC_07560 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71722"
FT                   /db_xref="GOA:A0A0H3F4P0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4P0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADW71722.1"
FT   gene            complement(93713..95311)
FT                   /locus_tag="Rahaq_0091"
FT   CDS_pept        complement(93713..95311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0091"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: ebi:EbC_07570 ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71723"
FT                   /db_xref="GOA:A0A0H3F4D3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4D3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADW71723.1"
FT                   WTWNGFRVYYALASK"
FT   sig_peptide     complement(95237..95311)
FT                   /locus_tag="Rahaq_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(95545..96984)
FT                   /locus_tag="Rahaq_0092"
FT   CDS_pept        complement(95545..96984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0092"
FT                   /product="amidohydrolase"
FT                   /note="KEGG: ebi:EbC_07580 aminobenzoyl-glutamate
FT                   utilization family protein; TIGRFAM: amidohydrolase; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71724"
FT                   /db_xref="GOA:A0A0H3F730"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F730"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADW71724.1"
FT   gene            complement(97242..98168)
FT                   /locus_tag="Rahaq_0093"
FT   CDS_pept        complement(97242..98168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0093"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ebi:EbC_07590 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71725"
FT                   /db_xref="GOA:A0A0H3F3M2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3M2"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADW71725.1"
FT   gene            98897..100504
FT                   /locus_tag="Rahaq_0094"
FT   CDS_pept        98897..100504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0094"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: yen:YE4083 periplasmic dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71726"
FT                   /db_xref="GOA:A0A0H3F9E3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9E3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADW71726.1"
FT                   GYVVDPLGKHHFENVSME"
FT   sig_peptide     98897..98983
FT                   /locus_tag="Rahaq_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.966 at
FT                   residue 29"
FT   gene            100705..101724
FT                   /locus_tag="Rahaq_0095"
FT   CDS_pept        100705..101724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0095"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: yen:YE4082 dipeptide
FT                   transporter permease DppB"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71727"
FT                   /db_xref="GOA:A0A0H3F4P5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4P5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADW71727.1"
FT   gene            101735..102649
FT                   /locus_tag="Rahaq_0096"
FT   CDS_pept        101735..102649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0096"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pct:PC1_0046 dipeptide
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71728"
FT                   /db_xref="GOA:A0A0H3F4D6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4D6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADW71728.1"
FT   gene            102660..103685
FT                   /locus_tag="Rahaq_0097"
FT   CDS_pept        102660..103685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0097"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: kpu:KP1_5242 dipeptide transporter ATP-binding
FT                   subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71729"
FT                   /db_xref="GOA:A0A0H3F733"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F733"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADW71729.1"
FT                   S"
FT   gene            103675..104697
FT                   /locus_tag="Rahaq_0098"
FT   CDS_pept        103675..104697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0098"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: esa:ESA_04197 dipeptide transporter ATP-binding
FT                   subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71730"
FT                   /db_xref="GOA:A0A0H3F3M5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3M5"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADW71730.1"
FT                   "
FT   gene            104806..105810
FT                   /locus_tag="Rahaq_0099"
FT   CDS_pept        104806..105810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0099"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: ddd:Dda3937_00500 ISEch4 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71731"
FT                   /db_xref="GOA:A0A0H3F9E8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9E8"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADW71731.1"
FT   gene            complement(106104..106712)
FT                   /locus_tag="Rahaq_0100"
FT   CDS_pept        complement(106104..106712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0100"
FT                   /product="mobile mystery protein B"
FT                   /note="KEGG: vei:Veis_0004 mobile mystery protein B;
FT                   TIGRFAM: mobile mystery protein B; PFAM: filamentation
FT                   induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71732"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR013436"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Q0"
FT                   /inference="protein motif:TFAM:TIGR02613"
FT                   /protein_id="ADW71732.1"
FT   gene            complement(106709..107176)
FT                   /locus_tag="Rahaq_0101"
FT   CDS_pept        complement(106709..107176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0101"
FT                   /product="mobile mystery protein A"
FT                   /note="TIGRFAM: mobile mystery protein A; PFAM:
FT                   helix-turn-helix domain protein; KEGG: dap:Dacet_0535
FT                   transcriptional regulator, XRE family; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71733"
FT                   /db_xref="GOA:A0A0H3F4D8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013435"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4D8"
FT                   /inference="protein motif:TFAM:TIGR02612"
FT                   /protein_id="ADW71733.1"
FT   gene            complement(107367..108380)
FT                   /locus_tag="Rahaq_0102"
FT   CDS_pept        complement(107367..108380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0102"
FT                   /product="glycoside hydrolase family 8"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   dze:Dd1591_4079 cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71734"
FT                   /db_xref="GOA:A0A0H3F737"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR019834"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F737"
FT                   /inference="protein motif:PFAM:PF01270"
FT                   /protein_id="ADW71734.1"
FT   sig_peptide     complement(108300..108380)
FT                   /locus_tag="Rahaq_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(108390..108869)
FT                   /locus_tag="Rahaq_0103"
FT   CDS_pept        complement(108390..108869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddd:Dda3937_01993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71735"
FT                   /db_xref="InterPro:IPR022798"
FT                   /db_xref="InterPro:IPR038470"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3N0"
FT                   /inference="similar to AA sequence:KEGG:Dda3937_01993"
FT                   /protein_id="ADW71735.1"
FT   gene            complement(108888..112850)
FT                   /locus_tag="Rahaq_0104"
FT   CDS_pept        complement(108888..112850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0104"
FT                   /product="cellulose synthase operon C domain protein"
FT                   /note="PFAM: cellulose synthase operon C domain protein;
FT                   KEGG: ebi:EbC_44000 cellulose synthase operon protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71736"
FT                   /db_xref="GOA:A0A0H3F9F1"
FT                   /db_xref="InterPro:IPR003921"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9F1"
FT                   /inference="protein motif:PFAM:PF05420"
FT                   /protein_id="ADW71736.1"
FT   gene            complement(112933..115422)
FT                   /locus_tag="Rahaq_0105"
FT   CDS_pept        complement(112933..115422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0105"
FT                   /product="Cellulose synthase BcsB"
FT                   /note="PFAM: Cellulose synthase BcsB; KEGG: ebi:EbC_44010
FT                   cellulose synthase operon protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71737"
FT                   /db_xref="GOA:A0A0H3F4Q2"
FT                   /db_xref="InterPro:IPR003920"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Q2"
FT                   /inference="protein motif:PFAM:PF03170"
FT                   /protein_id="ADW71737.1"
FT                   SLFVVLRRHAAKRLGQK"
FT   sig_peptide     complement(115297..115422)
FT                   /locus_tag="Rahaq_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.612) with cleavage site probability 0.578 at
FT                   residue 42"
FT   gene            complement(115419..117518)
FT                   /locus_tag="Rahaq_0106"
FT   CDS_pept        complement(115419..117518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0106"
FT                   /product="cellulose synthase catalytic subunit
FT                   (UDP-forming)"
FT                   /note="KEGG: pam:PANA_0128 BcsA; TIGRFAM: cellulose
FT                   synthase catalytic subunit (UDP-forming); PFAM: glycosyl
FT                   transferase family 2; type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71738"
FT                   /db_xref="GOA:A0A0H3F4E0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR005150"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4E0"
FT                   /inference="protein motif:TFAM:TIGR03030"
FT                   /protein_id="ADW71738.1"
FT                   KSEAA"
FT   gene            complement(117549..118352)
FT                   /locus_tag="Rahaq_0107"
FT   CDS_pept        complement(117549..118352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0107"
FT                   /product="cellulose synthase operon protein YhjQ"
FT                   /note="TIGRFAM: cellulose synthase operon protein YhjQ;
FT                   KEGG: ent:Ent638_3941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71739"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F741"
FT                   /inference="protein motif:TFAM:TIGR03371"
FT                   /protein_id="ADW71739.1"
FT   gene            complement(118343..119113)
FT                   /locus_tag="Rahaq_0108"
FT   CDS_pept        complement(118343..119113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ebi:EbC_44040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71740"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3N3"
FT                   /inference="similar to AA sequence:KEGG:EbC_44040"
FT                   /protein_id="ADW71740.1"
FT   gene            119673..121655
FT                   /locus_tag="Rahaq_0109"
FT   CDS_pept        119673..121655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0109"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor"
FT                   /note="KEGG: spe:Spro_0152 putative phosphodiesterase;
FT                   PFAM: EAL domain protein; histidine kinase HAMP region
FT                   domain protein; GGDEF domain containing protein; SMART: EAL
FT                   domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71741"
FT                   /db_xref="GOA:A0A0H3F9F4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033419"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9F4"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADW71741.1"
FT   gene            121892..123175
FT                   /locus_tag="Rahaq_0110"
FT   CDS_pept        121892..123175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0110"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   yen:YE4067 C4-dicarboxylate transporter DctA"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71742"
FT                   /db_xref="GOA:A0A0H3F4Q5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Q5"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ADW71742.1"
FT   gene            123502..125016
FT                   /locus_tag="Rahaq_0111"
FT   CDS_pept        123502..125016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0111"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG: yen:YE4066
FT                   insulinase family protease"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71743"
FT                   /db_xref="GOA:A0A0H3F4E3"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4E3"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ADW71743.1"
FT   sig_peptide     123502..123576
FT                   /locus_tag="Rahaq_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.900 at
FT                   residue 25"
FT   gene            complement(125189..126127)
FT                   /locus_tag="Rahaq_0112"
FT   CDS_pept        complement(125189..126127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0112"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: yen:YE4065
FT                   2-dehydro-3-deoxygluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71744"
FT                   /db_xref="GOA:A0A0H3F746"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F746"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADW71744.1"
FT   gene            complement(126321..126524)
FT                   /locus_tag="Rahaq_0113"
FT   CDS_pept        complement(126321..126524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0113"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="KEGG: ypi:YpsIP31758_4060 4-oxalocrotonate
FT                   tautomerase; TIGRFAM: 4-oxalocrotonate tautomerase family
FT                   enzyme; PFAM: 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71745"
FT                   /db_xref="GOA:A0A0H3F3N7"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3N7"
FT                   /inference="protein motif:TFAM:TIGR00013"
FT                   /protein_id="ADW71745.1"
FT   gene            126848..127624
FT                   /locus_tag="Rahaq_0114"
FT   CDS_pept        126848..127624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0114"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="KEGG: yen:YE4063 EAL domain-containing protein;
FT                   PFAM: EAL domain protein; SMART: EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71746"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9F8"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADW71746.1"
FT   gene            127836..129890
FT                   /locus_tag="Rahaq_0115"
FT   CDS_pept        127836..129890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0115"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: spe:Spro_4747 AsmA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71747"
FT                   /db_xref="GOA:A0A0H3F4Q9"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Q9"
FT                   /inference="protein motif:PFAM:PF05170"
FT                   /protein_id="ADW71747.1"
FT   gene            complement(129940..130710)
FT                   /locus_tag="Rahaq_0116"
FT   CDS_pept        complement(129940..130710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0116"
FT                   /product="CDP-diacylglycerol diphosphatase"
FT                   /EC_number=""
FT                   /note="KEGG: spe:Spro_4746 CDP-diacylglycerol
FT                   pyrophosphatase; PFAM: CDP-diacylglycerol pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71748"
FT                   /db_xref="GOA:A0A0H3F4E6"
FT                   /db_xref="InterPro:IPR003763"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR038433"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4E6"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71748.1"
FT   sig_peptide     complement(130609..130710)
FT                   /locus_tag="Rahaq_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.688 at
FT                   residue 34"
FT   gene            complement(130770..132092)
FT                   /locus_tag="Rahaq_0117"
FT   CDS_pept        complement(130770..132092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0117"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); KEGG: spe:Spro_4745 major facilitator
FT                   superfamily metabolite/H(+) symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71749"
FT                   /db_xref="GOA:A0A0H3F751"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F751"
FT                   /inference="protein motif:TFAM:TIGR00883"
FT                   /protein_id="ADW71749.1"
FT   gene            complement(132380..133504)
FT                   /locus_tag="Rahaq_0118"
FT   CDS_pept        complement(132380..133504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0118"
FT                   /product="ribonuclease"
FT                   /note="KEGG: spe:Spro_4744 putative ribonuclease; TIGRFAM:
FT                   ribonuclease; PFAM: ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71750"
FT                   /db_xref="GOA:A0A0H3F3P2"
FT                   /db_xref="InterPro:IPR005274"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3P2"
FT                   /inference="protein motif:TFAM:TIGR00766"
FT                   /protein_id="ADW71750.1"
FT   gene            complement(133589..134530)
FT                   /locus_tag="Rahaq_0119"
FT   CDS_pept        complement(133589..134530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0119"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ebi:EbC_01350 O-succinylbenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71751"
FT                   /db_xref="GOA:A0A0H3F9G1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9G1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADW71751.1"
FT   gene            134615..135373
FT                   /locus_tag="Rahaq_0120"
FT   CDS_pept        134615..135373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0120"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ebi:EbC_01360 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71752"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4R2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADW71752.1"
FT   gene            complement(135377..136123)
FT                   /locus_tag="Rahaq_0121"
FT   CDS_pept        complement(135377..136123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0121"
FT                   /product="YcgR family protein"
FT                   /note="PFAM: YcgR family protein; type IV pilus assembly
FT                   PilZ; KEGG: ypb:YPTS_0948 YcgR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71753"
FT                   /db_xref="GOA:A0A0H3F4E7"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR023787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4E7"
FT                   /inference="protein motif:PFAM:PF07317"
FT                   /protein_id="ADW71753.1"
FT   gene            136455..137033
FT                   /locus_tag="Rahaq_0122"
FT   CDS_pept        136455..137033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0122"
FT                   /product="cytochrome B561"
FT                   /note="KEGG: pam:PANA_1606 YceJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71754"
FT                   /db_xref="GOA:A0A0H3F756"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F756"
FT                   /inference="similar to AA sequence:KEGG:PANA_1606"
FT                   /protein_id="ADW71754.1"
FT   gene            137065..137607
FT                   /locus_tag="Rahaq_0123"
FT   CDS_pept        137065..137607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0123"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: spe:Spro_4454 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71755"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3P6"
FT                   /inference="similar to AA sequence:KEGG:Spro_4454"
FT                   /protein_id="ADW71755.1"
FT                   CEEYRDLSAAIDGHPES"
FT   sig_peptide     137065..137151
FT                   /locus_tag="Rahaq_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.556 at
FT                   residue 29"
FT   gene            137688..138143
FT                   /locus_tag="Rahaq_0124"
FT   CDS_pept        137688..138143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0124"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: ent:Ent638_3117 ECF subfamily RNA polymerase
FT                   sigma-24 factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71756"
FT                   /db_xref="GOA:A0A0H3F9G5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9G5"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADW71756.1"
FT   gene            138140..138916
FT                   /locus_tag="Rahaq_0125"
FT   CDS_pept        138140..138916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0125"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: spe:Spro_4456 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71757"
FT                   /db_xref="GOA:A0A0H3F4R4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4R4"
FT                   /inference="similar to AA sequence:KEGG:Spro_4456"
FT                   /protein_id="ADW71757.1"
FT   gene            139223..140872
FT                   /locus_tag="Rahaq_0126"
FT   CDS_pept        139223..140872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0126"
FT                   /product="malate/quinone oxidoreductase"
FT                   /note="TIGRFAM: malate/quinone oxidoreductase; KEGG:
FT                   enc:ECL_03512 malate:quinone oxidoreductase; PFAM:
FT                   Malate:quinone-oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71758"
FT                   /db_xref="GOA:A0A0H3F4F1"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4F1"
FT                   /inference="protein motif:TFAM:TIGR01320"
FT                   /protein_id="ADW71758.1"
FT   sig_peptide     139223..139291
FT                   /locus_tag="Rahaq_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            141058..141381
FT                   /pseudo
FT                   /locus_tag="Rahaq_0127"
FT   gene            141405..142868
FT                   /locus_tag="Rahaq_0128"
FT   CDS_pept        141405..142868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kpn:KPN_03171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71759"
FT                   /db_xref="GOA:A0A0H3F759"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F759"
FT                   /inference="similar to AA sequence:KEGG:KPN_03171"
FT                   /protein_id="ADW71759.1"
FT   gene            142868..143920
FT                   /locus_tag="Rahaq_0129"
FT   CDS_pept        142868..143920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0129"
FT                   /product="ImpA domain-containing protein"
FT                   /note="KEGG: ent:Ent638_2910 ImpA domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3Q0"
FT                   /inference="similar to AA sequence:KEGG:Ent638_2910"
FT                   /protein_id="ADW71760.1"
FT                   DDKGSVFINS"
FT   gene            143955..144292
FT                   /pseudo
FT                   /locus_tag="Rahaq_0130"
FT   gene            144330..144851
FT                   /locus_tag="Rahaq_0131"
FT   CDS_pept        144330..144851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctu:Ctu_27030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71761"
FT                   /db_xref="GOA:A0A0H3F9G7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9G7"
FT                   /inference="similar to AA sequence:KEGG:Ctu_27030"
FT                   /protein_id="ADW71761.1"
FT                   AQEQMSEQES"
FT   gene            144854..146644
FT                   /locus_tag="Rahaq_0132"
FT   CDS_pept        144854..146644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0132"
FT                   /product="Protein of unknown function DUF2235"
FT                   /note="PFAM: Protein of unknown function DUF2235; KEGG:
FT                   ctu:Ctu_27040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71762"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4R8"
FT                   /inference="protein motif:PFAM:PF09994"
FT                   /protein_id="ADW71762.1"
FT   gene            147025..148677
FT                   /locus_tag="Rahaq_0133"
FT   CDS_pept        147025..148677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0133"
FT                   /product="malate/quinone oxidoreductase"
FT                   /note="TIGRFAM: malate/quinone oxidoreductase; KEGG:
FT                   spe:Spro_1524 malate:quinone oxidoreductase; PFAM:
FT                   Malate:quinone-oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71763"
FT                   /db_xref="GOA:A0A0H3F4F5"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4F5"
FT                   /inference="protein motif:TFAM:TIGR01320"
FT                   /protein_id="ADW71763.1"
FT   gene            complement(148770..150269)
FT                   /locus_tag="Rahaq_0134"
FT   CDS_pept        complement(148770..150269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0134"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   spe:Spro_1975 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71764"
FT                   /db_xref="GOA:A0A0H3F764"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F764"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADW71764.1"
FT   gene            complement(150321..150773)
FT                   /locus_tag="Rahaq_0135"
FT   CDS_pept        complement(150321..150773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0135"
FT                   /product="Conserved hypothetical protein CHP00022"
FT                   /note="PFAM: Conserved hypothetical protein CHP00022; KEGG:
FT                   spe:Spro_1974 cryptic beta-D-galactosidase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71765"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3Q5"
FT                   /inference="protein motif:PFAM:PF04074"
FT                   /protein_id="ADW71765.1"
FT   gene            complement(150773..153829)
FT                   /locus_tag="Rahaq_0136"
FT   CDS_pept        complement(150773..153829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0136"
FT                   /product="glycoside hydrolase family 2 TIM barrel"
FT                   /note="PFAM: glycoside hydrolase family 2 TIM barrel;
FT                   glycoside hydrolase family 2 sugar binding; glycoside
FT                   hydrolase family 2 immunoglobulin domain protein
FT                   beta-sandwich; glycoside hydrolase family 42 domain 5 loop
FT                   region; KEGG: spe:Spro_1973 cryptic beta-D-galactosidase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71766"
FT                   /db_xref="GOA:A0A0H3F9G8"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9G8"
FT                   /inference="protein motif:PFAM:PF02836"
FT                   /protein_id="ADW71766.1"
FT   gene            complement(153964..155013)
FT                   /locus_tag="Rahaq_0137"
FT   CDS_pept        complement(153964..155013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0137"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: spe:Spro_1972 DNA-binding transcriptional
FT                   repressor EbgR; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71767"
FT                   /db_xref="GOA:A0A0H3F4S0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4S0"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADW71767.1"
FT                   LQLRDTTRR"
FT   gene            155155..156237
FT                   /locus_tag="Rahaq_0138"
FT   CDS_pept        155155..156237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_1971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71768"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4F9"
FT                   /inference="similar to AA sequence:KEGG:Spro_1971"
FT                   /protein_id="ADW71768.1"
FT   sig_peptide     155155..155226
FT                   /locus_tag="Rahaq_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 24"
FT   gene            156237..158618
FT                   /locus_tag="Rahaq_0139"
FT   CDS_pept        156237..158618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0139"
FT                   /product="putative glycosyl hydrolase"
FT                   /note="KEGG: spe:Spro_1970 putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71769"
FT                   /db_xref="GOA:A0A0H3F768"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F768"
FT                   /inference="similar to AA sequence:KEGG:Spro_1970"
FT                   /protein_id="ADW71769.1"
FT   sig_peptide     156237..156317
FT                   /locus_tag="Rahaq_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.652 at
FT                   residue 27"
FT   gene            complement(159150..160403)
FT                   /locus_tag="Rahaq_0140"
FT   CDS_pept        complement(159150..160403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0140"
FT                   /product="hydroxymethylpyrimidine transporter CytX"
FT                   /note="KEGG: pfl:PFL_0539 hydroxymethylpyrimidine
FT                   transporter CytX; TIGRFAM: hydroxymethylpyrimidine
FT                   transporter CytX; PFAM: permease for cytosine/purines
FT                   uracil thiamine allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71770"
FT                   /db_xref="GOA:A0A0H3F3R0"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012732"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3R0"
FT                   /inference="protein motif:TFAM:TIGR02358"
FT                   /protein_id="ADW71770.1"
FT                   IPSLLVAGLVCWGLGRKA"
FT   gene            complement(160560..161216)
FT                   /locus_tag="Rahaq_0141"
FT   CDS_pept        complement(160560..161216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddd:Dda3937_01264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71771"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9H1"
FT                   /inference="similar to AA sequence:KEGG:Dda3937_01264"
FT                   /protein_id="ADW71771.1"
FT   gene            161404..163557
FT                   /locus_tag="Rahaq_0142"
FT   CDS_pept        161404..163557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0142"
FT                   /product="Peptidyl-dipeptidase Dcp"
FT                   /EC_number=""
FT                   /note="KEGG: spe:Spro_2306 peptidyl-dipeptidase DCP; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71772"
FT                   /db_xref="GOA:A0A0H3F4S5"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4S5"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71772.1"
FT   sig_peptide     161404..161466
FT                   /locus_tag="Rahaq_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.980 at
FT                   residue 21"
FT   gene            163695..164753
FT                   /locus_tag="Rahaq_0143"
FT   CDS_pept        163695..164753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0143"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; Ada metal-binding
FT                   domain-containing protein; KEGG: dda:Dd703_0019
FT                   methylated-DNA/protein-cysteine methyltransferase; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71773"
FT                   /db_xref="GOA:A0A0H3F4G3"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4G3"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADW71773.1"
FT                   LIEHERRMALSR"
FT   gene            164768..165520
FT                   /locus_tag="Rahaq_0144"
FT   CDS_pept        164768..165520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sme:SMc01727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71774"
FT                   /db_xref="GOA:A0A0H3F773"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F773"
FT                   /inference="similar to AA sequence:KEGG:SMc01727"
FT                   /protein_id="ADW71774.1"
FT   gene            complement(165492..166706)
FT                   /locus_tag="Rahaq_0145"
FT   CDS_pept        complement(165492..166706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0145"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   spe:Spro_1571 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71775"
FT                   /db_xref="GOA:A0A0H3F3R5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3R5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADW71775.1"
FT                   QPRAV"
FT   gene            complement(166778..166897)
FT                   /locus_tag="Rahaq_0146"
FT   CDS_pept        complement(166778..166897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9H3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADW71776.1"
FT   gene            complement(166916..168001)
FT                   /locus_tag="Rahaq_0147"
FT   CDS_pept        complement(166916..168001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0147"
FT                   /product="protein of unknown function DUF450"
FT                   /note="PFAM: protein of unknown function DUF450; KEGG:
FT                   pmy:Pmen_3692 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71777"
FT                   /db_xref="InterPro:IPR017035"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4T0"
FT                   /inference="protein motif:PFAM:PF04313"
FT                   /protein_id="ADW71777.1"
FT   gene            complement(168145..168846)
FT                   /locus_tag="Rahaq_0148"
FT   CDS_pept        complement(168145..168846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0148"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: spe:Spro_2481
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71778"
FT                   /db_xref="GOA:A0A0H3F4G8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4G8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADW71778.1"
FT                   LLFHGVAPQKP"
FT   gene            168931..170430
FT                   /locus_tag="Rahaq_0149"
FT   CDS_pept        168931..170430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0149"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: spe:Spro_2480 EmrB/QacA family drug resistance
FT                   transporter; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71779"
FT                   /db_xref="GOA:A0A0H3F775"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F775"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADW71779.1"
FT   gene            170533..172380
FT                   /locus_tag="Rahaq_0150"
FT   CDS_pept        170533..172380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0150"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ebi:EbC_43270 putative ABC transporter,
FT                   ATP-binding protein/permease protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71780"
FT                   /db_xref="GOA:A0A0H3F3R8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3R8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADW71780.1"
FT   gene            complement(172390..173517)
FT                   /locus_tag="Rahaq_0151"
FT   CDS_pept        complement(172390..173517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0151"
FT                   /product="protein of unknown function DUF482"
FT                   /note="PFAM: protein of unknown function DUF482; KEGG:
FT                   ebi:EbC_43250 conserved uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71781"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9H5"
FT                   /inference="protein motif:PFAM:PF04339"
FT                   /protein_id="ADW71781.1"
FT   gene            complement(173681..174316)
FT                   /locus_tag="Rahaq_0152"
FT   CDS_pept        complement(173681..174316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0152"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number=""
FT                   /note="KEGG: pen:PSEEN3600 carbonic anhydrase; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71782"
FT                   /db_xref="GOA:A0A0H3F4T3"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4T3"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71782.1"
FT   gene            174537..175079
FT                   /locus_tag="Rahaq_0153"
FT   CDS_pept        174537..175079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0153"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   KEGG: pam:PANA_2239 MsrA; PFAM: Methionine sulfoxide
FT                   reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71783"
FT                   /db_xref="GOA:A0A0H3F4H1"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4H1"
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /protein_id="ADW71783.1"
FT                   LQKLRKSFAQRTKSLQQ"
FT   gene            complement(175149..175331)
FT                   /locus_tag="Rahaq_0154"
FT   CDS_pept        complement(175149..175331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0154"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   ara:Arad_4160 4-oxalocrotonate tautomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71784"
FT                   /db_xref="GOA:A0A0H3F778"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F778"
FT                   /inference="protein motif:PFAM:PF01361"
FT                   /protein_id="ADW71784.1"
FT                   IPKSHWAKGGVLPEE"
FT   gene            complement(175451..175756)
FT                   /locus_tag="Rahaq_0155"
FT   CDS_pept        complement(175451..175756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ebi:EbC_37830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71785"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3S2"
FT                   /inference="similar to AA sequence:KEGG:EbC_37830"
FT                   /protein_id="ADW71785.1"
FT   gene            complement(175777..177042)
FT                   /locus_tag="Rahaq_0156"
FT   CDS_pept        complement(175777..177042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0156"
FT                   /product="PTS system, mannitol-specific EIIC component"
FT                   /note="KEGG: ebi:EbC_37840 PTS system, mannitol-specific
FT                   EIIC component"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71786"
FT                   /db_xref="GOA:A0A0H3F9H9"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9H9"
FT                   /inference="similar to AA sequence:KEGG:EbC_37840"
FT                   /protein_id="ADW71786.1"
FT   gene            complement(177115..177417)
FT                   /locus_tag="Rahaq_0157"
FT   CDS_pept        complement(177115..177417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0157"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG:
FT                   ebi:EbC_37850 PTS system, mannitol-specific EIIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71787"
FT                   /db_xref="GOA:A0A0H3F4T7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4T7"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ADW71787.1"
FT   sig_peptide     complement(177358..177417)
FT                   /locus_tag="Rahaq_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 20"
FT   gene            complement(177483..177926)
FT                   /locus_tag="Rahaq_0158"
FT   CDS_pept        complement(177483..177926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0158"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: ebi:EbC_37870 PTS
FT                   system, mannitol-specific EIIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71788"
FT                   /db_xref="GOA:A0A0H3F4H5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4H5"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADW71788.1"
FT   gene            complement(178133..178729)
FT                   /locus_tag="Rahaq_0159"
FT   CDS_pept        complement(178133..178729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0159"
FT                   /product="glucokinase"
FT                   /note="KEGG: ebi:EbC_37880 glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71789"
FT                   /db_xref="GOA:A0A0H3F781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F781"
FT                   /inference="similar to AA sequence:KEGG:EbC_37880"
FT                   /protein_id="ADW71789.1"
FT   gene            complement(178722..179657)
FT                   /locus_tag="Rahaq_0160"
FT   CDS_pept        complement(178722..179657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0160"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   ebi:EbC_37890 tagatose-1,6-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71790"
FT                   /db_xref="GOA:A0A0H3F3S6"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3S6"
FT                   /inference="protein motif:PFAM:PF01791"
FT                   /protein_id="ADW71790.1"
FT   gene            179891..180823
FT                   /locus_tag="Rahaq_0161"
FT   CDS_pept        179891..180823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0161"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: sugar-binding domain-containing protein;
FT                   regulatory protein MarR; KEGG: ebi:EbC_37900
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71791"
FT                   /db_xref="GOA:A0A0H3F9I2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9I2"
FT                   /inference="protein motif:PFAM:PF04198"
FT                   /protein_id="ADW71791.1"
FT   gene            181378..181746
FT                   /locus_tag="Rahaq_0162"
FT   CDS_pept        181378..181746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ebi:EbC_38620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71792"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4U2"
FT                   /inference="similar to AA sequence:KEGG:EbC_38620"
FT                   /protein_id="ADW71792.1"
FT                   KGAAFKSMDERSQEVNKI"
FT   sig_peptide     181378..181443
FT                   /locus_tag="Rahaq_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.387 at
FT                   residue 22"
FT   gene            181743..184658
FT                   /locus_tag="Rahaq_0163"
FT   CDS_pept        181743..184658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0163"
FT                   /product="FKBP-type peptidyl-prolyl isomerase domain
FT                   protein"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl isomerase domain
FT                   protein; peptidylprolyl isomerase FKBP-type; KEGG:
FT                   ent:Ent638_0982 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71793"
FT                   /db_xref="GOA:A0A0H3F4H9"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4H9"
FT                   /inference="protein motif:PFAM:PF01346"
FT                   /protein_id="ADW71793.1"
FT   gene            complement(184726..185547)
FT                   /locus_tag="Rahaq_0164"
FT   CDS_pept        complement(184726..185547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0164"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: epy:EpC_35350
FT                   putative hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71794"
FT                   /db_xref="GOA:A0A0H3F787"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F787"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADW71794.1"
FT   gene            185875..186516
FT                   /locus_tag="Rahaq_0165"
FT   CDS_pept        185875..186516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0165"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: kva:Kvar_4035
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71795"
FT                   /db_xref="GOA:A0A0H3F3S8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3S8"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADW71795.1"
FT   gene            186579..186998
FT                   /locus_tag="Rahaq_0166"
FT   CDS_pept        186579..186998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0166"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: cti:RALTA_B0391
FT                   conserved hypothetical protein; putative membrane protein,
FT                   putative DoxX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71796"
FT                   /db_xref="GOA:A0A0H3F9I6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9I6"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADW71796.1"
FT   gene            186995..188581
FT                   /locus_tag="Rahaq_0167"
FT   CDS_pept        186995..188581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0167"
FT                   /product="protein of unknown function DUF894 DitE"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; KEGG:
FT                   vap:Vapar_5468 protein of unknown function DUF894 DitE"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71797"
FT                   /db_xref="GOA:A0A0H3F4U6"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4U6"
FT                   /inference="protein motif:PFAM:PF05977"
FT                   /protein_id="ADW71797.1"
FT                   KPQVHHYLSVR"
FT   gene            complement(188619..189527)
FT                   /locus_tag="Rahaq_0168"
FT   CDS_pept        complement(188619..189527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0168"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ebd:ECBD_1642 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71798"
FT                   /db_xref="GOA:A0A0H3F4I3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4I3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADW71798.1"
FT   gene            189667..189975
FT                   /locus_tag="Rahaq_0169"
FT   CDS_pept        189667..189975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0169"
FT                   /product="putative transport protein"
FT                   /note="KEGG: kpu:KP1_1209 putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR038762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F792"
FT                   /inference="similar to AA sequence:KEGG:KP1_1209"
FT                   /protein_id="ADW71799.1"
FT   gene            190096..190947
FT                   /locus_tag="Rahaq_0170"
FT   CDS_pept        190096..190947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0170"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="KEGG: ebi:EbC_18640 excinuclease cho; PFAM:
FT                   Excinuclease ABC C subunit domain protein; SMART:
FT                   Excinuclease ABC C subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71800"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3T2"
FT                   /inference="protein motif:PFAM:PF01541"
FT                   /protein_id="ADW71800.1"
FT                   LD"
FT   gene            complement(191031..191264)
FT                   /locus_tag="Rahaq_0171"
FT   CDS_pept        complement(191031..191264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0171"
FT                   /product="conserved uncharacterized protein"
FT                   /note="KEGG: epy:EpC_05510 conserved uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71801"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9I9"
FT                   /inference="similar to AA sequence:KEGG:EpC_05510"
FT                   /protein_id="ADW71801.1"
FT   gene            complement(191532..192884)
FT                   /locus_tag="Rahaq_0172"
FT   CDS_pept        complement(191532..192884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0172"
FT                   /product="glutathione-disulfide reductase"
FT                   /note="KEGG: spe:Spro_4714 glutathione reductase; TIGRFAM:
FT                   glutathione-disulfide reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71802"
FT                   /db_xref="GOA:A0A0H3F4V1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4V1"
FT                   /inference="protein motif:TFAM:TIGR01421"
FT                   /protein_id="ADW71802.1"
FT   gene            complement(193061..193903)
FT                   /locus_tag="Rahaq_0173"
FT   CDS_pept        complement(193061..193903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0173"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   spe:Spro_4713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71803"
FT                   /db_xref="GOA:A0A0H3F4I6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4I6"
FT                   /inference="protein motif:PFAM:PF04378"
FT                   /protein_id="ADW71803.1"
FT   gene            194085..196145
FT                   /locus_tag="Rahaq_0174"
FT   CDS_pept        194085..196145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0174"
FT                   /product="Oligopeptidase A"
FT                   /EC_number=""
FT                   /note="KEGG: spe:Spro_4701 oligopeptidase A; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71804"
FT                   /db_xref="GOA:A0A0H3F797"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F797"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71804.1"
FT   gene            196155..196901
FT                   /locus_tag="Rahaq_0175"
FT   CDS_pept        196155..196901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0175"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   spe:Spro_4700 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71805"
FT                   /db_xref="GOA:A0A0H3F3T6"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3T6"
FT                   /inference="protein motif:PFAM:PF04445"
FT                   /protein_id="ADW71805.1"
FT   gene            complement(196995..197435)
FT                   /locus_tag="Rahaq_0176"
FT   CDS_pept        complement(196995..197435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0176"
FT                   /product="UspA domain-containing protein"
FT                   /note="PFAM: UspA domain-containing protein; KEGG:
FT                   spe:Spro_4691 UspA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71806"
FT                   /db_xref="GOA:A0A0H3F9J4"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9J4"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADW71806.1"
FT   gene            197773..198108
FT                   /locus_tag="Rahaq_0177"
FT   CDS_pept        197773..198108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0177"
FT                   /product="Universal stress protein B"
FT                   /note="PFAM: Universal stress protein B; KEGG:
FT                   spe:Spro_4690 universal stress protein UspB"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71807"
FT                   /db_xref="GOA:A0A0H3F4V7"
FT                   /db_xref="InterPro:IPR019598"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4V7"
FT                   /inference="protein motif:PFAM:PF10625"
FT                   /protein_id="ADW71807.1"
FT                   LAMLIWY"
FT   gene            complement(198209..199714)
FT                   /locus_tag="Rahaq_0178"
FT   CDS_pept        complement(198209..199714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0178"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: spe:Spro_4689
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71808"
FT                   /db_xref="GOA:A0A0H3F4I8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4I8"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADW71808.1"
FT   gene            200026..201228
FT                   /locus_tag="Rahaq_0179"
FT   CDS_pept        200026..201228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0179"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; KEGG: ypb:YPTS_4023
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71809"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7A0"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ADW71809.1"
FT                   S"
FT   gene            complement(201369..201677)
FT                   /locus_tag="Rahaq_0180"
FT   CDS_pept        complement(201369..201677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0180"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dda:Dd703_2588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71810"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3U0"
FT                   /inference="similar to AA sequence:KEGG:Dd703_2588"
FT                   /protein_id="ADW71810.1"
FT   gene            complement(201719..203374)
FT                   /locus_tag="Rahaq_0181"
FT   CDS_pept        complement(201719..203374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0181"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: pct:PC1_3039 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71811"
FT                   /db_xref="GOA:A0A0H3F9J8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9J8"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADW71811.1"
FT   gene            203531..203773
FT                   /locus_tag="Rahaq_0182"
FT   CDS_pept        203531..203773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dan:Dana_GF19434 GF19434 gene product from
FT                   transcript GF19434-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4W2"
FT                   /inference="similar to AA sequence:KEGG:Dana_GF19434"
FT                   /protein_id="ADW71812.1"
FT   gene            203770..205020
FT                   /locus_tag="Rahaq_0183"
FT   CDS_pept        203770..205020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0183"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: eca:ECA0077 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71813"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4J1"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADW71813.1"
FT                   CGKETFFSSPVKEGEAR"
FT   sig_peptide     203770..203850
FT                   /locus_tag="Rahaq_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.656) with cleavage site probability 0.475 at
FT                   residue 27"
FT   gene            complement(205022..206728)
FT                   /locus_tag="Rahaq_0184"
FT   CDS_pept        complement(205022..206728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0184"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: ebi:EbC_38020 phospholipid/glycerol
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71814"
FT                   /db_xref="GOA:A0A0H3F7A5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7A5"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADW71814.1"
FT   gene            206927..208153
FT                   /locus_tag="Rahaq_0185"
FT   CDS_pept        206927..208153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0185"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pct:PC1_0088 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71815"
FT                   /db_xref="GOA:A0A0H3F3U4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023008"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3U4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADW71815.1"
FT                   ETSASVSAD"
FT   gene            complement(208150..208659)
FT                   /locus_tag="Rahaq_0186"
FT   CDS_pept        complement(208150..208659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0186"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   spe:Spro_4654 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71816"
FT                   /db_xref="GOA:A0A0H3F9K3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9K3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW71816.1"
FT                   GVRQPV"
FT   gene            complement(209085..210935)
FT                   /locus_tag="Rahaq_0187"
FT   CDS_pept        complement(209085..210935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_0396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71817"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4W6"
FT                   /inference="similar to AA sequence:KEGG:Cphy_0396"
FT                   /protein_id="ADW71817.1"
FT   gene            complement(210978..213074)
FT                   /locus_tag="Rahaq_0188"
FT   CDS_pept        complement(210978..213074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_0396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4J5"
FT                   /inference="similar to AA sequence:KEGG:Cphy_0396"
FT                   /protein_id="ADW71818.1"
FT                   NTEI"
FT   gene            213312..214007
FT                   /locus_tag="Rahaq_0189"
FT   CDS_pept        213312..214007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0189"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: yen:YE4023
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71819"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7B0"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ADW71819.1"
FT                   ILLFDLPPV"
FT   gene            complement(214072..216792)
FT                   /locus_tag="Rahaq_0190"
FT   CDS_pept        complement(214072..216792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0190"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="KEGG: yen:YE4059 putative autotransporter protein;
FT                   TIGRFAM: outer membrane autotransporter barrel domain
FT                   protein; PFAM: Autotransporter beta- domain protein;
FT                   Pertactin"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71820"
FT                   /db_xref="GOA:A0A0H3F3U8"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3U8"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ADW71820.1"
FT   gene            217193..217516
FT                   /locus_tag="Rahaq_0191"
FT   CDS_pept        217193..217516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0191"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG: asa:ASA_0480
FT                   PTS system cellobiose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71821"
FT                   /db_xref="GOA:A0A0H3F9K8"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9K8"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ADW71821.1"
FT                   SRV"
FT   sig_peptide     217193..217255
FT                   /locus_tag="Rahaq_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.662) with cleavage site probability 0.438 at
FT                   residue 21"
FT   gene            217513..218841
FT                   /locus_tag="Rahaq_0192"
FT   CDS_pept        217513..218841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0192"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: PTS system, lactose/cellobiose family IIC
FT                   subunit; KEGG: pwa:Pecwa_0034 PTS system,
FT                   lactose/cellobiose family IIC subunit; PFAM:
FT                   phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71822"
FT                   /db_xref="GOA:A0A0H3F4X0"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4X0"
FT                   /inference="protein motif:TFAM:TIGR00410"
FT                   /protein_id="ADW71822.1"
FT   gene            218895..220277
FT                   /locus_tag="Rahaq_0193"
FT   CDS_pept        218895..220277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0193"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0030 beta-glucosidase; PFAM: glycoside
FT                   hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71823"
FT                   /db_xref="GOA:A0A0H3F4J7"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4J7"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71823.1"
FT                   FD"
FT   gene            220291..221208
FT                   /locus_tag="Rahaq_0194"
FT   CDS_pept        220291..221208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0194"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: yen:YE1295 LacI family transcriptional
FT                   regulatory protein; PFAM: regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71824"
FT                   /db_xref="GOA:A0A0H3F7B3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7B3"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADW71824.1"
FT   gene            221308..222309
FT                   /locus_tag="Rahaq_0195"
FT   CDS_pept        221308..222309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0195"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: spe:Spro_4652 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71825"
FT                   /db_xref="GOA:A0A0H3F3V2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3V2"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADW71825.1"
FT   gene            complement(222455..222970)
FT                   /locus_tag="Rahaq_0196"
FT   CDS_pept        complement(222455..222970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0196"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number=""
FT                   /note="TIGRFAM: carbohydrate kinase, thermoresistant
FT                   glucokinase family; KEGG: pct:PC1_3943 carbohydrate kinase,
FT                   thermoresistant glucokinase family; PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71826"
FT                   /db_xref="GOA:A0A0H3F9L4"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9L4"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ADW71826.1"
FT                   AALKTVQK"
FT   gene            223217..224533
FT                   /locus_tag="Rahaq_0197"
FT   CDS_pept        223217..224533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0197"
FT                   /product="gluconate transporter"
FT                   /note="KEGG: yen:YE4021 putative gluconate permease;
FT                   TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71827"
FT                   /db_xref="GOA:A0A0H3F4X4"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4X4"
FT                   /inference="protein motif:TFAM:TIGR00791"
FT                   /protein_id="ADW71827.1"
FT   gene            224656..224988
FT                   /locus_tag="Rahaq_0198"
FT   CDS_pept        224656..224988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu3981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71828"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4K1"
FT                   /inference="similar to AA sequence:KEGG:plu3981"
FT                   /protein_id="ADW71828.1"
FT                   IVRSLS"
FT   gene            225004..225294
FT                   /locus_tag="Rahaq_0199"
FT   CDS_pept        225004..225294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0199"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: cko:CKO_04948 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71829"
FT                   /db_xref="GOA:A0A0H3F7B9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7B9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADW71829.1"
FT   gene            complement(225349..225942)
FT                   /locus_tag="Rahaq_0200"
FT   CDS_pept        complement(225349..225942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0200"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: eca:ECA4157 putative dITP- and XTP-
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71830"
FT                   /db_xref="GOA:A0A0H3F3V9"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3V9"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ADW71830.1"
FT   gene            226153..227256
FT                   /locus_tag="Rahaq_0201"
FT   CDS_pept        226153..227256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0201"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; KEGG:
FT                   yen:YE4018 aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase dimerisation region;
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71831"
FT                   /db_xref="GOA:A0A0H3F9M1"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9M1"
FT                   /inference="protein motif:TFAM:TIGR01745"
FT                   /protein_id="ADW71831.1"
FT   gene            227669..229852
FT                   /locus_tag="Rahaq_0202"
FT   CDS_pept        227669..229852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0202"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; alpha amylase all-beta; KEGG:
FT                   spe:Spro_4647 glycogen branching enzyme; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71832"
FT                   /db_xref="GOA:A0A0H3F4X9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4X9"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ADW71832.1"
FT   gene            229852..231876
FT                   /locus_tag="Rahaq_0203"
FT   CDS_pept        229852..231876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0203"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; KEGG: spe:Spro_4646 glycogen debranching
FT                   enzyme; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71833"
FT                   /db_xref="GOA:A0A0H3F4K6"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022844"
FT                   /db_xref="InterPro:IPR040784"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4K6"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ADW71833.1"
FT   gene            231894..233171
FT                   /locus_tag="Rahaq_0204"
FT   CDS_pept        231894..233171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0204"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="KEGG: spe:Spro_4645 glucose-1-phosphate
FT                   adenylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71834"
FT                   /db_xref="GOA:A0A0H3F7C2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7C2"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ADW71834.1"
FT   gene            233243..234679
FT                   /locus_tag="Rahaq_0205"
FT   CDS_pept        233243..234679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0205"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number=""
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   KEGG: spe:Spro_4644 glycogen synthase; PFAM: Starch
FT                   synthase catalytic domain-containing protein; glycosyl
FT                   transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71835"
FT                   /db_xref="GOA:A0A0H3F3W5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3W5"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ADW71835.1"
FT   gene            234717..237164
FT                   /locus_tag="Rahaq_0206"
FT   CDS_pept        234717..237164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0206"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: glycogen/starch/alpha-glucan phosphorylase;
FT                   KEGG: ypg:YpAngola_A4122 glycogen phosphorylase; PFAM:
FT                   glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71836"
FT                   /db_xref="GOA:A0A0H3F9M7"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9M7"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ADW71836.1"
FT                   VKL"
FT   gene            complement(237309..238820)
FT                   /locus_tag="Rahaq_0207"
FT   CDS_pept        complement(237309..238820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0207"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number=""
FT                   /note="KEGG: spe:Spro_4642 glycerol-3-phosphate
FT                   dehydrogenase; PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71837"
FT                   /db_xref="GOA:A0A0H3F4Y2"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Y2"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71837.1"
FT   gene            complement(239098..239856)
FT                   /locus_tag="Rahaq_0208"
FT   CDS_pept        complement(239098..239856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0208"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: yen:YE3987 DNA-binding transcriptional
FT                   repressor GlpR; PFAM: regulatory protein DeoR; SMART:
FT                   regulatory protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71838"
FT                   /db_xref="GOA:A0A0H3F4L1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4L1"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADW71838.1"
FT   gene            complement(239866..240699)
FT                   /locus_tag="Rahaq_0209"
FT   CDS_pept        complement(239866..240699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0209"
FT                   /product="Rhomboid protease"
FT                   /EC_number=""
FT                   /note="KEGG: yen:YE3988 intramembrane serine protease GlpG;
FT                   PFAM: Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71839"
FT                   /db_xref="GOA:A0A0H3F7C6"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7C6"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71839.1"
FT   gene            complement(240808..242076)
FT                   /locus_tag="Rahaq_0210"
FT   CDS_pept        complement(240808..242076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0210"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: bam:Bamb_5437 HipA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71840"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3W9"
FT                   /inference="protein motif:PFAM:PF07805"
FT                   /protein_id="ADW71840.1"
FT   gene            complement(242073..242561)
FT                   /locus_tag="Rahaq_0211"
FT   CDS_pept        complement(242073..242561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0211"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="manually curated; PFAM: helix-turn-helix domain
FT                   protein; KEGG: ecc:c5295 hypothetical protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71841"
FT                   /db_xref="GOA:A0A0H3F9N2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9N2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADW71841.1"
FT   gene            complement(242681..243871)
FT                   /locus_tag="Rahaq_0212"
FT   CDS_pept        complement(242681..243871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0212"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: tra:Trad_2517
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71842"
FT                   /db_xref="GOA:A0A0H3F4Y7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Y7"
FT                   /inference="protein motif:PFAM:PF01053"
FT                   /protein_id="ADW71842.1"
FT   gene            complement(244012..244332)
FT                   /locus_tag="Rahaq_0213"
FT   CDS_pept        complement(244012..244332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0213"
FT                   /product="Thiosulfate sulfurtransferase"
FT                   /EC_number=""
FT                   /note="PFAM: Rhodanese domain protein; KEGG: ebi:EbC_42170
FT                   thiosulfate sulfurtransferase; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71843"
FT                   /db_xref="GOA:A0A0H3F4L6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4L6"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71843.1"
FT                   EA"
FT   gene            complement(244417..245172)
FT                   /locus_tag="Rahaq_0214"
FT   CDS_pept        complement(244417..245172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0214"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: enc:ECL_00585 transcriptional repressor UlaR;
FT                   PFAM: regulatory protein DeoR; SMART: regulatory protein
FT                   DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71844"
FT                   /db_xref="GOA:A0A0H3F7D0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7D0"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADW71844.1"
FT   gene            complement(245287..246351)
FT                   /locus_tag="Rahaq_0215"
FT   CDS_pept        complement(245287..246351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0215"
FT                   /product="putative enzyme with metallo-hydrolase domain
FT                   protein"
FT                   /note="KEGG: kva:Kvar_4669 putative enzyme with
FT                   metallo-hydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71845"
FT                   /db_xref="GOA:A0A0H3F3X3"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3X3"
FT                   /inference="similar to AA sequence:KEGG:Kvar_4669"
FT                   /protein_id="ADW71845.1"
FT                   CFTTETDLPFKSFL"
FT   gene            246764..248167
FT                   /locus_tag="Rahaq_0216"
FT   CDS_pept        246764..248167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0216"
FT                   /product="PTS system ascorbate-specific transporter subunit
FT                   IIC"
FT                   /note="KEGG: set:SEN4149 PTS system ascorbate-specific
FT                   transporter subunit IIC"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71846"
FT                   /db_xref="GOA:A0A0H3F9N7"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9N7"
FT                   /inference="similar to AA sequence:KEGG:SEN4149"
FT                   /protein_id="ADW71846.1"
FT                   QALNQSVSH"
FT   gene            248224..248532
FT                   /locus_tag="Rahaq_0217"
FT   CDS_pept        248224..248532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0217"
FT                   /product="Protein-N(pi)-phosphohistidine--sugar
FT                   phosphotransferase"
FT                   /EC_number=""
FT                   /note="KEGG: sbc:SbBS512_E4724 PTS system
FT                   L-ascorbate-specific transporter subunit IIB; PFAM:
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71847"
FT                   /db_xref="GOA:A0A0H3F4Z2"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Z2"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71847.1"
FT   gene            248543..249013
FT                   /locus_tag="Rahaq_0218"
FT   CDS_pept        248543..249013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0218"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: set:SEN4151 PTS
FT                   system L-ascorbate-specific transporter subunit IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71848"
FT                   /db_xref="GOA:A0A0H3F4L8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4L8"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADW71848.1"
FT   gene            249039..249695
FT                   /locus_tag="Rahaq_0219"
FT   CDS_pept        249039..249695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0219"
FT                   /product="Orotidine 5'-phosphate decarboxylase"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase; KEGG:
FT                   ecz:ECS88_4782 3-keto-L-gulonate-6-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71849"
FT                   /db_xref="GOA:A0A0H3F7D4"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7D4"
FT                   /inference="protein motif:PFAM:PF00215"
FT                   /protein_id="ADW71849.1"
FT   gene            249706..250566
FT                   /locus_tag="Rahaq_0220"
FT   CDS_pept        249706..250566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0220"
FT                   /product="hexulose-6-phosphate isomerase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: hexulose-6-phosphate isomerase; KEGG:
FT                   seh:SeHA_C4805 L-xylulose 5-phosphate 3-epimerase; PFAM:
FT                   Xylose isomerase domain-containing protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71850"
FT                   /db_xref="GOA:A0A0H3F3X7"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3X7"
FT                   /inference="protein motif:TFAM:TIGR00542"
FT                   /protein_id="ADW71850.1"
FT                   MEETR"
FT   gene            250563..251252
FT                   /locus_tag="Rahaq_0221"
FT   CDS_pept        250563..251252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0221"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: sea:SeAg_B4666 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71851"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9P1"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADW71851.1"
FT                   DAYYGQK"
FT   gene            complement(251209..251403)
FT                   /locus_tag="Rahaq_0222"
FT   CDS_pept        complement(251209..251403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cfl:Cfla_3242 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Z5"
FT                   /inference="similar to AA sequence:KEGG:Cfla_3242"
FT                   /protein_id="ADW71852.1"
FT   gene            251520..253934
FT                   /locus_tag="Rahaq_0223"
FT   CDS_pept        251520..253934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0223"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /note="KEGG: spe:Spro_4636 glycogen/starch/alpha-glucan
FT                   phosphorylase; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71853"
FT                   /db_xref="GOA:A0A0H3F4M3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M3"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ADW71853.1"
FT   gene            253943..256018
FT                   /locus_tag="Rahaq_0224"
FT   CDS_pept        253943..256018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0224"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: 4-alpha-glucanotransferase; KEGG:
FT                   yen:YE3992 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71854"
FT                   /db_xref="GOA:A0A0H3F7D8"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7D8"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ADW71854.1"
FT   gene            complement(256074..256649)
FT                   /locus_tag="Rahaq_0225"
FT   CDS_pept        complement(256074..256649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0225"
FT                   /product="IscR-regulated protein YhgI"
FT                   /note="KEGG: eay:EAM_3259 Fe-S protein; TIGRFAM:
FT                   IscR-regulated protein YhgI; PFAM: HesB/YadR/YfhF-family
FT                   protein; nitrogen-fixing NifU domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71855"
FT                   /db_xref="GOA:A0A0H3F3Y0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3Y0"
FT                   /inference="protein motif:TFAM:TIGR03341"
FT                   /protein_id="ADW71855.1"
FT   gene            complement(256747..257436)
FT                   /locus_tag="Rahaq_0226"
FT   CDS_pept        complement(256747..257436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0226"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: spe:Spro_4633
FT                   gluconate periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71856"
FT                   /db_xref="GOA:A0A0H3F9P5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9P5"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADW71856.1"
FT                   ICRTLQA"
FT   gene            257483..258265
FT                   /locus_tag="Rahaq_0227"
FT   CDS_pept        257483..258265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0227"
FT                   /product="bioH protein"
FT                   /note="KEGG: spe:Spro_4632 BioH protein; TIGRFAM: bioH
FT                   protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71857"
FT                   /db_xref="GOA:A0A0H3F500"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F500"
FT                   /inference="protein motif:TFAM:TIGR01738"
FT                   /protein_id="ADW71857.1"
FT   gene            258486..258755
FT                   /locus_tag="Rahaq_0228"
FT   CDS_pept        258486..258755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0228"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   yen:YE3996 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71858"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M8"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ADW71858.1"
FT   sig_peptide     258486..258554
FT                   /locus_tag="Rahaq_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            259063..260724
FT                   /locus_tag="Rahaq_0229"
FT   CDS_pept        259063..260724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0229"
FT                   /product="malonate decarboxylase, alpha subunit"
FT                   /note="TIGRFAM: malonate decarboxylase, alpha subunit;
FT                   KEGG: enc:ECL_04727 putative malonate decarboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71859"
FT                   /db_xref="GOA:A0A0H3F7E2"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7E2"
FT                   /inference="protein motif:TFAM:TIGR01110"
FT                   /protein_id="ADW71859.1"
FT   gene            260730..261587
FT                   /locus_tag="Rahaq_0230"
FT   CDS_pept        260730..261587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0230"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase MdcB"
FT                   /EC_number=""
FT                   /note="TIGRFAM: triphosphoribosyl-dephospho-CoA synthase
FT                   MdcB; KEGG: kpn:KPN_01562 triphosphoribosyl-dephospho-CoA
FT                   transferase; PFAM: triphosphoribosyl-dephospho-CoA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71860"
FT                   /db_xref="GOA:A0A0H3F3Y5"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3Y5"
FT                   /inference="protein motif:TFAM:TIGR03132"
FT                   /protein_id="ADW71860.1"
FT                   VSVV"
FT   gene            261628..261930
FT                   /locus_tag="Rahaq_0231"
FT   CDS_pept        261628..261930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0231"
FT                   /product="malonate decarboxylase acyl carrier protein"
FT                   /note="KEGG: kpu:KP1_2579 malonate decarboxylase delta
FT                   subunit; TIGRFAM: malonate decarboxylase acyl carrier
FT                   protein; PFAM: malonate decarboxylase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71861"
FT                   /db_xref="GOA:A0A0H3F9P9"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9P9"
FT                   /inference="protein motif:TFAM:TIGR03130"
FT                   /protein_id="ADW71861.1"
FT   gene            261920..262762
FT                   /locus_tag="Rahaq_0232"
FT   CDS_pept        261920..262762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0232"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /note="TIGRFAM: malonate decarboxylase, beta subunit; KEGG:
FT                   cro:ROD_44601 putative malonate decarboxylase beta subunit
FT                   MdcD"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71862"
FT                   /db_xref="GOA:A0A0H3F504"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F504"
FT                   /inference="protein motif:TFAM:TIGR03133"
FT                   /protein_id="ADW71862.1"
FT   gene            262759..263574
FT                   /locus_tag="Rahaq_0233"
FT   CDS_pept        262759..263574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0233"
FT                   /product="malonate decarboxylase, gamma subunit"
FT                   /note="KEGG: dda:Dd703_1243 malonate decarboxylase, gamma
FT                   subunit; TIGRFAM: malonate decarboxylase, gamma subunit;
FT                   PFAM: malonate decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71863"
FT                   /db_xref="GOA:A0A0H3F4N1"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4N1"
FT                   /inference="protein motif:TFAM:TIGR03134"
FT                   /protein_id="ADW71863.1"
FT   gene            263765..264727
FT                   /locus_tag="Rahaq_0234"
FT   CDS_pept        263765..264727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0234"
FT                   /product="auxin efflux carrier"
FT                   /note="KEGG: cko:CKO_04764 hypothetical protein; TIGRFAM:
FT                   auxin efflux carrier; PFAM: Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71864"
FT                   /db_xref="GOA:A0A0H3F7E7"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7E7"
FT                   /inference="protein motif:TFAM:TIGR00946"
FT                   /protein_id="ADW71864.1"
FT   gene            264745..265371
FT                   /locus_tag="Rahaq_0235"
FT   CDS_pept        264745..265371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0235"
FT                   /product="holo-ACP synthase, malonate
FT                   decarboxylase-specific"
FT                   /note="TIGRFAM: holo-ACP synthase, malonate
FT                   decarboxylase-specific; KEGG: ctu:Ctu_35010
FT                   phosphoribosyl-dephospho-CoA transferase; PFAM: Holo-ACP
FT                   synthase, malonate decarboxylase-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71865"
FT                   /db_xref="GOA:A0A0H3F3Y9"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3Y9"
FT                   /inference="protein motif:TFAM:TIGR03135"
FT                   /protein_id="ADW71865.1"
FT   gene            265399..266334
FT                   /locus_tag="Rahaq_0236"
FT   CDS_pept        265399..266334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0236"
FT                   /product="malonate decarboxylase, epsilon subunit"
FT                   /note="KEGG: dda:Dd703_1240 malonate decarboxylase, epsilon
FT                   subunit; TIGRFAM: malonate decarboxylase, epsilon subunit;
FT                   PFAM: Acyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71866"
FT                   /db_xref="GOA:A0A0H3F9Q6"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR017554"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9Q6"
FT                   /inference="protein motif:TFAM:TIGR03131"
FT                   /protein_id="ADW71866.1"
FT   gene            266435..266674
FT                   /locus_tag="Rahaq_0237"
FT   CDS_pept        266435..266674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cro:ROD_27521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71867"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F509"
FT                   /inference="similar to AA sequence:KEGG:ROD_27521"
FT                   /protein_id="ADW71867.1"
FT   gene            266658..266924
FT                   /locus_tag="Rahaq_0238"
FT   CDS_pept        266658..266924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_1574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71868"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4N6"
FT                   /inference="similar to AA sequence:KEGG:Nwi_1574"
FT                   /protein_id="ADW71868.1"
FT   gene            complement(266904..267824)
FT                   /locus_tag="Rahaq_0239"
FT   CDS_pept        complement(266904..267824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0239"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: enc:ECL_04719 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71869"
FT                   /db_xref="GOA:A0A0H3F7F1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7F1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADW71869.1"
FT   gene            complement(267893..268132)
FT                   /locus_tag="Rahaq_0240"
FT   CDS_pept        complement(267893..268132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0240"
FT                   /product="protein of unknown function DUF1920"
FT                   /note="PFAM: protein of unknown function DUF1920; KEGG:
FT                   yen:YE3997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71870"
FT                   /db_xref="GOA:A0A0H3F3Z6"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR023732"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3Z6"
FT                   /inference="protein motif:PFAM:PF09012"
FT                   /protein_id="ADW71870.1"
FT   gene            complement(268141..270459)
FT                   /locus_tag="Rahaq_0241"
FT   CDS_pept        complement(268141..270459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0241"
FT                   /product="ferrous iron transport protein B"
FT                   /note="KEGG: yen:YE3998 ferrous iron transport protein B;
FT                   TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: Ferrous iron transport protein B
FT                   domain-containing protein; GTP-binding protein
FT                   HSR1-related; nucleoside recognition domain protein;
FT                   Ferrous iron transport B domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71871"
FT                   /db_xref="GOA:A0A0H3F9R4"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9R4"
FT                   /inference="protein motif:TFAM:TIGR00437"
FT                   /protein_id="ADW71871.1"
FT   gene            complement(270546..270770)
FT                   /locus_tag="Rahaq_0242"
FT   CDS_pept        complement(270546..270770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0242"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: yen:YE3999 ferrous
FT                   iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71872"
FT                   /db_xref="GOA:A0A0H3F513"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F513"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ADW71872.1"
FT   gene            complement(271169..273499)
FT                   /locus_tag="Rahaq_0243"
FT   CDS_pept        complement(271169..273499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0243"
FT                   /product="Tex-like protein"
FT                   /note="KEGG: eok:G2583_4104 protein YhgF; PFAM: Tex-like
FT                   protein-like; RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71873"
FT                   /db_xref="GOA:A0A0H3F4P1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4P1"
FT                   /inference="protein motif:PFAM:PF09371"
FT                   /protein_id="ADW71873.1"
FT   gene            complement(273611..274084)
FT                   /locus_tag="Rahaq_0244"
FT   CDS_pept        complement(273611..274084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0244"
FT                   /product="transcription elongation factor GreB"
FT                   /note="KEGG: kpu:KP1_5107 transcription elongation factor
FT                   GreB; TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71874"
FT                   /db_xref="GOA:A0A0H3F7F5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7F5"
FT                   /inference="protein motif:TFAM:TIGR01461"
FT                   /protein_id="ADW71874.1"
FT   gene            274316..280333
FT                   /locus_tag="Rahaq_0245"
FT   CDS_pept        274316..280333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0245"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein;
FT                   alpha-2-macroglobulin domain protein 2; KEGG: ypz:YPZ3_2273
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71875"
FT                   /db_xref="GOA:A0A0H3F403"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F403"
FT                   /inference="protein motif:PFAM:PF01835"
FT                   /protein_id="ADW71875.1"
FT                   VVVPADEAAVAKK"
FT   gene            280390..282759
FT                   /locus_tag="Rahaq_0246"
FT   CDS_pept        280390..282759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0246"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="KEGG: ypy:YPK_3054 penicillin-binding protein 1C;
FT                   TIGRFAM: penicillin-binding protein 1C; PFAM: glycosyl
FT                   transferase family 51; penicillin-binding protein
FT                   transpeptidase; Penicillin-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71876"
FT                   /db_xref="GOA:A0A0H3F9T0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9T0"
FT                   /inference="protein motif:TFAM:TIGR02073"
FT                   /protein_id="ADW71876.1"
FT   gene            complement(282774..283889)
FT                   /locus_tag="Rahaq_0247"
FT   CDS_pept        complement(282774..283889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0247"
FT                   /product="putative fimbrial protein"
FT                   /note="KEGG: eok:G2583_3869 putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71877"
FT                   /db_xref="GOA:A0A0H3F517"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F517"
FT                   /inference="similar to AA sequence:KEGG:G2583_3869"
FT                   /protein_id="ADW71877.1"
FT   sig_peptide     complement(283788..283889)
FT                   /locus_tag="Rahaq_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.665 at
FT                   residue 34"
FT   gene            complement(283899..286442)
FT                   /locus_tag="Rahaq_0248"
FT   CDS_pept        complement(283899..286442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0248"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: ecy:ECSE_3430 putative fimbrial usher
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71878"
FT                   /db_xref="GOA:A0A0H3F4P6"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4P6"
FT                   /inference="protein motif:PFAM:PF00577"
FT                   /protein_id="ADW71878.1"
FT   gene            complement(286515..287201)
FT                   /locus_tag="Rahaq_0249"
FT   CDS_pept        complement(286515..287201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0249"
FT                   /product="Pili assembly chaperone, N-terminal protein"
FT                   /note="PFAM: Pili assembly chaperone, N-terminal; Pili
FT                   assembly chaperone, C-terminal; KEGG: esa:ESA_02344
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71879"
FT                   /db_xref="GOA:A0A0H3F7F9"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7F9"
FT                   /inference="protein motif:PFAM:PF00345"
FT                   /protein_id="ADW71879.1"
FT                   RYEQPL"
FT   sig_peptide     complement(287127..287201)
FT                   /locus_tag="Rahaq_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.945 at
FT                   residue 25"
FT   gene            complement(287306..287854)
FT                   /locus_tag="Rahaq_0250"
FT   CDS_pept        complement(287306..287854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0250"
FT                   /product="Fimbrial protein domain-containing protein"
FT                   /note="PFAM: Fimbrial protein domain-containing protein;
FT                   KEGG: ebw:BWG_2846 putative fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71880"
FT                   /db_xref="GOA:A0A0H3F407"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F407"
FT                   /inference="protein motif:PFAM:PF00419"
FT                   /protein_id="ADW71880.1"
FT   sig_peptide     complement(287786..287854)
FT                   /locus_tag="Rahaq_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.798 at
FT                   residue 23"
FT   gene            complement(288153..288422)
FT                   /locus_tag="Rahaq_0251"
FT   CDS_pept        complement(288153..288422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71881"
FT                   /db_xref="GOA:A0A0H3F9T7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9T7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADW71881.1"
FT   gene            288444..289163
FT                   /locus_tag="Rahaq_0252"
FT   CDS_pept        288444..289163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0252"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: spe:Spro_4621 osmolarity response regulator;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain-containing protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71882"
FT                   /db_xref="GOA:A0A0H3F522"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F522"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADW71882.1"
FT                   QTVWGLGYVFVPDGSKA"
FT   gene            289160..290521
FT                   /locus_tag="Rahaq_0253"
FT   CDS_pept        289160..290521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0253"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: yen:YE4005 osmolarity sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71883"
FT                   /db_xref="GOA:A0A0H3F4P9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4P9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADW71883.1"
FT   sig_peptide     289160..289252
FT                   /locus_tag="Rahaq_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.611) with cleavage site probability 0.341 at
FT                   residue 31"
FT   gene            complement(290733..291212)
FT                   /locus_tag="Rahaq_0254"
FT   CDS_pept        complement(290733..291212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0254"
FT                   /product="PilT domain-containing protein"
FT                   /note="KEGG: spe:Spro_4619 PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71884"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7G4"
FT                   /inference="similar to AA sequence:KEGG:Spro_4619"
FT                   /protein_id="ADW71884.1"
FT   gene            complement(291209..291421)
FT                   /locus_tag="Rahaq_0255"
FT   CDS_pept        complement(291209..291421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_4618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71885"
FT                   /db_xref="GOA:A0A0H3F410"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F410"
FT                   /inference="similar to AA sequence:KEGG:Spro_4618"
FT                   /protein_id="ADW71885.1"
FT   gene            complement(291525..293147)
FT                   /locus_tag="Rahaq_0256"
FT   CDS_pept        complement(291525..293147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0256"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number=""
FT                   /note="TIGRFAM: phosphoenolpyruvate carboxykinase (ATP);
FT                   KEGG: esa:ESA_04336 phosphoenolpyruvate carboxykinase;
FT                   PFAM: phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71886"
FT                   /db_xref="GOA:A0A0H3F9U2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9U2"
FT                   /inference="protein motif:TFAM:TIGR00224"
FT                   /protein_id="ADW71886.1"
FT   gene            complement(293375..294286)
FT                   /locus_tag="Rahaq_0257"
FT   CDS_pept        complement(293375..294286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0257"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: ypb:YPTS_3957 HSP33-like
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71887"
FT                   /db_xref="GOA:A0A0H3F531"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F531"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ADW71887.1"
FT   gene            complement(294318..294722)
FT                   /locus_tag="Rahaq_0258"
FT   CDS_pept        complement(294318..294722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0258"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: spe:Spro_4615 RNA-binding S4 domain-containing
FT                   protein; PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71888"
FT                   /db_xref="GOA:A0A0H3F4Q4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Q4"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADW71888.1"
FT   gene            complement(294747..295436)
FT                   /locus_tag="Rahaq_0259"
FT   CDS_pept        complement(294747..295436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0259"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: spe:Spro_4614 HAD family hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71889"
FT                   /db_xref="GOA:A0A0H3F7G7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7G7"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADW71889.1"
FT                   PVTGPAK"
FT   gene            complement(295551..297683)
FT                   /locus_tag="Rahaq_0260"
FT   CDS_pept        complement(295551..297683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0260"
FT                   /product="Intracellular growth attenuator IgaA"
FT                   /note="PFAM: Intracellular growth attenuator IgaA; KEGG:
FT                   spe:Spro_4613 intracellular growth attenuator IgaA"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71890"
FT                   /db_xref="GOA:A0A0H3F413"
FT                   /db_xref="InterPro:IPR010771"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F413"
FT                   /inference="protein motif:PFAM:PF07095"
FT                   /protein_id="ADW71890.1"
FT                   SCFHPTLMPIPVQKLG"
FT   gene            complement(297971..298099)
FT                   /locus_tag="Rahaq_0261"
FT   CDS_pept        complement(297971..298099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71891"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9V0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADW71891.1"
FT   gene            298141..298698
FT                   /locus_tag="Rahaq_0262"
FT   CDS_pept        298141..298698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0262"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: spe:Spro_4612
FT                   ADP-ribose diphosphatase NudE"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71892"
FT                   /db_xref="GOA:A0A0H3F535"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F535"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADW71892.1"
FT   gene            complement(298773..301328)
FT                   /locus_tag="Rahaq_0263"
FT   CDS_pept        complement(298773..301328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0263"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number=""
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   KEGG: yen:YE3979 peptidoglycan synthetase; PFAM: glycosyl
FT                   transferase family 51; penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71893"
FT                   /db_xref="GOA:A0A0H3F4Q7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Q7"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ADW71893.1"
FT   gene            301450..302289
FT                   /locus_tag="Rahaq_0264"
FT   CDS_pept        301450..302289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddc:Dd586_3806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71894"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7H2"
FT                   /inference="similar to AA sequence:KEGG:Dd586_3806"
FT                   /protein_id="ADW71894.1"
FT   gene            302289..302852
FT                   /locus_tag="Rahaq_0265"
FT   CDS_pept        302289..302852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0265"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   spe:Spro_4609 fimbrial assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71895"
FT                   /db_xref="GOA:A0A0H3F416"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F416"
FT                   /inference="protein motif:PFAM:PF05137"
FT                   /protein_id="ADW71895.1"
FT   sig_peptide     302289..302429
FT                   /locus_tag="Rahaq_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.461 at
FT                   residue 47"
FT   gene            302849..303709
FT                   /locus_tag="Rahaq_0266"
FT   CDS_pept        302849..303709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pam:PANA_3670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71896"
FT                   /db_xref="GOA:A0A0H3F9W6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9W6"
FT                   /inference="similar to AA sequence:KEGG:PANA_3670"
FT                   /protein_id="ADW71896.1"
FT                   PGKGK"
FT   gene            303709..304971
FT                   /locus_tag="Rahaq_0267"
FT   CDS_pept        303709..304971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0267"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="KEGG: pwa:Pecwa_4062 putative outer membrane porin
FT                   HofQ; TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB short domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71897"
FT                   /db_xref="GOA:A0A0H3F540"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F540"
FT                   /inference="protein motif:TFAM:TIGR02515"
FT                   /protein_id="ADW71897.1"
FT   sig_peptide     303709..303777
FT                   /locus_tag="Rahaq_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            305266..305841
FT                   /locus_tag="Rahaq_0268"
FT   CDS_pept        305266..305841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0268"
FT                   /product="Shikimate kinase"
FT                   /EC_number=""
FT                   /note="KEGG: sgl:SG2309 shikimate kinase I; PFAM: shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71898"
FT                   /db_xref="GOA:A0A0H3F4R0"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4R0"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71898.1"
FT   gene            305899..306981
FT                   /locus_tag="Rahaq_0269"
FT   CDS_pept        305899..306981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0269"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: 3-dehydroquinate synthase; KEGG:
FT                   spe:Spro_4604 3-dehydroquinate synthase; PFAM:
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71899"
FT                   /db_xref="GOA:A0A0H3F7H6"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7H6"
FT                   /inference="protein motif:TFAM:TIGR01357"
FT                   /protein_id="ADW71899.1"
FT   gene            307109..308158
FT                   /locus_tag="Rahaq_0270"
FT   CDS_pept        307109..308158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0270"
FT                   /product="Sporulation domain-containing protein"
FT                   /note="PFAM: Sporulation domain-containing protein; KEGG:
FT                   spe:Spro_4603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71900"
FT                   /db_xref="GOA:A0A0H3F419"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F419"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADW71900.1"
FT                   HQVQQDLKK"
FT   gene            308241..309056
FT                   /locus_tag="Rahaq_0271"
FT   CDS_pept        308241..309056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0271"
FT                   /product="DNA adenine methylase"
FT                   /note="KEGG: ypb:YPTS_3942 DNA adenine methylase; TIGRFAM:
FT                   DNA adenine methylase; PFAM: D12 class N6 adenine-specific
FT                   DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71901"
FT                   /db_xref="GOA:A0A0H3F9Y1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9Y1"
FT                   /inference="protein motif:TFAM:TIGR00571"
FT                   /protein_id="ADW71901.1"
FT   gene            309107..309784
FT                   /locus_tag="Rahaq_0272"
FT   CDS_pept        309107..309784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0272"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   kva:Kvar_0344 ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71902"
FT                   /db_xref="GOA:A0A0H3F547"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F547"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ADW71902.1"
FT                   SHD"
FT   gene            309777..310475
FT                   /locus_tag="Rahaq_0273"
FT   CDS_pept        309777..310475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0273"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="KEGG: yen:YE3970 phosphoglycolate phosphatase;
FT                   TIGRFAM: phosphoglycolate phosphatase; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71903"
FT                   /db_xref="GOA:A0A0H3F4R5"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4R5"
FT                   /inference="protein motif:TFAM:TIGR01449"
FT                   /protein_id="ADW71903.1"
FT                   GLLSLKDQEA"
FT   gene            310477..311493
FT                   /locus_tag="Rahaq_0274"
FT   CDS_pept        310477..311493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0274"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; KEGG:
FT                   pwa:Pecwa_4054 tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71904"
FT                   /db_xref="GOA:A0A0H3F7H8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7H8"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ADW71904.1"
FT   gene            complement(311573..312967)
FT                   /locus_tag="Rahaq_0275"
FT   CDS_pept        complement(311573..312967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0275"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="KEGG: ypb:YPTS_3938 siroheme synthase; TIGRFAM:
FT                   uroporphyrin-III C-methyltransferase; siroheme synthase;
FT                   PFAM: Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; Sirohaem synthase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71905"
FT                   /db_xref="GOA:A0A0H3F423"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F423"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ADW71905.1"
FT                   VAMPSD"
FT   gene            complement(313059..313409)
FT                   /locus_tag="Rahaq_0276"
FT   CDS_pept        complement(313059..313409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0276"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /EC_number=""
FT                   /note="KEGG: ypb:YPTS_3936 nitrite reductase small subunit;
FT                   TIGRFAM: nitrite reductase [NAD(P)H], small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71906"
FT                   /db_xref="GOA:A0A0H3F9Z3"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9Z3"
FT                   /inference="protein motif:TFAM:TIGR02378"
FT                   /protein_id="ADW71906.1"
FT                   EINTTRLRAEIG"
FT   gene            complement(313406..315958)
FT                   /locus_tag="Rahaq_0277"
FT   CDS_pept        complement(313406..315958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0277"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /note="KEGG: spe:Spro_4595 nitrite reductase (NAD(P)H),
FT                   large subunit; TIGRFAM: nitrite reductase [NAD(P)H], large
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71907"
FT                   /db_xref="GOA:A0A0H3F553"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F553"
FT                   /inference="protein motif:TFAM:TIGR02374"
FT                   /protein_id="ADW71907.1"
FT   gene            316182..317465
FT                   /locus_tag="Rahaq_0278"
FT   CDS_pept        316182..317465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0278"
FT                   /product="Cytosine deaminase"
FT                   /EC_number=""
FT                   /note="KEGG: spe:Spro_4594 cytosine deaminase; PFAM:
FT                   Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71908"
FT                   /db_xref="GOA:A0A0H3F4R9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4R9"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71908.1"
FT   gene            317611..318177
FT                   /locus_tag="Rahaq_0279"
FT   CDS_pept        317611..318177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0279"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number=""
FT                   /note="KEGG: spe:Spro_4589 peptidyl-prolyl cis-trans
FT                   isomerase A (rotamase A); PFAM: peptidyl-prolyl cis-trans
FT                   isomerase cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71909"
FT                   /db_xref="GOA:A0A0H3F7I1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7I1"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71909.1"
FT   sig_peptide     317611..317682
FT                   /locus_tag="Rahaq_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            318319..319842
FT                   /locus_tag="Rahaq_0280"
FT   CDS_pept        318319..319842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0280"
FT                   /product="protein of unknown function DUF853 NPT hydrolase"
FT                   /note="PFAM: protein of unknown function DUF853 NPT
FT                   hydrolase; KEGG: spe:Spro_4584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71910"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F425"
FT                   /inference="protein motif:PFAM:PF05872"
FT                   /protein_id="ADW71910.1"
FT   gene            320086..321291
FT                   /locus_tag="Rahaq_0281"
FT   CDS_pept        320086..321291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA4385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71911"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9Z9"
FT                   /inference="similar to AA sequence:KEGG:ECA4385"
FT                   /protein_id="ADW71911.1"
FT                   VE"
FT   sig_peptide     320086..320148
FT                   /locus_tag="Rahaq_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.992 at
FT                   residue 21"
FT   gene            321389..321559
FT                   /locus_tag="Rahaq_0282"
FT   CDS_pept        321389..321559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: esa:ESA_04371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71912"
FT                   /db_xref="InterPro:IPR022541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F556"
FT                   /inference="similar to AA sequence:KEGG:ESA_04371"
FT                   /protein_id="ADW71912.1"
FT                   RLTELRKHYER"
FT   gene            321549..322151
FT                   /locus_tag="Rahaq_0283"
FT   CDS_pept        321549..322151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0283"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: ent:Ent638_3788 cell filamentation protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71913"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4S4"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ADW71913.1"
FT   gene            322228..322803
FT                   /locus_tag="Rahaq_0284"
FT   CDS_pept        322228..322803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0284"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: yen:YE3958 para-aminobenzoate synthase
FT                   component II; TIGRFAM: glutamine amidotransferase of
FT                   anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71914"
FT                   /db_xref="GOA:A0A0H3F7I6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7I6"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADW71914.1"
FT   gene            322927..324144
FT                   /locus_tag="Rahaq_0285"
FT   CDS_pept        322927..324144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0285"
FT                   /product="succinylornithine transaminase family"
FT                   /note="KEGG: ypy:YPK_0245 bifunctional
FT                   N-succinyldiaminopimelate-aminotransferase/acetylornithine
FT                   transaminase protein; TIGRFAM: succinylornithine
FT                   transaminase family; acetylornithine and succinylornithine
FT                   aminotransferase; PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71915"
FT                   /db_xref="GOA:A0A0H3F429"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F429"
FT                   /inference="protein motif:TFAM:TIGR03246"
FT                   /protein_id="ADW71915.1"
FT                   GKVCGG"
FT   gene            complement(324838..326913)
FT                   /locus_tag="Rahaq_0286"
FT   CDS_pept        complement(324838..326913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0286"
FT                   /product="integral membrane protein, YccS/YhfK family"
FT                   /note="TIGRFAM: integral membrane protein, YccS/YhfK
FT                   family; KEGG: spe:Spro_4581 YccS/YhfK family integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71916"
FT                   /db_xref="GOA:A0A0H3FA03"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FA03"
FT                   /inference="protein motif:TFAM:TIGR01667"
FT                   /protein_id="ADW71916.1"
FT   gene            complement(326975..327607)
FT                   /locus_tag="Rahaq_0287"
FT   CDS_pept        complement(326975..327607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0287"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="KEGG: ebi:EbC_41710 transcriptional regulator,
FT                   Crp/Fnr family; PFAM: cyclic nucleotide-binding; regulatory
FT                   protein Crp; SMART: cyclic nucleotide-binding; regulatory
FT                   protein Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71917"
FT                   /db_xref="GOA:A0A0H3F560"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F560"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADW71917.1"
FT   gene            327970..328377
FT                   /locus_tag="Rahaq_0288"
FT   CDS_pept        327970..328377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0288"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: spe:Spro_4579
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71918"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4S7"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADW71918.1"
FT   gene            complement(328381..329250)
FT                   /locus_tag="Rahaq_0289"
FT   CDS_pept        complement(328381..329250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0289"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number=""
FT                   /note="KEGG: spe:Spro_4578 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71919"
FT                   /db_xref="GOA:A0A0H3F7I9"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7I9"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71919.1"
FT                   LMEGKKIE"
FT   gene            complement(329386..330300)
FT                   /locus_tag="Rahaq_0290"
FT   CDS_pept        complement(329386..330300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0290"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cko:CKO_04286 DNA-binding
FT                   transcriptional activator AllS"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71920"
FT                   /db_xref="GOA:A0A0H3F432"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F432"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADW71920.1"
FT   gene            330515..331021
FT                   /locus_tag="Rahaq_0291"
FT   CDS_pept        330515..331021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0291"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /EC_number=""
FT                   /note="KEGG: kpu:KP1_1359 ureidoglycolate hydrolase; PFAM:
FT                   Ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71921"
FT                   /db_xref="GOA:A0A0H3FA10"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FA10"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71921.1"
FT                   AGLKS"
FT   gene            331108..331917
FT                   /locus_tag="Rahaq_0292"
FT   CDS_pept        331108..331917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0292"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: ecy:ECSE_0532 DNA-binding transcriptional
FT                   repressor AllR; PFAM: Transcriptional regulator IclR ;
FT                   regulatory protein IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71922"
FT                   /db_xref="GOA:A0A0H3F564"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F564"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ADW71922.1"
FT   gene            332032..333813
FT                   /locus_tag="Rahaq_0293"
FT   CDS_pept        332032..333813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0293"
FT                   /product="glyoxylate carboligase"
FT                   /note="KEGG: eck:EC55989_0522 glyoxylate carboligase;
FT                   TIGRFAM: glyoxylate carboligase; PFAM: thiamine
FT                   pyrophosphate TPP-binding domain-containing protein;
FT                   thiamine pyrophosphate central domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71923"
FT                   /db_xref="GOA:A0A0H3F4T2"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4T2"
FT                   /inference="protein motif:TFAM:TIGR01504"
FT                   /protein_id="ADW71923.1"
FT                   ADNADDAPTHVSFMKYE"
FT   gene            333829..334605
FT                   /locus_tag="Rahaq_0294"
FT   CDS_pept        333829..334605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0294"
FT                   /product="hydroxypyruvate isomerase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: hydroxypyruvate isomerase; KEGG:
FT                   ecl:EcolC_3114 hydroxypyruvate isomerase; PFAM: Xylose
FT                   isomerase domain-containing protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71924"
FT                   /db_xref="GOA:A0A0H3F7J2"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR017643"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7J2"
FT                   /inference="protein motif:TFAM:TIGR03234"
FT                   /protein_id="ADW71924.1"
FT   gene            334697..335575
FT                   /locus_tag="Rahaq_0295"
FT   CDS_pept        334697..335575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0295"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: 2-hydroxy-3-oxopropionate reductase; KEGG:
FT                   ecc:c0624 2-hydroxy-3-oxopropionate reductase; PFAM:
FT                   6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71925"
FT                   /db_xref="GOA:A0A0H3F436"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F436"
FT                   /inference="protein motif:TFAM:TIGR01505"
FT                   /protein_id="ADW71925.1"
FT                   SLEMMSNHKIG"
FT   gene            335651..337105
FT                   /locus_tag="Rahaq_0296"
FT   CDS_pept        335651..337105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0296"
FT                   /product="NCS1 nucleoside transporter family"
FT                   /note="KEGG: sed:SeD_A0570 allantoin permease; TIGRFAM:
FT                   NCS1 nucleoside transporter family; PFAM: permease for
FT                   cytosine/purines uracil thiamine allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71926"
FT                   /db_xref="GOA:A0A0H3FA26"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FA26"
FT                   /inference="protein motif:TFAM:TIGR00800"
FT                   /protein_id="ADW71926.1"
FT   gene            337188..338549
FT                   /locus_tag="Rahaq_0297"
FT   CDS_pept        337188..338549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0297"
FT                   /product="allantoinase"
FT                   /note="KEGG: kpu:KP1_1367 allantoinase; TIGRFAM:
FT                   allantoinase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71927"
FT                   /db_xref="GOA:A0A0H3F569"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F569"
FT                   /inference="protein motif:TFAM:TIGR03178"
FT                   /protein_id="ADW71927.1"
FT   gene            338612..339898
FT                   /locus_tag="Rahaq_0298"
FT   CDS_pept        338612..339898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0298"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   kpu:KP1_1368 putative purine permease YbbY"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71928"
FT                   /db_xref="GOA:A0A0H3F4T8"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4T8"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADW71928.1"
FT   gene            339923..341068
FT                   /locus_tag="Rahaq_0299"
FT   CDS_pept        339923..341068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0299"
FT                   /product="glycerate kinase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: glycerate kinase; KEGG: sea:SeAg_B0571
FT                   glycerate kinase II; PFAM: glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71929"
FT                   /db_xref="GOA:A0A0H3F7J5"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7J5"
FT                   /inference="protein motif:TFAM:TIGR00045"
FT                   /protein_id="ADW71929.1"
FT   gene            complement(341136..341927)
FT                   /locus_tag="Rahaq_0300"
FT   CDS_pept        complement(341136..341927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0300"
FT                   /product="allantoin catabolism protein"
FT                   /note="KEGG: ecw:EcE24377A_0553 hypothetical protein;
FT                   TIGRFAM: allantoin catabolism protein; PFAM: Cupin 2
FT                   conserved barrel domain protein; protein of unknown
FT                   function DUF861 cupin_3"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71930"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F440"
FT                   /inference="protein motif:TFAM:TIGR03214"
FT                   /protein_id="ADW71930.1"
FT   gene            complement(341950..343176)
FT                   /locus_tag="Rahaq_0301"
FT   CDS_pept        complement(341950..343176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0301"
FT                   /product="allantoate amidohydrolase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: allantoate amidohydrolase; amidase,
FT                   hydantoinase/carbamoylase family; KEGG: kpu:KP1_1372
FT                   allantoate amidohydrolase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71931"
FT                   /db_xref="GOA:A0A0H3FA42"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR017591"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FA42"
FT                   /inference="protein motif:TFAM:TIGR03176"
FT                   /protein_id="ADW71931.1"
FT                   AKMLHQLAY"
FT   gene            complement(343202..344251)
FT                   /locus_tag="Rahaq_0302"
FT   CDS_pept        complement(343202..344251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0302"
FT                   /product="ureidoglycolate dehydrogenase"
FT                   /note="KEGG: kpu:KP1_1373 putative malate dehydrogenase;
FT                   TIGRFAM: ureidoglycolate dehydrogenase; PFAM:
FT                   Malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71932"
FT                   /db_xref="GOA:A0A0H3F574"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR017590"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F574"
FT                   /inference="protein motif:TFAM:TIGR03175"
FT                   /protein_id="ADW71932.1"
FT                   YQTQSPFAH"
FT   gene            344549..346216
FT                   /locus_tag="Rahaq_0303"
FT   CDS_pept        344549..346216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0303"
FT                   /product="membrane protein FdrA"
FT                   /note="KEGG: eok:G2583_0638 bacterial FdrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71933"
FT                   /db_xref="GOA:A0A0H3F4U3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4U3"
FT                   /inference="similar to AA sequence:KEGG:G2583_0638"
FT                   /protein_id="ADW71933.1"
FT   gene            346250..347518
FT                   /locus_tag="Rahaq_0304"
FT   CDS_pept        346250..347518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0304"
FT                   /product="protein of unknown function DUF1116"
FT                   /note="PFAM: protein of unknown function DUF1116; KEGG:
FT                   set:SEN0511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71934"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7J8"
FT                   /inference="protein motif:PFAM:PF06545"
FT                   /protein_id="ADW71934.1"
FT   gene            347515..348276
FT                   /locus_tag="Rahaq_0305"
FT   CDS_pept        347515..348276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbc:SbBS512_E0454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71935"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F444"
FT                   /inference="similar to AA sequence:KEGG:SbBS512_E0454"
FT                   /protein_id="ADW71935.1"
FT   gene            348286..349185
FT                   /locus_tag="Rahaq_0306"
FT   CDS_pept        348286..349185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0306"
FT                   /product="carbamate kinase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: carbamate kinase; KEGG: eum:ECUMN_0561
FT                   carbamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71936"
FT                   /db_xref="GOA:A0A0H3FA51"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FA51"
FT                   /inference="protein motif:TFAM:TIGR00746"
FT                   /protein_id="ADW71936.1"
FT                   QIEAVLAGDAGTCISATA"
FT   gene            complement(349217..349462)
FT                   /locus_tag="Rahaq_0307"
FT   CDS_pept        complement(349217..349462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0307"
FT                   /product="protein of unknown function UPF0270"
FT                   /note="PFAM: protein of unknown function UPF0270; KEGG:
FT                   spe:Spro_4577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71937"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F578"
FT                   /inference="protein motif:PFAM:PF06794"
FT                   /protein_id="ADW71937.1"
FT   gene            complement(349459..350454)
FT                   /locus_tag="Rahaq_0308"
FT   CDS_pept        complement(349459..350454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0308"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ypb:YPTS_3916
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71938"
FT                   /db_xref="GOA:A0A0H3F4U8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4U8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADW71938.1"
FT   gene            350555..351157
FT                   /locus_tag="Rahaq_0309"
FT   CDS_pept        350555..351157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0309"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   yen:YE3950 putative ABC-transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71939"
FT                   /db_xref="GOA:A0A0H3F7K1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7K1"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADW71939.1"
FT   gene            complement(351218..353134)
FT                   /locus_tag="Rahaq_0310"
FT   CDS_pept        complement(351218..353134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0310"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: yen:YE3942 putative ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71940"
FT                   /db_xref="GOA:A0A0H3F449"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F449"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADW71940.1"
FT                   DLD"
FT   gene            353264..353818
FT                   /locus_tag="Rahaq_0311"
FT   CDS_pept        353264..353818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0311"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   spe:Spro_4561 glutathione-regulated potassium-efflux system
FT                   ancillary protein KefG"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71941"
FT                   /db_xref="GOA:A0A0H3FA58"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023947"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FA58"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ADW71941.1"
FT   gene            353818..355626
FT                   /locus_tag="Rahaq_0312"
FT   CDS_pept        353818..355626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0312"
FT                   /product="potassium efflux system protein"
FT                   /note="KEGG: yen:YE3940 glutathione-regulated
FT                   potassium-efflux system protein KefB; TIGRFAM: potassium
FT                   efflux system protein; PFAM: sodium/hydrogen exchanger;
FT                   TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71942"
FT                   /db_xref="GOA:A0A0H3F583"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR020884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F583"
FT                   /inference="protein motif:TFAM:TIGR00932"
FT                   /protein_id="ADW71942.1"
FT   gene            355705..355908
FT                   /locus_tag="Rahaq_0313"
FT   CDS_pept        355705..355908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0313"
FT                   /product="Conserved hypothetical protein CHP02443"
FT                   /note="PFAM: Conserved hypothetical protein CHP02443; KEGG:
FT                   spe:Spro_4559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71943"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4V4"
FT                   /inference="protein motif:PFAM:PF09526"
FT                   /protein_id="ADW71943.1"
FT   gene            356107..356712
FT                   /locus_tag="Rahaq_0314"
FT   CDS_pept        356107..356712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0314"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number=""
FT                   /note="KEGG: spe:Spro_4558 FKBP-type peptidyl-prolyl
FT                   cis-trans isomerase; PFAM: peptidylprolyl isomerase
FT                   FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71944"
FT                   /db_xref="GOA:A0A0H3F7K4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7K4"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71944.1"
FT   gene            complement(356790..357011)
FT                   /locus_tag="Rahaq_0315"
FT   CDS_pept        complement(356790..357011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0315"
FT                   /product="SlyX family protein"
FT                   /note="PFAM: SlyX family protein; KEGG: ypb:YPTS_3903
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71945"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F453"
FT                   /inference="protein motif:PFAM:PF04102"
FT                   /protein_id="ADW71945.1"
FT   gene            357302..358156
FT                   /locus_tag="Rahaq_0316"
FT   CDS_pept        357302..358156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0316"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number=""
FT                   /note="KEGG: spe:Spro_4556 FKBP-type peptidyl-prolyl
FT                   cis-trans isomerase; PFAM: FKBP-type peptidyl-prolyl
FT                   isomerase domain protein; peptidylprolyl isomerase
FT                   FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71946"
FT                   /db_xref="GOA:A0A0H3FA64"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FA64"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71946.1"
FT                   KAN"
FT   sig_peptide     357302..357379
FT                   /locus_tag="Rahaq_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            358421..359143
FT                   /locus_tag="Rahaq_0317"
FT   CDS_pept        358421..359143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0317"
FT                   /product="YheO-like domain-containing protein"
FT                   /note="PFAM: YheO-like domain-containing protein; KEGG:
FT                   yen:YE3934 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71947"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F587"
FT                   /inference="protein motif:PFAM:PF08348"
FT                   /protein_id="ADW71947.1"
FT                   VYLYIRQFKSGDLVGNER"
FT   gene            359140..359532
FT                   /locus_tag="Rahaq_0318"
FT   CDS_pept        359140..359532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0318"
FT                   /product="sulfur relay protein TusD/DsrE"
FT                   /note="KEGG: ypb:YPTS_3900 sulfur transfer complex subunit
FT                   TusD; TIGRFAM: sulfur relay protein TusD/DsrE; PFAM: DsrE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71948"
FT                   /db_xref="GOA:A0A0H3F4V8"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4V8"
FT                   /inference="protein motif:TFAM:TIGR03012"
FT                   /protein_id="ADW71948.1"
FT   sig_peptide     359140..359205
FT                   /locus_tag="Rahaq_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.826 at
FT                   residue 22"
FT   gene            359555..359914
FT                   /locus_tag="Rahaq_0319"
FT   CDS_pept        359555..359914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0319"
FT                   /product="sulfur relay protein TusC/DsrF"
FT                   /note="KEGG: ddc:Dd586_3745 sulfur relay protein TusC/DsrF;
FT                   TIGRFAM: sulfur relay protein TusC/DsrF; PFAM: DsrE family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71949"
FT                   /db_xref="GOA:A0A0H3F7K8"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR037450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7K8"
FT                   /inference="protein motif:TFAM:TIGR03010"
FT                   /protein_id="ADW71949.1"
FT                   EIRQRLAEYDVVMTF"
FT   gene            359928..360215
FT                   /locus_tag="Rahaq_0320"
FT   CDS_pept        359928..360215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0320"
FT                   /product="sulfur relay protein TusB/DsrH"
FT                   /note="KEGG: yen:YE3931 sulfur transfer complex subunit
FT                   TusB; TIGRFAM: sulfur relay protein TusB/DsrH; PFAM: DsrH
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71950"
FT                   /db_xref="GOA:A0A0H3F458"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F458"
FT                   /inference="protein motif:TFAM:TIGR03011"
FT                   /protein_id="ADW71950.1"
FT   gene            360359..360733
FT                   /locus_tag="Rahaq_0321"
FT   CDS_pept        360359..360733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0321"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: dze:Dd1591_0316 30S ribosomal protein S12;
FT                   TIGRFAM: ribosomal protein S12; PFAM: ribosomal protein
FT                   S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71951"
FT                   /db_xref="GOA:A0A0H3FA83"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FA83"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADW71951.1"
FT   gene            360830..361300
FT                   /locus_tag="Rahaq_0322"
FT   CDS_pept        360830..361300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0322"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: pwa:Pecwa_4008 30S ribosomal protein S7;
FT                   TIGRFAM: ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71952"
FT                   /db_xref="GOA:A0A0H3F592"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F592"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADW71952.1"
FT   gene            361397..363511
FT                   /locus_tag="Rahaq_0323"
FT   CDS_pept        361397..363511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0323"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: spe:Spro_4549 elongation factor G; TIGRFAM:
FT                   translation elongation factor G; small GTP-binding protein;
FT                   PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   elongation factor G domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71953"
FT                   /db_xref="GOA:A0A0H3F4W3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4W3"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADW71953.1"
FT                   ALAVIEARGK"
FT   gene            363583..364767
FT                   /locus_tag="Rahaq_0324"
FT   CDS_pept        363583..364767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0324"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: spe:Spro_4548 elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor Tu
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71954"
FT                   /db_xref="GOA:A0A0H3FFB7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FFB7"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADW71954.1"
FT   gene            364914..365108
FT                   /locus_tag="Rahaq_0325"
FT   CDS_pept        364914..365108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0325"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="KEGG: enc:ECL_04701 bacterioferritin-associated
FT                   ferredoxin; manually curated; PFAM: BFD domain protein
FT                   [2Fe-2S]-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71955"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F463"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ADW71955.1"
FT   gene            365194..365673
FT                   /locus_tag="Rahaq_0326"
FT   CDS_pept        365194..365673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0326"
FT                   /product="bacterioferritin"
FT                   /note="KEGG: ctu:Ctu_38500 bacterioferritin; TIGRFAM:
FT                   bacterioferritin; PFAM: Ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71956"
FT                   /db_xref="GOA:A0A0H3FAA2"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAA2"
FT                   /inference="protein motif:TFAM:TIGR00754"
FT                   /protein_id="ADW71956.1"
FT   gene            complement(365685..366518)
FT                   /locus_tag="Rahaq_0327"
FT   CDS_pept        complement(365685..366518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0327"
FT                   /product="Prepilin peptidase"
FT                   /EC_number=""
FT                   /note="KEGG: psp:PSPPH_0818 type IV pilus prepilin
FT                   peptidase PilD; PFAM: peptidase A24A domain protein;
FT                   peptidase A24A prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71957"
FT                   /db_xref="GOA:A0A0H3F597"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F597"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW71957.1"
FT   gene            complement(366552..367010)
FT                   /locus_tag="Rahaq_0328"
FT   CDS_pept        complement(366552..367010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0328"
FT                   /product="General secretion pathway M protein"
FT                   /note="PFAM: General secretion pathway M protein; KEGG:
FT                   ppr:PBPRA3472 putative general secretion pathway protein M"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71958"
FT                   /db_xref="GOA:A0A0H3F4W9"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4W9"
FT                   /inference="protein motif:PFAM:PF04612"
FT                   /protein_id="ADW71958.1"
FT   gene            complement(367007..368182)
FT                   /locus_tag="Rahaq_0329"
FT   CDS_pept        complement(367007..368182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0329"
FT                   /product="general secretion pathway protein L"
FT                   /note="KEGG: cko:CKO_02220 hypothetical protein; TIGRFAM:
FT                   general secretion pathway protein L; PFAM: General
FT                   secretion pathway L"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71959"
FT                   /db_xref="GOA:A0A0H3F7L9"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7L9"
FT                   /inference="protein motif:TFAM:TIGR01709"
FT                   /protein_id="ADW71959.1"
FT   gene            complement(368183..369169)
FT                   /locus_tag="Rahaq_0330"
FT   CDS_pept        complement(368183..369169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0330"
FT                   /product="general secretory pathway component, cryptic"
FT                   /note="KEGG: ecz:ECS88_3720 general secretory pathway
FT                   component, cryptic"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71960"
FT                   /db_xref="GOA:A0A0H3F466"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F466"
FT                   /inference="similar to AA sequence:KEGG:ECS88_3720"
FT                   /protein_id="ADW71960.1"
FT   sig_peptide     complement(369098..369169)
FT                   /locus_tag="Rahaq_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.939 at
FT                   residue 24"
FT   gene            complement(369162..369845)
FT                   /locus_tag="Rahaq_0331"
FT   CDS_pept        complement(369162..369845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0331"
FT                   /product="general secretion pathway protein J"
FT                   /note="TIGRFAM: general secretion pathway protein J; KEGG:
FT                   tau:Tola_0361 general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71961"
FT                   /db_xref="GOA:A0A0H3FAB0"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAB0"
FT                   /inference="protein motif:TFAM:TIGR01711"
FT                   /protein_id="ADW71961.1"
FT                   NTTDE"
FT   gene            complement(369842..370231)
FT                   /locus_tag="Rahaq_0332"
FT   CDS_pept        complement(369842..370231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0332"
FT                   /product="general secretion pathway protein I"
FT                   /note="KEGG: enc:ECL_02793 general secretion pathway
FT                   protein I; TIGRFAM: general secretion pathway protein I;
FT                   PFAM: type II secretion system protein I/J"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71962"
FT                   /db_xref="GOA:A0A0H3F5A2"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5A2"
FT                   /inference="protein motif:TFAM:TIGR01707"
FT                   /protein_id="ADW71962.1"
FT   gene            complement(370231..370752)
FT                   /locus_tag="Rahaq_0333"
FT   CDS_pept        complement(370231..370752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0333"
FT                   /product="general secretion pathway protein H"
FT                   /note="TIGRFAM: general secretion pathway protein H; KEGG:
FT                   enc:ECL_02794 general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71963"
FT                   /db_xref="GOA:A0A0H3F4X5"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4X5"
FT                   /inference="protein motif:TFAM:TIGR01708"
FT                   /protein_id="ADW71963.1"
FT                   LIFNVRRSGK"
FT   gene            complement(370755..371210)
FT                   /locus_tag="Rahaq_0334"
FT   CDS_pept        complement(370755..371210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0334"
FT                   /product="general secretion pathway protein G"
FT                   /note="KEGG: enc:ECL_02795 general secretion pathway
FT                   protein G; TIGRFAM: general secretion pathway protein G;
FT                   PFAM: type II secretion system protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71964"
FT                   /db_xref="GOA:A0A0H3F7M4"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7M4"
FT                   /inference="protein motif:TFAM:TIGR01710"
FT                   /protein_id="ADW71964.1"
FT   gene            complement(371223..372440)
FT                   /locus_tag="Rahaq_0335"
FT   CDS_pept        complement(371223..372440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0335"
FT                   /product="general secretion pathway protein F"
FT                   /note="KEGG: ecz:ECS88_3715 general secretory pathway
FT                   component, cryptic; TIGRFAM: general secretion pathway
FT                   protein F; PFAM: Type II secretion system F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71965"
FT                   /db_xref="GOA:A0A0H3F470"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F470"
FT                   /inference="protein motif:TFAM:TIGR02120"
FT                   /protein_id="ADW71965.1"
FT                   LNNLVS"
FT   gene            complement(372437..373963)
FT                   /locus_tag="Rahaq_0336"
FT   CDS_pept        complement(372437..373963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0336"
FT                   /product="general secretory pathway protein E"
FT                   /note="TIGRFAM: general secretory pathway protein E; PFAM:
FT                   type II secretion system protein E; KEGG: enc:ECL_02797
FT                   general secretion pathway protein E; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71966"
FT                   /db_xref="GOA:A0A0H3FAB5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAB5"
FT                   /inference="protein motif:TFAM:TIGR02533"
FT                   /protein_id="ADW71966.1"
FT   gene            complement(373967..375946)
FT                   /locus_tag="Rahaq_0337"
FT   CDS_pept        complement(373967..375946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0337"
FT                   /product="general secretion pathway protein D"
FT                   /note="KEGG: cro:ROD_44971 putative T2SS protein D;
FT                   TIGRFAM: general secretion pathway protein D; PFAM: type II
FT                   and III secretion system protein; NolW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71967"
FT                   /db_xref="GOA:A0A0H3F5A6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5A6"
FT                   /inference="protein motif:TFAM:TIGR02517"
FT                   /protein_id="ADW71967.1"
FT   sig_peptide     complement(375869..375946)
FT                   /locus_tag="Rahaq_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.954 at
FT                   residue 26"
FT   gene            complement(375930..376763)
FT                   /locus_tag="Rahaq_0338"
FT   CDS_pept        complement(375930..376763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: enc:ECL_02799 general secretion pathway
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71968"
FT                   /db_xref="GOA:A0A0H3F4Y0"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Y0"
FT                   /inference="similar to AA sequence:KEGG:ECL_02799"
FT                   /protein_id="ADW71968.1"
FT   gene            376950..378482
FT                   /locus_tag="Rahaq_0339"
FT   CDS_pept        376950..378482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0339"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   cko:CKO_02233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71969"
FT                   /db_xref="GOA:A0A0H3F7N0"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7N0"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADW71969.1"
FT   gene            378489..378974
FT                   /locus_tag="Rahaq_0340"
FT   CDS_pept        378489..378974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pop:POPTR_785446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71970"
FT                   /db_xref="GOA:A0A0H3F474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F474"
FT                   /inference="similar to AA sequence:KEGG:POPTR_785446"
FT                   /protein_id="ADW71970.1"
FT   sig_peptide     378489..378629
FT                   /locus_tag="Rahaq_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.810 at
FT                   residue 47"
FT   gene            379209..379520
FT                   /locus_tag="Rahaq_0341"
FT   CDS_pept        379209..379520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0341"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: ent:Ent638_3752 SSU ribosomal protein S10P;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71971"
FT                   /db_xref="GOA:A0A0H3FAC0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAC0"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADW71971.1"
FT   gene            379554..380183
FT                   /locus_tag="Rahaq_0342"
FT   CDS_pept        379554..380183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0342"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: spe:Spro_4544 50S ribosomal protein L3;
FT                   TIGRFAM: 50S ribosomal protein L3; PFAM: ribosomal protein
FT                   L3"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71972"
FT                   /db_xref="GOA:A0A0H3F5A9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5A9"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADW71972.1"
FT   gene            380200..380805
FT                   /locus_tag="Rahaq_0343"
FT   CDS_pept        380200..380805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0343"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: spe:Spro_4543
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71973"
FT                   /db_xref="GOA:A0A0H3F4Y5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Y5"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADW71973.1"
FT   gene            380802..381104
FT                   /locus_tag="Rahaq_0344"
FT   CDS_pept        380802..381104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0344"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: yen:YE3921
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71974"
FT                   /db_xref="GOA:A0A0H3F7N4"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7N4"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADW71974.1"
FT   gene            381123..381947
FT                   /locus_tag="Rahaq_0345"
FT   CDS_pept        381123..381947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0345"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: ypb:YPTS_3887 50S ribosomal protein L2;
FT                   TIGRFAM: ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71975"
FT                   /db_xref="GOA:A0A0H3F479"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F479"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADW71975.1"
FT   gene            381962..382240
FT                   /locus_tag="Rahaq_0346"
FT   CDS_pept        381962..382240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0346"
FT                   /product="ribosomal protein S19"
FT                   /note="KEGG: pwa:Pecwa_3997 30S ribosomal protein S19;
FT                   TIGRFAM: ribosomal protein S19; PFAM: ribosomal protein
FT                   S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71976"
FT                   /db_xref="GOA:A0A0H3FAC5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAC5"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADW71976.1"
FT   gene            382255..382587
FT                   /locus_tag="Rahaq_0347"
FT   CDS_pept        382255..382587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0347"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: spe:Spro_4539 50S ribosomal protein L22;
FT                   TIGRFAM: ribosomal protein L22; PFAM: ribosomal protein
FT                   L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71977"
FT                   /db_xref="GOA:A0A0H3F5B4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5B4"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADW71977.1"
FT                   VVVSDR"
FT   gene            382605..383303
FT                   /locus_tag="Rahaq_0348"
FT   CDS_pept        382605..383303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0348"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; Ribosomal protein S3 domain; KH
FT                   type 2 domain protein; KEGG: kva:Kvar_0389 ribosomal
FT                   protein S3; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71978"
FT                   /db_xref="GOA:A0A0H3F4Y9"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Y9"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADW71978.1"
FT                   PKKQQRKGRK"
FT   gene            383316..383726
FT                   /locus_tag="Rahaq_0349"
FT   CDS_pept        383316..383726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0349"
FT                   /product="ribosomal protein L16"
FT                   /note="KEGG: ctu:Ctu_38400 50S ribosomal protein L16;
FT                   TIGRFAM: ribosomal protein L16; PFAM: Ribosomal protein
FT                   L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71979"
FT                   /db_xref="GOA:A0A0H3F7P0"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7P0"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADW71979.1"
FT   gene            383726..383917
FT                   /locus_tag="Rahaq_0350"
FT   CDS_pept        383726..383917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0350"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: ctu:Ctu_38390 50S ribosomal protein L29;
FT                   TIGRFAM: ribosomal protein L29; PFAM: ribosomal protein
FT                   L29"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71980"
FT                   /db_xref="GOA:A0A0H3F482"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F482"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADW71980.1"
FT                   VRRDVARVKTLLTEKAGA"
FT   gene            383917..384171
FT                   /locus_tag="Rahaq_0351"
FT   CDS_pept        383917..384171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0351"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: etr:ETAE_3221 30S ribosomal protein S17;
FT                   TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal protein
FT                   S17"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71981"
FT                   /db_xref="GOA:A0A0H3FAC9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAC9"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADW71981.1"
FT   gene            384343..384714
FT                   /locus_tag="Rahaq_0352"
FT   CDS_pept        384343..384714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0352"
FT                   /product="ribosomal protein L14"
FT                   /note="KEGG: spe:Spro_4534 50S ribosomal protein L14;
FT                   TIGRFAM: ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71982"
FT                   /db_xref="GOA:A0A0H3F5C0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5C0"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADW71982.1"
FT   gene            384725..385039
FT                   /locus_tag="Rahaq_0353"
FT   CDS_pept        384725..385039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0353"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; KEGG: ebi:EbC_41190
FT                   50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71983"
FT                   /db_xref="GOA:A0A0H3F4Z4"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Z4"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADW71983.1"
FT                   "
FT   gene            385054..385593
FT                   /locus_tag="Rahaq_0354"
FT   CDS_pept        385054..385593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0354"
FT                   /product="50S ribosomal protein L5"
FT                   /note="KEGG: etr:ETAE_3218 50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71984"
FT                   /db_xref="GOA:A0A0H3F7P4"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7P4"
FT                   /inference="similar to AA sequence:KEGG:ETAE_3218"
FT                   /protein_id="ADW71984.1"
FT                   DEGRALLTAFNFPFRK"
FT   gene            385607..385912
FT                   /locus_tag="Rahaq_0355"
FT   CDS_pept        385607..385912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0355"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: pwa:Pecwa_3988
FT                   30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71985"
FT                   /db_xref="GOA:A0A0H3F485"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F485"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ADW71985.1"
FT   gene            385946..386338
FT                   /locus_tag="Rahaq_0356"
FT   CDS_pept        385946..386338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0356"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: etr:ETAE_3216 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71986"
FT                   /db_xref="GOA:A0A0H3FAD3"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAD3"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADW71986.1"
FT   gene            386352..386885
FT                   /locus_tag="Rahaq_0357"
FT   CDS_pept        386352..386885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0357"
FT                   /product="ribosomal protein L6"
FT                   /note="KEGG: ypb:YPTS_3875 50S ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71987"
FT                   /db_xref="GOA:A0A0H3F5C3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5C3"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ADW71987.1"
FT                   YADEVVRTKEAKKK"
FT   gene            386895..387248
FT                   /locus_tag="Rahaq_0358"
FT   CDS_pept        386895..387248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0358"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: ent:Ent638_3735 50S ribosomal protein L18;
FT                   TIGRFAM: ribosomal protein L18; PFAM: ribosomal protein
FT                   L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71988"
FT                   /db_xref="GOA:A0A0H3F4Z9"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4Z9"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADW71988.1"
FT                   ALADAAREAGLQF"
FT   gene            387263..387763
FT                   /locus_tag="Rahaq_0359"
FT   CDS_pept        387263..387763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0359"
FT                   /product="ribosomal protein S5"
FT                   /note="KEGG: pwa:Pecwa_3984 30S ribosomal protein S5;
FT                   TIGRFAM: ribosomal protein S5; PFAM: ribosomal protein S5
FT                   domain protein; Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71989"
FT                   /db_xref="GOA:A0A0H3F7Q1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7Q1"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADW71989.1"
FT                   ILG"
FT   gene            387770..387949
FT                   /locus_tag="Rahaq_0360"
FT   CDS_pept        387770..387949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0360"
FT                   /product="ribosomal protein L30"
FT                   /note="KEGG: spe:Spro_4526 50S ribosomal protein L30;
FT                   TIGRFAM: ribosomal protein L30; PFAM: ribosomal protein
FT                   L30"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71990"
FT                   /db_xref="GOA:A0A0H3F488"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F488"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ADW71990.1"
FT                   GMINLVSYMVKVEE"
FT   gene            387953..388387
FT                   /locus_tag="Rahaq_0361"
FT   CDS_pept        387953..388387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0361"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; KEGG: ypb:YPTS_3871
FT                   50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71991"
FT                   /db_xref="GOA:A0A0H3FAD8"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAD8"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADW71991.1"
FT   gene            388395..389726
FT                   /locus_tag="Rahaq_0362"
FT   CDS_pept        388395..389726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0362"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="KEGG: spe:Spro_4524 preprotein translocase subunit
FT                   SecY; TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71992"
FT                   /db_xref="GOA:A0A0H3F5C9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5C9"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ADW71992.1"
FT   gene            389760..389876
FT                   /locus_tag="Rahaq_0363"
FT   CDS_pept        389760..389876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0363"
FT                   /product="ribosomal protein L36"
FT                   /note="KEGG: sgl:SG2257 50S ribosomal protein L36; TIGRFAM:
FT                   ribosomal protein L36; PFAM: ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71993"
FT                   /db_xref="GOA:A0A0H3F505"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F505"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ADW71993.1"
FT   gene            390025..390381
FT                   /locus_tag="Rahaq_0364"
FT   CDS_pept        390025..390381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0364"
FT                   /product="30S ribosomal protein S13"
FT                   /note="KEGG: yen:YE3901 30S ribosomal protein S13; TIGRFAM:
FT                   30S ribosomal protein S13; PFAM: ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71994"
FT                   /db_xref="GOA:A0A0H3F7Q6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7Q6"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ADW71994.1"
FT                   NARTRKGPRKPIKK"
FT   gene            390399..390788
FT                   /locus_tag="Rahaq_0365"
FT   CDS_pept        390399..390788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0365"
FT                   /product="30S ribosomal protein S11"
FT                   /note="KEGG: spe:Spro_4521 30S ribosomal protein S11;
FT                   TIGRFAM: 30S ribosomal protein S11; PFAM: ribosomal protein
FT                   S11"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71995"
FT                   /db_xref="GOA:A0A0H3F491"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F491"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ADW71995.1"
FT   gene            390819..391439
FT                   /locus_tag="Rahaq_0366"
FT   CDS_pept        390819..391439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0366"
FT                   /product="ribosomal protein S4"
FT                   /note="TIGRFAM: ribosomal protein S4; PFAM: ribosomal
FT                   protein S4; RNA-binding S4 domain protein; KEGG:
FT                   ddd:Dda3937_01514 30S ribosomal subunit protein S4; SMART:
FT                   RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71996"
FT                   /db_xref="GOA:A0A0H3FAE4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAE4"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ADW71996.1"
FT   gene            391465..392454
FT                   /locus_tag="Rahaq_0367"
FT   CDS_pept        391465..392454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0367"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase dimerisation;
FT                   RNA polymerase alpha subunit domain protein; KEGG:
FT                   spe:Spro_4519 DNA-directed RNA polymerase subunit alpha;
FT                   SMART: RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71997"
FT                   /db_xref="GOA:A0A0H3F5D4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5D4"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ADW71997.1"
FT   gene            392495..392884
FT                   /locus_tag="Rahaq_0368"
FT   CDS_pept        392495..392884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0368"
FT                   /product="ribosomal protein L17"
FT                   /note="KEGG: spe:Spro_4518 50S ribosomal protein L17;
FT                   TIGRFAM: ribosomal protein L17; PFAM: ribosomal protein
FT                   L17"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71998"
FT                   /db_xref="GOA:A0A0H3F510"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F510"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADW71998.1"
FT   gene            393057..393425
FT                   /locus_tag="Rahaq_0369"
FT   CDS_pept        393057..393425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0369"
FT                   /product="DnaJ family protein"
FT                   /note="PFAM: DnaJ homologue, subfamily C, member 28,
FT                   conserved domain; KEGG: kpu:KP1_5012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71999"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7R1"
FT                   /inference="protein motif:PFAM:PF09350"
FT                   /protein_id="ADW71999.1"
FT                   DFLRGHYKNALKDKLRGK"
FT   gene            393428..393844
FT                   /locus_tag="Rahaq_0370"
FT   CDS_pept        393428..393844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0370"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Zn(II)-responsive transcriptional
FT                   regulator; PFAM: Transcription regulator MerR DNA binding;
FT                   regulatory protein MerR; KEGG: spe:Spro_4517
FT                   zinc-responsive transcriptional regulator; SMART:
FT                   regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72000"
FT                   /db_xref="GOA:A0A0H3F494"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011788"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F494"
FT                   /inference="protein motif:TFAM:TIGR02043"
FT                   /protein_id="ADW72000.1"
FT   gene            393941..394141
FT                   /locus_tag="Rahaq_0371"
FT   CDS_pept        393941..394141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0371"
FT                   /product="protein of unknown function DUF331"
FT                   /note="PFAM: protein of unknown function DUF331; KEGG:
FT                   xne:XNC1_0346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72001"
FT                   /db_xref="GOA:A0A0H3FAE7"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAE7"
FT                   /inference="protein motif:PFAM:PF03889"
FT                   /protein_id="ADW72001.1"
FT   gene            complement(394157..394573)
FT                   /locus_tag="Rahaq_0372"
FT   CDS_pept        complement(394157..394573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0372"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="KEGG: spe:Spro_4515 large-conductance
FT                   mechanosensitive channel; TIGRFAM: large conductance
FT                   mechanosensitive channel protein; PFAM: large-conductance
FT                   mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72002"
FT                   /db_xref="GOA:A0A0H3F5D9"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5D9"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ADW72002.1"
FT   gene            complement(394698..396074)
FT                   /locus_tag="Rahaq_0373"
FT   CDS_pept        complement(394698..396074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0373"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: spe:Spro_4514 potassium transporter peripheral
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72003"
FT                   /db_xref="GOA:A0A0H3F516"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F516"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADW72003.1"
FT                   "
FT   gene            complement(396135..397424)
FT                   /locus_tag="Rahaq_0374"
FT   CDS_pept        complement(396135..397424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0374"
FT                   /product="sun protein"
FT                   /note="KEGG: spe:Spro_4513 16S rRNA methyltransferase B;
FT                   TIGRFAM: sun protein; PFAM: Fmu (Sun) domain protein;
FT                   NusB/RsmB/TIM44"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72004"
FT                   /db_xref="GOA:A0A0H3F7R6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023541"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7R6"
FT                   /inference="protein motif:TFAM:TIGR00563"
FT                   /protein_id="ADW72004.1"
FT   gene            complement(397500..398435)
FT                   /locus_tag="Rahaq_0375"
FT   CDS_pept        complement(397500..398435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0375"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; KEGG:
FT                   yen:YE3890 methionyl-tRNA formyltransferase; PFAM: formyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72005"
FT                   /db_xref="GOA:A0A0H3F498"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F498"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ADW72005.1"
FT   gene            complement(398461..398973)
FT                   /locus_tag="Rahaq_0376"
FT   CDS_pept        complement(398461..398973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0376"
FT                   /product="peptide deformylase"
FT                   /note="KEGG: yen:YE3889 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72006"
FT                   /db_xref="GOA:A0A0H3FAF0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAF0"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ADW72006.1"
FT                   KLNARAD"
FT   gene            399102..400271
FT                   /locus_tag="Rahaq_0377"
FT   CDS_pept        399102..400271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0377"
FT                   /product="DNA protecting protein DprA"
FT                   /note="KEGG: dda:Dd703_0440 DNA protecting protein DprA;
FT                   TIGRFAM: DNA protecting protein DprA; PFAM: SMF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72007"
FT                   /db_xref="GOA:A0A0H3F5E3"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5E3"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ADW72007.1"
FT   gene            400243..400716
FT                   /locus_tag="Rahaq_0378"
FT   CDS_pept        400243..400716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0378"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   spe:Spro_4509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72008"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F521"
FT                   /inference="protein motif:PFAM:PF04361"
FT                   /protein_id="ADW72008.1"
FT   gene            400741..401301
FT                   /locus_tag="Rahaq_0379"
FT   CDS_pept        400741..401301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0379"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase type IA zn finger domain
FT                   protein; KEGG: yen:YE3886 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72009"
FT                   /db_xref="GOA:A0A0H3F7S1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7S1"
FT                   /inference="protein motif:PFAM:PF01396"
FT                   /protein_id="ADW72009.1"
FT   gene            401294..401863
FT                   /locus_tag="Rahaq_0380"
FT   CDS_pept        401294..401863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0380"
FT                   /product="SUA5/yciO/yrdC domain protein"
FT                   /note="PFAM: SUA5/yciO/yrdC domain; KEGG: eca:ECA3996
FT                   putative DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72010"
FT                   /db_xref="GOA:A0A0H3F4A2"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4A2"
FT                   /inference="protein motif:PFAM:PF01300"
FT                   /protein_id="ADW72010.1"
FT   gene            401867..402694
FT                   /locus_tag="Rahaq_0381"
FT   CDS_pept        401867..402694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0381"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="KEGG: yen:YE3884 shikimate 5-dehydrogenase; TIGRFAM:
FT                   shikimate 5-dehydrogenase; PFAM: Shikimate dehydrogenase
FT                   substrate binding domain protein; Shikimate/quinate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72011"
FT                   /db_xref="GOA:A0A0H3FAF5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAF5"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ADW72011.1"
FT   gene            complement(402746..403288)
FT                   /locus_tag="Rahaq_0382"
FT   CDS_pept        complement(402746..403288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0382"
FT                   /product="putative transferase"
FT                   /note="KEGG: ebi:EbC_40910 putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72012"
FT                   /db_xref="GOA:A0A0H3F5E7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5E7"
FT                   /inference="similar to AA sequence:KEGG:EbC_40910"
FT                   /protein_id="ADW72012.1"
FT                   SSNNYVTWKDLYLSQEQ"
FT   gene            403818..405347
FT                   /locus_tag="Rahaq_R0002"
FT   rRNA            403818..405347
FT                   /locus_tag="Rahaq_R0002"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            405424..405500
FT                   /locus_tag="Rahaq_R0003"
FT                   /note="tRNA-Ile1"
FT   tRNA            405424..405500
FT                   /locus_tag="Rahaq_R0003"
FT                   /product="tRNA-Ile"
FT                   /note="GenePRIMP"
FT   gene            405635..405710
FT                   /locus_tag="Rahaq_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            405635..405710
FT                   /locus_tag="Rahaq_R0004"
FT                   /product="tRNA-Ala"
FT   gene            405927..408833
FT                   /locus_tag="Rahaq_R0005"
FT   rRNA            405927..408833
FT                   /locus_tag="Rahaq_R0005"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            408947..409062
FT                   /locus_tag="Rahaq_R0006"
FT   rRNA            408947..409062
FT                   /locus_tag="Rahaq_R0006"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 83.37"
FT   gene            409113..409188
FT                   /locus_tag="Rahaq_R0007"
FT                   /note="tRNA-Thr1"
FT   tRNA            409113..409188
FT                   /locus_tag="Rahaq_R0007"
FT                   /product="tRNA-Thr"
FT   gene            409225..409340
FT                   /locus_tag="Rahaq_R0008"
FT   rRNA            409225..409340
FT                   /locus_tag="Rahaq_R0008"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 83.46"
FT   gene            complement(409476..411143)
FT                   /locus_tag="Rahaq_0383"
FT   CDS_pept        complement(409476..411143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0383"
FT                   /product="cation/acetate symporter ActP"
FT                   /note="KEGG: spe:Spro_0295 acetate permease; TIGRFAM:
FT                   cation/acetate symporter ActP; SSS sodium solute
FT                   transporter superfamily; PFAM: Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72013"
FT                   /db_xref="GOA:A0A0H3F525"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F525"
FT                   /inference="protein motif:TFAM:TIGR02711"
FT                   /protein_id="ADW72013.1"
FT   sig_peptide     complement(411072..411143)
FT                   /locus_tag="Rahaq_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(411140..411451)
FT                   /locus_tag="Rahaq_0384"
FT   CDS_pept        complement(411140..411451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0384"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   yen:YE0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72014"
FT                   /db_xref="GOA:A0A0H3F7S6"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7S6"
FT                   /inference="protein motif:PFAM:PF04341"
FT                   /protein_id="ADW72014.1"
FT   gene            complement(411507..413468)
FT                   /locus_tag="Rahaq_0385"
FT   CDS_pept        complement(411507..413468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0385"
FT                   /product="acetate/CoA ligase"
FT                   /note="KEGG: spe:Spro_0297 acetyl-CoA synthetase; TIGRFAM:
FT                   acetate/CoA ligase; PFAM: AMP-dependent synthetase and
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72015"
FT                   /db_xref="GOA:A0A0H3F4A5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4A5"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ADW72015.1"
FT                   PGVVDKLLEEKQSMKVPS"
FT   gene            413984..414562
FT                   /locus_tag="Rahaq_0386"
FT   CDS_pept        413984..414562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0386"
FT                   /product="Fimbrial protein domain-containing protein"
FT                   /note="PFAM: Fimbrial protein domain-containing protein;
FT                   KEGG: ypi:YpsIP31758_4107 fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72016"
FT                   /db_xref="GOA:A0A0H3FAG0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAG0"
FT                   /inference="protein motif:PFAM:PF00419"
FT                   /protein_id="ADW72016.1"
FT   sig_peptide     413984..414055
FT                   /locus_tag="Rahaq_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            414664..417165
FT                   /locus_tag="Rahaq_0387"
FT   CDS_pept        414664..417165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0387"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: yps:YPTB3895 outer membrane fimbrial usher
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72017"
FT                   /db_xref="GOA:A0A0H3F5F2"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5F2"
FT                   /inference="protein motif:PFAM:PF00577"
FT                   /protein_id="ADW72017.1"
FT   gene            417212..417949
FT                   /locus_tag="Rahaq_0388"
FT   CDS_pept        417212..417949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0388"
FT                   /product="Pili assembly chaperone, N-terminal protein"
FT                   /note="PFAM: Pili assembly chaperone, N-terminal; Pili
FT                   assembly chaperone, C-terminal; KEGG: ypb:YPTS_4111 pili
FT                   assembly chaperone, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72018"
FT                   /db_xref="GOA:A0A0H3F530"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F530"
FT                   /inference="protein motif:PFAM:PF00345"
FT                   /protein_id="ADW72018.1"
FT   sig_peptide     417212..417286
FT                   /locus_tag="Rahaq_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.979 at
FT                   residue 25"
FT   gene            417959..418930
FT                   /locus_tag="Rahaq_0389"
FT   CDS_pept        417959..418930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_4104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72019"
FT                   /db_xref="GOA:A0A0H3F7T1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7T1"
FT                   /inference="similar to AA sequence:KEGG:YpsIP31758_4104"
FT                   /protein_id="ADW72019.1"
FT   sig_peptide     417959..418042
FT                   /locus_tag="Rahaq_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.877 at
FT                   residue 28"
FT   gene            418958..419230
FT                   /locus_tag="Rahaq_0390"
FT   CDS_pept        418958..419230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0390"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: plu:plu0900 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72020"
FT                   /db_xref="GOA:A0A0H3F4A9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4A9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADW72020.1"
FT   gene            complement(419255..419812)
FT                   /locus_tag="Rahaq_0391"
FT   CDS_pept        complement(419255..419812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_01390 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72021"
FT                   /db_xref="GOA:A0A0H3FAG6"
FT                   /db_xref="InterPro:IPR031854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAG6"
FT                   /inference="similar to AA sequence:KEGG:PFHG_01390"
FT                   /protein_id="ADW72021.1"
FT   gene            complement(419802..420683)
FT                   /locus_tag="Rahaq_0392"
FT   CDS_pept        complement(419802..420683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0392"
FT                   /product="transcriptional regulator, CadC"
FT                   /note="PFAM: transcriptional regulator domain-containing
FT                   protein; KEGG: spe:Spro_1500 transcriptional regulator,
FT                   CadC"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72022"
FT                   /db_xref="GOA:A0A0H3F5F6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5F6"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADW72022.1"
FT                   SYYTNDRTTHVQ"
FT   gene            complement(420932..421960)
FT                   /locus_tag="Rahaq_0393"
FT   CDS_pept        complement(420932..421960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0393"
FT                   /product="peptidase U61 LD-carboxypeptidase A"
FT                   /note="PFAM: peptidase U61 LD-carboxypeptidase A; KEGG:
FT                   dze:Dd1591_1452 peptidase U61 LD-carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72023"
FT                   /db_xref="GOA:A0A0H3F536"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F536"
FT                   /inference="protein motif:PFAM:PF02016"
FT                   /protein_id="ADW72023.1"
FT                   QQ"
FT   gene            complement(422052..423368)
FT                   /locus_tag="Rahaq_0394"
FT   CDS_pept        complement(422052..423368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0394"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bmj:BMULJ_06130 putative sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72024"
FT                   /db_xref="GOA:A0A0H3F7T8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7T8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADW72024.1"
FT   gene            complement(423361..424521)
FT                   /locus_tag="Rahaq_0395"
FT   CDS_pept        complement(423361..424521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0395"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bmj:BMULJ_06131 mandelate racemase (MR)-like
FT                   subfamily protein of the enolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72025"
FT                   /db_xref="GOA:A0A0H3F4B4"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4B4"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ADW72025.1"
FT   gene            complement(424743..424818)
FT                   /locus_tag="Rahaq_R0009"
FT                   /note="tRNA-Phe2"
FT   tRNA            complement(424743..424818)
FT                   /locus_tag="Rahaq_R0009"
FT                   /product="tRNA-Phe"
FT   gene            complement(424948..425523)
FT                   /locus_tag="Rahaq_0396"
FT   CDS_pept        complement(424948..425523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0396"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: yen:YE0346 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72026"
FT                   /db_xref="GOA:A0A0H3FAH3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAH3"
FT                   /inference="similar to AA sequence:KEGG:YE0346"
FT                   /protein_id="ADW72026.1"
FT   gene            complement(425567..427303)
FT                   /locus_tag="Rahaq_0397"
FT   CDS_pept        complement(425567..427303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0397"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number=""
FT                   /note="KEGG: spe:Spro_0403 thiol:disulfide interchange
FT                   protein precursor; PFAM: cytochrome c biogenesis protein
FT                   transmembrane region; Thioredoxin domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72027"
FT                   /db_xref="GOA:A0A0H3F5G0"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5G0"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW72027.1"
FT                   HP"
FT   sig_peptide     complement(427229..427303)
FT                   /locus_tag="Rahaq_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.968 at
FT                   residue 25"
FT   gene            complement(427474..428775)
FT                   /locus_tag="Rahaq_0398"
FT   CDS_pept        complement(427474..428775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0398"
FT                   /product="anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family"
FT                   /note="KEGG: spe:Spro_0405 anaerobic C4-dicarboxylate
FT                   transporter; TIGRFAM: anaerobic c4-dicarboxylate
FT                   antiporter, Dcu family; PFAM: anaerobic c4-dicarboxylate
FT                   membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72028"
FT                   /db_xref="GOA:A0A0H3F541"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F541"
FT                   /inference="protein motif:TFAM:TIGR00770"
FT                   /protein_id="ADW72028.1"
FT   gene            complement(428911..430347)
FT                   /locus_tag="Rahaq_0399"
FT   CDS_pept        complement(428911..430347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0399"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="KEGG: spe:Spro_0406 aspartate ammonia-lyase;
FT                   TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate lyase;
FT                   Fumarase C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72029"
FT                   /db_xref="GOA:A0A0H3F7U2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7U2"
FT                   /inference="protein motif:TFAM:TIGR00839"
FT                   /protein_id="ADW72029.1"
FT   gene            430721..431212
FT                   /locus_tag="Rahaq_0400"
FT   CDS_pept        430721..431212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0400"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="PFAM: FxsA cytoplasmic membrane protein; KEGG:
FT                   spe:Spro_0407 FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72030"
FT                   /db_xref="GOA:A0A0H3F4B8"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4B8"
FT                   /inference="protein motif:PFAM:PF04186"
FT                   /protein_id="ADW72030.1"
FT                   "
FT   gene            431427..431720
FT                   /locus_tag="Rahaq_0401"
FT   CDS_pept        431427..431720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0401"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: dze:Dd1591_3530
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72031"
FT                   /db_xref="GOA:A0A0H3FAH7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAH7"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADW72031.1"
FT   gene            431774..433420
FT                   /locus_tag="Rahaq_0402"
FT   CDS_pept        431774..433420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0402"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: ypb:YPTS_0431 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72032"
FT                   /db_xref="GOA:A0A0H3F5G4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5G4"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADW72032.1"
FT   gene            433709..434065
FT                   /locus_tag="Rahaq_0403"
FT   CDS_pept        433709..434065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0403"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: spe:Spro_0410 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72033"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F545"
FT                   /inference="similar to AA sequence:KEGG:Spro_0410"
FT                   /protein_id="ADW72033.1"
FT                   PVDSKMVGQVYKCP"
FT   sig_peptide     433709..433801
FT                   /locus_tag="Rahaq_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.822 at
FT                   residue 31"
FT   gene            434105..434257
FT                   /pseudo
FT                   /locus_tag="Rahaq_0404"
FT   gene            complement(434254..435282)
FT                   /locus_tag="Rahaq_0405"
FT   CDS_pept        complement(434254..435282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0405"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number=""
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   KEGG: ypi:YpsIP31758_3673 KamA family iron-sulfur
FT                   cluster-binding protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72034"
FT                   /db_xref="GOA:A0A0H3F7U8"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7U8"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ADW72034.1"
FT                   QS"
FT   gene            435321..435887
FT                   /locus_tag="Rahaq_0406"
FT   CDS_pept        435321..435887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0406"
FT                   /product="translation elongation factor P"
FT                   /note="KEGG: spe:Spro_0412 elongation factor P; TIGRFAM:
FT                   translation elongation factor P; PFAM: Elongation factor P
FT                   ; Elongation factor KOW-like domain-containing protein;
FT                   Elongation factor P/YeiP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72035"
FT                   /db_xref="GOA:A0A0H3F4C2"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4C2"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ADW72035.1"
FT   gene            435983..436111
FT                   /locus_tag="Rahaq_0407"
FT   CDS_pept        435983..436111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0407"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: spe:Spro_0413
FT                   entericidin EcnAB"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72036"
FT                   /db_xref="GOA:A0A0H3FAI3"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAI3"
FT                   /inference="protein motif:PFAM:PF08085"
FT                   /protein_id="ADW72036.1"
FT   sig_peptide     435983..436063
FT                   /locus_tag="Rahaq_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 27"
FT   gene            436230..436364
FT                   /locus_tag="Rahaq_0408"
FT   CDS_pept        436230..436364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0408"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: ebi:EbC_04350
FT                   entericidin B"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72037"
FT                   /db_xref="GOA:A0A0H3F5G7"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5G7"
FT                   /inference="protein motif:PFAM:PF08085"
FT                   /protein_id="ADW72037.1"
FT   sig_peptide     436230..436295
FT                   /locus_tag="Rahaq_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 22"
FT   gene            complement(436454..436978)
FT                   /locus_tag="Rahaq_0409"
FT   CDS_pept        complement(436454..436978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0409"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin family protein; KEGG: yen:YE0360
FT                   outer membrane lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72038"
FT                   /db_xref="GOA:A0A0H3F552"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F552"
FT                   /inference="protein motif:PFAM:PF08212"
FT                   /protein_id="ADW72038.1"
FT                   DTSKLVWVKQP"
FT   sig_peptide     complement(436916..436978)
FT                   /locus_tag="Rahaq_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.428 at
FT                   residue 21"
FT   gene            complement(437103..437462)
FT                   /locus_tag="Rahaq_0410"
FT   CDS_pept        complement(437103..437462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0410"
FT                   /product="fumarate reductase D subunit"
FT                   /note="PFAM: fumarate reductase D subunit; KEGG:
FT                   sbo:SBO_4305 fumarate reductase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72039"
FT                   /db_xref="GOA:A0A0H3F7V3"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7V3"
FT                   /inference="protein motif:PFAM:PF02313"
FT                   /protein_id="ADW72039.1"
FT                   ATILSIVTLIVLIRL"
FT   gene            complement(437472..437882)
FT                   /locus_tag="Rahaq_0411"
FT   CDS_pept        complement(437472..437882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0411"
FT                   /product="fumarate reductase subunit C"
FT                   /note="PFAM: fumarate reductase subunit C; KEGG:
FT                   esa:ESA_00163 fumarate reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72040"
FT                   /db_xref="GOA:A0A0H3F4C7"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4C7"
FT                   /inference="protein motif:PFAM:PF02300"
FT                   /protein_id="ADW72040.1"
FT   gene            complement(437894..438628)
FT                   /locus_tag="Rahaq_0412"
FT   CDS_pept        complement(437894..438628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0412"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /note="KEGG: ddd:Dda3937_02146 fumarate reductase
FT                   (anaerobic), Fe-S subunit; TIGRFAM: succinate dehydrogenase
FT                   and fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72041"
FT                   /db_xref="GOA:A0A0H3FAI9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAI9"
FT                   /inference="protein motif:TFAM:TIGR00384"
FT                   /protein_id="ADW72041.1"
FT   gene            complement(438621..440420)
FT                   /locus_tag="Rahaq_0413"
FT   CDS_pept        complement(438621..440420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0413"
FT                   /product="fumarate reductase, flavoprotein subunit"
FT                   /note="KEGG: spe:Spro_0419 fumarate reductase flavoprotein
FT                   subunit; TIGRFAM: fumarate reductase, flavoprotein subunit;
FT                   succinate dehydrogenase or fumarate reductase, flavoprotein
FT                   subunit; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72042"
FT                   /db_xref="GOA:A0A0H3F5H0"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5H0"
FT                   /inference="protein motif:TFAM:TIGR01176"
FT                   /protein_id="ADW72042.1"
FT   gene            440704..441681
FT                   /locus_tag="Rahaq_0414"
FT   CDS_pept        440704..441681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0414"
FT                   /product="lysyl-tRNA synthetase-related protein GenX"
FT                   /note="KEGG: spe:Spro_0420 lysyl-tRNA synthetase; TIGRFAM:
FT                   lysyl-tRNA synthetase-related protein GenX; PFAM: tRNA
FT                   synthetase class II (D K and N)"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72043"
FT                   /db_xref="GOA:A0A0H3F557"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F557"
FT                   /inference="protein motif:TFAM:TIGR00462"
FT                   /protein_id="ADW72043.1"
FT   gene            441947..443311
FT                   /locus_tag="Rahaq_0415"
FT   CDS_pept        441947..443311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0415"
FT                   /product="xanthine permease"
FT                   /note="KEGG: ebi:EbC_00110 purine permease; TIGRFAM:
FT                   xanthine permease; uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72044"
FT                   /db_xref="GOA:A0A0H3F7V8"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7V8"
FT                   /inference="protein motif:TFAM:TIGR03173"
FT                   /protein_id="ADW72044.1"
FT   gene            443406..444764
FT                   /locus_tag="Rahaq_0416"
FT   CDS_pept        443406..444764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0416"
FT                   /product="S-adenosylhomocysteine deaminase"
FT                   /EC_number=""
FT                   /note="KEGG: ebi:EbC_00100 amidohydrolase; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72045"
FT                   /db_xref="GOA:A0A0H3F4D0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4D0"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW72045.1"
FT   gene            complement(444833..448201)
FT                   /locus_tag="Rahaq_0417"
FT   CDS_pept        complement(444833..448201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0417"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   yps:YPTB0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72046"
FT                   /db_xref="GOA:A0A0H3FAJ4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAJ4"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADW72046.1"
FT                   GSGRSGNSSRSPGDL"
FT   sig_peptide     complement(448136..448201)
FT                   /locus_tag="Rahaq_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.556 at
FT                   residue 22"
FT   gene            complement(448249..449226)
FT                   /locus_tag="Rahaq_0418"
FT   CDS_pept        complement(448249..449226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0418"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /note="KEGG: spe:Spro_0422 phosphatidylserine
FT                   decarboxylase; TIGRFAM: phosphatidylserine decarboxylase;
FT                   PFAM: phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72047"
FT                   /db_xref="GOA:A0A0H3F5H4"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5H4"
FT                   /inference="protein motif:TFAM:TIGR00163"
FT                   /protein_id="ADW72047.1"
FT   gene            complement(449409..450446)
FT                   /locus_tag="Rahaq_0419"
FT   CDS_pept        complement(449409..450446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0419"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="KEGG: spe:Spro_0423 ribosome-associated GTPase;
FT                   TIGRFAM: ribosome small subunit-dependent GTPase A; PFAM:
FT                   GTPase EngC"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72048"
FT                   /db_xref="GOA:A0A0H3F563"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F563"
FT                   /inference="protein motif:TFAM:TIGR00157"
FT                   /protein_id="ADW72048.1"
FT                   NFDTL"
FT   gene            450573..451127
FT                   /locus_tag="Rahaq_0420"
FT   CDS_pept        450573..451127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0420"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="KEGG: yen:YE0369 oligoribonuclease; PFAM:
FT                   Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72049"
FT                   /db_xref="GOA:A0A0H3F7W2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7W2"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ADW72049.1"
FT   gene            451312..451387
FT                   /locus_tag="Rahaq_R0010"
FT                   /note="tRNA-Gly1"
FT   tRNA            451312..451387
FT                   /locus_tag="Rahaq_R0010"
FT                   /product="tRNA-Gly"
FT   gene            451445..451520
FT                   /locus_tag="Rahaq_R0011"
FT                   /note="tRNA-Gly2"
FT   tRNA            451445..451520
FT                   /locus_tag="Rahaq_R0011"
FT                   /product="tRNA-Gly"
FT                   /note="GenePRIMP"
FT   gene            451582..451657
FT                   /locus_tag="Rahaq_R0012"
FT                   /note="tRNA-Gly3"
FT   tRNA            451582..451657
FT                   /locus_tag="Rahaq_R0012"
FT                   /product="tRNA-Gly"
FT                   /note="GenePRIMP"
FT   gene            complement(451972..453126)
FT                   /locus_tag="Rahaq_0421"
FT   CDS_pept        complement(451972..453126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0421"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="manually curated; TIGRFAM: iron-sulfur cluster
FT                   binding protein; KEGG: spe:Spro_0425 putative iron-sulfur
FT                   cluster binding protein; PFAM: domain of unknown function
FT                   DUF1730"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72050"
FT                   /db_xref="GOA:A0A0H3F4D4"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4D4"
FT                   /inference="protein motif:TFAM:TIGR00276"
FT                   /protein_id="ADW72050.1"
FT   gene            453125..454639
FT                   /locus_tag="Rahaq_0422"
FT   CDS_pept        453125..454639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0422"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="KEGG: stm:STM4356 putative ATP binding site; other
FT                   site; TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72051"
FT                   /db_xref="GOA:A0A0H3FAJ7"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAJ7"
FT                   /inference="protein motif:TFAM:TIGR00197"
FT                   /protein_id="ADW72051.1"
FT   gene            454650..455117
FT                   /locus_tag="Rahaq_0423"
FT   CDS_pept        454650..455117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0423"
FT                   /product="Uncharacterized protein family UPF0079, ATPase"
FT                   /note="PFAM: Uncharacterised protein family UPF0079,
FT                   ATPase; KEGG: spe:Spro_0427 putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72052"
FT                   /db_xref="GOA:A0A0H3F5H6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5H6"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADW72052.1"
FT   gene            455125..456891
FT                   /locus_tag="Rahaq_0424"
FT   CDS_pept        455125..456891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0424"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="KEGG: ypz:YPZ3_0369 putative
FT                   N-acetylmuramoyl-L-alanine amidase-family protein; PFAM:
FT                   cell wall hydrolase/autolysin; Peptidoglycan-binding lysin
FT                   domain; SMART: cell wall hydrolase/autolysin;
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72053"
FT                   /db_xref="GOA:A0A0H3F566"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F566"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ADW72053.1"
FT                   VQLGQTLTIPQS"
FT   sig_peptide     455125..455220
FT                   /locus_tag="Rahaq_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 32"
FT   gene            456923..458842
FT                   /locus_tag="Rahaq_0425"
FT   CDS_pept        456923..458842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0425"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="KEGG: spe:Spro_0429 DNA mismatch repair protein;
FT                   TIGRFAM: DNA mismatch repair protein MutL; PFAM: DNA
FT                   mismatch repair protein domain protein; ATP-binding region
FT                   ATPase domain protein; MutL dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72054"
FT                   /db_xref="GOA:A0A0H3F7W6"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7W6"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ADW72054.1"
FT                   FKHD"
FT   gene            458835..459776
FT                   /locus_tag="Rahaq_0426"
FT   CDS_pept        458835..459776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0426"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /note="TIGRFAM: tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; KEGG: spe:Spro_0430 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; PFAM: tRNA
FT                   isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72055"
FT                   /db_xref="GOA:A0A0H3F4D7"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4D7"
FT                   /inference="protein motif:TFAM:TIGR00174"
FT                   /protein_id="ADW72055.1"
FT   gene            459891..460199
FT                   /locus_tag="Rahaq_0427"
FT   CDS_pept        459891..460199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0427"
FT                   /product="RNA chaperone Hfq"
FT                   /note="KEGG: yen:YE0377 RNA-binding protein Hfq; TIGRFAM:
FT                   RNA chaperone Hfq; PFAM: Like-Sm ribonucleoprotein core"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72056"
FT                   /db_xref="GOA:A0A0H3FAK0"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAK0"
FT                   /inference="protein motif:TFAM:TIGR02383"
FT                   /protein_id="ADW72056.1"
FT   gene            460298..461602
FT                   /locus_tag="Rahaq_0428"
FT   CDS_pept        460298..461602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0428"
FT                   /product="GTP-binding proten HflX"
FT                   /note="KEGG: spe:Spro_0432 putative GTPase HflX; TIGRFAM:
FT                   GTP-binding proten HflX; small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72057"
FT                   /db_xref="GOA:A0A0H3F5H9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5H9"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ADW72057.1"
FT   gene            461636..462934
FT                   /locus_tag="Rahaq_0429"
FT   CDS_pept        461636..462934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0429"
FT                   /product="HflK protein"
FT                   /note="TIGRFAM: HflK protein; PFAM: band 7 protein; KEGG:
FT                   spe:Spro_0433 FtsH protease regulator HflK; SMART: band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72058"
FT                   /db_xref="GOA:A0A0H3F571"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F571"
FT                   /inference="protein motif:TFAM:TIGR01933"
FT                   /protein_id="ADW72058.1"
FT   gene            462937..463935
FT                   /locus_tag="Rahaq_0430"
FT   CDS_pept        462937..463935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0430"
FT                   /product="HflC protein"
FT                   /note="TIGRFAM: HflC protein; PFAM: band 7 protein; KEGG:
FT                   yen:YE0380 FtsH protease regulator HflC; SMART: band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72059"
FT                   /db_xref="GOA:A0A0H3F7X1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7X1"
FT                   /inference="protein motif:TFAM:TIGR01932"
FT                   /protein_id="ADW72059.1"
FT   sig_peptide     462937..463011
FT                   /locus_tag="Rahaq_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.383 at
FT                   residue 25"
FT   gene            464033..464233
FT                   /locus_tag="Rahaq_0431"
FT   CDS_pept        464033..464233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0431"
FT                   /product="Protein of unknown function DUF2065"
FT                   /note="PFAM: Protein of unknown function DUF2065; KEGG:
FT                   pwa:Pecwa_3915 protein of unknown function DUF2065"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72060"
FT                   /db_xref="GOA:A0A0H3F4E2"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4E2"
FT                   /inference="protein motif:PFAM:PF09838"
FT                   /protein_id="ADW72060.1"
FT   gene            464378..465676
FT                   /locus_tag="Rahaq_0432"
FT   CDS_pept        464378..465676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0432"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number=""
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: spe:Spro_0436
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72061"
FT                   /db_xref="GOA:A0A0H3FAK4"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAK4"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADW72061.1"
FT   gene            465904..466329
FT                   /locus_tag="Rahaq_0433"
FT   CDS_pept        465904..466329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0433"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="KEGG: ypb:YPTS_0460 transcriptional repressor NsrR;
FT                   TIGRFAM: transcriptional regulator, Rrf2 family; PFAM:
FT                   protein of unknown function UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72062"
FT                   /db_xref="GOA:A0A0H3F5I3"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR023761"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5I3"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADW72062.1"
FT   gene            466371..468869
FT                   /locus_tag="Rahaq_0434"
FT   CDS_pept        466371..468869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0434"
FT                   /product="ribonuclease R"
FT                   /note="TIGRFAM: ribonuclease R; VacB and RNase II family
FT                   3'-5' exoribonuclease; PFAM: ribonuclease II; Ribonuclease
FT                   B OB region domain; Ribonuclease R winged-helix domain
FT                   protein; RNA binding S1 domain protein; KEGG: yen:YE0384
FT                   exoribonuclease R; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72063"
FT                   /db_xref="GOA:A0A0H3F575"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F575"
FT                   /inference="protein motif:TFAM:TIGR02063"
FT                   /protein_id="ADW72063.1"
FT   gene            468890..469705
FT                   /locus_tag="Rahaq_0435"
FT   CDS_pept        468890..469705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0435"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: yen:YE0385 23S rRNA
FT                   (guanosine-2'-O-)-methyltransferase; TIGRFAM: RNA
FT                   methyltransferase, TrmH family, group 3; PFAM: tRNA/rRNA
FT                   methyltransferase (SpoU); RNA 2-O ribose methyltransferase
FT                   substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72064"
FT                   /db_xref="GOA:A0A0H3F7X6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7X6"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADW72064.1"
FT   gene            469842..471473
FT                   /locus_tag="Rahaq_0436"
FT   CDS_pept        469842..471473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0436"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: spe:Spro_0440 isovaleryl CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72065"
FT                   /db_xref="GOA:A0A0H3F4E4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4E4"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADW72065.1"
FT   gene            complement(471474..471785)
FT                   /locus_tag="Rahaq_0437"
FT   CDS_pept        complement(471474..471785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0437"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   spe:Spro_0443 putative biofilm stress and motility protein
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72066"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAK8"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ADW72066.1"
FT   sig_peptide     complement(471711..471785)
FT                   /locus_tag="Rahaq_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.585 at
FT                   residue 25"
FT   gene            complement(471882..473831)
FT                   /locus_tag="Rahaq_0438"
FT   CDS_pept        complement(471882..473831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0438"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: pct:PC1_3437 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; PAS fold-4
FT                   domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72067"
FT                   /db_xref="GOA:A0A0H3F5I6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5I6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADW72067.1"
FT                   HLSQLVSVFKISER"
FT   sig_peptide     complement(473709..473831)
FT                   /locus_tag="Rahaq_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.553 at
FT                   residue 41"
FT   gene            474111..474860
FT                   /locus_tag="Rahaq_0439"
FT   CDS_pept        474111..474860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0439"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   ypi:YpsIP31758_3640 esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72068"
FT                   /db_xref="GOA:A0A0H3F580"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F580"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ADW72068.1"
FT   gene            475011..475403
FT                   /locus_tag="Rahaq_0440"
FT   CDS_pept        475011..475403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0440"
FT                   /product="ribosomal protein S6"
FT                   /note="KEGG: eca:ECA3613 30S ribosomal protein S6; TIGRFAM:
FT                   ribosomal protein S6; PFAM: Ribosomal protein S6,
FT                   bacterial-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72069"
FT                   /db_xref="GOA:A0A0H3F7Y3"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7Y3"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ADW72069.1"
FT   gene            475409..475726
FT                   /locus_tag="Rahaq_0441"
FT   CDS_pept        475409..475726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0441"
FT                   /product="single-strand binding protein/Primosomal
FT                   replication protein n"
FT                   /note="KEGG: dda:Dd703_0795 primosomal replication protein
FT                   N; manually curated; PFAM: single-strand binding
FT                   protein/Primosomal replication protein n"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72070"
FT                   /db_xref="GOA:A0A0H3F4E9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4E9"
FT                   /inference="protein motif:PFAM:PF00436"
FT                   /protein_id="ADW72070.1"
FT                   D"
FT   gene            475731..475958
FT                   /locus_tag="Rahaq_0442"
FT   CDS_pept        475731..475958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0442"
FT                   /product="ribosomal protein S18"
FT                   /note="KEGG: spe:Spro_0448 30S ribosomal protein S18;
FT                   TIGRFAM: ribosomal protein S18; PFAM: ribosomal protein
FT                   S18"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72071"
FT                   /db_xref="GOA:A0A0H3FAL3"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAL3"
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /protein_id="ADW72071.1"
FT   gene            475998..476450
FT                   /locus_tag="Rahaq_0443"
FT   CDS_pept        475998..476450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0443"
FT                   /product="ribosomal protein L9"
FT                   /note="KEGG: spe:Spro_0449 50S ribosomal protein L9;
FT                   TIGRFAM: ribosomal protein L9; PFAM: Ribosomal protein
FT                   L9-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72072"
FT                   /db_xref="GOA:A0A0H3F5I9"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5I9"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ADW72072.1"
FT   gene            complement(476538..477248)
FT                   /locus_tag="Rahaq_0444"
FT   CDS_pept        complement(476538..477248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0444"
FT                   /product="Opacity-associated protein A domain protein"
FT                   /note="PFAM: Opacity-associated protein A domain protein;
FT                   KEGG: spe:Spro_0451 opacity-associated protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72073"
FT                   /db_xref="GOA:A0A0H3F586"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F586"
FT                   /inference="protein motif:PFAM:PF08525"
FT                   /protein_id="ADW72073.1"
FT                   TFTRQPDGSFQRGN"
FT   gene            477504..478124
FT                   /locus_tag="Rahaq_0445"
FT   CDS_pept        477504..478124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0445"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; FKBP-type
FT                   peptidyl-prolyl isomerase domain protein; KEGG:
FT                   pct:PC1_3428 peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72074"
FT                   /db_xref="GOA:A0A0H3F7Y8"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7Y8"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ADW72074.1"
FT   gene            complement(478190..478855)
FT                   /locus_tag="Rahaq_0446"
FT   CDS_pept        complement(478190..478855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0446"
FT                   /product="iron-sulfur cluster repair di-iron protein"
FT                   /note="KEGG: ypy:YPK_3777 iron-sulfur cluster repair
FT                   di-iron protein; TIGRFAM: iron-sulfur cluster repair
FT                   di-iron protein; PFAM: protein of unknown function DUF542
FT                   ScdA domain protein; Hemerythrin HHE cation binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72075"
FT                   /db_xref="GOA:A0A0H3F4F3"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023742"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4F3"
FT                   /inference="protein motif:TFAM:TIGR03652"
FT                   /protein_id="ADW72075.1"
FT   gene            complement(478979..480928)
FT                   /locus_tag="Rahaq_0447"
FT   CDS_pept        complement(478979..480928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0447"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
FT                   /note="KEGG: spe:Spro_0453 bifunctional 2',3'-cyclic
FT                   nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic
FT                   precursor protein; TIGRFAM: 2',3'-cyclic-nucleotide
FT                   2'-phosphodiesterase; PFAM: 5'-Nucleotidase
FT                   domain-containing protein; metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72076"
FT                   /db_xref="GOA:A0A0H3FAL8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006294"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAL8"
FT                   /inference="protein motif:TFAM:TIGR01390"
FT                   /protein_id="ADW72076.1"
FT                   DAIGFQIYQVDLQK"
FT   sig_peptide     complement(480863..480928)
FT                   /locus_tag="Rahaq_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.987 at
FT                   residue 22"
FT   gene            481127..481873
FT                   /locus_tag="Rahaq_0448"
FT   CDS_pept        481127..481873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0448"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="KEGG: dze:Dd1591_0784
FT                   adenosine-3'(2'),5'-bisphosphate nucleotidase; TIGRFAM:
FT                   3'(2'),5'-bisphosphate nucleotidase; PFAM: inositol
FT                   monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72077"
FT                   /db_xref="GOA:A0A0H3F5J3"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5J3"
FT                   /inference="protein motif:TFAM:TIGR01331"
FT                   /protein_id="ADW72077.1"
FT   gene            complement(481909..482466)
FT                   /locus_tag="Rahaq_0449"
FT   CDS_pept        complement(481909..482466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0449"
FT                   /product="Conserved hypothetical protein, YtfJ"
FT                   /note="PFAM: Conserved hypothetical protein, YtfJ; KEGG:
FT                   spe:Spro_0455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72078"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F591"
FT                   /inference="protein motif:PFAM:PF09695"
FT                   /protein_id="ADW72078.1"
FT   sig_peptide     complement(482404..482466)
FT                   /locus_tag="Rahaq_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 21"
FT   gene            482776..482982
FT                   /locus_tag="Rahaq_0450"
FT   CDS_pept        482776..482982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0450"
FT                   /product="protein of unknown function DUF1107"
FT                   /note="PFAM: protein of unknown function DUF1107; KEGG:
FT                   spe:Spro_0456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72079"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7Z4"
FT                   /inference="protein motif:PFAM:PF06526"
FT                   /protein_id="ADW72079.1"
FT   gene            complement(483096..484445)
FT                   /locus_tag="Rahaq_0451"
FT   CDS_pept        complement(483096..484445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0451"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   yen:YE0403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72080"
FT                   /db_xref="GOA:A0A0H3F4F7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4F7"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADW72080.1"
FT   sig_peptide     complement(484365..484445)
FT                   /locus_tag="Rahaq_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.873 at
FT                   residue 27"
FT   gene            complement(484673..485311)
FT                   /locus_tag="Rahaq_0452"
FT   CDS_pept        complement(484673..485311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0452"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   KEGG: spe:Spro_0458 methionine sulfoxide reductase A; PFAM:
FT                   Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72081"
FT                   /db_xref="GOA:A0A0H3FAM3"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAM3"
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /protein_id="ADW72081.1"
FT   gene            485581..487317
FT                   /locus_tag="Rahaq_0453"
FT   CDS_pept        485581..487317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0453"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat-containing protein; KEGG:
FT                   spe:Spro_0459 surface antigen (D15)"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72082"
FT                   /db_xref="GOA:A0A0H3F5J7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5J7"
FT                   /inference="protein motif:PFAM:PF01103"
FT                   /protein_id="ADW72082.1"
FT                   EL"
FT   sig_peptide     485581..485646
FT                   /locus_tag="Rahaq_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.896 at
FT                   residue 22"
FT   gene            487314..491129
FT                   /locus_tag="Rahaq_0454"
FT   CDS_pept        487314..491129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0454"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   spe:Spro_0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72083"
FT                   /db_xref="GOA:A0A0H3F596"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F596"
FT                   /inference="protein motif:PFAM:PF04357"
FT                   /protein_id="ADW72083.1"
FT   gene            491161..491514
FT                   /locus_tag="Rahaq_0455"
FT   CDS_pept        491161..491514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0455"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: etr:ETAE_0379
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72084"
FT                   /db_xref="GOA:A0A0H3F7Z9"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7Z9"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ADW72084.1"
FT                   GGDWVKRNEAVSE"
FT   gene            complement(491616..492146)
FT                   /locus_tag="Rahaq_0456"
FT   CDS_pept        complement(491616..492146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0456"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number=""
FT                   /note="KEGG: etr:ETAE_0380 inorganic pyrophosphatase; PFAM:
FT                   Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72085"
FT                   /db_xref="GOA:A0A0H3F4G2"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4G2"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW72085.1"
FT                   AEIVTSFERAKNK"
FT   gene            complement(492301..492420)
FT                   /locus_tag="Rahaq_0457"
FT   CDS_pept        complement(492301..492420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADW72086.1"
FT   gene            492463..494034
FT                   /locus_tag="Rahaq_0458"
FT   CDS_pept        492463..494034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0458"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: spe:Spro_0463 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72087"
FT                   /db_xref="GOA:A0A0H3F5K2"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5K2"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADW72087.1"
FT                   NRADHF"
FT   sig_peptide     492463..492552
FT                   /locus_tag="Rahaq_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.529 at
FT                   residue 30"
FT   gene            complement(494158..495162)
FT                   /locus_tag="Rahaq_0459"
FT   CDS_pept        complement(494158..495162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0459"
FT                   /product="Fructose-bisphosphatase"
FT                   /EC_number=""
FT                   /note="KEGG: pay:PAU_04051 fructose-1,6-bisphosphatase
FT                   (d-fructose-1,6-bisphosphate 1 phosphohydrolase) (fbpase);
FT                   PFAM: Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72088"
FT                   /db_xref="GOA:A0A0H3F5A1"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5A1"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW72088.1"
FT   gene            495330..496715
FT                   /locus_tag="Rahaq_0460"
FT   CDS_pept        495330..496715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0460"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="KEGG: spe:Spro_0465 UDP-N-acetylmuramate; TIGRFAM:
FT                   UDP-N-acetylmuramate; PFAM: cytoplasmic peptidoglycan
FT                   synthetase domain protein; Mur ligase middle domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72089"
FT                   /db_xref="GOA:A0A0H3F805"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F805"
FT                   /inference="protein motif:TFAM:TIGR01081"
FT                   /protein_id="ADW72089.1"
FT                   QVQ"
FT   sig_peptide     495330..495404
FT                   /locus_tag="Rahaq_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.732) with cleavage site probability 0.366 at
FT                   residue 25"
FT   gene            complement(497014..497286)
FT                   /locus_tag="Rahaq_0461"
FT   CDS_pept        complement(497014..497286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0461"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   pam:PANA_3550 YhcN"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72090"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4G5"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ADW72090.1"
FT   sig_peptide     complement(497209..497286)
FT                   /locus_tag="Rahaq_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 26"
FT   gene            complement(497357..497458)
FT                   /locus_tag="Rahaq_0462"
FT   CDS_pept        complement(497357..497458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADW72091.1"
FT   gene            complement(497488..497751)
FT                   /locus_tag="Rahaq_0463"
FT   CDS_pept        complement(497488..497751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0463"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   yen:YE0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72092"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5K7"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ADW72092.1"
FT   sig_peptide     complement(497683..497751)
FT                   /locus_tag="Rahaq_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(498202..498672)
FT                   /locus_tag="Rahaq_0464"
FT   CDS_pept        complement(498202..498672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0464"
FT                   /product="arginine repressor, ArgR"
FT                   /note="KEGG: ypb:YPTS_0489 arginine repressor; TIGRFAM:
FT                   arginine repressor; PFAM: Arginine repressor-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72093"
FT                   /db_xref="GOA:A0A0H3F5A7"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5A7"
FT                   /inference="protein motif:TFAM:TIGR01529"
FT                   /protein_id="ADW72093.1"
FT   gene            499137..500075
FT                   /locus_tag="Rahaq_0465"
FT   CDS_pept        499137..500075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0465"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /note="KEGG: ypb:YPTS_0490 malate dehydrogenase; TIGRFAM:
FT                   malate dehydrogenase, NAD-dependent; PFAM: Lactate/malate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72094"
FT                   /db_xref="GOA:A0A0H3F809"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F809"
FT                   /inference="protein motif:TFAM:TIGR01772"
FT                   /protein_id="ADW72094.1"
FT   gene            complement(500119..500391)
FT                   /locus_tag="Rahaq_0466"
FT   CDS_pept        complement(500119..500391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0466"
FT                   /product="putative transcriptional regulator, Nlp"
FT                   /note="KEGG: ddc:Dd586_0582 putative transcriptional
FT                   regulator, Nlp"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72095"
FT                   /db_xref="GOA:A0A0H3F4G9"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4G9"
FT                   /inference="similar to AA sequence:KEGG:Dd586_0582"
FT                   /protein_id="ADW72095.1"
FT   gene            501052..501411
FT                   /locus_tag="Rahaq_0467"
FT   CDS_pept        501052..501411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0467"
FT                   /product="MuA-transposase/repressor protein CI DNA-binding
FT                   protein"
FT                   /note="PFAM: MuA-transposase/repressor protein CI
FT                   DNA-binding; KEGG: ypb:YPTS_0492 MuA-transposase/repressor
FT                   protein CI DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72096"
FT                   /db_xref="GOA:A0A0H3FAN3"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAN3"
FT                   /inference="protein motif:PFAM:PF02316"
FT                   /protein_id="ADW72096.1"
FT                   GISELLNRLREPEKN"
FT   gene            complement(501465..502436)
FT                   /locus_tag="Rahaq_0468"
FT   CDS_pept        complement(501465..502436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0468"
FT                   /product="Polyprenyl synthetase"
FT                   /note="KEGG: pwa:Pecwa_0792 octaprenyl diphosphate
FT                   synthase; manually curated; PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72097"
FT                   /db_xref="GOA:A0A0H3F5K9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5K9"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADW72097.1"
FT   gene            502696..503007
FT                   /locus_tag="Rahaq_0469"
FT   CDS_pept        502696..503007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0469"
FT                   /product="ribosomal protein L21"
FT                   /note="KEGG: yen:YE0418 50S ribosomal protein L21; TIGRFAM:
FT                   ribosomal protein L21; PFAM: ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72098"
FT                   /db_xref="GOA:A0A0H3F5B0"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5B0"
FT                   /inference="protein motif:TFAM:TIGR00061"
FT                   /protein_id="ADW72098.1"
FT   gene            503026..503283
FT                   /locus_tag="Rahaq_0470"
FT   CDS_pept        503026..503283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0470"
FT                   /product="ribosomal protein L27"
FT                   /note="KEGG: ypb:YPTS_0495 50S ribosomal protein L27;
FT                   TIGRFAM: ribosomal protein L27; PFAM: ribosomal protein
FT                   L27"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72099"
FT                   /db_xref="GOA:A0A0H3F815"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F815"
FT                   /inference="protein motif:TFAM:TIGR00062"
FT                   /protein_id="ADW72099.1"
FT   gene            503369..504325
FT                   /locus_tag="Rahaq_0471"
FT   CDS_pept        503369..504325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0471"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ypb:YPTS_0496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72100"
FT                   /db_xref="GOA:A0A0H3F4H3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4H3"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADW72100.1"
FT   gene            504359..505531
FT                   /locus_tag="Rahaq_0472"
FT   CDS_pept        504359..505531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0472"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="KEGG: spe:Spro_0476 GTPase ObgE; TIGRFAM:
FT                   GTP-binding protein Obg/CgtA; small GTP-binding protein;
FT                   PFAM: GTP1/OBG sub domain protein; GTP-binding protein
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72101"
FT                   /db_xref="GOA:A0A0H3FAN5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAN5"
FT                   /inference="protein motif:TFAM:TIGR02729"
FT                   /protein_id="ADW72101.1"
FT   gene            505660..506982
FT                   /locus_tag="Rahaq_0473"
FT   CDS_pept        505660..506982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0473"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   dda:Dd703_2863 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72102"
FT                   /db_xref="GOA:A0A0H3FBL7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FBL7"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADW72102.1"
FT   gene            complement(507041..508132)
FT                   /locus_tag="Rahaq_0474"
FT   CDS_pept        complement(507041..508132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0474"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: spe:Spro_0477 sensor protein BasS/PmrB; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72103"
FT                   /db_xref="GOA:A0A0H3F5B5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5B5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADW72103.1"
FT   gene            complement(508129..508791)
FT                   /locus_tag="Rahaq_0475"
FT   CDS_pept        complement(508129..508791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0475"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: spe:Spro_0478 DNA-binding transcriptional
FT                   regulator BasR; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72104"
FT                   /db_xref="GOA:A0A0H3F821"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F821"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADW72104.1"
FT   gene            complement(508812..510245)
FT                   /locus_tag="Rahaq_0476"
FT   CDS_pept        complement(508812..510245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0476"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; KEGG:
FT                   spe:Spro_0479 D-alanyl-D-alanine
FT                   carboxypeptidase/endopeptidase; PFAM: peptidase S13
FT                   D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72105"
FT                   /db_xref="GOA:A0A0H3F4H7"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4H7"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ADW72105.1"
FT   sig_peptide     complement(510183..510245)
FT                   /locus_tag="Rahaq_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.903 at
FT                   residue 21"
FT   gene            510527..511003
FT                   /locus_tag="Rahaq_0477"
FT   CDS_pept        510527..511003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0477"
FT                   /product="transcription elongation factor GreA"
FT                   /note="KEGG: pct:PC1_0563 transcription elongation factor
FT                   GreA; TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72106"
FT                   /db_xref="GOA:A0A0H3FAP0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAP0"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ADW72106.1"
FT   gene            complement(511184..511480)
FT                   /locus_tag="Rahaq_0478"
FT   CDS_pept        complement(511184..511480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0478"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   spe:Spro_0481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72107"
FT                   /db_xref="GOA:A0A0H3F5L9"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5L9"
FT                   /inference="protein motif:PFAM:PF01985"
FT                   /protein_id="ADW72107.1"
FT   gene            511663..512292
FT                   /locus_tag="Rahaq_0479"
FT   CDS_pept        511663..512292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0479"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /note="KEGG: yen:YE0427 23S rRNA methyltransferase J;
FT                   TIGRFAM: ribosomal RNA large subunit methyltransferase J;
FT                   PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72108"
FT                   /db_xref="GOA:A0A0H3F5C1"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5C1"
FT                   /inference="protein motif:TFAM:TIGR00438"
FT                   /protein_id="ADW72108.1"
FT   gene            512340..514292
FT                   /locus_tag="Rahaq_0480"
FT   CDS_pept        512340..514292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0480"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number=""
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: spe:Spro_0483 ATP-dependent
FT                   metalloprotease; PFAM: peptidase M41; AAA ATPase central
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72109"
FT                   /db_xref="GOA:A0A0H3F825"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F825"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADW72109.1"
FT                   TPNPGNTMFEQFSGK"
FT   gene            514417..515256
FT                   /locus_tag="Rahaq_0481"
FT   CDS_pept        514417..515256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0481"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG: yen:YE0429
FT                   dihydropteroate synthase; PFAM: dihydropteroate synthase
FT                   DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72110"
FT                   /db_xref="GOA:A0A0H3F4I2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4I2"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADW72110.1"
FT   gene            515259..516599
FT                   /locus_tag="Rahaq_0482"
FT   CDS_pept        515259..516599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0482"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: pwa:Pecwa_0803 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72111"
FT                   /db_xref="GOA:A0A0H3FAP5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAP5"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADW72111.1"
FT   gene            516835..517170
FT                   /locus_tag="Rahaq_0483"
FT   CDS_pept        516835..517170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0483"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="KEGG: yen:YE0431 preprotein translocase subunit
FT                   SecG; TIGRFAM: preprotein translocase, SecG subunit; PFAM:
FT                   Preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72112"
FT                   /db_xref="GOA:A0A0H3F5M4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5M4"
FT                   /inference="protein motif:TFAM:TIGR00810"
FT                   /protein_id="ADW72112.1"
FT                   PNSDVPH"
FT   gene            517255..517341
FT                   /locus_tag="Rahaq_R0013"
FT                   /note="tRNA-Leu1"
FT   tRNA            517255..517341
FT                   /locus_tag="Rahaq_R0013"
FT                   /product="tRNA-Leu"
FT   gene            517401..517477
FT                   /locus_tag="Rahaq_R0014"
FT                   /note="tRNA-Met1"
FT   tRNA            517401..517477
FT                   /locus_tag="Rahaq_R0014"
FT                   /product="tRNA-Met"
FT   gene            517582..518146
FT                   /pseudo
FT                   /locus_tag="Rahaq_0484"
FT   gene            518170..519678
FT                   /locus_tag="Rahaq_0485"
FT   CDS_pept        518170..519678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0485"
FT                   /product="NusA antitermination factor"
FT                   /note="KEGG: spe:Spro_0488 transcription elongation factor
FT                   NusA; TIGRFAM: transcription termination factor NusA; PFAM:
FT                   NusA domain-containing protein; RNA binding S1 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72113"
FT                   /db_xref="GOA:A0A0H3F5C6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5C6"
FT                   /inference="protein motif:TFAM:TIGR01953"
FT                   /protein_id="ADW72113.1"
FT   gene            519703..522396
FT                   /locus_tag="Rahaq_0486"
FT   CDS_pept        519703..522396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0486"
FT                   /product="translation initiation factor IF-2"
FT                   /note="KEGG: ypb:YPTS_0510 translation initiation factor
FT                   IF-2; TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; Initiation factor 2 associated domain protein
FT                   ; translation initiation factor IF-2 domain-containing
FT                   protein; elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72114"
FT                   /db_xref="GOA:A0A0H3F831"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F831"
FT                   /inference="protein motif:TFAM:TIGR00487"
FT                   /protein_id="ADW72114.1"
FT   gene            522476..522889
FT                   /locus_tag="Rahaq_0487"
FT   CDS_pept        522476..522889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0487"
FT                   /product="ribosome-binding factor A"
FT                   /note="KEGG: spe:Spro_0490 ribosome-binding factor A;
FT                   TIGRFAM: ribosome-binding factor A; PFAM: ribosome-binding
FT                   factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72115"
FT                   /db_xref="GOA:A0A0H3F4I5"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4I5"
FT                   /inference="protein motif:TFAM:TIGR00082"
FT                   /protein_id="ADW72115.1"
FT   gene            522889..523833
FT                   /locus_tag="Rahaq_0488"
FT   CDS_pept        522889..523833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0488"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="KEGG: spe:Spro_0491 tRNA pseudouridine synthase B;
FT                   TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein; tRNA
FT                   pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72116"
FT                   /db_xref="GOA:A0A0H3FAQ2"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAQ2"
FT                   /inference="protein motif:TFAM:TIGR00431"
FT                   /protein_id="ADW72116.1"
FT   gene            523956..524225
FT                   /locus_tag="Rahaq_0489"
FT   CDS_pept        523956..524225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0489"
FT                   /product="ribosomal protein S15"
FT                   /note="KEGG: cko:CKO_04564 30S ribosomal protein S15;
FT                   TIGRFAM: ribosomal protein S15; PFAM: ribosomal protein
FT                   S15"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72117"
FT                   /db_xref="GOA:A0A0H3F5M9"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5M9"
FT                   /inference="protein motif:TFAM:TIGR00952"
FT                   /protein_id="ADW72117.1"
FT   gene            524655..526778
FT                   /locus_tag="Rahaq_0490"
FT   CDS_pept        524655..526778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0490"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number=""
FT                   /note="SMART: KH domain protein; TIGRFAM:
FT                   polyribonucleotide nucleotidyltransferase; KEGG:
FT                   spe:Spro_0493 polynucleotide phosphorylase/polyadenylase;
FT                   PFAM: 3' exoribonuclease; Exoribonuclease, phosphorolytic
FT                   domain 2; Polynucleotide phosphorylase, phosphorolytic
FT                   RNA-binding; K Homology, type 1, subgroup; RNA binding S1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72118"
FT                   /db_xref="GOA:A0A0H3F5D0"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5D0"
FT                   /inference="protein motif:TFAM:TIGR03591"
FT                   /protein_id="ADW72118.1"
FT                   PSQDETTEQPAAE"
FT   gene            526908..527792
FT                   /locus_tag="Rahaq_0491"
FT   CDS_pept        526908..527792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0491"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="KEGG: spe:Spro_0494 lipoprotein NlpI; PFAM:
FT                   Tetratricopeptide TPR_1 repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72119"
FT                   /db_xref="GOA:A0A0H3F836"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F836"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADW72119.1"
FT                   GHEQDDLSESDQQ"
FT   gene            527977..529899
FT                   /locus_tag="Rahaq_0492"
FT   CDS_pept        527977..529899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0492"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: spe:Spro_0495 ATP-dependent RNA helicase DeaD;
FT                   PFAM: DEAD/DEAH box helicase domain protein; helicase
FT                   domain protein; DbpA RNA-binding domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72120"
FT                   /db_xref="GOA:A0A0H3F4J0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR021046"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4J0"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADW72120.1"
FT                   RTSDA"
FT   gene            complement(529986..531011)
FT                   /locus_tag="Rahaq_0493"
FT   CDS_pept        complement(529986..531011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0493"
FT                   /product="luciferase family oxidoreductase, group 1"
FT                   /note="KEGG: spe:Spro_0498 hypothetical protein; TIGRFAM:
FT                   luciferase family oxidoreductase, group 1; PFAM:
FT                   Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72121"
FT                   /db_xref="GOA:A0A0H3FAQ7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAQ7"
FT                   /inference="protein motif:TFAM:TIGR03558"
FT                   /protein_id="ADW72121.1"
FT                   G"
FT   gene            531229..532203
FT                   /locus_tag="Rahaq_0494"
FT   CDS_pept        531229..532203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0494"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   spe:Spro_0499 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72122"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5N5"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADW72122.1"
FT   sig_peptide     531229..531309
FT                   /locus_tag="Rahaq_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.738 at
FT                   residue 27"
FT   gene            532200..533372
FT                   /locus_tag="Rahaq_0495"
FT   CDS_pept        532200..533372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0495"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: spe:Spro_0500
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72123"
FT                   /db_xref="GOA:A0A0H3F5D5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5D5"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADW72123.1"
FT   gene            533369..534532
FT                   /locus_tag="Rahaq_0496"
FT   CDS_pept        533369..534532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0496"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: spe:Spro_0501
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72124"
FT                   /db_xref="GOA:A0A0H3F842"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F842"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADW72124.1"
FT   gene            complement(534585..535463)
FT                   /locus_tag="Rahaq_0497"
FT   CDS_pept        complement(534585..535463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0497"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: yen:YE0449 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72125"
FT                   /db_xref="GOA:A0A0H3F4J4"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4J4"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ADW72125.1"
FT                   WQRVAGLELRQ"
FT   gene            complement(535478..536473)
FT                   /locus_tag="Rahaq_0498"
FT   CDS_pept        complement(535478..536473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0498"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: cko:CKO_04553
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72126"
FT                   /db_xref="GOA:A0A0H3FAR3"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAR3"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ADW72126.1"
FT   gene            536789..537310
FT                   /locus_tag="Rahaq_0499"
FT   CDS_pept        536789..537310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0499"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   spe:Spro_0505 sterol-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72127"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016830"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5P0"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADW72127.1"
FT                   GSKTPVAEPC"
FT   gene            537304..537807
FT                   /locus_tag="Rahaq_0500"
FT   CDS_pept        537304..537807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0500"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   yen:YE0452 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72128"
FT                   /db_xref="GOA:A0A0H3F5E0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5E0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW72128.1"
FT                   FNRF"
FT   gene            complement(537848..538150)
FT                   /locus_tag="Rahaq_0501"
FT   CDS_pept        complement(537848..538150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0501"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: yen:YE0453 GIY-YIG nuclease superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72129"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR022992"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F847"
FT                   /inference="protein motif:PFAM:PF01541"
FT                   /protein_id="ADW72129.1"
FT   gene            538266..538700
FT                   /locus_tag="Rahaq_0502"
FT   CDS_pept        538266..538700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_0510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72130"
FT                   /db_xref="GOA:A0A0H3F4J8"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4J8"
FT                   /inference="similar to AA sequence:KEGG:Spro_0510"
FT                   /protein_id="ADW72130.1"
FT   gene            538806..539447
FT                   /locus_tag="Rahaq_0503"
FT   CDS_pept        538806..539447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0503"
FT                   /product="Semialdehyde dehydrogenase NAD-binding protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   KEGG: spe:Spro_0511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72131"
FT                   /db_xref="GOA:A0A0H3FAR8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAR8"
FT                   /inference="protein motif:PFAM:PF01118"
FT                   /protein_id="ADW72131.1"
FT   gene            complement(539546..540184)
FT                   /locus_tag="Rahaq_0504"
FT   CDS_pept        complement(539546..540184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0504"
FT                   /product="phosphonate metabolim protein, transferase
FT                   hexapeptide repeat family"
FT                   /note="TIGRFAM: phosphonate metabolim protein, transferase
FT                   hexapeptide repeat family; KEGG: spe:Spro_0513 putative
FT                   acetyltransferase (virginiamycin, streptogramin A,
FT                   chloramphenicol)"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72132"
FT                   /db_xref="GOA:A0A0H3F5P5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5P5"
FT                   /inference="protein motif:TFAM:TIGR03308"
FT                   /protein_id="ADW72132.1"
FT   gene            complement(540193..540768)
FT                   /locus_tag="Rahaq_0505"
FT   CDS_pept        complement(540193..540768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0505"
FT                   /product="phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN"
FT                   /note="KEGG: ebi:EbC_27490 ribose 1,5-bisphosphokinase;
FT                   TIGRFAM: phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN; SMART:
FT                   guanylate kinase/L-type calcium channel region"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72133"
FT                   /db_xref="GOA:A0A0H3F5E5"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5E5"
FT                   /inference="protein motif:TFAM:TIGR02322"
FT                   /protein_id="ADW72133.1"
FT   gene            complement(540844..541980)
FT                   /locus_tag="Rahaq_0506"
FT   CDS_pept        complement(540844..541980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0506"
FT                   /product="phosphonate metabolism protein PhnM"
FT                   /note="KEGG: spe:Spro_0515 phosphonate metabolism protein
FT                   PhnM; TIGRFAM: phosphonate metabolism protein PhnM; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72134"
FT                   /db_xref="GOA:A0A0H3F853"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F853"
FT                   /inference="protein motif:TFAM:TIGR02318"
FT                   /protein_id="ADW72134.1"
FT   gene            complement(541977..542684)
FT                   /locus_tag="Rahaq_0507"
FT   CDS_pept        complement(541977..542684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0507"
FT                   /product="phosphonate C-P lyase system protein PhnL"
FT                   /note="TIGRFAM: phosphonate C-P lyase system protein PhnL;
FT                   PFAM: ABC transporter related; KEGG: spe:Spro_0516
FT                   phosphonate C-P lyase system protein PhnL; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72135"
FT                   /db_xref="GOA:A0A0H3F4K3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4K3"
FT                   /inference="protein motif:TFAM:TIGR02324"
FT                   /protein_id="ADW72135.1"
FT                   YEMSPETAPEMSV"
FT   gene            complement(542713..543504)
FT                   /locus_tag="Rahaq_0508"
FT   CDS_pept        complement(542713..543504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0508"
FT                   /product="phosphonate C-P lyase system protein PhnK"
FT                   /note="TIGRFAM: phosphonate C-P lyase system protein PhnK;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; KEGG: spe:Spro_0517 phosphonate
FT                   C-P lyase system protein PhnK; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72136"
FT                   /db_xref="GOA:A0A0H3FAS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAS1"
FT                   /inference="protein motif:TFAM:TIGR02323"
FT                   /protein_id="ADW72136.1"
FT   gene            complement(543504..544379)
FT                   /locus_tag="Rahaq_0509"
FT   CDS_pept        complement(543504..544379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0509"
FT                   /product="phosphonate metabolism PhnJ"
FT                   /note="PFAM: phosphonate metabolism PhnJ; KEGG:
FT                   pam:PANA_2395 PhnJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72137"
FT                   /db_xref="GOA:A0A0H3F5Q1"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5Q1"
FT                   /inference="protein motif:PFAM:PF06007"
FT                   /protein_id="ADW72137.1"
FT                   EQQASNEGNR"
FT   gene            complement(544369..545451)
FT                   /locus_tag="Rahaq_0510"
FT   CDS_pept        complement(544369..545451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0510"
FT                   /product="phosphonate metabolism"
FT                   /note="PFAM: phosphonate metabolism; KEGG: spe:Spro_0519
FT                   phosphonate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72138"
FT                   /db_xref="GOA:A0A0H3F5F1"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5F1"
FT                   /inference="protein motif:PFAM:PF05861"
FT                   /protein_id="ADW72138.1"
FT   gene            complement(545451..546032)
FT                   /locus_tag="Rahaq_0511"
FT   CDS_pept        complement(545451..546032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0511"
FT                   /product="phosphonate C-P lyase system protein PhnH"
FT                   /note="KEGG: pct:PC1_0888 phosphonate C-P lyase system
FT                   protein PhnH; TIGRFAM: phosphonate C-P lyase system protein
FT                   PhnH; PFAM: phosphonate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72139"
FT                   /db_xref="GOA:A0A0H3F858"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F858"
FT                   /inference="protein motif:TFAM:TIGR03292"
FT                   /protein_id="ADW72139.1"
FT   gene            complement(546036..546479)
FT                   /locus_tag="Rahaq_0512"
FT   CDS_pept        complement(546036..546479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0512"
FT                   /product="phosphonate C-P lyase system protein PhnG"
FT                   /note="KEGG: spe:Spro_0521 phosphonate metabolism PhnG;
FT                   TIGRFAM: phosphonate C-P lyase system protein PhnG; PFAM:
FT                   phosphonate metabolism PhnG"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72140"
FT                   /db_xref="GOA:A0A0H3F4K8"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4K8"
FT                   /inference="protein motif:TFAM:TIGR03293"
FT                   /protein_id="ADW72140.1"
FT   gene            complement(546480..547205)
FT                   /locus_tag="Rahaq_0513"
FT   CDS_pept        complement(546480..547205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0513"
FT                   /product="phosphonate C-P lyase system transcriptional
FT                   regulator PhnF, GntR family"
FT                   /note="TIGRFAM: phosphonates metabolism transcriptional
FT                   regulator PhnF; PFAM: UbiC transcription
FT                   regulator-associated domain-containing protein; regulatory
FT                   protein GntR HTH; KEGG: spe:Spro_0522 phosphonate
FT                   metabolism transcriptional regulator PhnF; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72141"
FT                   /db_xref="GOA:A0A0H3FAS4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAS4"
FT                   /inference="protein motif:TFAM:TIGR02325"
FT                   /protein_id="ADW72141.1"
FT   gene            547513..547854
FT                   /locus_tag="Rahaq_0514"
FT   CDS_pept        547513..547854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0514"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   eum:ECUMN_2400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72142"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5Q7"
FT                   /inference="protein motif:PFAM:PF05973"
FT                   /protein_id="ADW72142.1"
FT                   SRRKNDSEF"
FT   gene            547838..548125
FT                   /locus_tag="Rahaq_0515"
FT   CDS_pept        547838..548125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0515"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: eba:ebA101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72143"
FT                   /db_xref="GOA:A0A0H3F5F5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5F5"
FT                   /inference="similar to AA sequence:KEGG:ebA101"
FT                   /protein_id="ADW72143.1"
FT   gene            548246..548407
FT                   /locus_tag="Rahaq_0516"
FT   CDS_pept        548246..548407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yen:YE3481 gyrase inhibitor antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72144"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F862"
FT                   /inference="similar to AA sequence:KEGG:YE3481"
FT                   /protein_id="ADW72144.1"
FT                   FSDYQRVF"
FT   gene            complement(548442..548906)
FT                   /locus_tag="Rahaq_0517"
FT   CDS_pept        complement(548442..548906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0517"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="KEGG: pct:PC1_0359 anaerobic ribonucleotide
FT                   reductase-activating protein; manually curated; TIGRFAM:
FT                   anaerobic ribonucleoside-triphosphate reductase activating
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72145"
FT                   /db_xref="GOA:A0A0H3F4L5"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4L5"
FT                   /inference="protein motif:TFAM:TIGR02491"
FT                   /protein_id="ADW72145.1"
FT   gene            complement(548911..551094)
FT                   /locus_tag="Rahaq_0518"
FT   CDS_pept        complement(548911..551094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0518"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: spe:Spro_0525 anaerobic ribonucleoside
FT                   triphosphate reductase; PFAM: formate C-acetyltransferase
FT                   glycine radical; ATP-cone domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72146"
FT                   /db_xref="GOA:A0A0H3FAS8"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAS8"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ADW72146.1"
FT   gene            complement(551393..553036)
FT                   /locus_tag="Rahaq_0519"
FT   CDS_pept        complement(551393..553036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0519"
FT                   /product="alpha,alpha-phosphotrehalase"
FT                   /note="TIGRFAM: alpha,alpha-phosphotrehalase; PFAM: alpha
FT                   amylase catalytic region; KEGG: spe:Spro_0528
FT                   trehalose-6-phosphate hydrolase; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72147"
FT                   /db_xref="GOA:A0A0H3F5R3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5R3"
FT                   /inference="protein motif:TFAM:TIGR02403"
FT                   /protein_id="ADW72147.1"
FT   gene            complement(553059..554477)
FT                   /locus_tag="Rahaq_0520"
FT   CDS_pept        complement(553059..554477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0520"
FT                   /product="PTS system, trehalose-specific IIBC subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: PTS system, trehalose-specific IIBC
FT                   subunit; PTS system, glucose-like IIB subunint; KEGG:
FT                   spe:Spro_0529 PTS system trehalose(maltose)-specific
FT                   transporter subunits IIBC; PFAM: phosphotransferase system
FT                   EIIC; Phosphotransferase system EIIB/cysteine,
FT                   phosphorylation site"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72148"
FT                   /db_xref="GOA:A0A0H3F5F9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5F9"
FT                   /inference="protein motif:TFAM:TIGR01992"
FT                   /protein_id="ADW72148.1"
FT                   VYQRKARRGELAVV"
FT   gene            complement(554630..555586)
FT                   /locus_tag="Rahaq_0521"
FT   CDS_pept        complement(554630..555586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0521"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="TIGRFAM: trehalose operon repressor; PFAM:
FT                   regulatory protein LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: yen:YE3775 trehalose
FT                   repressor; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72149"
FT                   /db_xref="GOA:A0A0H3F865"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012771"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F865"
FT                   /inference="protein motif:TFAM:TIGR02405"
FT                   /protein_id="ADW72149.1"
FT   gene            555934..558633
FT                   /locus_tag="Rahaq_0522"
FT   CDS_pept        555934..558633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0522"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: magnesium-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; KEGG: spe:Spro_0535 magnesium-transporting ATPase MgtA;
FT                   PFAM: E1-E2 ATPase-associated domain protein; cation
FT                   transporting ATPase domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72150"
FT                   /db_xref="GOA:A0A0H3F4M2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M2"
FT                   /inference="protein motif:TFAM:TIGR01524"
FT                   /protein_id="ADW72150.1"
FT   gene            complement(558711..559685)
FT                   /locus_tag="Rahaq_0523"
FT   CDS_pept        complement(558711..559685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0523"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   eay:EAM_0499 protein Alx ( high pH-induced membrane-bound
FT                   redox modulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72151"
FT                   /db_xref="GOA:A0A0H3FAT3"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAT3"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="ADW72151.1"
FT   gene            complement(559983..560729)
FT                   /locus_tag="Rahaq_0524"
FT   CDS_pept        complement(559983..560729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0524"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   spe:Spro_4317 glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72152"
FT                   /db_xref="GOA:A0A0H3F5R6"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5R6"
FT                   /inference="protein motif:PFAM:PF00117"
FT                   /protein_id="ADW72152.1"
FT   gene            complement(560756..561742)
FT                   /locus_tag="Rahaq_0525"
FT   CDS_pept        complement(560756..561742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0525"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   spe:Spro_4316 oxidoreductase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72153"
FT                   /db_xref="GOA:A0A0H3F5G3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5G3"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADW72153.1"
FT   gene            complement(561765..562271)
FT                   /locus_tag="Rahaq_0526"
FT   CDS_pept        complement(561765..562271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0526"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   yen:YE3701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72154"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F870"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ADW72154.1"
FT                   GKLYQ"
FT   gene            562442..563593
FT                   /locus_tag="Rahaq_0527"
FT   CDS_pept        562442..563593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0527"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: spe:Spro_4312 rRNA
FT                   (guanine-N(2)-)-methyltransferase; PFAM: methyltransferase
FT                   small"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72155"
FT                   /db_xref="GOA:A0A0H3F4M9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M9"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW72155.1"
FT   gene            complement(563677..565713)
FT                   /locus_tag="Rahaq_0528"
FT   CDS_pept        complement(563677..565713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0528"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ypi:YpsIP31758_0501 2,4-dienoyl-coa
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72156"
FT                   /db_xref="GOA:A0A0H3FAT9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAT9"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADW72156.1"
FT   gene            566110..566976
FT                   /locus_tag="Rahaq_0529"
FT   CDS_pept        566110..566976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0529"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   spe:Spro_4743 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72157"
FT                   /db_xref="GOA:A0A0H3F5S1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5S1"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADW72157.1"
FT                   ASLRKTG"
FT   gene            complement(567006..569024)
FT                   /locus_tag="Rahaq_0530"
FT   CDS_pept        complement(567006..569024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0530"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; KEGG: yen:YE0053 RNase II
FT                   stability modulator; SMART: EAL domain protein; GGDEF
FT                   domain containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72158"
FT                   /db_xref="GOA:A0A0H3F5G6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5G6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADW72158.1"
FT   gene            complement(569307..571604)
FT                   /locus_tag="Rahaq_0531"
FT   CDS_pept        complement(569307..571604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0531"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: spe:Spro_1371 glycoside hydrolase family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72159"
FT                   /db_xref="GOA:A0A0H3F875"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F875"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ADW72159.1"
FT                   SQDVKQTSFLLK"
FT   sig_peptide     complement(571539..571604)
FT                   /locus_tag="Rahaq_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.992 at
FT                   residue 22"
FT   gene            complement(571984..572268)
FT                   /locus_tag="Rahaq_0532"
FT   CDS_pept        complement(571984..572268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_2355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72160"
FT                   /db_xref="GOA:A0A0H3F4N5"
FT                   /db_xref="InterPro:IPR016958"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4N5"
FT                   /inference="similar to AA sequence:KEGG:Spro_2355"
FT                   /protein_id="ADW72160.1"
FT   gene            complement(572521..575247)
FT                   /locus_tag="Rahaq_0533"
FT   CDS_pept        complement(572521..575247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0533"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="KEGG: ebi:EbC_44730 transcriptional regulator MalT;
FT                   PFAM: regulatory protein LuxR; SMART: regulatory protein
FT                   LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72161"
FT                   /db_xref="GOA:A0A0H3FAU5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR023768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAU5"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADW72161.1"
FT   gene            575570..577972
FT                   /locus_tag="Rahaq_0534"
FT   CDS_pept        575570..577972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0534"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /note="KEGG: ebi:EbC_44720 maltodextrin phosphorylase;
FT                   TIGRFAM: glycogen/starch/alpha-glucan phosphorylase; PFAM:
FT                   glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72162"
FT                   /db_xref="GOA:A0A0H3F5S6"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5S6"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ADW72162.1"
FT   gene            577982..580072
FT                   /locus_tag="Rahaq_0535"
FT   CDS_pept        577982..580072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0535"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: 4-alpha-glucanotransferase; KEGG:
FT                   ebi:EbC_44710 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72163"
FT                   /db_xref="GOA:A0A0H3F5H2"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5H2"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ADW72163.1"
FT                   VS"
FT   gene            580194..581198
FT                   /locus_tag="Rahaq_0536"
FT   CDS_pept        580194..581198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0536"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: ddd:Dda3937_00500 ISEch4 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72164"
FT                   /db_xref="GOA:A0A0H3F880"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F880"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADW72164.1"
FT   gene            complement(581694..582584)
FT                   /locus_tag="Rahaq_0537"
FT   CDS_pept        complement(581694..582584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0537"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ebi:EbC_44700 maltose
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72165"
FT                   /db_xref="GOA:A0A0H3F4P2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4P2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADW72165.1"
FT                   QRWLVGGLTAGGVKG"
FT   sig_peptide     complement(582474..582584)
FT                   /locus_tag="Rahaq_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.767 at
FT                   residue 37"
FT   gene            complement(582598..584142)
FT                   /locus_tag="Rahaq_0538"
FT   CDS_pept        complement(582598..584142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0538"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ebi:EbC_44690
FT                   maltose/maltodextrin ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72166"
FT                   /db_xref="GOA:A0A0H3FAX5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAX5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADW72166.1"
FT   gene            complement(584214..585413)
FT                   /locus_tag="Rahaq_0539"
FT   CDS_pept        complement(584214..585413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0539"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ebi:EbC_44680 maltose/maltodextrin-binding
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72167"
FT                   /db_xref="GOA:A0A0H3F5V2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5V2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADW72167.1"
FT                   "
FT   sig_peptide     complement(585324..585413)
FT                   /locus_tag="Rahaq_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            585780..586889
FT                   /locus_tag="Rahaq_0540"
FT   CDS_pept        585780..586889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0540"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: spe:Spro_4470 maltose/maltodextrin transporter
FT                   ATP-binding protein; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72168"
FT                   /db_xref="GOA:A0A0H3F5K1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5K1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADW72168.1"
FT   gene            586919..588214
FT                   /locus_tag="Rahaq_0541"
FT   CDS_pept        586919..588214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0541"
FT                   /product="porin LamB type"
FT                   /note="PFAM: porin LamB type; KEGG: ebi:EbC_44660
FT                   maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72169"
FT                   /db_xref="GOA:A0A0H3F8A1"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F8A1"
FT                   /inference="protein motif:PFAM:PF02264"
FT                   /protein_id="ADW72169.1"
FT   sig_peptide     586919..586993
FT                   /locus_tag="Rahaq_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            588445..589341
FT                   /locus_tag="Rahaq_0542"
FT   CDS_pept        588445..589341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0542"
FT                   /product="Maltose operon periplasmic"
FT                   /note="PFAM: Maltose operon periplasmic; KEGG:
FT                   ebi:EbC_44650 maltose operon periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72170"
FT                   /db_xref="GOA:A0A0H3F4S3"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4S3"
FT                   /inference="protein motif:PFAM:PF07148"
FT                   /protein_id="ADW72170.1"
FT                   RLGSKSARKTFIESVKH"
FT   sig_peptide     588445..588519
FT                   /locus_tag="Rahaq_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 25"
FT   gene            589579..590418
FT                   /locus_tag="Rahaq_0543"
FT   CDS_pept        589579..590418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0543"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: pfs:PFLU2718 putative AraC-family
FT                   transcriptional regulator; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; SMART: Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72171"
FT                   /db_xref="GOA:A0A0H3FAX9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAX9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADW72171.1"
FT   gene            590470..590907
FT                   /locus_tag="Rahaq_0544"
FT   CDS_pept        590470..590907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0544"
FT                   /product="Protein of unknown function DUF2000"
FT                   /note="PFAM: Protein of unknown function DUF2000; KEGG:
FT                   ebi:EbC_15810 conserved uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72172"
FT                   /db_xref="InterPro:IPR017021"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5V3"
FT                   /inference="protein motif:PFAM:PF09391"
FT                   /protein_id="ADW72172.1"
FT   gene            590978..591676
FT                   /locus_tag="Rahaq_0545"
FT   CDS_pept        590978..591676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0545"
FT                   /product="acid phosphatase"
FT                   /note="KEGG: mlo:mll2704 acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72173"
FT                   /db_xref="GOA:A0A0H3F5K6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5K6"
FT                   /inference="similar to AA sequence:KEGG:mll2704"
FT                   /protein_id="ADW72173.1"
FT                   AELRAQLGLK"
FT   sig_peptide     590978..591043
FT                   /locus_tag="Rahaq_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            591740..592225
FT                   /locus_tag="Rahaq_0546"
FT   CDS_pept        591740..592225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0546"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: pfl:PFL_5108 methylated-DNA--protein-cysteine
FT                   methyltransferase; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; methylguanine DNA
FT                   methyltransferase ribonuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72174"
FT                   /db_xref="GOA:A0A0H3F8A7"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F8A7"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADW72174.1"
FT   gene            592338..593681
FT                   /locus_tag="Rahaq_0547"
FT   CDS_pept        592338..593681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0547"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number=""
FT                   /note="KEGG: set:SEN1744 glutamate dehydrogenase; PFAM:
FT                   Glu/Leu/Phe/Val dehydrogenase ; Glu/Leu/Phe/Val
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72175"
FT                   /db_xref="GOA:A0A0H3F4S6"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4S6"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ADW72175.1"
FT   gene            complement(593751..596045)
FT                   /locus_tag="Rahaq_0548"
FT   CDS_pept        complement(593751..596045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0548"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="KEGG: spe:Spro_3430 outer membrane receptor FepA;
FT                   TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor plug; TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72176"
FT                   /db_xref="GOA:A0A0H3FAY2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAY2"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ADW72176.1"
FT                   RTFYMSLNTHF"
FT   sig_peptide     complement(595941..596045)
FT                   /locus_tag="Rahaq_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.907 at
FT                   residue 35"
FT   gene            596247..597590
FT                   /locus_tag="Rahaq_0549"
FT   CDS_pept        596247..597590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0549"
FT                   /product="esterase"
FT                   /note="PFAM: esterase; KEGG: spe:Spro_3429
FT                   enterobactin/ferric enterobactin esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72177"
FT                   /db_xref="GOA:A0A0H3F5V8"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR021764"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5V8"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ADW72177.1"
FT   gene            complement(597564..598361)
FT                   /locus_tag="Rahaq_0550"
FT   CDS_pept        complement(597564..598361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0550"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: spe:Spro_3426 ABC transporter-related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72178"
FT                   /db_xref="GOA:A0A0H3F5L2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5L2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADW72178.1"
FT   gene            complement(598358..599386)
FT                   /locus_tag="Rahaq_0551"
FT   CDS_pept        complement(598358..599386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0551"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   spe:Spro_3425 iron-enterobactin transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72179"
FT                   /db_xref="GOA:A0A0H3F8B0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F8B0"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADW72179.1"