(data stored in ACNUC9543 zone)

EMBL: CP002684

ID   CP002684; SV 1; linear; genomic DNA; STD; PLN; 30427671 BP.
XX
AC   CP002684;
XX
PR   Project:PRJNA116;
XX
DT   06-MAY-2011 (Rel. 108, Created)
DT   03-FEB-2017 (Rel. 131, Last updated, Version 8)
XX
DE   Arabidopsis thaliana chromosome 1 sequence.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-30427671
RX   DOI; 10.1038/35048500.
RX   PUBMED; 11130712.
RA   Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O.,
RA   Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E.,
RA   Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K., Conn L.,
RA   Conway A.B., Conway A.R., Creasy T.H., Dewar K., Dunn P., Etgu P.,
RA   Feldblyum T.V., Feng J., Fong B., Fujii C.Y., Gill J.E., Goldsmith A.D.,
RA   Haas B., Hansen N.F., Hughes B., Huizar L., Hunter J.L., Jenkins J.,
RA   Johnson-Hopson C., Khan S., Khaykin E., Kim C.J., Koo H.L.,
RA   Kremenetskaia I., Kurtz D.B., Kwan A., Lam B., Langin-Hooper S., Lee A.,
RA   Lee J.M., Lenz C.A., Li J.H., Li Y., Lin X., Liu S.X., Liu Z.A.,
RA   Luros J.S., Maiti R., Marziali A., Militscher J., Miranda M., Nguyen M.,
RA   Nierman W.C., Osborne B.I., Pai G., Peterson J., Pham P.K., Rizzo M.,
RA   Rooney T., Rowley D., Sakano H., Salzberg S.L., Schwartz J.R., Shinn P.,
RA   Southwick A.M., Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D.,
RA   Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M., Wu D.,
RA   Yu G., Fraser C.M., Venter J.C., Davis R.W.;
RT   "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana";
RL   Nature 408(6814):816-820(2000).
XX
RN   [2]
RP   1-30427671
RG   TAIR
RA   Swarbreck D., Lamesch P., Wilks C., Huala E.;
RT   ;
RL   Submitted (18-FEB-2011) to the INSDC.
RL   Department of Plant Biology, Carnegie Institution, 260 Panama Street,
RL   Stanford, CA, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-30427671
RA   Krishnakumar V., Cheng C.-Y., Chan A.P., Schobel S., Kim M., Ferlanti E.S.,
RA   Belyaeva I., Rosen B.D., Micklem G., Miller J.R., Vaughn M., Town C.D.;
RT   ;
RL   Submitted (17-MAY-2016) to the INSDC.
RL   Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr,
RL   Rockville, MD 20850, USA
XX
DR   MD5; 66bcd0ba0c2303c318cfa2742cfb4203.
DR   BioSample; SAMN03081427.
DR   EnsemblGenomes-Gn; AT1G01046.
DR   EnsemblGenomes-Gn; AT1G01183.
DR   EnsemblGenomes-Gn; AT1G01270.
DR   EnsemblGenomes-Gn; AT1G01448.
DR   EnsemblGenomes-Gn; AT1G01870.
DR   EnsemblGenomes-Gn; AT1G01890.
DR   EnsemblGenomes-Gn; AT1G02480.
DR   EnsemblGenomes-Gn; AT1G02600.
DR   EnsemblGenomes-Gn; AT1G02760.
DR   EnsemblGenomes-Gn; AT1G02952.
DR   EnsemblGenomes-Gn; AT1G03495.
DR   EnsemblGenomes-Gn; AT1G03502.
DR   EnsemblGenomes-Gn; AT1G03506.
DR   EnsemblGenomes-Gn; AT1G03515.
DR   EnsemblGenomes-Gn; AT1G03545.
DR   EnsemblGenomes-Gn; AT1G03570.
DR   EnsemblGenomes-Gn; AT1G03640.
DR   EnsemblGenomes-Gn; AT1G03743.
DR   EnsemblGenomes-Gn; AT1G03746.
DR   EnsemblGenomes-Gn; AT1G03935.
DR   EnsemblGenomes-Gn; AT1G03987.
DR   EnsemblGenomes-Gn; AT1G03993.
DR   EnsemblGenomes-Gn; AT1G03997.
DR   EnsemblGenomes-Gn; AT1G04003.
DR   EnsemblGenomes-Gn; AT1G04007.
DR   EnsemblGenomes-Gn; AT1G04013.
DR   EnsemblGenomes-Gn; AT1G04017.
DR   EnsemblGenomes-Gn; AT1G04023.
DR   EnsemblGenomes-Gn; AT1G04027.
DR   EnsemblGenomes-Gn; AT1G04033.
DR   EnsemblGenomes-Gn; AT1G04037.
DR   EnsemblGenomes-Gn; AT1G04043.
DR   EnsemblGenomes-Gn; AT1G04047.
DR   EnsemblGenomes-Gn; AT1G04053.
DR   EnsemblGenomes-Gn; AT1G04057.
DR   EnsemblGenomes-Gn; AT1G04063.
DR   EnsemblGenomes-Gn; AT1G04067.
DR   EnsemblGenomes-Gn; AT1G04073.
DR   EnsemblGenomes-Gn; AT1G04077.
DR   EnsemblGenomes-Gn; AT1G04083.
DR   EnsemblGenomes-Gn; AT1G04087.
DR   EnsemblGenomes-Gn; AT1G04093.
DR   EnsemblGenomes-Gn; AT1G04097.
DR   EnsemblGenomes-Gn; AT1G04103.
DR   EnsemblGenomes-Gn; AT1G04117.
DR   EnsemblGenomes-Gn; AT1G04123.
DR   EnsemblGenomes-Gn; AT1G04127.
DR   EnsemblGenomes-Gn; AT1G04133.
DR   EnsemblGenomes-Gn; AT1G04137.
DR   EnsemblGenomes-Gn; AT1G04143.
DR   EnsemblGenomes-Gn; AT1G04147.
DR   EnsemblGenomes-Gn; AT1G04153.
DR   EnsemblGenomes-Gn; AT1G04157.
DR   EnsemblGenomes-Gn; AT1G04163.
DR   EnsemblGenomes-Gn; AT1G04167.
DR   EnsemblGenomes-Gn; AT1G04173.
DR   EnsemblGenomes-Gn; AT1G04177.
DR   EnsemblGenomes-Gn; AT1G04183.
DR   EnsemblGenomes-Gn; AT1G04187.
DR   EnsemblGenomes-Gn; AT1G04193.
DR   EnsemblGenomes-Gn; AT1G04197.
DR   EnsemblGenomes-Gn; AT1G04203.
DR   EnsemblGenomes-Gn; AT1G04207.
DR   EnsemblGenomes-Gn; AT1G04213.
DR   EnsemblGenomes-Gn; AT1G04217.
DR   EnsemblGenomes-Gn; AT1G04223.
DR   EnsemblGenomes-Gn; AT1G04227.
DR   EnsemblGenomes-Gn; AT1G04233.
DR   EnsemblGenomes-Gn; AT1G04237.
DR   EnsemblGenomes-Gn; AT1G04243.
DR   EnsemblGenomes-Gn; AT1G04247.
DR   EnsemblGenomes-Gn; AT1G04253.
DR   EnsemblGenomes-Gn; AT1G04257.
DR   EnsemblGenomes-Gn; AT1G04263.
DR   EnsemblGenomes-Gn; AT1G04267.
DR   EnsemblGenomes-Gn; AT1G04273.
DR   EnsemblGenomes-Gn; AT1G04277.
DR   EnsemblGenomes-Gn; AT1G04283.
DR   EnsemblGenomes-Gn; AT1G04287.
DR   EnsemblGenomes-Gn; AT1G04293.
DR   EnsemblGenomes-Gn; AT1G04295.
DR   EnsemblGenomes-Gn; AT1G04297.
DR   EnsemblGenomes-Gn; AT1G04303.
DR   EnsemblGenomes-Gn; AT1G04307.
DR   EnsemblGenomes-Gn; AT1G04313.
DR   EnsemblGenomes-Gn; AT1G04320.
DR   EnsemblGenomes-Gn; AT1G04323.
DR   EnsemblGenomes-Gn; AT1G04327.
DR   EnsemblGenomes-Gn; AT1G04333.
DR   EnsemblGenomes-Gn; AT1G04337.
DR   EnsemblGenomes-Gn; AT1G04343.
DR   EnsemblGenomes-Gn; AT1G04347.
DR   EnsemblGenomes-Gn; AT1G04353.
DR   EnsemblGenomes-Gn; AT1G04357.
DR   EnsemblGenomes-Gn; AT1G04363.
DR   EnsemblGenomes-Gn; AT1G04367.
DR   EnsemblGenomes-Gn; AT1G04373.
DR   EnsemblGenomes-Gn; AT1G04377.
DR   EnsemblGenomes-Gn; AT1G04383.
DR   EnsemblGenomes-Gn; AT1G04387.
DR   EnsemblGenomes-Gn; AT1G04393.
DR   EnsemblGenomes-Gn; AT1G04397.
DR   EnsemblGenomes-Gn; AT1G04403.
DR   EnsemblGenomes-Gn; AT1G04407.
DR   EnsemblGenomes-Gn; AT1G04413.
DR   EnsemblGenomes-Gn; AT1G04417.
DR   EnsemblGenomes-Gn; AT1G04423.
DR   EnsemblGenomes-Gn; AT1G04425.
DR   EnsemblGenomes-Gn; AT1G04427.
DR   EnsemblGenomes-Gn; AT1G04433.
DR   EnsemblGenomes-Gn; AT1G04437.
DR   EnsemblGenomes-Gn; AT1G04443.
DR   EnsemblGenomes-Gn; AT1G04447.
DR   EnsemblGenomes-Gn; AT1G04453.
DR   EnsemblGenomes-Gn; AT1G04463.
DR   EnsemblGenomes-Gn; AT1G04467.
DR   EnsemblGenomes-Gn; AT1G04473.
DR   EnsemblGenomes-Gn; AT1G04477.
DR   EnsemblGenomes-Gn; AT1G04483.
DR   EnsemblGenomes-Gn; AT1G04487.
DR   EnsemblGenomes-Gn; AT1G04493.
DR   EnsemblGenomes-Gn; AT1G04497.
DR   EnsemblGenomes-Gn; AT1G04503.
DR   EnsemblGenomes-Gn; AT1G04507.
DR   EnsemblGenomes-Gn; AT1G04513.
DR   EnsemblGenomes-Gn; AT1G04517.
DR   EnsemblGenomes-Gn; AT1G04523.
DR   EnsemblGenomes-Gn; AT1G04527.
DR   EnsemblGenomes-Gn; AT1G04533.
DR   EnsemblGenomes-Gn; AT1G04537.
DR   EnsemblGenomes-Gn; AT1G04547.
DR   EnsemblGenomes-Gn; AT1G04557.
DR   EnsemblGenomes-Gn; AT1G04563.
DR   EnsemblGenomes-Gn; AT1G04567.
DR   EnsemblGenomes-Gn; AT1G04573.
DR   EnsemblGenomes-Gn; AT1G04577.
DR   EnsemblGenomes-Gn; AT1G04583.
DR   EnsemblGenomes-Gn; AT1G04587.
DR   EnsemblGenomes-Gn; AT1G04593.
DR   EnsemblGenomes-Gn; AT1G04597.
DR   EnsemblGenomes-Gn; AT1G04603.
DR   EnsemblGenomes-Gn; AT1G04607.
DR   EnsemblGenomes-Gn; AT1G04623.
DR   EnsemblGenomes-Gn; AT1G04643.
DR   EnsemblGenomes-Gn; AT1G04647.
DR   EnsemblGenomes-Gn; AT1G04653.
DR   EnsemblGenomes-Gn; AT1G04657.
DR   EnsemblGenomes-Gn; AT1G04667.
DR   EnsemblGenomes-Gn; AT1G04673.
DR   EnsemblGenomes-Gn; AT1G04677.
DR   EnsemblGenomes-Gn; AT1G04683.
DR   EnsemblGenomes-Gn; AT1G04687.
DR   EnsemblGenomes-Gn; AT1G04693.
DR   EnsemblGenomes-Gn; AT1G04697.
DR   EnsemblGenomes-Gn; AT1G04703.
DR   EnsemblGenomes-Gn; AT1G04707.
DR   EnsemblGenomes-Gn; AT1G04713.
DR   EnsemblGenomes-Gn; AT1G04717.
DR   EnsemblGenomes-Gn; AT1G04720.
DR   EnsemblGenomes-Gn; AT1G04723.
DR   EnsemblGenomes-Gn; AT1G04733.
DR   EnsemblGenomes-Gn; AT1G04737.
DR   EnsemblGenomes-Gn; AT1G04743.
DR   EnsemblGenomes-Gn; AT1G04747.
DR   EnsemblGenomes-Gn; AT1G04753.
DR   EnsemblGenomes-Gn; AT1G04763.
DR   EnsemblGenomes-Gn; AT1G04767.
DR   EnsemblGenomes-Gn; AT1G04773.
DR   EnsemblGenomes-Gn; AT1G04783.
DR   EnsemblGenomes-Gn; AT1G04787.
DR   EnsemblGenomes-Gn; AT1G04793.
DR   EnsemblGenomes-Gn; AT1G04797.
DR   EnsemblGenomes-Gn; AT1G04803.
DR   EnsemblGenomes-Gn; AT1G04807.
DR   EnsemblGenomes-Gn; AT1G04813.
DR   EnsemblGenomes-Gn; AT1G04817.
DR   EnsemblGenomes-Gn; AT1G04823.
DR   EnsemblGenomes-Gn; AT1G04827.
DR   EnsemblGenomes-Gn; AT1G04833.
DR   EnsemblGenomes-Gn; AT1G04837.
DR   EnsemblGenomes-Gn; AT1G04847.
DR   EnsemblGenomes-Gn; AT1G04853.
DR   EnsemblGenomes-Gn; AT1G04857.
DR   EnsemblGenomes-Gn; AT1G04863.
DR   EnsemblGenomes-Gn; AT1G04867.
DR   EnsemblGenomes-Gn; AT1G04873.
DR   EnsemblGenomes-Gn; AT1G04877.
DR   EnsemblGenomes-Gn; AT1G04883.
DR   EnsemblGenomes-Gn; AT1G04887.
DR   EnsemblGenomes-Gn; AT1G04893.
DR   EnsemblGenomes-Gn; AT1G04897.
DR   EnsemblGenomes-Gn; AT1G04907.
DR   EnsemblGenomes-Gn; AT1G04913.
DR   EnsemblGenomes-Gn; AT1G04917.
DR   EnsemblGenomes-Gn; AT1G04923.
DR   EnsemblGenomes-Gn; AT1G04927.
DR   EnsemblGenomes-Gn; AT1G04933.
DR   EnsemblGenomes-Gn; AT1G04937.
DR   EnsemblGenomes-Gn; AT1G04943.
DR   EnsemblGenomes-Gn; AT1G04947.
DR   EnsemblGenomes-Gn; AT1G04953.
DR   EnsemblGenomes-Gn; AT1G04957.
DR   EnsemblGenomes-Gn; AT1G04963.
DR   EnsemblGenomes-Gn; AT1G04967.
DR   EnsemblGenomes-Gn; AT1G04973.
DR   EnsemblGenomes-Gn; AT1G04977.
DR   EnsemblGenomes-Gn; AT1G04983.
DR   EnsemblGenomes-Gn; AT1G04987.
DR   EnsemblGenomes-Gn; AT1G04993.
DR   EnsemblGenomes-Gn; AT1G04997.
DR   EnsemblGenomes-Gn; AT1G05003.
DR   EnsemblGenomes-Gn; AT1G05007.
DR   EnsemblGenomes-Gn; AT1G05013.
DR   EnsemblGenomes-Gn; AT1G05017.
DR   EnsemblGenomes-Gn; AT1G05023.
DR   EnsemblGenomes-Gn; AT1G05027.
DR   EnsemblGenomes-Gn; AT1G05033.
DR   EnsemblGenomes-Gn; AT1G05037.
DR   EnsemblGenomes-Gn; AT1G05043.
DR   EnsemblGenomes-Gn; AT1G05047.
DR   EnsemblGenomes-Gn; AT1G05053.
DR   EnsemblGenomes-Gn; AT1G05057.
DR   EnsemblGenomes-Gn; AT1G05067.
DR   EnsemblGenomes-Gn; AT1G05073.
DR   EnsemblGenomes-Gn; AT1G05077.
DR   EnsemblGenomes-Gn; AT1G05083.
DR   EnsemblGenomes-Gn; AT1G05093.
DR   EnsemblGenomes-Gn; AT1G05097.
DR   EnsemblGenomes-Gn; AT1G05103.
DR   EnsemblGenomes-Gn; AT1G05107.
DR   EnsemblGenomes-Gn; AT1G05113.
DR   EnsemblGenomes-Gn; AT1G05117.
DR   EnsemblGenomes-Gn; AT1G05123.
DR   EnsemblGenomes-Gn; AT1G05127.
DR   EnsemblGenomes-Gn; AT1G05133.
DR   EnsemblGenomes-Gn; AT1G05137.
DR   EnsemblGenomes-Gn; AT1G05143.
DR   EnsemblGenomes-Gn; AT1G05147.
DR   EnsemblGenomes-Gn; AT1G05153.
DR   EnsemblGenomes-Gn; AT1G05163.
DR   EnsemblGenomes-Gn; AT1G05173.
DR   EnsemblGenomes-Gn; AT1G05177.
DR   EnsemblGenomes-Gn; AT1G05183.
DR   EnsemblGenomes-Gn; AT1G05187.
DR   EnsemblGenomes-Gn; AT1G05193.
DR   EnsemblGenomes-Gn; AT1G05197.
DR   EnsemblGenomes-Gn; AT1G05203.
DR   EnsemblGenomes-Gn; AT1G05207.
DR   EnsemblGenomes-Gn; AT1G05213.
DR   EnsemblGenomes-Gn; AT1G05217.
DR   EnsemblGenomes-Gn; AT1G05223.
DR   EnsemblGenomes-Gn; AT1G05227.
DR   EnsemblGenomes-Gn; AT1G05233.
DR   EnsemblGenomes-Gn; AT1G05237.
DR   EnsemblGenomes-Gn; AT1G05243.
DR   EnsemblGenomes-Gn; AT1G05247.
DR   EnsemblGenomes-Gn; AT1G05253.
DR   EnsemblGenomes-Gn; AT1G05257.
DR   EnsemblGenomes-Gn; AT1G05263.
DR   EnsemblGenomes-Gn; AT1G05267.
DR   EnsemblGenomes-Gn; AT1G05273.
DR   EnsemblGenomes-Gn; AT1G05277.
DR   EnsemblGenomes-Gn; AT1G05283.
DR   EnsemblGenomes-Gn; AT1G05287.
DR   EnsemblGenomes-Gn; AT1G05293.
DR   EnsemblGenomes-Gn; AT1G05297.
DR   EnsemblGenomes-Gn; AT1G05303.
DR   EnsemblGenomes-Gn; AT1G05307.
DR   EnsemblGenomes-Gn; AT1G05313.
DR   EnsemblGenomes-Gn; AT1G05317.
DR   EnsemblGenomes-Gn; AT1G05323.
DR   EnsemblGenomes-Gn; AT1G05327.
DR   EnsemblGenomes-Gn; AT1G05333.
DR   EnsemblGenomes-Gn; AT1G05337.
DR   EnsemblGenomes-Gn; AT1G05343.
DR   EnsemblGenomes-Gn; AT1G05347.
DR   EnsemblGenomes-Gn; AT1G05353.
DR   EnsemblGenomes-Gn; AT1G05357.
DR   EnsemblGenomes-Gn; AT1G05363.
DR   EnsemblGenomes-Gn; AT1G05367.
DR   EnsemblGenomes-Gn; AT1G05373.
DR   EnsemblGenomes-Gn; AT1G05377.
DR   EnsemblGenomes-Gn; AT1G05383.
DR   EnsemblGenomes-Gn; AT1G05387.
DR   EnsemblGenomes-Gn; AT1G05390.
DR   EnsemblGenomes-Gn; AT1G05397.
DR   EnsemblGenomes-Gn; AT1G05407.
DR   EnsemblGenomes-Gn; AT1G05413.
DR   EnsemblGenomes-Gn; AT1G05417.
DR   EnsemblGenomes-Gn; AT1G05423.
DR   EnsemblGenomes-Gn; AT1G05427.
DR   EnsemblGenomes-Gn; AT1G05433.
DR   EnsemblGenomes-Gn; AT1G05443.
DR   EnsemblGenomes-Gn; AT1G05447.
DR   EnsemblGenomes-Gn; AT1G05453.
DR   EnsemblGenomes-Gn; AT1G05463.
DR   EnsemblGenomes-Gn; AT1G05467.
DR   EnsemblGenomes-Gn; AT1G05473.
DR   EnsemblGenomes-Gn; AT1G05477.
DR   EnsemblGenomes-Gn; AT1G05483.
DR   EnsemblGenomes-Gn; AT1G05487.
DR   EnsemblGenomes-Gn; AT1G05493.
DR   EnsemblGenomes-Gn; AT1G05497.
DR   EnsemblGenomes-Gn; AT1G05507.
DR   EnsemblGenomes-Gn; AT1G05517.
DR   EnsemblGenomes-Gn; AT1G05523.
DR   EnsemblGenomes-Gn; AT1G05527.
DR   EnsemblGenomes-Gn; AT1G05533.
DR   EnsemblGenomes-Gn; AT1G05537.
DR   EnsemblGenomes-Gn; AT1G05543.
DR   EnsemblGenomes-Gn; AT1G05547.
DR   EnsemblGenomes-Gn; AT1G05553.
DR   EnsemblGenomes-Gn; AT1G05557.
DR   EnsemblGenomes-Gn; AT1G05562.
DR   EnsemblGenomes-Gn; AT1G05563.
DR   EnsemblGenomes-Gn; AT1G05567.
DR   EnsemblGenomes-Gn; AT1G05583.
DR   EnsemblGenomes-Gn; AT1G05587.
DR   EnsemblGenomes-Gn; AT1G05593.
DR   EnsemblGenomes-Gn; AT1G05597.
DR   EnsemblGenomes-Gn; AT1G05603.
DR   EnsemblGenomes-Gn; AT1G05607.
DR   EnsemblGenomes-Gn; AT1G05613.
DR   EnsemblGenomes-Gn; AT1G05617.
DR   EnsemblGenomes-Gn; AT1G05623.
DR   EnsemblGenomes-Gn; AT1G05627.
DR   EnsemblGenomes-Gn; AT1G05633.
DR   EnsemblGenomes-Gn; AT1G05637.
DR   EnsemblGenomes-Gn; AT1G05643.
DR   EnsemblGenomes-Gn; AT1G05647.
DR   EnsemblGenomes-Gn; AT1G05653.
DR   EnsemblGenomes-Gn; AT1G05657.
DR   EnsemblGenomes-Gn; AT1G05663.
DR   EnsemblGenomes-Gn; AT1G05667.
DR   EnsemblGenomes-Gn; AT1G05673.
DR   EnsemblGenomes-Gn; AT1G05683.
DR   EnsemblGenomes-Gn; AT1G05687.
DR   EnsemblGenomes-Gn; AT1G05693.
DR   EnsemblGenomes-Gn; AT1G05697.
DR   EnsemblGenomes-Gn; AT1G05703.
DR   EnsemblGenomes-Gn; AT1G05707.
DR   EnsemblGenomes-Gn; AT1G05713.
DR   EnsemblGenomes-Gn; AT1G05717.
DR   EnsemblGenomes-Gn; AT1G05723.
DR   EnsemblGenomes-Gn; AT1G05727.
DR   EnsemblGenomes-Gn; AT1G05733.
DR   EnsemblGenomes-Gn; AT1G05737.
DR   EnsemblGenomes-Gn; AT1G05747.
DR   EnsemblGenomes-Gn; AT1G05753.
DR   EnsemblGenomes-Gn; AT1G05757.
DR   EnsemblGenomes-Gn; AT1G05763.
DR   EnsemblGenomes-Gn; AT1G05767.
DR   EnsemblGenomes-Gn; AT1G05773.
DR   EnsemblGenomes-Gn; AT1G05777.
DR   EnsemblGenomes-Gn; AT1G05787.
DR   EnsemblGenomes-Gn; AT1G05793.
DR   EnsemblGenomes-Gn; AT1G05797.
DR   EnsemblGenomes-Gn; AT1G05803.
DR   EnsemblGenomes-Gn; AT1G05807.
DR   EnsemblGenomes-Gn; AT1G05813.
DR   EnsemblGenomes-Gn; AT1G05817.
DR   EnsemblGenomes-Gn; AT1G05823.
DR   EnsemblGenomes-Gn; AT1G05827.
DR   EnsemblGenomes-Gn; AT1G05833.
DR   EnsemblGenomes-Gn; AT1G05837.
DR   EnsemblGenomes-Gn; AT1G05843.
DR   EnsemblGenomes-Gn; AT1G05847.
DR   EnsemblGenomes-Gn; AT1G05853.
DR   EnsemblGenomes-Gn; AT1G05857.
DR   EnsemblGenomes-Gn; AT1G05863.
DR   EnsemblGenomes-Gn; AT1G05867.
DR   EnsemblGenomes-Gn; AT1G05873.
DR   EnsemblGenomes-Gn; AT1G05887.
DR   EnsemblGenomes-Gn; AT1G05893.
DR   EnsemblGenomes-Gn; AT1G05897.
DR   EnsemblGenomes-Gn; AT1G05903.
DR   EnsemblGenomes-Gn; AT1G05907.
DR   EnsemblGenomes-Gn; AT1G05913.
DR   EnsemblGenomes-Gn; AT1G05917.
DR   EnsemblGenomes-Gn; AT1G05927.
DR   EnsemblGenomes-Gn; AT1G05933.
DR   EnsemblGenomes-Gn; AT1G05937.
DR   EnsemblGenomes-Gn; AT1G05943.
DR   EnsemblGenomes-Gn; AT1G05947.
DR   EnsemblGenomes-Gn; AT1G05953.
DR   EnsemblGenomes-Gn; AT1G05957.
DR   EnsemblGenomes-Gn; AT1G05963.
DR   EnsemblGenomes-Gn; AT1G05967.
DR   EnsemblGenomes-Gn; AT1G05973.
DR   EnsemblGenomes-Gn; AT1G05977.
DR   EnsemblGenomes-Gn; AT1G05980.
DR   EnsemblGenomes-Gn; AT1G05983.
DR   EnsemblGenomes-Gn; AT1G05987.
DR   EnsemblGenomes-Gn; AT1G05993.
DR   EnsemblGenomes-Gn; AT1G05997.
DR   EnsemblGenomes-Gn; AT1G06002.
DR   EnsemblGenomes-Gn; AT1G06003.
DR   EnsemblGenomes-Gn; AT1G06007.
DR   EnsemblGenomes-Gn; AT1G06013.
DR   EnsemblGenomes-Gn; AT1G06017.
DR   EnsemblGenomes-Gn; AT1G06023.
DR   EnsemblGenomes-Gn; AT1G06027.
DR   EnsemblGenomes-Gn; AT1G06033.
DR   EnsemblGenomes-Gn; AT1G06037.
DR   EnsemblGenomes-Gn; AT1G06043.
DR   EnsemblGenomes-Gn; AT1G06047.
DR   EnsemblGenomes-Gn; AT1G06053.
DR   EnsemblGenomes-Gn; AT1G06057.
DR   EnsemblGenomes-Gn; AT1G06063.
DR   EnsemblGenomes-Gn; AT1G06067.
DR   EnsemblGenomes-Gn; AT1G06073.
DR   EnsemblGenomes-Gn; AT1G06083.
DR   EnsemblGenomes-Gn; AT1G06087.
DR   EnsemblGenomes-Gn; AT1G06093.
DR   EnsemblGenomes-Gn; AT1G06097.
DR   EnsemblGenomes-Gn; AT1G06103.
DR   EnsemblGenomes-Gn; AT1G06113.
DR   EnsemblGenomes-Gn; AT1G06117.
DR   EnsemblGenomes-Gn; AT1G06123.
DR   EnsemblGenomes-Gn; AT1G06127.
DR   EnsemblGenomes-Gn; AT1G06133.
DR   EnsemblGenomes-Gn; AT1G06147.
DR   EnsemblGenomes-Gn; AT1G06153.
DR   EnsemblGenomes-Gn; AT1G06157.
DR   EnsemblGenomes-Gn; AT1G06163.
DR   EnsemblGenomes-Gn; AT1G06173.
DR   EnsemblGenomes-Gn; AT1G06177.
DR   EnsemblGenomes-Gn; AT1G06187.
DR   EnsemblGenomes-Gn; AT1G06197.
DR   EnsemblGenomes-Gn; AT1G06203.
DR   EnsemblGenomes-Gn; AT1G06207.
DR   EnsemblGenomes-Gn; AT1G06210.
DR   EnsemblGenomes-Gn; AT1G06213.
DR   EnsemblGenomes-Gn; AT1G06217.
DR   EnsemblGenomes-Gn; AT1G06227.
DR   EnsemblGenomes-Gn; AT1G06233.
DR   EnsemblGenomes-Gn; AT1G06237.
DR   EnsemblGenomes-Gn; AT1G06243.
DR   EnsemblGenomes-Gn; AT1G06247.
DR   EnsemblGenomes-Gn; AT1G06253.
DR   EnsemblGenomes-Gn; AT1G06257.
DR   EnsemblGenomes-Gn; AT1G06263.
DR   EnsemblGenomes-Gn; AT1G06265.
DR   EnsemblGenomes-Gn; AT1G06267.
DR   EnsemblGenomes-Gn; AT1G06273.
DR   EnsemblGenomes-Gn; AT1G06277.
DR   EnsemblGenomes-Gn; AT1G06283.
DR   EnsemblGenomes-Gn; AT1G06287.
DR   EnsemblGenomes-Gn; AT1G06293.
DR   EnsemblGenomes-Gn; AT1G06297.
DR   EnsemblGenomes-Gn; AT1G06303.
DR   EnsemblGenomes-Gn; AT1G06307.
DR   EnsemblGenomes-Gn; AT1G06313.
DR   EnsemblGenomes-Gn; AT1G06317.
DR   EnsemblGenomes-Gn; AT1G06323.
DR   EnsemblGenomes-Gn; AT1G06327.
DR   EnsemblGenomes-Gn; AT1G06333.
DR   EnsemblGenomes-Gn; AT1G06337.
DR   EnsemblGenomes-Gn; AT1G06343.
DR   EnsemblGenomes-Gn; AT1G06347.
DR   EnsemblGenomes-Gn; AT1G06353.
DR   EnsemblGenomes-Gn; AT1G06357.
DR   EnsemblGenomes-Gn; AT1G06363.
DR   EnsemblGenomes-Gn; AT1G06373.
DR   EnsemblGenomes-Gn; AT1G06377.
DR   EnsemblGenomes-Gn; AT1G06383.
DR   EnsemblGenomes-Gn; AT1G06387.
DR   EnsemblGenomes-Gn; AT1G06393.
DR   EnsemblGenomes-Gn; AT1G06397.
DR   EnsemblGenomes-Gn; AT1G06403.
DR   EnsemblGenomes-Gn; AT1G06407.
DR   EnsemblGenomes-Gn; AT1G06413.
DR   EnsemblGenomes-Gn; AT1G06417.
DR   EnsemblGenomes-Gn; AT1G06423.
DR   EnsemblGenomes-Gn; AT1G06427.
DR   EnsemblGenomes-Gn; AT1G06433.
DR   EnsemblGenomes-Gn; AT1G06437.
DR   EnsemblGenomes-Gn; AT1G06443.
DR   EnsemblGenomes-Gn; AT1G06447.
DR   EnsemblGenomes-Gn; AT1G06453.
DR   EnsemblGenomes-Gn; AT1G06457.
DR   EnsemblGenomes-Gn; AT1G06463.
DR   EnsemblGenomes-Gn; AT1G06467.
DR   EnsemblGenomes-Gn; AT1G06473.
DR   EnsemblGenomes-Gn; AT1G06480.
DR   EnsemblGenomes-Gn; AT1G06483.
DR   EnsemblGenomes-Gn; AT1G06487.
DR   EnsemblGenomes-Gn; AT1G06493.
DR   EnsemblGenomes-Gn; AT1G06497.
DR   EnsemblGenomes-Gn; AT1G06507.
DR   EnsemblGenomes-Gn; AT1G06513.
DR   EnsemblGenomes-Gn; AT1G06517.
DR   EnsemblGenomes-Gn; AT1G06523.
DR   EnsemblGenomes-Gn; AT1G06527.
DR   EnsemblGenomes-Gn; AT1G06533.
DR   EnsemblGenomes-Gn; AT1G06537.
DR   EnsemblGenomes-Gn; AT1G06543.
DR   EnsemblGenomes-Gn; AT1G06547.
DR   EnsemblGenomes-Gn; AT1G06553.
DR   EnsemblGenomes-Gn; AT1G06557.
DR   EnsemblGenomes-Gn; AT1G06567.
DR   EnsemblGenomes-Gn; AT1G06573.
DR   EnsemblGenomes-Gn; AT1G06577.
DR   EnsemblGenomes-Gn; AT1G06583.
DR   EnsemblGenomes-Gn; AT1G06587.
DR   EnsemblGenomes-Gn; AT1G06593.
DR   EnsemblGenomes-Gn; AT1G06597.
DR   EnsemblGenomes-Gn; AT1G06603.
DR   EnsemblGenomes-Gn; AT1G06607.
DR   EnsemblGenomes-Gn; AT1G06610.
DR   EnsemblGenomes-Gn; AT1G06613.
DR   EnsemblGenomes-Gn; AT1G06617.
DR   EnsemblGenomes-Gn; AT1G06623.
DR   EnsemblGenomes-Gn; AT1G06627.
DR   EnsemblGenomes-Gn; AT1G06633.
DR   EnsemblGenomes-Gn; AT1G06637.
DR   EnsemblGenomes-Gn; AT1G06643.
DR   EnsemblGenomes-Gn; AT1G06647.
DR   EnsemblGenomes-Gn; AT1G06653.
DR   EnsemblGenomes-Gn; AT1G06657.
DR   EnsemblGenomes-Gn; AT1G06663.
DR   EnsemblGenomes-Gn; AT1G06667.
DR   EnsemblGenomes-Gn; AT1G06673.
DR   EnsemblGenomes-Gn; AT1G06677.
DR   EnsemblGenomes-Gn; AT1G06683.
DR   EnsemblGenomes-Gn; AT1G06687.
DR   EnsemblGenomes-Gn; AT1G06693.
DR   EnsemblGenomes-Gn; AT1G06697.
DR   EnsemblGenomes-Gn; AT1G06703.
DR   EnsemblGenomes-Gn; AT1G06707.
DR   EnsemblGenomes-Gn; AT1G06713.
DR   EnsemblGenomes-Gn; AT1G06717.
DR   EnsemblGenomes-Gn; AT1G06723.
DR   EnsemblGenomes-Gn; AT1G06727.
DR   EnsemblGenomes-Gn; AT1G06733.
DR   EnsemblGenomes-Gn; AT1G06737.
DR   EnsemblGenomes-Gn; AT1G06743.
DR   EnsemblGenomes-Gn; AT1G06747.
DR   EnsemblGenomes-Gn; AT1G06753.
DR   EnsemblGenomes-Gn; AT1G06757.
DR   EnsemblGenomes-Gn; AT1G06773.
DR   EnsemblGenomes-Gn; AT1G06777.
DR   EnsemblGenomes-Gn; AT1G06783.
DR   EnsemblGenomes-Gn; AT1G06787.
DR   EnsemblGenomes-Gn; AT1G06797.
DR   EnsemblGenomes-Gn; AT1G06817.
DR   EnsemblGenomes-Gn; AT1G06823.
DR   EnsemblGenomes-Gn; AT1G06827.
DR   EnsemblGenomes-Gn; AT1G06837.
DR   EnsemblGenomes-Gn; AT1G06853.
DR   EnsemblGenomes-Gn; AT1G06857.
DR   EnsemblGenomes-Gn; AT1G06860.
DR   EnsemblGenomes-Gn; AT1G06863.
DR   EnsemblGenomes-Gn; AT1G06867.
DR   EnsemblGenomes-Gn; AT1G06873.
DR   EnsemblGenomes-Gn; AT1G06877.
DR   EnsemblGenomes-Gn; AT1G06880.
DR   EnsemblGenomes-Gn; AT1G06883.
DR   EnsemblGenomes-Gn; AT1G06897.
DR   EnsemblGenomes-Gn; AT1G06903.
DR   EnsemblGenomes-Gn; AT1G06907.
DR   EnsemblGenomes-Gn; AT1G06913.
DR   EnsemblGenomes-Gn; AT1G06917.
DR   EnsemblGenomes-Gn; AT1G06927.
DR   EnsemblGenomes-Gn; AT1G06933.
DR   EnsemblGenomes-Gn; AT1G06937.
DR   EnsemblGenomes-Gn; AT1G06943.
DR   EnsemblGenomes-Gn; AT1G06947.
DR   EnsemblGenomes-Gn; AT1G06953.
DR   EnsemblGenomes-Gn; AT1G06957.
DR   EnsemblGenomes-Gn; AT1G06963.
DR   EnsemblGenomes-Gn; AT1G06967.
DR   EnsemblGenomes-Gn; AT1G06973.
DR   EnsemblGenomes-Gn; AT1G06977.
DR   EnsemblGenomes-Gn; AT1G06983.
DR   EnsemblGenomes-Gn; AT1G06987.
DR   EnsemblGenomes-Gn; AT1G06993.
DR   EnsemblGenomes-Gn; AT1G06997.
DR   EnsemblGenomes-Gn; AT1G07003.
DR   EnsemblGenomes-Gn; AT1G07007.
DR   EnsemblGenomes-Gn; AT1G07013.
DR   EnsemblGenomes-Gn; AT1G07017.
DR   EnsemblGenomes-Gn; AT1G07023.
DR   EnsemblGenomes-Gn; AT1G07027.
DR   EnsemblGenomes-Gn; AT1G07051.
DR   EnsemblGenomes-Gn; AT1G07100.
DR   EnsemblGenomes-Gn; AT1G07117.
DR   EnsemblGenomes-Gn; AT1G07119.
DR   EnsemblGenomes-Gn; AT1G07123.
DR   EnsemblGenomes-Gn; AT1G07127.
DR   EnsemblGenomes-Gn; AT1G07128.
DR   EnsemblGenomes-Gn; AT1G07133.
DR   EnsemblGenomes-Gn; AT1G07137.
DR   EnsemblGenomes-Gn; AT1G07143.
DR   EnsemblGenomes-Gn; AT1G07147.
DR   EnsemblGenomes-Gn; AT1G07157.
DR   EnsemblGenomes-Gn; AT1G07163.
DR   EnsemblGenomes-Gn; AT1G07167.
DR   EnsemblGenomes-Gn; AT1G07173.
DR   EnsemblGenomes-Gn; AT1G07177.
DR   EnsemblGenomes-Gn; AT1G07183.
DR   EnsemblGenomes-Gn; AT1G07187.
DR   EnsemblGenomes-Gn; AT1G07193.
DR   EnsemblGenomes-Gn; AT1G07197.
DR   EnsemblGenomes-Gn; AT1G07233.
DR   EnsemblGenomes-Gn; AT1G07237.
DR   EnsemblGenomes-Gn; AT1G07243.
DR   EnsemblGenomes-Gn; AT1G07247.
DR   EnsemblGenomes-Gn; AT1G07253.
DR   EnsemblGenomes-Gn; AT1G07257.
DR   EnsemblGenomes-Gn; AT1G07263.
DR   EnsemblGenomes-Gn; AT1G07267.
DR   EnsemblGenomes-Gn; AT1G07273.
DR   EnsemblGenomes-Gn; AT1G07277.
DR   EnsemblGenomes-Gn; AT1G07283.
DR   EnsemblGenomes-Gn; AT1G07287.
DR   EnsemblGenomes-Gn; AT1G07290.
DR   EnsemblGenomes-Gn; AT1G07293.
DR   EnsemblGenomes-Gn; AT1G07297.
DR   EnsemblGenomes-Gn; AT1G07303.
DR   EnsemblGenomes-Gn; AT1G07313.
DR   EnsemblGenomes-Gn; AT1G07317.
DR   EnsemblGenomes-Gn; AT1G07323.
DR   EnsemblGenomes-Gn; AT1G07327.
DR   EnsemblGenomes-Gn; AT1G07333.
DR   EnsemblGenomes-Gn; AT1G07337.
DR   EnsemblGenomes-Gn; AT1G07343.
DR   EnsemblGenomes-Gn; AT1G07347.
DR   EnsemblGenomes-Gn; AT1G07353.
DR   EnsemblGenomes-Gn; AT1G07357.
DR   EnsemblGenomes-Gn; AT1G07367.
DR   EnsemblGenomes-Gn; AT1G07373.
DR   EnsemblGenomes-Gn; AT1G07383.
DR   EnsemblGenomes-Gn; AT1G07393.
DR   EnsemblGenomes-Gn; AT1G07397.
DR   EnsemblGenomes-Gn; AT1G07407.
DR   EnsemblGenomes-Gn; AT1G07413.
DR   EnsemblGenomes-Gn; AT1G07417.
DR   EnsemblGenomes-Gn; AT1G07423.
DR   EnsemblGenomes-Gn; AT1G07433.
DR   EnsemblGenomes-Gn; AT1G07437.
DR   EnsemblGenomes-Gn; AT1G07447.
DR   EnsemblGenomes-Gn; AT1G07453.
DR   EnsemblGenomes-Gn; AT1G07457.
DR   EnsemblGenomes-Gn; AT1G07463.
DR   EnsemblGenomes-Gn; AT1G07467.
DR   EnsemblGenomes-Gn; AT1G07477.
DR   EnsemblGenomes-Gn; AT1G07483.
DR   EnsemblGenomes-Gn; AT1G07487.
DR   EnsemblGenomes-Gn; AT1G07493.
DR   EnsemblGenomes-Gn; AT1G07497.
DR   EnsemblGenomes-Gn; AT1G07503.
DR   EnsemblGenomes-Gn; AT1G07507.
DR   EnsemblGenomes-Gn; AT1G07513.
DR   EnsemblGenomes-Gn; AT1G07517.
DR   EnsemblGenomes-Gn; AT1G07523.
DR   EnsemblGenomes-Gn; AT1G07527.
DR   EnsemblGenomes-Gn; AT1G07533.
DR   EnsemblGenomes-Gn; AT1G07537.
DR   EnsemblGenomes-Gn; AT1G07543.
DR   EnsemblGenomes-Gn; AT1G07547.
DR   EnsemblGenomes-Gn; AT1G07553.
DR   EnsemblGenomes-Gn; AT1G07557.
DR   EnsemblGenomes-Gn; AT1G07563.
DR   EnsemblGenomes-Gn; AT1G07567.
DR   EnsemblGenomes-Gn; AT1G07573.
DR   EnsemblGenomes-Gn; AT1G07580.
DR   EnsemblGenomes-Gn; AT1G07583.
DR   EnsemblGenomes-Gn; AT1G07587.
DR   EnsemblGenomes-Gn; AT1G07593.
DR   EnsemblGenomes-Gn; AT1G07597.
DR   EnsemblGenomes-Gn; AT1G07603.
DR   EnsemblGenomes-Gn; AT1G07607.
DR   EnsemblGenomes-Gn; AT1G07613.
DR   EnsemblGenomes-Gn; AT1G07617.
DR   EnsemblGenomes-Gn; AT1G07623.
DR   EnsemblGenomes-Gn; AT1G07627.
DR   EnsemblGenomes-Gn; AT1G07633.
DR   EnsemblGenomes-Gn; AT1G07637.
DR   EnsemblGenomes-Gn; AT1G07647.
DR   EnsemblGenomes-Gn; AT1G07653.
DR   EnsemblGenomes-Gn; AT1G07657.
DR   EnsemblGenomes-Gn; AT1G07663.
DR   EnsemblGenomes-Gn; AT1G07667.
DR   EnsemblGenomes-Gn; AT1G07673.
DR   EnsemblGenomes-Gn; AT1G07683.
DR   EnsemblGenomes-Gn; AT1G07693.
DR   EnsemblGenomes-Gn; AT1G07697.
DR   EnsemblGenomes-Gn; AT1G07702.
DR   EnsemblGenomes-Gn; AT1G07703.
DR   EnsemblGenomes-Gn; AT1G07707.
DR   EnsemblGenomes-Gn; AT1G07717.
DR   EnsemblGenomes-Gn; AT1G07723.
DR   EnsemblGenomes-Gn; AT1G07727.
DR   EnsemblGenomes-Gn; AT1G07728.
DR   EnsemblGenomes-Gn; AT1G07733.
DR   EnsemblGenomes-Gn; AT1G07737.
DR   EnsemblGenomes-Gn; AT1G07743.
DR   EnsemblGenomes-Gn; AT1G07753.
DR   EnsemblGenomes-Gn; AT1G07757.
DR   EnsemblGenomes-Gn; AT1G07760.
DR   EnsemblGenomes-Gn; AT1G07763.
DR   EnsemblGenomes-Gn; AT1G07767.
DR   EnsemblGenomes-Gn; AT1G07773.
DR   EnsemblGenomes-Gn; AT1G07777.
DR   EnsemblGenomes-Gn; AT1G07783.
DR   EnsemblGenomes-Gn; AT1G07787.
DR   EnsemblGenomes-Gn; AT1G07793.
DR   EnsemblGenomes-Gn; AT1G07803.
DR   EnsemblGenomes-Gn; AT1G07807.
DR   EnsemblGenomes-Gn; AT1G07813.
DR   EnsemblGenomes-Gn; AT1G07823.
DR   EnsemblGenomes-Gn; AT1G07827.
DR   EnsemblGenomes-Gn; AT1G07833.
DR   EnsemblGenomes-Gn; AT1G07837.
DR   EnsemblGenomes-Gn; AT1G07843.
DR   EnsemblGenomes-Gn; AT1G07847.
DR   EnsemblGenomes-Gn; AT1G07853.
DR   EnsemblGenomes-Gn; AT1G07857.
DR   EnsemblGenomes-Gn; AT1G07863.
DR   EnsemblGenomes-Gn; AT1G07867.
DR   EnsemblGenomes-Gn; AT1G07873.
DR   EnsemblGenomes-Gn; AT1G07877.
DR   EnsemblGenomes-Gn; AT1G07883.
DR   EnsemblGenomes-Gn; AT1G07887.
DR   EnsemblGenomes-Gn; AT1G07893.
DR   EnsemblGenomes-Gn; AT1G07897.
DR   EnsemblGenomes-Gn; AT1G07903.
DR   EnsemblGenomes-Gn; AT1G07907.
DR   EnsemblGenomes-Gn; AT1G07910.
DR   EnsemblGenomes-Gn; AT1G07913.
DR   EnsemblGenomes-Gn; AT1G07917.
DR   EnsemblGenomes-Gn; AT1G07923.
DR   EnsemblGenomes-Gn; AT1G07927.
DR   EnsemblGenomes-Gn; AT1G07933.
DR   EnsemblGenomes-Gn; AT1G07937.
DR   EnsemblGenomes-Gn; AT1G07943.
DR   EnsemblGenomes-Gn; AT1G07947.
DR   EnsemblGenomes-Gn; AT1G07957.
DR   EnsemblGenomes-Gn; AT1G07963.
DR   EnsemblGenomes-Gn; AT1G07967.
DR   EnsemblGenomes-Gn; AT1G07973.
DR   EnsemblGenomes-Gn; AT1G07977.
DR   EnsemblGenomes-Gn; AT1G07983.
DR   EnsemblGenomes-Gn; AT1G07987.
DR   EnsemblGenomes-Gn; AT1G07993.
DR   EnsemblGenomes-Gn; AT1G07997.
DR   EnsemblGenomes-Gn; AT1G08003.
DR   EnsemblGenomes-Gn; AT1G08007.
DR   EnsemblGenomes-Gn; AT1G08013.
DR   EnsemblGenomes-Gn; AT1G08017.
DR   EnsemblGenomes-Gn; AT1G08023.
DR   EnsemblGenomes-Gn; AT1G08027.
DR   EnsemblGenomes-Gn; AT1G08033.
DR   EnsemblGenomes-Gn; AT1G08037.
DR   EnsemblGenomes-Gn; AT1G08043.
DR   EnsemblGenomes-Gn; AT1G08047.
DR   EnsemblGenomes-Gn; AT1G08053.
DR   EnsemblGenomes-Gn; AT1G08057.
DR   EnsemblGenomes-Gn; AT1G08063.
DR   EnsemblGenomes-Gn; AT1G08073.
DR   EnsemblGenomes-Gn; AT1G08077.
DR   EnsemblGenomes-Gn; AT1G08087.
DR   EnsemblGenomes-Gn; AT1G08093.
DR   EnsemblGenomes-Gn; AT1G08097.
DR   EnsemblGenomes-Gn; AT1G08103.
DR   EnsemblGenomes-Gn; AT1G08107.
DR   EnsemblGenomes-Gn; AT1G08113.
DR   EnsemblGenomes-Gn; AT1G08115.
DR   EnsemblGenomes-Gn; AT1G08117.
DR   EnsemblGenomes-Gn; AT1G08123.
DR   EnsemblGenomes-Gn; AT1G08127.
DR   EnsemblGenomes-Gn; AT1G08133.
DR   EnsemblGenomes-Gn; AT1G08137.
DR   EnsemblGenomes-Gn; AT1G08143.
DR   EnsemblGenomes-Gn; AT1G08147.
DR   EnsemblGenomes-Gn; AT1G08153.
DR   EnsemblGenomes-Gn; AT1G08157.
DR   EnsemblGenomes-Gn; AT1G08163.
DR   EnsemblGenomes-Gn; AT1G08173.
DR   EnsemblGenomes-Gn; AT1G08177.
DR   EnsemblGenomes-Gn; AT1G08183.
DR   EnsemblGenomes-Gn; AT1G08193.
DR   EnsemblGenomes-Gn; AT1G08207.
DR   EnsemblGenomes-Gn; AT1G08213.
DR   EnsemblGenomes-Gn; AT1G08217.
DR   EnsemblGenomes-Gn; AT1G08223.
DR   EnsemblGenomes-Gn; AT1G08227.
DR   EnsemblGenomes-Gn; AT1G08237.
DR   EnsemblGenomes-Gn; AT1G08240.
DR   EnsemblGenomes-Gn; AT1G08247.
DR   EnsemblGenomes-Gn; AT1G08253.
DR   EnsemblGenomes-Gn; AT1G08257.
DR   EnsemblGenomes-Gn; AT1G08263.
DR   EnsemblGenomes-Gn; AT1G08267.
DR   EnsemblGenomes-Gn; AT1G08273.
DR   EnsemblGenomes-Gn; AT1G08277.
DR   EnsemblGenomes-Gn; AT1G08283.
DR   EnsemblGenomes-Gn; AT1G08287.
DR   EnsemblGenomes-Gn; AT1G08293.
DR   EnsemblGenomes-Gn; AT1G08297.
DR   EnsemblGenomes-Gn; AT1G08303.
DR   EnsemblGenomes-Gn; AT1G08307.
DR   EnsemblGenomes-Gn; AT1G08313.
DR   EnsemblGenomes-Gn; AT1G08317.
DR   EnsemblGenomes-Gn; AT1G08323.
DR   EnsemblGenomes-Gn; AT1G08327.
DR   EnsemblGenomes-Gn; AT1G08333.
DR   EnsemblGenomes-Gn; AT1G08337.
DR   EnsemblGenomes-Gn; AT1G08343.
DR   EnsemblGenomes-Gn; AT1G08347.
DR   EnsemblGenomes-Gn; AT1G08353.
DR   EnsemblGenomes-Gn; AT1G08357.
DR   EnsemblGenomes-Gn; AT1G08363.
DR   EnsemblGenomes-Gn; AT1G08367.
DR   EnsemblGenomes-Gn; AT1G08377.
DR   EnsemblGenomes-Gn; AT1G08383.
DR   EnsemblGenomes-Gn; AT1G08387.
DR   EnsemblGenomes-Gn; AT1G08393.
DR   EnsemblGenomes-Gn; AT1G08397.
DR   EnsemblGenomes-Gn; AT1G08403.
DR   EnsemblGenomes-Gn; AT1G08413.
DR   EnsemblGenomes-Gn; AT1G08417.
DR   EnsemblGenomes-Gn; AT1G08427.
DR   EnsemblGenomes-Gn; AT1G08433.
DR   EnsemblGenomes-Gn; AT1G08437.
DR   EnsemblGenomes-Gn; AT1G08443.
DR   EnsemblGenomes-Gn; AT1G08447.
DR   EnsemblGenomes-Gn; AT1G08453.
DR   EnsemblGenomes-Gn; AT1G08457.
DR   EnsemblGenomes-Gn; AT1G08463.
DR   EnsemblGenomes-Gn; AT1G08473.
DR   EnsemblGenomes-Gn; AT1G08477.
DR   EnsemblGenomes-Gn; AT1G08483.
DR   EnsemblGenomes-Gn; AT1G08487.
DR   EnsemblGenomes-Gn; AT1G08493.
DR   EnsemblGenomes-Gn; AT1G08497.
DR   EnsemblGenomes-Gn; AT1G08503.
DR   EnsemblGenomes-Gn; AT1G08507.
DR   EnsemblGenomes-Gn; AT1G08513.
DR   EnsemblGenomes-Gn; AT1G08517.
DR   EnsemblGenomes-Gn; AT1G08523.
DR   EnsemblGenomes-Gn; AT1G08533.
DR   EnsemblGenomes-Gn; AT1G08537.
DR   EnsemblGenomes-Gn; AT1G08543.
DR   EnsemblGenomes-Gn; AT1G08547.
DR   EnsemblGenomes-Gn; AT1G08553.
DR   EnsemblGenomes-Gn; AT1G08557.
DR   EnsemblGenomes-Gn; AT1G08563.
DR   EnsemblGenomes-Gn; AT1G08567.
DR   EnsemblGenomes-Gn; AT1G08573.
DR   EnsemblGenomes-Gn; AT1G08577.
DR   EnsemblGenomes-Gn; AT1G08583.
DR   EnsemblGenomes-Gn; AT1G08587.
DR   EnsemblGenomes-Gn; AT1G08592.
DR   EnsemblGenomes-Gn; AT1G08597.
DR   EnsemblGenomes-Gn; AT1G08603.
DR   EnsemblGenomes-Gn; AT1G08607.
DR   EnsemblGenomes-Gn; AT1G08613.
DR   EnsemblGenomes-Gn; AT1G08623.
DR   EnsemblGenomes-Gn; AT1G08627.
DR   EnsemblGenomes-Gn; AT1G08633.
DR   EnsemblGenomes-Gn; AT1G08637.
DR   EnsemblGenomes-Gn; AT1G08643.
DR   EnsemblGenomes-Gn; AT1G08647.
DR   EnsemblGenomes-Gn; AT1G08653.
DR   EnsemblGenomes-Gn; AT1G08657.
DR   EnsemblGenomes-Gn; AT1G08663.
DR   EnsemblGenomes-Gn; AT1G08667.
DR   EnsemblGenomes-Gn; AT1G08673.
DR   EnsemblGenomes-Gn; AT1G08677.
DR   EnsemblGenomes-Gn; AT1G08683.
DR   EnsemblGenomes-Gn; AT1G08697.
DR   EnsemblGenomes-Gn; AT1G08703.
DR   EnsemblGenomes-Gn; AT1G08707.
DR   EnsemblGenomes-Gn; AT1G08713.
DR   EnsemblGenomes-Gn; AT1G08717.
DR   EnsemblGenomes-Gn; AT1G08723.
DR   EnsemblGenomes-Gn; AT1G08727.
DR   EnsemblGenomes-Gn; AT1G08733.
DR   EnsemblGenomes-Gn; AT1G08737.
DR   EnsemblGenomes-Gn; AT1G08743.
DR   EnsemblGenomes-Gn; AT1G08747.
DR   EnsemblGenomes-Gn; AT1G08753.
DR   EnsemblGenomes-Gn; AT1G08757.
DR   EnsemblGenomes-Gn; AT1G08763.
DR   EnsemblGenomes-Gn; AT1G08767.
DR   EnsemblGenomes-Gn; AT1G08773.
DR   EnsemblGenomes-Gn; AT1G08777.
DR   EnsemblGenomes-Gn; AT1G08783.
DR   EnsemblGenomes-Gn; AT1G08787.
DR   EnsemblGenomes-Gn; AT1G08793.
DR   EnsemblGenomes-Gn; AT1G08797.
DR   EnsemblGenomes-Gn; AT1G08803.
DR   EnsemblGenomes-Gn; AT1G08807.
DR   EnsemblGenomes-Gn; AT1G08813.
DR   EnsemblGenomes-Gn; AT1G08817.
DR   EnsemblGenomes-Gn; AT1G08823.
DR   EnsemblGenomes-Gn; AT1G08827.
DR   EnsemblGenomes-Gn; AT1G08833.
DR   EnsemblGenomes-Gn; AT1G08843.
DR   EnsemblGenomes-Gn; AT1G08847.
DR   EnsemblGenomes-Gn; AT1G08853.
DR   EnsemblGenomes-Gn; AT1G08857.
DR   EnsemblGenomes-Gn; AT1G08863.
DR   EnsemblGenomes-Gn; AT1G08867.
DR   EnsemblGenomes-Gn; AT1G08870.
DR   EnsemblGenomes-Gn; AT1G08877.
DR   EnsemblGenomes-Gn; AT1G08883.
DR   EnsemblGenomes-Gn; AT1G08887.
DR   EnsemblGenomes-Gn; AT1G08893.
DR   EnsemblGenomes-Gn; AT1G08897.
DR   EnsemblGenomes-Gn; AT1G08903.
DR   EnsemblGenomes-Gn; AT1G08907.
DR   EnsemblGenomes-Gn; AT1G08913.
DR   EnsemblGenomes-Gn; AT1G08923.
DR   EnsemblGenomes-Gn; AT1G08927.
DR   EnsemblGenomes-Gn; AT1G08933.
DR   EnsemblGenomes-Gn; AT1G08937.
DR   EnsemblGenomes-Gn; AT1G08947.
DR   EnsemblGenomes-Gn; AT1G08950.
DR   EnsemblGenomes-Gn; AT1G08953.
DR   EnsemblGenomes-Gn; AT1G08963.
DR   EnsemblGenomes-Gn; AT1G08967.
DR   EnsemblGenomes-Gn; AT1G08973.
DR   EnsemblGenomes-Gn; AT1G08977.
DR   EnsemblGenomes-Gn; AT1G08983.
DR   EnsemblGenomes-Gn; AT1G08987.
DR   EnsemblGenomes-Gn; AT1G08993.
DR   EnsemblGenomes-Gn; AT1G08997.
DR   EnsemblGenomes-Gn; AT1G09003.
DR   EnsemblGenomes-Gn; AT1G09007.
DR   EnsemblGenomes-Gn; AT1G09013.
DR   EnsemblGenomes-Gn; AT1G09017.
DR   EnsemblGenomes-Gn; AT1G09023.
DR   EnsemblGenomes-Gn; AT1G09027.
DR   EnsemblGenomes-Gn; AT1G09033.
DR   EnsemblGenomes-Gn; AT1G09037.
DR   EnsemblGenomes-Gn; AT1G09043.
DR   EnsemblGenomes-Gn; AT1G09047.
DR   EnsemblGenomes-Gn; AT1G09053.
DR   EnsemblGenomes-Gn; AT1G09057.
DR   EnsemblGenomes-Gn; AT1G09063.
DR   EnsemblGenomes-Gn; AT1G09067.
DR   EnsemblGenomes-Gn; AT1G09073.
DR   EnsemblGenomes-Gn; AT1G09077.
DR   EnsemblGenomes-Gn; AT1G09083.
DR   EnsemblGenomes-Gn; AT1G09087.
DR   EnsemblGenomes-Gn; AT1G09097.
DR   EnsemblGenomes-Gn; AT1G09103.
DR   EnsemblGenomes-Gn; AT1G09107.
DR   EnsemblGenomes-Gn; AT1G09110.
DR   EnsemblGenomes-Gn; AT1G09113.
DR   EnsemblGenomes-Gn; AT1G09117.
DR   EnsemblGenomes-Gn; AT1G09123.
DR   EnsemblGenomes-Gn; AT1G09127.
DR   EnsemblGenomes-Gn; AT1G09133.
DR   EnsemblGenomes-Gn; AT1G09137.
DR   EnsemblGenomes-Gn; AT1G09143.
DR   EnsemblGenomes-Gn; AT1G09147.
DR   EnsemblGenomes-Gn; AT1G09153.
DR   EnsemblGenomes-Gn; AT1G09163.
DR   EnsemblGenomes-Gn; AT1G09167.
DR   EnsemblGenomes-Gn; AT1G09173.
DR   EnsemblGenomes-Gn; AT1G09177.
DR   EnsemblGenomes-Gn; AT1G09183.
DR   EnsemblGenomes-Gn; AT1G09187.
DR   EnsemblGenomes-Gn; AT1G09193.
DR   EnsemblGenomes-Gn; AT1G09197.
DR   EnsemblGenomes-Gn; AT1G09207.
DR   EnsemblGenomes-Gn; AT1G09213.
DR   EnsemblGenomes-Gn; AT1G09217.
DR   EnsemblGenomes-Gn; AT1G09223.
DR   EnsemblGenomes-Gn; AT1G09227.
DR   EnsemblGenomes-Gn; AT1G09233.
DR   EnsemblGenomes-Gn; AT1G09237.
DR   EnsemblGenomes-Gn; AT1G09243.
DR   EnsemblGenomes-Gn; AT1G09247.
DR   EnsemblGenomes-Gn; AT1G09253.
DR   EnsemblGenomes-Gn; AT1G09257.
DR   EnsemblGenomes-Gn; AT1G09263.
DR   EnsemblGenomes-Gn; AT1G09267.
DR   EnsemblGenomes-Gn; AT1G09273.
DR   EnsemblGenomes-Gn; AT1G09277.
DR   EnsemblGenomes-Gn; AT1G09283.
DR   EnsemblGenomes-Gn; AT1G09287.
DR   EnsemblGenomes-Gn; AT1G09293.
DR   EnsemblGenomes-Gn; AT1G09297.
DR   EnsemblGenomes-Gn; AT1G09300.
DR   EnsemblGenomes-Gn; AT1G09303.
DR   EnsemblGenomes-Gn; AT1G09307.
DR   EnsemblGenomes-Gn; AT1G09313.
DR   EnsemblGenomes-Gn; AT1G09317.
DR   EnsemblGenomes-Gn; AT1G09323.
DR   EnsemblGenomes-Gn; AT1G09327.
DR   EnsemblGenomes-Gn; AT1G09333.
DR   EnsemblGenomes-Gn; AT1G09337.
DR   EnsemblGenomes-Gn; AT1G09343.
DR   EnsemblGenomes-Gn; AT1G09353.
DR   EnsemblGenomes-Gn; AT1G09357.
DR   EnsemblGenomes-Gn; AT1G09363.
DR   EnsemblGenomes-Gn; AT1G09367.
DR   EnsemblGenomes-Gn; AT1G09373.
DR   EnsemblGenomes-Gn; AT1G09377.
DR   EnsemblGenomes-Gn; AT1G09383.
DR   EnsemblGenomes-Gn; AT1G09387.
DR   EnsemblGenomes-Gn; AT1G09393.
DR   EnsemblGenomes-Gn; AT1G09397.
DR   EnsemblGenomes-Gn; AT1G09407.
DR   EnsemblGenomes-Gn; AT1G09417.
DR   EnsemblGenomes-Gn; AT1G09421.
DR   EnsemblGenomes-Gn; AT1G09423.
DR   EnsemblGenomes-Gn; AT1G09427.
DR   EnsemblGenomes-Gn; AT1G09433.
DR   EnsemblGenomes-Gn; AT1G09437.
DR   EnsemblGenomes-Gn; AT1G09443.
DR   EnsemblGenomes-Gn; AT1G09447.
DR   EnsemblGenomes-Gn; AT1G09453.
DR   EnsemblGenomes-Gn; AT1G09457.
DR   EnsemblGenomes-Gn; AT1G09463.
DR   EnsemblGenomes-Gn; AT1G09467.
DR   EnsemblGenomes-Gn; AT1G09473.
DR   EnsemblGenomes-Gn; AT1G09477.
DR   EnsemblGenomes-Gn; AT1G09487.
DR   EnsemblGenomes-Gn; AT1G09493.
DR   EnsemblGenomes-Gn; AT1G09497.
DR   EnsemblGenomes-Gn; AT1G09503.
DR   EnsemblGenomes-Gn; AT1G09507.
DR   EnsemblGenomes-Gn; AT1G09513.
DR   EnsemblGenomes-Gn; AT1G09517.
DR   EnsemblGenomes-Gn; AT1G09523.
DR   EnsemblGenomes-Gn; AT1G09527.
DR   EnsemblGenomes-Gn; AT1G09533.
DR   EnsemblGenomes-Gn; AT1G09537.
DR   EnsemblGenomes-Gn; AT1G09543.
DR   EnsemblGenomes-Gn; AT1G09547.
DR   EnsemblGenomes-Gn; AT1G09553.
DR   EnsemblGenomes-Gn; AT1G09557.
DR   EnsemblGenomes-Gn; AT1G09563.
DR   EnsemblGenomes-Gn; AT1G09567.
DR   EnsemblGenomes-Gn; AT1G09573.
DR   EnsemblGenomes-Gn; AT1G09577.
DR   EnsemblGenomes-Gn; AT1G09583.
DR   EnsemblGenomes-Gn; AT1G09587.
DR   EnsemblGenomes-Gn; AT1G09593.
DR   EnsemblGenomes-Gn; AT1G09597.
DR   EnsemblGenomes-Gn; AT1G09603.
DR   EnsemblGenomes-Gn; AT1G09607.
DR   EnsemblGenomes-Gn; AT1G09613.
DR   EnsemblGenomes-Gn; AT1G09617.
DR   EnsemblGenomes-Gn; AT1G09623.
DR   EnsemblGenomes-Gn; AT1G09627.
DR   EnsemblGenomes-Gn; AT1G09633.
DR   EnsemblGenomes-Gn; AT1G09637.
DR   EnsemblGenomes-Gn; AT1G09647.
DR   EnsemblGenomes-Gn; AT1G09653.
DR   EnsemblGenomes-Gn; AT1G09657.
DR   EnsemblGenomes-Gn; AT1G09663.
DR   EnsemblGenomes-Gn; AT1G09667.
DR   EnsemblGenomes-Gn; AT1G09673.
DR   EnsemblGenomes-Gn; AT1G09677.
DR   EnsemblGenomes-Gn; AT1G09683.
DR   EnsemblGenomes-Gn; AT1G09687.
DR   EnsemblGenomes-Gn; AT1G09693.
DR   EnsemblGenomes-Gn; AT1G09697.
DR   EnsemblGenomes-Gn; AT1G09703.
DR   EnsemblGenomes-Gn; AT1G09713.
DR   EnsemblGenomes-Gn; AT1G09717.
DR   EnsemblGenomes-Gn; AT1G09723.
DR   EnsemblGenomes-Gn; AT1G09733.
DR   EnsemblGenomes-Gn; AT1G09737.
DR   EnsemblGenomes-Gn; AT1G09743.
DR   EnsemblGenomes-Gn; AT1G09747.
DR   EnsemblGenomes-Gn; AT1G09753.
DR   EnsemblGenomes-Gn; AT1G09757.
DR   EnsemblGenomes-Gn; AT1G09763.
DR   EnsemblGenomes-Gn; AT1G09767.
DR   EnsemblGenomes-Gn; AT1G09773.
DR   EnsemblGenomes-Gn; AT1G09777.
DR   EnsemblGenomes-Gn; AT1G09783.
DR   EnsemblGenomes-Gn; AT1G09787.
DR   EnsemblGenomes-Gn; AT1G09793.
DR   EnsemblGenomes-Gn; AT1G09797.
DR   EnsemblGenomes-Gn; AT1G09803.
DR   EnsemblGenomes-Gn; AT1G09807.
DR   EnsemblGenomes-Gn; AT1G09813.
DR   EnsemblGenomes-Gn; AT1G09817.
DR   EnsemblGenomes-Gn; AT1G09823.
DR   EnsemblGenomes-Gn; AT1G09827.
DR   EnsemblGenomes-Gn; AT1G09833.
DR   EnsemblGenomes-Gn; AT1G09837.
DR   EnsemblGenomes-Gn; AT1G09843.
DR   EnsemblGenomes-Gn; AT1G09847.
DR   EnsemblGenomes-Gn; AT1G09853.
DR   EnsemblGenomes-Gn; AT1G09857.
DR   EnsemblGenomes-Gn; AT1G09863.
DR   EnsemblGenomes-Gn; AT1G09867.
DR   EnsemblGenomes-Gn; AT1G09873.
DR   EnsemblGenomes-Gn; AT1G09877.
DR   EnsemblGenomes-Gn; AT1G09883.
DR   EnsemblGenomes-Gn; AT1G09887.
DR   EnsemblGenomes-Gn; AT1G09893.
DR   EnsemblGenomes-Gn; AT1G09897.
DR   EnsemblGenomes-Gn; AT1G09903.
DR   EnsemblGenomes-Gn; AT1G09907.
DR   EnsemblGenomes-Gn; AT1G09913.
DR   EnsemblGenomes-Gn; AT1G09917.
DR   EnsemblGenomes-Gn; AT1G09923.
DR   EnsemblGenomes-Gn; AT1G09927.
DR   EnsemblGenomes-Gn; AT1G09937.
DR   EnsemblGenomes-Gn; AT1G09947.
DR   EnsemblGenomes-Gn; AT1G09953.
DR   EnsemblGenomes-Gn; AT1G09957.
DR   EnsemblGenomes-Gn; AT1G09963.
DR   EnsemblGenomes-Gn; AT1G09967.
DR   EnsemblGenomes-Gn; AT1G09973.
DR   EnsemblGenomes-Gn; AT1G09977.
DR   EnsemblGenomes-Gn; AT1G09983.
DR   EnsemblGenomes-Gn; AT1G09987.
DR   EnsemblGenomes-Gn; AT1G09993.
DR   EnsemblGenomes-Gn; AT1G09997.
DR   EnsemblGenomes-Gn; AT1G10440.
DR   EnsemblGenomes-Gn; AT1G10682.
DR   EnsemblGenomes-Gn; AT1G10890.
DR   EnsemblGenomes-Gn; AT1G11010.
DR   EnsemblGenomes-Gn; AT1G11030.
DR   EnsemblGenomes-Gn; AT1G11175.
DR   EnsemblGenomes-Gn; AT1G11185.
DR   EnsemblGenomes-Gn; AT1G11450.
DR   EnsemblGenomes-Gn; AT1G11540.
DR   EnsemblGenomes-Gn; AT1G11550.
DR   EnsemblGenomes-Gn; AT1G11592.
DR   EnsemblGenomes-Gn; AT1G11640.
DR   EnsemblGenomes-Gn; AT1G11735.
DR   EnsemblGenomes-Gn; AT1G11840.
DR   EnsemblGenomes-Gn; AT1G12013.
DR   EnsemblGenomes-Gn; AT1G12015.
DR   EnsemblGenomes-Gn; AT1G12294.
DR   EnsemblGenomes-Gn; AT1G12510.
DR   EnsemblGenomes-Gn; AT1G12590.
DR   EnsemblGenomes-Gn; AT1G12660.
DR   EnsemblGenomes-Gn; AT1G13010.
DR   EnsemblGenomes-Gn; AT1G13240.
DR   EnsemblGenomes-Gn; AT1G13448.
DR   EnsemblGenomes-Gn; AT1G13630.
DR   EnsemblGenomes-Gn; AT1G13720.
DR   EnsemblGenomes-Gn; AT1G13840.
DR   EnsemblGenomes-Gn; AT1G13850.
DR   EnsemblGenomes-Gn; AT1G14071.
DR   EnsemblGenomes-Gn; AT1G14320.
DR   EnsemblGenomes-Gn; AT1G14518.
DR   EnsemblGenomes-Gn; AT1G14530.
DR   EnsemblGenomes-Gn; AT1G15002.
DR   EnsemblGenomes-Gn; AT1G15090.
DR   EnsemblGenomes-Gn; AT1G15175.
DR   EnsemblGenomes-Gn; AT1G15405.
DR   EnsemblGenomes-Gn; AT1G15450.
DR   EnsemblGenomes-Gn; AT1G15650.
DR   EnsemblGenomes-Gn; AT1G16100.
DR   EnsemblGenomes-Gn; AT1G16450.
DR   EnsemblGenomes-Gn; AT1G16489.
DR   EnsemblGenomes-Gn; AT1G16635.
DR   EnsemblGenomes-Gn; AT1G17000.
DR   EnsemblGenomes-Gn; AT1G17040.
DR   EnsemblGenomes-Gn; AT1G17060.
DR   EnsemblGenomes-Gn; AT1G17232.
DR   EnsemblGenomes-Gn; AT1G17255.
DR   EnsemblGenomes-Gn; AT1G17570.
DR   EnsemblGenomes-Gn; AT1G17660.
DR   EnsemblGenomes-Gn; AT1G17670.
DR   EnsemblGenomes-Gn; AT1G18075.
DR   EnsemblGenomes-Gn; AT1G18320.
DR   EnsemblGenomes-Gn; AT1G18382.
DR   EnsemblGenomes-Gn; AT1G18415.
DR   EnsemblGenomes-Gn; AT1G18430.
DR   EnsemblGenomes-Gn; AT1G18670.
DR   EnsemblGenomes-Gn; AT1G18735.
DR   EnsemblGenomes-Gn; AT1G18745.
DR   EnsemblGenomes-Gn; AT1G18820.
DR   EnsemblGenomes-Gn; AT1G18860.
DR   EnsemblGenomes-Gn; AT1G18879.
DR   EnsemblGenomes-Gn; AT1G19090.
DR   EnsemblGenomes-Gn; AT1G19230.
DR   EnsemblGenomes-Gn; AT1G19371.
DR   EnsemblGenomes-Gn; AT1G19373.
DR   EnsemblGenomes-Gn; AT1G19376.
DR   EnsemblGenomes-Gn; AT1G19464.
DR   EnsemblGenomes-Gn; AT1G19520.
DR   EnsemblGenomes-Gn; AT1G19968.
DR   EnsemblGenomes-Gn; AT1G20015.
DR   EnsemblGenomes-Gn; AT1G20040.
DR   EnsemblGenomes-Gn; AT1G20170.
DR   EnsemblGenomes-Gn; AT1G20210.
DR   EnsemblGenomes-Gn; AT1G20250.
DR   EnsemblGenomes-Gn; AT1G20375.
DR   EnsemblGenomes-Gn; AT1G20420.
DR   EnsemblGenomes-Gn; AT1G20515.
DR   EnsemblGenomes-Gn; AT1G20691.
DR   EnsemblGenomes-Gn; AT1G20800.
DR   EnsemblGenomes-Gn; AT1G20820.
DR   EnsemblGenomes-Gn; AT1G21202.
DR   EnsemblGenomes-Gn; AT1G21420.
DR   EnsemblGenomes-Gn; AT1G21529.
DR   EnsemblGenomes-Gn; AT1G21620.
DR   EnsemblGenomes-Gn; AT1G21800.
DR   EnsemblGenomes-Gn; AT1G22320.
DR   EnsemblGenomes-Gn; AT1G22403.
DR   EnsemblGenomes-Gn; AT1G23052.
DR   EnsemblGenomes-Gn; AT1G24068.
DR   EnsemblGenomes-Gn; AT1G24080.
DR   EnsemblGenomes-Gn; AT1G25098.
DR   EnsemblGenomes-Gn; AT1G25175.
DR   EnsemblGenomes-Gn; AT1G25210.
DR   EnsemblGenomes-Gn; AT1G26208.
DR   EnsemblGenomes-Gn; AT1G26218.
DR   EnsemblGenomes-Gn; AT1G26230.
DR   EnsemblGenomes-Gn; AT1G26233.
DR   EnsemblGenomes-Gn; AT1G26235.
DR   EnsemblGenomes-Gn; AT1G26430.
DR   EnsemblGenomes-Gn; AT1G26490.
DR   EnsemblGenomes-Gn; AT1G26558.
DR   EnsemblGenomes-Gn; AT1G26790.
DR   EnsemblGenomes-Gn; AT1G26973.
DR   EnsemblGenomes-Gn; AT1G26975.
DR   EnsemblGenomes-Gn; AT1G26985.
DR   EnsemblGenomes-Gn; AT1G27921.
DR   EnsemblGenomes-Gn; AT1G28020.
DR   EnsemblGenomes-Gn; AT1G28600.
DR   EnsemblGenomes-Gn; AT1G28640.
DR   EnsemblGenomes-Gn; AT1G28685.
DR   EnsemblGenomes-Gn; AT1G28715.
DR   EnsemblGenomes-Gn; AT1G28720.
DR   EnsemblGenomes-Gn; AT1G28730.
DR   EnsemblGenomes-Gn; AT1G28740.
DR   EnsemblGenomes-Gn; AT1G28750.
DR   EnsemblGenomes-Gn; AT1G28770.
DR   EnsemblGenomes-Gn; AT1G28780.
DR   EnsemblGenomes-Gn; AT1G28790.
DR   EnsemblGenomes-Gn; AT1G28800.
DR   EnsemblGenomes-Gn; AT1G28810.
DR   EnsemblGenomes-Gn; AT1G28820.
DR   EnsemblGenomes-Gn; AT1G28830.
DR   EnsemblGenomes-Gn; AT1G28840.
DR   EnsemblGenomes-Gn; AT1G28850.
DR   EnsemblGenomes-Gn; AT1G28860.
DR   EnsemblGenomes-Gn; AT1G28870.
DR   EnsemblGenomes-Gn; AT1G28880.
DR   EnsemblGenomes-Gn; AT1G28890.
DR   EnsemblGenomes-Gn; AT1G28900.
DR   EnsemblGenomes-Gn; AT1G28910.
DR   EnsemblGenomes-Gn; AT1G28920.
DR   EnsemblGenomes-Gn; AT1G28930.
DR   EnsemblGenomes-Gn; AT1G28940.
DR   EnsemblGenomes-Gn; AT1G28950.
DR   EnsemblGenomes-Gn; AT1G28970.
DR   EnsemblGenomes-Gn; AT1G28980.
DR   EnsemblGenomes-Gn; AT1G28990.
DR   EnsemblGenomes-Gn; AT1G29071.
DR   EnsemblGenomes-Gn; AT1G29210.
DR   EnsemblGenomes-Gn; AT1G29265.
DR   EnsemblGenomes-Gn; AT1G29357.
DR   EnsemblGenomes-Gn; AT1G29600.
DR   EnsemblGenomes-Gn; AT1G29785.
DR   EnsemblGenomes-Gn; AT1G30282.
DR   EnsemblGenomes-Gn; AT1G30430.
DR   EnsemblGenomes-Gn; AT1G30830.
DR   EnsemblGenomes-Gn; AT1G31110.
DR   EnsemblGenomes-Gn; AT1G31173.
DR   EnsemblGenomes-Gn; AT1G31200.
DR   EnsemblGenomes-Gn; AT1G31258.
DR   EnsemblGenomes-Gn; AT1G31358.
DR   EnsemblGenomes-Gn; AT1G31390.
DR   EnsemblGenomes-Gn; AT1G31485.
DR   EnsemblGenomes-Gn; AT1G31670.
DR   EnsemblGenomes-Gn; AT1G31935.
DR   EnsemblGenomes-Gn; AT1G32172.
DR   EnsemblGenomes-Gn; AT1G32385.
DR   EnsemblGenomes-Gn; AT1G32582.
DR   EnsemblGenomes-Gn; AT1G32620.
DR   EnsemblGenomes-Gn; AT1G32713.
DR   EnsemblGenomes-Gn; AT1G32992.
DR   EnsemblGenomes-Gn; AT1G33355.
DR   EnsemblGenomes-Gn; AT1G33370.
DR   EnsemblGenomes-Gn; AT1G33415.
DR   EnsemblGenomes-Gn; AT1G33615.
DR   EnsemblGenomes-Gn; AT1G33840.
DR   EnsemblGenomes-Gn; AT1G34140.
DR   EnsemblGenomes-Gn; AT1G34180.
DR   EnsemblGenomes-Gn; AT1G34392.
DR   EnsemblGenomes-Gn; AT1G34418.
DR   EnsemblGenomes-Gn; AT1G34844.
DR   EnsemblGenomes-Gn; AT1G35240.
DR   EnsemblGenomes-Gn; AT1G35330.
DR   EnsemblGenomes-Gn; AT1G35501.
DR   EnsemblGenomes-Gn; AT1G35545.
DR   EnsemblGenomes-Gn; AT1G35850.
DR   EnsemblGenomes-Gn; AT1G36350.
DR   EnsemblGenomes-Gn; AT1G36992.
DR   EnsemblGenomes-Gn; AT1G42120.
DR   EnsemblGenomes-Gn; AT1G43765.
DR   EnsemblGenomes-Gn; AT1G43820.
DR   EnsemblGenomes-Gn; AT1G44125.
DR   EnsemblGenomes-Gn; AT1G45191.
DR   EnsemblGenomes-Gn; AT1G45234.
DR   EnsemblGenomes-Gn; AT1G45238.
DR   EnsemblGenomes-Gn; AT1G45240.
DR   EnsemblGenomes-Gn; AT1G45242.
DR   EnsemblGenomes-Gn; AT1G45244.
DR   EnsemblGenomes-Gn; AT1G45246.
DR   EnsemblGenomes-Gn; AT1G46554.
DR   EnsemblGenomes-Gn; AT1G47290.
DR   EnsemblGenomes-Gn; AT1G47603.
DR   EnsemblGenomes-Gn; AT1G48060.
DR   EnsemblGenomes-Gn; AT1G48080.
DR   EnsemblGenomes-Gn; AT1G48267.
DR   EnsemblGenomes-Gn; AT1G48300.
DR   EnsemblGenomes-Gn; AT1G48315.
DR   EnsemblGenomes-Gn; AT1G48400.
DR   EnsemblGenomes-Gn; AT1G48698.
DR   EnsemblGenomes-Gn; AT1G48742.
DR   EnsemblGenomes-Gn; AT1G49020.
DR   EnsemblGenomes-Gn; AT1G49280.
DR   EnsemblGenomes-Gn; AT1G49460.
DR   EnsemblGenomes-Gn; AT1G49610.
DR   EnsemblGenomes-Gn; AT1G49690.
DR   EnsemblGenomes-Gn; AT1G49832.
DR   EnsemblGenomes-Gn; AT1G49938.
DR   EnsemblGenomes-Gn; AT1G49952.
DR   EnsemblGenomes-Gn; AT1G50055.
DR   EnsemblGenomes-Gn; AT1G50070.
DR   EnsemblGenomes-Gn; AT1G50100.
DR   EnsemblGenomes-Gn; AT1G50390.
DR   EnsemblGenomes-Gn; AT1G50659.
DR   EnsemblGenomes-Gn; AT1G51490.
DR   EnsemblGenomes-Gn; AT1G51645.
DR   EnsemblGenomes-Gn; AT1G51965.
DR   EnsemblGenomes-Gn; AT1G52170.
DR   EnsemblGenomes-Gn; AT1G52185.
DR   EnsemblGenomes-Gn; AT1G52347.
DR   EnsemblGenomes-Gn; AT1G52350.
DR   EnsemblGenomes-Gn; AT1G52495.
DR   EnsemblGenomes-Gn; AT1G52615.
DR   EnsemblGenomes-Gn; AT1G52860.
DR   EnsemblGenomes-Gn; AT1G52940.
DR   EnsemblGenomes-Gn; AT1G53220.
DR   EnsemblGenomes-Gn; AT1G53233.
DR   EnsemblGenomes-Gn; AT1G53410.
DR   EnsemblGenomes-Gn; AT1G53683.
DR   EnsemblGenomes-Gn; AT1G53687.
DR   EnsemblGenomes-Gn; AT1G53801.
DR   EnsemblGenomes-Gn; AT1G53940.
DR   EnsemblGenomes-Gn; AT1G54355.
DR   EnsemblGenomes-Gn; AT1G54360.
DR   EnsemblGenomes-Gn; AT1G54670.
DR   EnsemblGenomes-Gn; AT1G55310.
DR   EnsemblGenomes-Gn; AT1G55525.
DR   EnsemblGenomes-Gn; AT1G55591.
DR   EnsemblGenomes-Gn; AT1G55625.
DR   EnsemblGenomes-Gn; AT1G55720.
DR   EnsemblGenomes-Gn; AT1G55790.
DR   EnsemblGenomes-Gn; AT1G55950.
DR   EnsemblGenomes-Gn; AT1G55970.
DR   EnsemblGenomes-Gn; AT1G56130.
DR   EnsemblGenomes-Gn; AT1G56165.
DR   EnsemblGenomes-Gn; AT1G56242.
DR   EnsemblGenomes-Gn; AT1G56280.
DR   EnsemblGenomes-Gn; AT1G56500.
DR   EnsemblGenomes-Gn; AT1G56612.
DR   EnsemblGenomes-Gn; AT1G56730.
DR   EnsemblGenomes-Gn; AT1G56740.
DR   EnsemblGenomes-Gn; AT1G56750.
DR   EnsemblGenomes-Gn; AT1G56760.
DR   EnsemblGenomes-Gn; AT1G56770.
DR   EnsemblGenomes-Gn; AT1G56780.
DR   EnsemblGenomes-Gn; AT1G56790.
DR   EnsemblGenomes-Gn; AT1G56800.
DR   EnsemblGenomes-Gn; AT1G56810.
DR   EnsemblGenomes-Gn; AT1G56820.
DR   EnsemblGenomes-Gn; AT1G56830.
DR   EnsemblGenomes-Gn; AT1G56840.
DR   EnsemblGenomes-Gn; AT1G56850.
DR   EnsemblGenomes-Gn; AT1G56860.
DR   EnsemblGenomes-Gn; AT1G56870.
DR   EnsemblGenomes-Gn; AT1G56880.
DR   EnsemblGenomes-Gn; AT1G56890.
DR   EnsemblGenomes-Gn; AT1G56900.
DR   EnsemblGenomes-Gn; AT1G56910.
DR   EnsemblGenomes-Gn; AT1G56920.
DR   EnsemblGenomes-Gn; AT1G56930.
DR   EnsemblGenomes-Gn; AT1G56940.
DR   EnsemblGenomes-Gn; AT1G56950.
DR   EnsemblGenomes-Gn; AT1G56960.
DR   EnsemblGenomes-Gn; AT1G56970.
DR   EnsemblGenomes-Gn; AT1G56980.
DR   EnsemblGenomes-Gn; AT1G56990.
DR   EnsemblGenomes-Gn; AT1G57000.
DR   EnsemblGenomes-Gn; AT1G57010.
DR   EnsemblGenomes-Gn; AT1G57020.
DR   EnsemblGenomes-Gn; AT1G57030.
DR   EnsemblGenomes-Gn; AT1G57040.
DR   EnsemblGenomes-Gn; AT1G57050.
DR   EnsemblGenomes-Gn; AT1G57060.
DR   EnsemblGenomes-Gn; AT1G57070.
DR   EnsemblGenomes-Gn; AT1G57080.
DR   EnsemblGenomes-Gn; AT1G57090.
DR   EnsemblGenomes-Gn; AT1G57100.
DR   EnsemblGenomes-Gn; AT1G57110.
DR   EnsemblGenomes-Gn; AT1G57120.
DR   EnsemblGenomes-Gn; AT1G57130.
DR   EnsemblGenomes-Gn; AT1G57140.
DR   EnsemblGenomes-Gn; AT1G57150.
DR   EnsemblGenomes-Gn; AT1G57160.
DR   EnsemblGenomes-Gn; AT1G57170.
DR   EnsemblGenomes-Gn; AT1G57180.
DR   EnsemblGenomes-Gn; AT1G57190.
DR   EnsemblGenomes-Gn; AT1G57200.
DR   EnsemblGenomes-Gn; AT1G57210.
DR   EnsemblGenomes-Gn; AT1G57220.
DR   EnsemblGenomes-Gn; AT1G57230.
DR   EnsemblGenomes-Gn; AT1G57240.
DR   EnsemblGenomes-Gn; AT1G57250.
DR   EnsemblGenomes-Gn; AT1G57260.
DR   EnsemblGenomes-Gn; AT1G57270.
DR   EnsemblGenomes-Gn; AT1G57280.
DR   EnsemblGenomes-Gn; AT1G57290.
DR   EnsemblGenomes-Gn; AT1G57300.
DR   EnsemblGenomes-Gn; AT1G57310.
DR   EnsemblGenomes-Gn; AT1G57320.
DR   EnsemblGenomes-Gn; AT1G57330.
DR   EnsemblGenomes-Gn; AT1G57340.
DR   EnsemblGenomes-Gn; AT1G57350.
DR   EnsemblGenomes-Gn; AT1G57360.
DR   EnsemblGenomes-Gn; AT1G57370.
DR   EnsemblGenomes-Gn; AT1G57380.
DR   EnsemblGenomes-Gn; AT1G57390.
DR   EnsemblGenomes-Gn; AT1G57400.
DR   EnsemblGenomes-Gn; AT1G57410.
DR   EnsemblGenomes-Gn; AT1G57420.
DR   EnsemblGenomes-Gn; AT1G57430.
DR   EnsemblGenomes-Gn; AT1G57440.
DR   EnsemblGenomes-Gn; AT1G57450.
DR   EnsemblGenomes-Gn; AT1G57460.
DR   EnsemblGenomes-Gn; AT1G57470.
DR   EnsemblGenomes-Gn; AT1G57480.
DR   EnsemblGenomes-Gn; AT1G57490.
DR   EnsemblGenomes-Gn; AT1G57500.
DR   EnsemblGenomes-Gn; AT1G57510.
DR   EnsemblGenomes-Gn; AT1G57520.
DR   EnsemblGenomes-Gn; AT1G57530.
DR   EnsemblGenomes-Gn; AT1G57835.
DR   EnsemblGenomes-Gn; AT1G58250.
DR   EnsemblGenomes-Gn; AT1G58590.
DR   EnsemblGenomes-Gn; AT1G58808.
DR   EnsemblGenomes-Gn; AT1G59550.
DR   EnsemblGenomes-Gn; AT1G59570.
DR   EnsemblGenomes-Gn; AT1G59620.
DR   EnsemblGenomes-Gn; AT1G59680.
DR   EnsemblGenomes-Gn; AT1G59880.
DR   EnsemblGenomes-Gn; AT1G60025.
DR   EnsemblGenomes-Gn; AT1G60072.
DR   EnsemblGenomes-Gn; AT1G60073.
DR   EnsemblGenomes-Gn; AT1G60260.
DR   EnsemblGenomes-Gn; AT1G60505.
DR   EnsemblGenomes-Gn; AT1G60525.
DR   EnsemblGenomes-Gn; AT1G60545.
DR   EnsemblGenomes-Gn; AT1G60580.
DR   EnsemblGenomes-Gn; AT1G60820.
DR   EnsemblGenomes-Gn; AT1G60840.
DR   EnsemblGenomes-Gn; AT1G60910.
DR   EnsemblGenomes-Gn; AT1G60930.
DR   EnsemblGenomes-Gn; AT1G61020.
DR   EnsemblGenomes-Gn; AT1G61224.
DR   EnsemblGenomes-Gn; AT1G61226.
DR   EnsemblGenomes-Gn; AT1G61275.
DR   EnsemblGenomes-Gn; AT1G61310.
DR   EnsemblGenomes-Gn; AT1G61732.
DR   EnsemblGenomes-Gn; AT1G61850.
DR   EnsemblGenomes-Gn; AT1G61880.
DR   EnsemblGenomes-Gn; AT1G61910.
DR   EnsemblGenomes-Gn; AT1G62035.
DR   EnsemblGenomes-Gn; AT1G62355.
DR   EnsemblGenomes-Gn; AT1G63005.
DR   EnsemblGenomes-Gn; AT1G63100.
DR   EnsemblGenomes-Gn; AT1G63340.
DR   EnsemblGenomes-Gn; AT1G63410.
DR   EnsemblGenomes-Gn; AT1G63510.
DR   EnsemblGenomes-Gn; AT1G63522.
DR   EnsemblGenomes-Gn; AT1G63600.
DR   EnsemblGenomes-Gn; AT1G63790.
DR   EnsemblGenomes-Gn; AT1G64120.
DR   EnsemblGenomes-Gn; AT1G64420.
DR   EnsemblGenomes-Gn; AT1G64460.
DR   EnsemblGenomes-Gn; AT1G64563.
DR   EnsemblGenomes-Gn; AT1G64572.
DR   EnsemblGenomes-Gn; AT1G64618.
DR   EnsemblGenomes-Gn; AT1G64633.
DR   EnsemblGenomes-Gn; AT1G65830.
DR   EnsemblGenomes-Gn; AT1G66173.
DR   EnsemblGenomes-Gn; AT1G66490.
DR   EnsemblGenomes-Gn; AT1G66725.
DR   EnsemblGenomes-Gn; AT1G66783.
DR   EnsemblGenomes-Gn; AT1G66795.
DR   EnsemblGenomes-Gn; AT1G67105.
DR   EnsemblGenomes-Gn; AT1G67130.
DR   EnsemblGenomes-Gn; AT1G67195.
DR   EnsemblGenomes-Gn; AT1G67238.
DR   EnsemblGenomes-Gn; AT1G67328.
DR   EnsemblGenomes-Gn; AT1G67365.
DR   EnsemblGenomes-Gn; AT1G67455.
DR   EnsemblGenomes-Gn; AT1G67481.
DR   EnsemblGenomes-Gn; AT1G67792.
DR   EnsemblGenomes-Gn; AT1G68568.
DR   EnsemblGenomes-Gn; AT1G68770.
DR   EnsemblGenomes-Gn; AT1G68860.
DR   EnsemblGenomes-Gn; AT1G68872.
DR   EnsemblGenomes-Gn; AT1G68940.
DR   EnsemblGenomes-Gn; AT1G68950.
DR   EnsemblGenomes-Gn; AT1G68970.
DR   EnsemblGenomes-Gn; AT1G69000.
DR   EnsemblGenomes-Gn; AT1G69130.
DR   EnsemblGenomes-Gn; AT1G69252.
DR   EnsemblGenomes-Gn; AT1G69300.
DR   EnsemblGenomes-Gn; AT1G69572.
DR   EnsemblGenomes-Gn; AT1G69587.
DR   EnsemblGenomes-Gn; AT1G69792.
DR   EnsemblGenomes-Gn; AT1G69795.
DR   EnsemblGenomes-Gn; AT1G69797.
DR   EnsemblGenomes-Gn; AT1G69820.
DR   EnsemblGenomes-Gn; AT1G70050.
DR   EnsemblGenomes-Gn; AT1G70185.
DR   EnsemblGenomes-Gn; AT1G70360.
DR   EnsemblGenomes-Gn; AT1G70518.
DR   EnsemblGenomes-Gn; AT1G70581.
DR   EnsemblGenomes-Gn; AT1G70645.
DR   EnsemblGenomes-Gn; AT1G71002.
DR   EnsemblGenomes-Gn; AT1G71528.
DR   EnsemblGenomes-Gn; AT1G71700.
DR   EnsemblGenomes-Gn; AT1G71828.
DR   EnsemblGenomes-Gn; AT1G72780.
DR   EnsemblGenomes-Gn; AT1G72852.
DR   EnsemblGenomes-Gn; AT1G72855.
DR   EnsemblGenomes-Gn; AT1G73570.
DR   EnsemblGenomes-Gn; AT1G73687.
DR   EnsemblGenomes-Gn; AT1G73900.
DR   EnsemblGenomes-Gn; AT1G73960.
DR   EnsemblGenomes-Gn; AT1G74205.
DR   EnsemblGenomes-Gn; AT1G74350.
DR   EnsemblGenomes-Gn; AT1G74453.
DR   EnsemblGenomes-Gn; AT1G74456.
DR   EnsemblGenomes-Gn; AT1G74545.
DR   EnsemblGenomes-Gn; AT1G74570.
DR   EnsemblGenomes-Gn; AT1G74610.
DR   EnsemblGenomes-Gn; AT1G75070.
DR   EnsemblGenomes-Gn; AT1G75163.
DR   EnsemblGenomes-Gn; AT1G75166.
DR   EnsemblGenomes-Gn; AT1G75295.
DR   EnsemblGenomes-Gn; AT1G75570.
DR   EnsemblGenomes-Gn; AT1G75650.
DR   EnsemblGenomes-Gn; AT1G75740.
DR   EnsemblGenomes-Gn; AT1G75891.
DR   EnsemblGenomes-Gn; AT1G75970.
DR   EnsemblGenomes-Gn; AT1G76000.
DR   EnsemblGenomes-Gn; AT1G76040.
DR   EnsemblGenomes-Gn; AT1G76062.
DR   EnsemblGenomes-Gn; AT1G76135.
DR   EnsemblGenomes-Gn; AT1G76330.
DR   EnsemblGenomes-Gn; AT1G76820.
DR   EnsemblGenomes-Gn; AT1G76878.
DR   EnsemblGenomes-Gn; AT1G76892.
DR   EnsemblGenomes-Gn; AT1G76930.
DR   EnsemblGenomes-Gn; AT1G76952.
DR   EnsemblGenomes-Gn; AT1G77040.
DR   EnsemblGenomes-Gn; AT1G77138.
DR   EnsemblGenomes-Gn; AT1G77190.
DR   EnsemblGenomes-Gn; AT1G77235.
DR   EnsemblGenomes-Gn; AT1G77560.
DR   EnsemblGenomes-Gn; AT1G77992.
DR   EnsemblGenomes-Gn; AT1G78206.
DR   EnsemblGenomes-Gn; AT1G78250.
DR   EnsemblGenomes-Gn; AT1G78265.
DR   EnsemblGenomes-Gn; AT1G78360.
DR   EnsemblGenomes-Gn; AT1G78478.
DR   EnsemblGenomes-Gn; AT1G78540.
DR   EnsemblGenomes-Gn; AT1G78640.
DR   EnsemblGenomes-Gn; AT1G78865.
DR   EnsemblGenomes-Gn; AT1G79075.
DR   EnsemblGenomes-Gn; AT1G79240.
DR   EnsemblGenomes-Gn; AT1G79290.
DR   EnsemblGenomes-Gn; AT1G79300.
DR   EnsemblGenomes-Gn; AT1G79529.
DR   EnsemblGenomes-Gn; AT1G79980.
DR   EnsemblGenomes-Gn; AT1G80250.
DR   EnsemblGenomes-Gn; AT1G80325.
DR   EnsemblGenomes-Gn; AT1G80390.
DR   EnsemblGenomes-Gn; AT1G80430.
DR   EnsemblGenomes-Gn; ENSRNA049492452.
DR   EnsemblGenomes-Gn; ENSRNA049492453.
DR   EnsemblGenomes-Gn; ENSRNA049492454.
DR   EnsemblGenomes-Gn; ENSRNA049492455.
DR   EnsemblGenomes-Gn; ENSRNA049492457.
DR   EnsemblGenomes-Gn; ENSRNA049492458.
DR   EnsemblGenomes-Gn; ENSRNA049492459.
DR   EnsemblGenomes-Gn; ENSRNA049492461.
DR   EnsemblGenomes-Gn; ENSRNA049492462.
DR   EnsemblGenomes-Gn; ENSRNA049492464.
DR   EnsemblGenomes-Gn; ENSRNA049492465.
DR   EnsemblGenomes-Gn; ENSRNA049492466.
DR   EnsemblGenomes-Gn; ENSRNA049492467.
DR   EnsemblGenomes-Gn; ENSRNA049492468.
DR   EnsemblGenomes-Gn; ENSRNA049492469.
DR   EnsemblGenomes-Gn; ENSRNA049492470.
DR   EnsemblGenomes-Gn; ENSRNA049492471.
DR   EnsemblGenomes-Gn; ENSRNA049492473.
DR   EnsemblGenomes-Gn; ENSRNA049492474.
DR   EnsemblGenomes-Gn; ENSRNA049492476.
DR   EnsemblGenomes-Gn; ENSRNA049492479.
DR   EnsemblGenomes-Gn; ENSRNA049492480.
DR   EnsemblGenomes-Gn; ENSRNA049492482.
DR   EnsemblGenomes-Gn; ENSRNA049492483.
DR   EnsemblGenomes-Gn; ENSRNA049492485.
DR   EnsemblGenomes-Gn; ENSRNA049492487.
DR   EnsemblGenomes-Gn; ENSRNA049492489.
DR   EnsemblGenomes-Gn; ENSRNA049492491.
DR   EnsemblGenomes-Gn; ENSRNA049492492.
DR   EnsemblGenomes-Gn; ENSRNA049492493.
DR   EnsemblGenomes-Gn; ENSRNA049492494.
DR   EnsemblGenomes-Gn; ENSRNA049492495.
DR   EnsemblGenomes-Gn; ENSRNA049492496.
DR   EnsemblGenomes-Gn; ENSRNA049492498.
DR   EnsemblGenomes-Gn; ENSRNA049492499.
DR   EnsemblGenomes-Gn; ENSRNA049492500.
DR   EnsemblGenomes-Gn; ENSRNA049492501.
DR   EnsemblGenomes-Gn; ENSRNA049492502.
DR   EnsemblGenomes-Gn; ENSRNA049492504.
DR   EnsemblGenomes-Gn; ENSRNA049492506.
DR   EnsemblGenomes-Gn; ENSRNA049492507.
DR   EnsemblGenomes-Gn; ENSRNA049492508.
DR   EnsemblGenomes-Gn; ENSRNA049492509.
DR   EnsemblGenomes-Gn; ENSRNA049492510.
DR   EnsemblGenomes-Gn; ENSRNA049492511.
DR   EnsemblGenomes-Gn; ENSRNA049492512.
DR   EnsemblGenomes-Gn; ENSRNA049492513.
DR   EnsemblGenomes-Gn; ENSRNA049492515.
DR   EnsemblGenomes-Gn; ENSRNA049492516.
DR   EnsemblGenomes-Gn; ENSRNA049492518.
DR   EnsemblGenomes-Gn; ENSRNA049492519.
DR   EnsemblGenomes-Gn; ENSRNA049492520.
DR   EnsemblGenomes-Gn; ENSRNA049492521.
DR   EnsemblGenomes-Gn; ENSRNA049492522.
DR   EnsemblGenomes-Gn; ENSRNA049492523.
DR   EnsemblGenomes-Gn; ENSRNA049492524.
DR   EnsemblGenomes-Gn; ENSRNA049492525.
DR   EnsemblGenomes-Gn; ENSRNA049492526.
DR   EnsemblGenomes-Gn; ENSRNA049492527.
DR   EnsemblGenomes-Gn; ENSRNA049492528.
DR   EnsemblGenomes-Gn; ENSRNA049492529.
DR   EnsemblGenomes-Gn; ENSRNA049492530.
DR   EnsemblGenomes-Gn; ENSRNA049492531.
DR   EnsemblGenomes-Gn; ENSRNA049492532.
DR   EnsemblGenomes-Gn; ENSRNA049492533.
DR   EnsemblGenomes-Gn; ENSRNA049492534.
DR   EnsemblGenomes-Gn; ENSRNA049492535.
DR   EnsemblGenomes-Gn; ENSRNA049492536.
DR   EnsemblGenomes-Gn; ENSRNA049492537.
DR   EnsemblGenomes-Gn; ENSRNA049492538.
DR   EnsemblGenomes-Gn; ENSRNA049492539.
DR   EnsemblGenomes-Gn; ENSRNA049492540.
DR   EnsemblGenomes-Gn; ENSRNA049492541.
DR   EnsemblGenomes-Gn; ENSRNA049492542.
DR   EnsemblGenomes-Gn; ENSRNA049492543.
DR   EnsemblGenomes-Gn; ENSRNA049492544.
DR   EnsemblGenomes-Gn; ENSRNA049492545.
DR   EnsemblGenomes-Gn; ENSRNA049492546.
DR   EnsemblGenomes-Gn; ENSRNA049492547.
DR   EnsemblGenomes-Gn; ENSRNA049492548.
DR   EnsemblGenomes-Gn; ENSRNA049492549.
DR   EnsemblGenomes-Gn; ENSRNA049492550.
DR   EnsemblGenomes-Gn; ENSRNA049492551.
DR   EnsemblGenomes-Gn; ENSRNA049492552.
DR   EnsemblGenomes-Gn; ENSRNA049492553.
DR   EnsemblGenomes-Gn; ENSRNA049492554.
DR   EnsemblGenomes-Gn; ENSRNA049492557.
DR   EnsemblGenomes-Gn; ENSRNA049492558.
DR   EnsemblGenomes-Gn; ENSRNA049492559.
DR   EnsemblGenomes-Gn; ENSRNA049492560.
DR   EnsemblGenomes-Gn; ENSRNA049492561.
DR   EnsemblGenomes-Gn; ENSRNA049492562.
DR   EnsemblGenomes-Gn; ENSRNA049492563.
DR   EnsemblGenomes-Gn; ENSRNA049492564.
DR   EnsemblGenomes-Gn; ENSRNA049492565.
DR   EnsemblGenomes-Gn; ENSRNA049492566.
DR   EnsemblGenomes-Gn; ENSRNA049492568.
DR   EnsemblGenomes-Gn; ENSRNA049492569.
DR   EnsemblGenomes-Gn; ENSRNA049492570.
DR   EnsemblGenomes-Gn; ENSRNA049492571.
DR   EnsemblGenomes-Gn; ENSRNA049492572.
DR   EnsemblGenomes-Gn; ENSRNA049492574.
DR   EnsemblGenomes-Gn; ENSRNA049492576.
DR   EnsemblGenomes-Gn; ENSRNA049492577.
DR   EnsemblGenomes-Gn; ENSRNA049492578.
DR   EnsemblGenomes-Gn; ENSRNA049492579.
DR   EnsemblGenomes-Gn; ENSRNA049492580.
DR   EnsemblGenomes-Gn; ENSRNA049492581.
DR   EnsemblGenomes-Gn; ENSRNA049492582.
DR   EnsemblGenomes-Gn; ENSRNA049492583.
DR   EnsemblGenomes-Gn; ENSRNA049492585.
DR   EnsemblGenomes-Gn; ENSRNA049492586.
DR   EnsemblGenomes-Gn; ENSRNA049492587.
DR   EnsemblGenomes-Gn; ENSRNA049492588.
DR   EnsemblGenomes-Gn; ENSRNA049492589.
DR   EnsemblGenomes-Gn; ENSRNA049492591.
DR   EnsemblGenomes-Gn; ENSRNA049492593.
DR   EnsemblGenomes-Gn; ENSRNA049492594.
DR   EnsemblGenomes-Gn; ENSRNA049492596.
DR   EnsemblGenomes-Gn; ENSRNA049492598.
DR   EnsemblGenomes-Gn; ENSRNA049492599.
DR   EnsemblGenomes-Gn; ENSRNA049492601.
DR   EnsemblGenomes-Gn; ENSRNA049492602.
DR   EnsemblGenomes-Gn; ENSRNA049492603.
DR   EnsemblGenomes-Gn; ENSRNA049492604.
DR   EnsemblGenomes-Gn; ENSRNA049492605.
DR   EnsemblGenomes-Gn; ENSRNA049492606.
DR   EnsemblGenomes-Gn; ENSRNA049492607.
DR   EnsemblGenomes-Gn; ENSRNA049492608.
DR   EnsemblGenomes-Gn; ENSRNA049492609.
DR   EnsemblGenomes-Gn; ENSRNA049492611.
DR   EnsemblGenomes-Gn; ENSRNA049492612.
DR   EnsemblGenomes-Gn; ENSRNA049492614.
DR   EnsemblGenomes-Gn; ENSRNA049493308.
DR   EnsemblGenomes-Gn; ENSRNA049493309.
DR   EnsemblGenomes-Gn; ENSRNA049493310.
DR   EnsemblGenomes-Gn; ENSRNA049493311.
DR   EnsemblGenomes-Gn; ENSRNA049493312.
DR   EnsemblGenomes-Gn; ENSRNA049493314.
DR   EnsemblGenomes-Gn; ENSRNA049493317.
DR   EnsemblGenomes-Gn; ENSRNA049493319.
DR   EnsemblGenomes-Gn; ENSRNA049493321.
DR   EnsemblGenomes-Gn; ENSRNA049493322.
DR   EnsemblGenomes-Gn; ENSRNA049493324.
DR   EnsemblGenomes-Gn; ENSRNA049493327.
DR   EnsemblGenomes-Gn; ENSRNA049493328.
DR   EnsemblGenomes-Gn; ENSRNA049493330.
DR   EnsemblGenomes-Gn; ENSRNA049493332.
DR   EnsemblGenomes-Gn; ENSRNA049493335.
DR   EnsemblGenomes-Gn; ENSRNA049493772.
DR   EnsemblGenomes-Gn; ENSRNA049495687.
DR   EnsemblGenomes-Gn; ENSRNA049495688.
DR   EnsemblGenomes-Gn; ENSRNA049495689.
DR   EnsemblGenomes-Gn; ENSRNA049495690.
DR   EnsemblGenomes-Gn; ENSRNA049495691.
DR   EnsemblGenomes-Gn; ENSRNA049495692.
DR   EnsemblGenomes-Gn; ENSRNA049495693.
DR   EnsemblGenomes-Gn; ENSRNA049495694.
DR   EnsemblGenomes-Gn; ENSRNA049495695.
DR   EnsemblGenomes-Gn; ENSRNA049495696.
DR   EnsemblGenomes-Gn; ENSRNA049495697.
DR   EnsemblGenomes-Gn; ENSRNA049495698.
DR   EnsemblGenomes-Gn; ENSRNA049495699.
DR   EnsemblGenomes-Gn; ENSRNA049495700.
DR   EnsemblGenomes-Gn; ENSRNA049495701.
DR   EnsemblGenomes-Gn; ENSRNA049495702.
DR   EnsemblGenomes-Gn; ENSRNA049495703.
DR   EnsemblGenomes-Gn; ENSRNA049495704.
DR   EnsemblGenomes-Gn; ENSRNA049495705.
DR   EnsemblGenomes-Gn; ENSRNA049495706.
DR   EnsemblGenomes-Gn; ENSRNA049495707.
DR   EnsemblGenomes-Gn; ENSRNA049495708.
DR   EnsemblGenomes-Gn; ENSRNA049495709.
DR   EnsemblGenomes-Gn; ENSRNA049495710.
DR   EnsemblGenomes-Gn; ENSRNA049495711.
DR   EnsemblGenomes-Gn; ENSRNA049495712.
DR   EnsemblGenomes-Gn; ENSRNA049495713.
DR   EnsemblGenomes-Gn; ENSRNA049495714.
DR   EnsemblGenomes-Gn; ENSRNA049495715.
DR   EnsemblGenomes-Gn; ENSRNA049495716.
DR   EnsemblGenomes-Gn; ENSRNA049495717.
DR   EnsemblGenomes-Gn; ENSRNA049495718.
DR   EnsemblGenomes-Gn; ENSRNA049495719.
DR   EnsemblGenomes-Gn; ENSRNA049495720.
DR   EnsemblGenomes-Gn; ENSRNA049495721.
DR   EnsemblGenomes-Gn; ENSRNA049495722.
DR   EnsemblGenomes-Gn; ENSRNA049495723.
DR   EnsemblGenomes-Gn; ENSRNA049495724.
DR   EnsemblGenomes-Gn; ENSRNA049495725.
DR   EnsemblGenomes-Gn; ENSRNA049495726.
DR   EnsemblGenomes-Gn; ENSRNA049495727.
DR   EnsemblGenomes-Gn; ENSRNA049495728.
DR   EnsemblGenomes-Gn; ENSRNA049495729.
DR   EnsemblGenomes-Gn; ENSRNA049495730.
DR   EnsemblGenomes-Gn; ENSRNA049495731.
DR   EnsemblGenomes-Gn; ENSRNA049495732.
DR   EnsemblGenomes-Gn; ENSRNA049495733.
DR   EnsemblGenomes-Tr; AT1G01046.1.
DR   EnsemblGenomes-Tr; AT1G01070.2.
DR   EnsemblGenomes-Tr; AT1G01140.2.
DR   EnsemblGenomes-Tr; AT1G01140.3.
DR   EnsemblGenomes-Tr; AT1G01183.1.
DR   EnsemblGenomes-Tr; AT1G01270.1.
DR   EnsemblGenomes-Tr; AT1G01340.1.
DR   EnsemblGenomes-Tr; AT1G01448.1.
DR   EnsemblGenomes-Tr; AT1G01448.2.
DR   EnsemblGenomes-Tr; AT1G01448.3.
DR   EnsemblGenomes-Tr; AT1G01480.2.
DR   EnsemblGenomes-Tr; AT1G01560.1.
DR   EnsemblGenomes-Tr; AT1G01870.1.
DR   EnsemblGenomes-Tr; AT1G01890.1.
DR   EnsemblGenomes-Tr; AT1G02090.2.
DR   EnsemblGenomes-Tr; AT1G02136.1.
DR   EnsemblGenomes-Tr; AT1G02145.1.
DR   EnsemblGenomes-Tr; AT1G02145.2.
DR   EnsemblGenomes-Tr; AT1G02145.4.
DR   EnsemblGenomes-Tr; AT1G02205.3.
DR   EnsemblGenomes-Tr; AT1G02228.1.
DR   EnsemblGenomes-Tr; AT1G02480.1.
DR   EnsemblGenomes-Tr; AT1G02600.1.
DR   EnsemblGenomes-Tr; AT1G02630.2.
DR   EnsemblGenomes-Tr; AT1G02681.1.
DR   EnsemblGenomes-Tr; AT1G02760.1.
DR   EnsemblGenomes-Tr; AT1G02860.2.
DR   EnsemblGenomes-Tr; AT1G02950.1.
DR   EnsemblGenomes-Tr; AT1G02950.3.
DR   EnsemblGenomes-Tr; AT1G02952.1.
DR   EnsemblGenomes-Tr; AT1G03090.1.
DR   EnsemblGenomes-Tr; AT1G03420.1.
DR   EnsemblGenomes-Tr; AT1G03502.1.
DR   EnsemblGenomes-Tr; AT1G03506.1.
DR   EnsemblGenomes-Tr; AT1G03515.1.
DR   EnsemblGenomes-Tr; AT1G03545.1.
DR   EnsemblGenomes-Tr; AT1G03570.1.
DR   EnsemblGenomes-Tr; AT1G03580.1.
DR   EnsemblGenomes-Tr; AT1G03640.1.
DR   EnsemblGenomes-Tr; AT1G03743.1.
DR   EnsemblGenomes-Tr; AT1G03746.1.
DR   EnsemblGenomes-Tr; AT1G03780.1.
DR   EnsemblGenomes-Tr; AT1G03780.2.
DR   EnsemblGenomes-Tr; AT1G03840.2.
DR   EnsemblGenomes-Tr; AT1G03850.1.
DR   EnsemblGenomes-Tr; AT1G03860.2.
DR   EnsemblGenomes-Tr; AT1G03935.1.
DR   EnsemblGenomes-Tr; AT1G03960.2.
DR   EnsemblGenomes-Tr; AT1G04295.1.
DR   EnsemblGenomes-Tr; AT1G04320.1.
DR   EnsemblGenomes-Tr; AT1G04425.1.
DR   EnsemblGenomes-Tr; AT1G04457.1.
DR   EnsemblGenomes-Tr; AT1G04720.1.
DR   EnsemblGenomes-Tr; AT1G04870.1.
DR   EnsemblGenomes-Tr; AT1G05061.1.
DR   EnsemblGenomes-Tr; AT1G05135.1.
DR   EnsemblGenomes-Tr; AT1G05170.1.
DR   EnsemblGenomes-Tr; AT1G05390.1.
DR   EnsemblGenomes-Tr; AT1G05562.1.
DR   EnsemblGenomes-Tr; AT1G05580.2.
DR   EnsemblGenomes-Tr; AT1G05620.2.
DR   EnsemblGenomes-Tr; AT1G05880.1.
DR   EnsemblGenomes-Tr; AT1G05980.1.
DR   EnsemblGenomes-Tr; AT1G06002.1.
DR   EnsemblGenomes-Tr; AT1G06130.2.
DR   EnsemblGenomes-Tr; AT1G06190.2.
DR   EnsemblGenomes-Tr; AT1G06265.1.
DR   EnsemblGenomes-Tr; AT1G06265.2.
DR   EnsemblGenomes-Tr; AT1G06370.1.
DR   EnsemblGenomes-Tr; AT1G06480.1.
DR   EnsemblGenomes-Tr; AT1G06610.1.
DR   EnsemblGenomes-Tr; AT1G06640.2.
DR   EnsemblGenomes-Tr; AT1G06650.1.
DR   EnsemblGenomes-Tr; AT1G06740.1.
DR   EnsemblGenomes-Tr; AT1G06770.2.
DR   EnsemblGenomes-Tr; AT1G06860.1.
DR   EnsemblGenomes-Tr; AT1G06880.1.
DR   EnsemblGenomes-Tr; AT1G06960.2.
DR   EnsemblGenomes-Tr; AT1G06960.3.
DR   EnsemblGenomes-Tr; AT1G07051.1.
DR   EnsemblGenomes-Tr; AT1G07100.1.
DR   EnsemblGenomes-Tr; AT1G07119.1.
DR   EnsemblGenomes-Tr; AT1G07128.1.
DR   EnsemblGenomes-Tr; AT1G07420.2.
DR   EnsemblGenomes-Tr; AT1G07580.1.
DR   EnsemblGenomes-Tr; AT1G07640.1.
DR   EnsemblGenomes-Tr; AT1G07700.2.
DR   EnsemblGenomes-Tr; AT1G07700.3.
DR   EnsemblGenomes-Tr; AT1G07702.1.
DR   EnsemblGenomes-Tr; AT1G07728.1.
DR   EnsemblGenomes-Tr; AT1G07728.2.
DR   EnsemblGenomes-Tr; AT1G07760.1.
DR   EnsemblGenomes-Tr; AT1G07800.1.
DR   EnsemblGenomes-Tr; AT1G07880.1.
DR   EnsemblGenomes-Tr; AT1G08105.1.
DR   EnsemblGenomes-Tr; AT1G08115.1.
DR   EnsemblGenomes-Tr; AT1G08240.1.
DR   EnsemblGenomes-Tr; AT1G08570.3.
DR   EnsemblGenomes-Tr; AT1G08570.4.
DR   EnsemblGenomes-Tr; AT1G08592.1.
DR   EnsemblGenomes-Tr; AT1G08680.2.
DR   EnsemblGenomes-Tr; AT1G08680.3.
DR   EnsemblGenomes-Tr; AT1G08710.1.
DR   EnsemblGenomes-Tr; AT1G08735.1.
DR   EnsemblGenomes-Tr; AT1G08740.1.
DR   EnsemblGenomes-Tr; AT1G08870.1.
DR   EnsemblGenomes-Tr; AT1G08920.2.
DR   EnsemblGenomes-Tr; AT1G08950.1.
DR   EnsemblGenomes-Tr; AT1G09080.2.
DR   EnsemblGenomes-Tr; AT1G09110.1.
DR   EnsemblGenomes-Tr; AT1G09421.1.
DR   EnsemblGenomes-Tr; AT1G09486.1.
DR   EnsemblGenomes-Tr; AT1G09660.2.
DR   EnsemblGenomes-Tr; AT1G10160.1.
DR   EnsemblGenomes-Tr; AT1G10260.1.
DR   EnsemblGenomes-Tr; AT1G10419.1.
DR   EnsemblGenomes-Tr; AT1G10440.1.
DR   EnsemblGenomes-Tr; AT1G10538.1.
DR   EnsemblGenomes-Tr; AT1G10570.2.
DR   EnsemblGenomes-Tr; AT1G10600.2.
DR   EnsemblGenomes-Tr; AT1G10600.3.
DR   EnsemblGenomes-Tr; AT1G10682.1.
DR   EnsemblGenomes-Tr; AT1G10705.1.
DR   EnsemblGenomes-Tr; AT1G10830.2.
DR   EnsemblGenomes-Tr; AT1G11010.1.
DR   EnsemblGenomes-Tr; AT1G11030.1.
DR   EnsemblGenomes-Tr; AT1G11055.1.
DR   EnsemblGenomes-Tr; AT1G11150.1.
DR   EnsemblGenomes-Tr; AT1G11175.1.
DR   EnsemblGenomes-Tr; AT1G11185.1.
DR   EnsemblGenomes-Tr; AT1G11265.1.
DR   EnsemblGenomes-Tr; AT1G11280.3.
DR   EnsemblGenomes-Tr; AT1G11450.1.
DR   EnsemblGenomes-Tr; AT1G11450.2.
DR   EnsemblGenomes-Tr; AT1G11482.1.
DR   EnsemblGenomes-Tr; AT1G11550.1.
DR   EnsemblGenomes-Tr; AT1G11592.1.
DR   EnsemblGenomes-Tr; AT1G11592.2.
DR   EnsemblGenomes-Tr; AT1G11595.1.
DR   EnsemblGenomes-Tr; AT1G11640.1.
DR   EnsemblGenomes-Tr; AT1G11735.1.
DR   EnsemblGenomes-Tr; AT1G11790.2.
DR   EnsemblGenomes-Tr; AT1G11803.1.
DR   EnsemblGenomes-Tr; AT1G11806.1.
DR   EnsemblGenomes-Tr; AT1G12013.1.
DR   EnsemblGenomes-Tr; AT1G12015.1.
DR   EnsemblGenomes-Tr; AT1G12140.2.
DR   EnsemblGenomes-Tr; AT1G12294.1.
DR   EnsemblGenomes-Tr; AT1G12370.1.
DR   EnsemblGenomes-Tr; AT1G12510.1.
DR   EnsemblGenomes-Tr; AT1G12520.2.
DR   EnsemblGenomes-Tr; AT1G12520.3.
DR   EnsemblGenomes-Tr; AT1G12590.1.
DR   EnsemblGenomes-Tr; AT1G12667.1.
DR   EnsemblGenomes-Tr; AT1G12669.1.
DR   EnsemblGenomes-Tr; AT1G12670.1.
DR   EnsemblGenomes-Tr; AT1G12720.1.
DR   EnsemblGenomes-Tr; AT1G12725.1.
DR   EnsemblGenomes-Tr; AT1G12935.1.
DR   EnsemblGenomes-Tr; AT1G13010.1.
DR   EnsemblGenomes-Tr; AT1G13070.1.
DR   EnsemblGenomes-Tr; AT1G13080.2.
DR   EnsemblGenomes-Tr; AT1G13145.1.
DR   EnsemblGenomes-Tr; AT1G13240.1.
DR   EnsemblGenomes-Tr; AT1G13448.1.
DR   EnsemblGenomes-Tr; AT1G13450.2.
DR   EnsemblGenomes-Tr; AT1G13450.3.
DR   EnsemblGenomes-Tr; AT1G13580.1.
DR   EnsemblGenomes-Tr; AT1G13660.1.
DR   EnsemblGenomes-Tr; AT1G13720.1.
DR   EnsemblGenomes-Tr; AT1G13840.1.
DR   EnsemblGenomes-Tr; AT1G13850.1.
DR   EnsemblGenomes-Tr; AT1G13860.2.
DR   EnsemblGenomes-Tr; AT1G13960.2.
DR   EnsemblGenomes-Tr; AT1G14071.1.
DR   EnsemblGenomes-Tr; AT1G14090.1.
DR   EnsemblGenomes-Tr; AT1G14150.2.
DR   EnsemblGenomes-Tr; AT1G14182.1.
DR   EnsemblGenomes-Tr; AT1G14518.1.
DR   EnsemblGenomes-Tr; AT1G14700.2.
DR   EnsemblGenomes-Tr; AT1G14750.2.
DR   EnsemblGenomes-Tr; AT1G15002.1.
DR   EnsemblGenomes-Tr; AT1G15020.1.
DR   EnsemblGenomes-Tr; AT1G15090.1.
DR   EnsemblGenomes-Tr; AT1G15175.1.
DR   EnsemblGenomes-Tr; AT1G15215.1.
DR   EnsemblGenomes-Tr; AT1G15215.3.
DR   EnsemblGenomes-Tr; AT1G15300.1.
DR   EnsemblGenomes-Tr; AT1G15340.2.
DR   EnsemblGenomes-Tr; AT1G15400.1.
DR   EnsemblGenomes-Tr; AT1G15400.2.
DR   EnsemblGenomes-Tr; AT1G15405.1.
DR   EnsemblGenomes-Tr; AT1G15450.1.
DR   EnsemblGenomes-Tr; AT1G15560.1.
DR   EnsemblGenomes-Tr; AT1G15650.1.
DR   EnsemblGenomes-Tr; AT1G16060.2.
DR   EnsemblGenomes-Tr; AT1G16100.1.
DR   EnsemblGenomes-Tr; AT1G16140.1.
DR   EnsemblGenomes-Tr; AT1G16410.2.
DR   EnsemblGenomes-Tr; AT1G16450.1.
DR   EnsemblGenomes-Tr; AT1G16489.1.
DR   EnsemblGenomes-Tr; AT1G16550.1.
DR   EnsemblGenomes-Tr; AT1G16600.1.
DR   EnsemblGenomes-Tr; AT1G16610.2.
DR   EnsemblGenomes-Tr; AT1G16610.3.
DR   EnsemblGenomes-Tr; AT1G16620.1.
DR   EnsemblGenomes-Tr; AT1G16635.1.
DR   EnsemblGenomes-Tr; AT1G16660.1.
DR   EnsemblGenomes-Tr; AT1G16890.1.
DR   EnsemblGenomes-Tr; AT1G17060.1.
DR   EnsemblGenomes-Tr; AT1G17232.1.
DR   EnsemblGenomes-Tr; AT1G17255.1.
DR   EnsemblGenomes-Tr; AT1G17275.1.
DR   EnsemblGenomes-Tr; AT1G17277.1.
DR   EnsemblGenomes-Tr; AT1G17390.1.
DR   EnsemblGenomes-Tr; AT1G17495.1.
DR   EnsemblGenomes-Tr; AT1G17570.1.
DR   EnsemblGenomes-Tr; AT1G17660.1.
DR   EnsemblGenomes-Tr; AT1G17670.1.
DR   EnsemblGenomes-Tr; AT1G17710.2.
DR   EnsemblGenomes-Tr; AT1G17720.2.
DR   EnsemblGenomes-Tr; AT1G17900.1.
DR   EnsemblGenomes-Tr; AT1G18030.2.
DR   EnsemblGenomes-Tr; AT1G18075.1.
DR   EnsemblGenomes-Tr; AT1G18120.1.
DR   EnsemblGenomes-Tr; AT1G18191.1.
DR   EnsemblGenomes-Tr; AT1G18230.1.
DR   EnsemblGenomes-Tr; AT1G18240.1.
DR   EnsemblGenomes-Tr; AT1G18382.1.
DR   EnsemblGenomes-Tr; AT1G18415.1.
DR   EnsemblGenomes-Tr; AT1G18430.1.
DR   EnsemblGenomes-Tr; AT1G18735.1.
DR   EnsemblGenomes-Tr; AT1G18745.1.
DR   EnsemblGenomes-Tr; AT1G18820.1.
DR   EnsemblGenomes-Tr; AT1G18879.1.
DR   EnsemblGenomes-Tr; AT1G18930.1.
DR   EnsemblGenomes-Tr; AT1G19030.1.
DR   EnsemblGenomes-Tr; AT1G19230.1.
DR   EnsemblGenomes-Tr; AT1G19371.1.
DR   EnsemblGenomes-Tr; AT1G19373.1.
DR   EnsemblGenomes-Tr; AT1G19376.1.
DR   EnsemblGenomes-Tr; AT1G19392.1.
DR   EnsemblGenomes-Tr; AT1G19415.1.
DR   EnsemblGenomes-Tr; AT1G19420.1.
DR   EnsemblGenomes-Tr; AT1G19464.1.
DR   EnsemblGenomes-Tr; AT1G19560.1.
DR   EnsemblGenomes-Tr; AT1G19570.2.
DR   EnsemblGenomes-Tr; AT1G19810.1.
DR   EnsemblGenomes-Tr; AT1G19968.1.
DR   EnsemblGenomes-Tr; AT1G20015.1.
DR   EnsemblGenomes-Tr; AT1G20020.2.
DR   EnsemblGenomes-Tr; AT1G20020.3.
DR   EnsemblGenomes-Tr; AT1G20040.1.
DR   EnsemblGenomes-Tr; AT1G20170.1.
DR   EnsemblGenomes-Tr; AT1G20180.2.
DR   EnsemblGenomes-Tr; AT1G20210.1.
DR   EnsemblGenomes-Tr; AT1G20250.1.
DR   EnsemblGenomes-Tr; AT1G20375.1.
DR   EnsemblGenomes-Tr; AT1G20390.1.
DR   EnsemblGenomes-Tr; AT1G20420.1.
DR   EnsemblGenomes-Tr; AT1G20490.1.
DR   EnsemblGenomes-Tr; AT1G20515.1.
DR   EnsemblGenomes-Tr; AT1G20657.1.
DR   EnsemblGenomes-Tr; AT1G20691.1.
DR   EnsemblGenomes-Tr; AT1G20693.2.
DR   EnsemblGenomes-Tr; AT1G20693.3.
DR   EnsemblGenomes-Tr; AT1G20696.2.
DR   EnsemblGenomes-Tr; AT1G20696.3.
DR   EnsemblGenomes-Tr; AT1G20820.1.
DR   EnsemblGenomes-Tr; AT1G21020.1.
DR   EnsemblGenomes-Tr; AT1G21040.1.
DR   EnsemblGenomes-Tr; AT1G21202.1.
DR   EnsemblGenomes-Tr; AT1G21220.1.
DR   EnsemblGenomes-Tr; AT1G21260.1.
DR   EnsemblGenomes-Tr; AT1G21286.1.
DR   EnsemblGenomes-Tr; AT1G21290.1.
DR   EnsemblGenomes-Tr; AT1G21300.1.
DR   EnsemblGenomes-Tr; AT1G21330.1.
DR   EnsemblGenomes-Tr; AT1G21420.1.
DR   EnsemblGenomes-Tr; AT1G21490.1.
DR   EnsemblGenomes-Tr; AT1G21525.1.
DR   EnsemblGenomes-Tr; AT1G21529.1.
DR   EnsemblGenomes-Tr; AT1G21530.1.
DR   EnsemblGenomes-Tr; AT1G21650.1.
DR   EnsemblGenomes-Tr; AT1G21800.1.
DR   EnsemblGenomes-Tr; AT1G21880.1.
DR   EnsemblGenomes-Tr; AT1G21945.1.
DR   EnsemblGenomes-Tr; AT1G21973.1.
DR   EnsemblGenomes-Tr; AT1G22280.2.
DR   EnsemblGenomes-Tr; AT1G22310.1.
DR   EnsemblGenomes-Tr; AT1G22320.1.
DR   EnsemblGenomes-Tr; AT1G22350.1.
DR   EnsemblGenomes-Tr; AT1G22370.1.
DR   EnsemblGenomes-Tr; AT1G22403.1.
DR   EnsemblGenomes-Tr; AT1G22403.2.
DR   EnsemblGenomes-Tr; AT1G22560.1.
DR   EnsemblGenomes-Tr; AT1G22580.1.
DR   EnsemblGenomes-Tr; AT1G22880.2.
DR   EnsemblGenomes-Tr; AT1G23020.1.
DR   EnsemblGenomes-Tr; AT1G23052.1.
DR   EnsemblGenomes-Tr; AT1G23080.2.
DR   EnsemblGenomes-Tr; AT1G23230.2.
DR   EnsemblGenomes-Tr; AT1G23240.2.
DR   EnsemblGenomes-Tr; AT1G23240.3.
DR   EnsemblGenomes-Tr; AT1G23310.2.
DR   EnsemblGenomes-Tr; AT1G23360.2.
DR   EnsemblGenomes-Tr; AT1G23360.3.
DR   EnsemblGenomes-Tr; AT1G23380.2.
DR   EnsemblGenomes-Tr; AT1G23470.1.
DR   EnsemblGenomes-Tr; AT1G23480.3.
DR   EnsemblGenomes-Tr; AT1G23620.1.
DR   EnsemblGenomes-Tr; AT1G23920.1.
DR   EnsemblGenomes-Tr; AT1G23930.1.
DR   EnsemblGenomes-Tr; AT1G23950.1.
DR   EnsemblGenomes-Tr; AT1G23950.3.
DR   EnsemblGenomes-Tr; AT1G23950.4.
DR   EnsemblGenomes-Tr; AT1G23950.5.
DR   EnsemblGenomes-Tr; AT1G23990.1.
DR   EnsemblGenomes-Tr; AT1G24068.1.
DR   EnsemblGenomes-Tr; AT1G24080.1.
DR   EnsemblGenomes-Tr; AT1G24150.1.
DR   EnsemblGenomes-Tr; AT1G24212.1.
DR   EnsemblGenomes-Tr; AT1G24370.1.
DR   EnsemblGenomes-Tr; AT1G24485.1.
DR   EnsemblGenomes-Tr; AT1G24640.1.
DR   EnsemblGenomes-Tr; AT1G24657.1.
DR   EnsemblGenomes-Tr; AT1G24686.1.
DR   EnsemblGenomes-Tr; AT1G24733.1.
DR   EnsemblGenomes-Tr; AT1G24792.1.
DR   EnsemblGenomes-Tr; AT1G24793.2.
DR   EnsemblGenomes-Tr; AT1G24879.1.
DR   EnsemblGenomes-Tr; AT1G24880.1.
DR   EnsemblGenomes-Tr; AT1G24938.1.
DR   EnsemblGenomes-Tr; AT1G24967.1.
DR   EnsemblGenomes-Tr; AT1G25053.1.
DR   EnsemblGenomes-Tr; AT1G25098.1.
DR   EnsemblGenomes-Tr; AT1G25098.2.
DR   EnsemblGenomes-Tr; AT1G25175.1.
DR   EnsemblGenomes-Tr; AT1G25209.1.
DR   EnsemblGenomes-Tr; AT1G25430.1.
DR   EnsemblGenomes-Tr; AT1G25540.2.
DR   EnsemblGenomes-Tr; AT1G25784.1.
DR   EnsemblGenomes-Tr; AT1G25886.1.
DR   EnsemblGenomes-Tr; AT1G26110.2.
DR   EnsemblGenomes-Tr; AT1G26208.1.
DR   EnsemblGenomes-Tr; AT1G26208.2.
DR   EnsemblGenomes-Tr; AT1G26218.1.
DR   EnsemblGenomes-Tr; AT1G26230.2.
DR   EnsemblGenomes-Tr; AT1G26233.1.
DR   EnsemblGenomes-Tr; AT1G26235.1.
DR   EnsemblGenomes-Tr; AT1G26260.3.
DR   EnsemblGenomes-Tr; AT1G26430.1.
DR   EnsemblGenomes-Tr; AT1G26490.1.
DR   EnsemblGenomes-Tr; AT1G26558.1.
DR   EnsemblGenomes-Tr; AT1G26558.2.
DR   EnsemblGenomes-Tr; AT1G26665.1.
DR   EnsemblGenomes-Tr; AT1G26860.1.
DR   EnsemblGenomes-Tr; AT1G26911.1.
DR   EnsemblGenomes-Tr; AT1G26950.1.
DR   EnsemblGenomes-Tr; AT1G26973.1.
DR   EnsemblGenomes-Tr; AT1G26975.1.
DR   EnsemblGenomes-Tr; AT1G26985.1.
DR   EnsemblGenomes-Tr; AT1G26990.1.
DR   EnsemblGenomes-Tr; AT1G27040.2.
DR   EnsemblGenomes-Tr; AT1G27285.1.
DR   EnsemblGenomes-Tr; AT1G27450.2.
DR   EnsemblGenomes-Tr; AT1G27560.1.
DR   EnsemblGenomes-Tr; AT1G27671.1.
DR   EnsemblGenomes-Tr; AT1G27780.1.
DR   EnsemblGenomes-Tr; AT1G27790.1.
DR   EnsemblGenomes-Tr; AT1G27800.1.
DR   EnsemblGenomes-Tr; AT1G27810.1.
DR   EnsemblGenomes-Tr; AT1G27815.1.
DR   EnsemblGenomes-Tr; AT1G27921.1.
DR   EnsemblGenomes-Tr; AT1G27921.2.
DR   EnsemblGenomes-Tr; AT1G28002.1.
DR   EnsemblGenomes-Tr; AT1G28130.2.
DR   EnsemblGenomes-Tr; AT1G28323.1.
DR   EnsemblGenomes-Tr; AT1G28447.1.
DR   EnsemblGenomes-Tr; AT1G28455.1.
DR   EnsemblGenomes-Tr; AT1G28465.1.
DR   EnsemblGenomes-Tr; AT1G28560.2.
DR   EnsemblGenomes-Tr; AT1G28570.2.
DR   EnsemblGenomes-Tr; AT1G28580.2.
DR   EnsemblGenomes-Tr; AT1G28591.1.
DR   EnsemblGenomes-Tr; AT1G28600.2.
DR   EnsemblGenomes-Tr; AT1G28610.1.
DR   EnsemblGenomes-Tr; AT1G28620.1.
DR   EnsemblGenomes-Tr; AT1G28660.2.
DR   EnsemblGenomes-Tr; AT1G28685.1.
DR   EnsemblGenomes-Tr; AT1G28720.1.
DR   EnsemblGenomes-Tr; AT1G28730.1.
DR   EnsemblGenomes-Tr; AT1G28740.1.
DR   EnsemblGenomes-Tr; AT1G28750.1.
DR   EnsemblGenomes-Tr; AT1G28770.1.
DR   EnsemblGenomes-Tr; AT1G28780.1.
DR   EnsemblGenomes-Tr; AT1G28790.1.
DR   EnsemblGenomes-Tr; AT1G28800.1.
DR   EnsemblGenomes-Tr; AT1G28810.1.
DR   EnsemblGenomes-Tr; AT1G28820.1.
DR   EnsemblGenomes-Tr; AT1G28830.1.
DR   EnsemblGenomes-Tr; AT1G28840.1.
DR   EnsemblGenomes-Tr; AT1G28850.1.
DR   EnsemblGenomes-Tr; AT1G28860.1.
DR   EnsemblGenomes-Tr; AT1G28870.1.
DR   EnsemblGenomes-Tr; AT1G28880.1.
DR   EnsemblGenomes-Tr; AT1G28890.1.
DR   EnsemblGenomes-Tr; AT1G28900.1.
DR   EnsemblGenomes-Tr; AT1G28910.1.
DR   EnsemblGenomes-Tr; AT1G28920.1.
DR   EnsemblGenomes-Tr; AT1G28930.1.
DR   EnsemblGenomes-Tr; AT1G28940.1.
DR   EnsemblGenomes-Tr; AT1G28950.1.
DR   EnsemblGenomes-Tr; AT1G28970.1.
DR   EnsemblGenomes-Tr; AT1G28980.1.
DR   EnsemblGenomes-Tr; AT1G28990.1.
DR   EnsemblGenomes-Tr; AT1G29071.1.
DR   EnsemblGenomes-Tr; AT1G29075.1.
DR   EnsemblGenomes-Tr; AT1G29190.1.
DR   EnsemblGenomes-Tr; AT1G29210.1.
DR   EnsemblGenomes-Tr; AT1G29265.1.
DR   EnsemblGenomes-Tr; AT1G29357.1.
DR   EnsemblGenomes-Tr; AT1G29357.2.
DR   EnsemblGenomes-Tr; AT1G29360.1.
DR   EnsemblGenomes-Tr; AT1G29390.2.
DR   EnsemblGenomes-Tr; AT1G29410.1.
DR   EnsemblGenomes-Tr; AT1G29475.1.
DR   EnsemblGenomes-Tr; AT1G29630.1.
DR   EnsemblGenomes-Tr; AT1G29650.1.
DR   EnsemblGenomes-Tr; AT1G29715.1.
DR   EnsemblGenomes-Tr; AT1G29750.1.
DR   EnsemblGenomes-Tr; AT1G29785.1.
DR   EnsemblGenomes-Tr; AT1G29785.2.
DR   EnsemblGenomes-Tr; AT1G30030.1.
DR   EnsemblGenomes-Tr; AT1G30040.2.
DR   EnsemblGenomes-Tr; AT1G30150.1.
DR   EnsemblGenomes-Tr; AT1G30180.1.
DR   EnsemblGenomes-Tr; AT1G30282.1.
DR   EnsemblGenomes-Tr; AT1G30310.1.
DR   EnsemblGenomes-Tr; AT1G30340.1.
DR   EnsemblGenomes-Tr; AT1G30390.1.
DR   EnsemblGenomes-Tr; AT1G30430.1.
DR   EnsemblGenomes-Tr; AT1G30460.2.
DR   EnsemblGenomes-Tr; AT1G30510.1.
DR   EnsemblGenomes-Tr; AT1G30510.3.
DR   EnsemblGenomes-Tr; AT1G30784.1.
DR   EnsemblGenomes-Tr; AT1G30830.1.
DR   EnsemblGenomes-Tr; AT1G30835.1.
DR   EnsemblGenomes-Tr; AT1G30835.2.
DR   EnsemblGenomes-Tr; AT1G30921.1.
DR   EnsemblGenomes-Tr; AT1G30935.1.
DR   EnsemblGenomes-Tr; AT1G30940.1.
DR   EnsemblGenomes-Tr; AT1G30945.1.
DR   EnsemblGenomes-Tr; AT1G30975.1.
DR   EnsemblGenomes-Tr; AT1G30980.1.
DR   EnsemblGenomes-Tr; AT1G31030.1.
DR   EnsemblGenomes-Tr; AT1G31072.1.
DR   EnsemblGenomes-Tr; AT1G31093.1.
DR   EnsemblGenomes-Tr; AT1G31100.1.
DR   EnsemblGenomes-Tr; AT1G31110.1.
DR   EnsemblGenomes-Tr; AT1G31166.1.
DR   EnsemblGenomes-Tr; AT1G31170.3.
DR   EnsemblGenomes-Tr; AT1G31173.1.
DR   EnsemblGenomes-Tr; AT1G31210.1.
DR   EnsemblGenomes-Tr; AT1G31245.1.
DR   EnsemblGenomes-Tr; AT1G31258.1.
DR   EnsemblGenomes-Tr; AT1G31274.1.
DR   EnsemblGenomes-Tr; AT1G31355.1.
DR   EnsemblGenomes-Tr; AT1G31358.1.
DR   EnsemblGenomes-Tr; AT1G31360.2.
DR   EnsemblGenomes-Tr; AT1G31485.1.
DR   EnsemblGenomes-Tr; AT1G31500.1.
DR   EnsemblGenomes-Tr; AT1G31500.2.
DR   EnsemblGenomes-Tr; AT1G31500.3.
DR   EnsemblGenomes-Tr; AT1G31550.1.
DR   EnsemblGenomes-Tr; AT1G31570.1.
DR   EnsemblGenomes-Tr; AT1G31830.2.
DR   EnsemblGenomes-Tr; AT1G31900.1.
DR   EnsemblGenomes-Tr; AT1G31935.1.
DR   EnsemblGenomes-Tr; AT1G31983.1.
DR   EnsemblGenomes-Tr; AT1G31993.1.
DR   EnsemblGenomes-Tr; AT1G32040.1.
DR   EnsemblGenomes-Tr; AT1G32045.1.
DR   EnsemblGenomes-Tr; AT1G32049.1.
DR   EnsemblGenomes-Tr; AT1G32070.1.
DR   EnsemblGenomes-Tr; AT1G32070.3.
DR   EnsemblGenomes-Tr; AT1G32110.1.
DR   EnsemblGenomes-Tr; AT1G32172.1.
DR   EnsemblGenomes-Tr; AT1G32230.2.
DR   EnsemblGenomes-Tr; AT1G32385.1.
DR   EnsemblGenomes-Tr; AT1G32390.1.
DR   EnsemblGenomes-Tr; AT1G32480.1.
DR   EnsemblGenomes-Tr; AT1G32505.1.
DR   EnsemblGenomes-Tr; AT1G32540.1.
DR   EnsemblGenomes-Tr; AT1G32582.1.
DR   EnsemblGenomes-Tr; AT1G32590.1.
DR   EnsemblGenomes-Tr; AT1G32620.1.
DR   EnsemblGenomes-Tr; AT1G32680.1.
DR   EnsemblGenomes-Tr; AT1G32713.1.
DR   EnsemblGenomes-Tr; AT1G32820.1.
DR   EnsemblGenomes-Tr; AT1G32830.1.
DR   EnsemblGenomes-Tr; AT1G32840.1.
DR   EnsemblGenomes-Tr; AT1G32890.1.
DR   EnsemblGenomes-Tr; AT1G32992.1.
DR   EnsemblGenomes-Tr; AT1G33000.1.
DR   EnsemblGenomes-Tr; AT1G33130.1.
DR   EnsemblGenomes-Tr; AT1G33135.1.
DR   EnsemblGenomes-Tr; AT1G33160.1.
DR   EnsemblGenomes-Tr; AT1G33180.1.
DR   EnsemblGenomes-Tr; AT1G33190.1.
DR   EnsemblGenomes-Tr; AT1G33200.1.
DR   EnsemblGenomes-Tr; AT1G33260.2.
DR   EnsemblGenomes-Tr; AT1G33300.1.
DR   EnsemblGenomes-Tr; AT1G33370.1.
DR   EnsemblGenomes-Tr; AT1G33380.1.
DR   EnsemblGenomes-Tr; AT1G33415.1.
DR   EnsemblGenomes-Tr; AT1G33415.2.
DR   EnsemblGenomes-Tr; AT1G33450.1.
DR   EnsemblGenomes-Tr; AT1G33460.1.
DR   EnsemblGenomes-Tr; AT1G33510.1.
DR   EnsemblGenomes-Tr; AT1G33550.1.
DR   EnsemblGenomes-Tr; AT1G33570.1.
DR   EnsemblGenomes-Tr; AT1G33580.1.
DR   EnsemblGenomes-Tr; AT1G33615.1.
DR   EnsemblGenomes-Tr; AT1G33660.1.
DR   EnsemblGenomes-Tr; AT1G33740.1.
DR   EnsemblGenomes-Tr; AT1G33743.1.
DR   EnsemblGenomes-Tr; AT1G33785.1.
DR   EnsemblGenomes-Tr; AT1G33813.1.
DR   EnsemblGenomes-Tr; AT1G33817.1.
DR   EnsemblGenomes-Tr; AT1G33835.1.
DR   EnsemblGenomes-Tr; AT1G33855.1.
DR   EnsemblGenomes-Tr; AT1G33980.2.
DR   EnsemblGenomes-Tr; AT1G34044.1.
DR   EnsemblGenomes-Tr; AT1G34080.1.
DR   EnsemblGenomes-Tr; AT1G34090.1.
DR   EnsemblGenomes-Tr; AT1G34097.1.
DR   EnsemblGenomes-Tr; AT1G34100.1.
DR   EnsemblGenomes-Tr; AT1G34120.1.
DR   EnsemblGenomes-Tr; AT1G34230.1.
DR   EnsemblGenomes-Tr; AT1G34240.1.
DR   EnsemblGenomes-Tr; AT1G34250.1.
DR   EnsemblGenomes-Tr; AT1G34281.1.
DR   EnsemblGenomes-Tr; AT1G34330.1.
DR   EnsemblGenomes-Tr; AT1G34392.1.
DR   EnsemblGenomes-Tr; AT1G34405.1.
DR   EnsemblGenomes-Tr; AT1G34418.1.
DR   EnsemblGenomes-Tr; AT1G34530.1.
DR   EnsemblGenomes-Tr; AT1G34545.1.
DR   EnsemblGenomes-Tr; AT1G34590.1.
DR   EnsemblGenomes-Tr; AT1G34600.1.
DR   EnsemblGenomes-Tr; AT1G34610.1.
DR   EnsemblGenomes-Tr; AT1G34620.1.
DR   EnsemblGenomes-Tr; AT1G34660.1.
DR   EnsemblGenomes-Tr; AT1G34680.1.
DR   EnsemblGenomes-Tr; AT1G34690.1.
DR   EnsemblGenomes-Tr; AT1G34700.1.
DR   EnsemblGenomes-Tr; AT1G34710.1.
DR   EnsemblGenomes-Tr; AT1G34720.1.
DR   EnsemblGenomes-Tr; AT1G34730.1.
DR   EnsemblGenomes-Tr; AT1G34740.1.
DR   EnsemblGenomes-Tr; AT1G34760.1.
DR   EnsemblGenomes-Tr; AT1G34780.2.
DR   EnsemblGenomes-Tr; AT1G34797.1.
DR   EnsemblGenomes-Tr; AT1G34803.1.
DR   EnsemblGenomes-Tr; AT1G34808.1.
DR   EnsemblGenomes-Tr; AT1G34813.1.
DR   EnsemblGenomes-Tr; AT1G34818.1.
DR   EnsemblGenomes-Tr; AT1G34823.1.
DR   EnsemblGenomes-Tr; AT1G34828.1.
DR   EnsemblGenomes-Tr; AT1G34836.1.
DR   EnsemblGenomes-Tr; AT1G34842.1.
DR   EnsemblGenomes-Tr; AT1G34844.1.
DR   EnsemblGenomes-Tr; AT1G34904.1.
DR   EnsemblGenomes-Tr; AT1G34967.1.
DR   EnsemblGenomes-Tr; AT1G35050.1.
DR   EnsemblGenomes-Tr; AT1G35060.1.
DR   EnsemblGenomes-Tr; AT1G35080.1.
DR   EnsemblGenomes-Tr; AT1G35090.1.
DR   EnsemblGenomes-Tr; AT1G35100.1.
DR   EnsemblGenomes-Tr; AT1G35110.1.
DR   EnsemblGenomes-Tr; AT1G35112.1.
DR   EnsemblGenomes-Tr; AT1G35115.1.
DR   EnsemblGenomes-Tr; AT1G35120.1.
DR   EnsemblGenomes-Tr; AT1G35130.1.
DR   EnsemblGenomes-Tr; AT1G35143.1.
DR   EnsemblGenomes-Tr; AT1G35146.1.
DR   EnsemblGenomes-Tr; AT1G35186.1.
DR   EnsemblGenomes-Tr; AT1G35200.1.
DR   EnsemblGenomes-Tr; AT1G35270.1.
DR   EnsemblGenomes-Tr; AT1G35280.1.
DR   EnsemblGenomes-Tr; AT1G35300.1.
DR   EnsemblGenomes-Tr; AT1G35360.1.
DR   EnsemblGenomes-Tr; AT1G35370.1.
DR   EnsemblGenomes-Tr; AT1G35380.1.
DR   EnsemblGenomes-Tr; AT1G35390.1.
DR   EnsemblGenomes-Tr; AT1G35405.1.
DR   EnsemblGenomes-Tr; AT1G35450.1.
DR   EnsemblGenomes-Tr; AT1G35465.1.
DR   EnsemblGenomes-Tr; AT1G35480.1.
DR   EnsemblGenomes-Tr; AT1G35501.1.
DR   EnsemblGenomes-Tr; AT1G35513.1.
DR   EnsemblGenomes-Tr; AT1G35535.1.
DR   EnsemblGenomes-Tr; AT1G35545.1.
DR   EnsemblGenomes-Tr; AT1G35570.1.
DR   EnsemblGenomes-Tr; AT1G35590.1.
DR   EnsemblGenomes-Tr; AT1G35600.1.
DR   EnsemblGenomes-Tr; AT1G35612.1.
DR   EnsemblGenomes-Tr; AT1G35640.1.
DR   EnsemblGenomes-Tr; AT1G35645.1.
DR   EnsemblGenomes-Tr; AT1G35647.1.
DR   EnsemblGenomes-Tr; AT1G35650.1.
DR   EnsemblGenomes-Tr; AT1G35663.1.
DR   EnsemblGenomes-Tr; AT1G35690.1.
DR   EnsemblGenomes-Tr; AT1G35700.1.
DR   EnsemblGenomes-Tr; AT1G35735.1.
DR   EnsemblGenomes-Tr; AT1G35740.1.
DR   EnsemblGenomes-Tr; AT1G35745.1.
DR   EnsemblGenomes-Tr; AT1G35760.1.
DR   EnsemblGenomes-Tr; AT1G35770.1.
DR   EnsemblGenomes-Tr; AT1G35790.1.
DR   EnsemblGenomes-Tr; AT1G35840.1.
DR   EnsemblGenomes-Tr; AT1G35850.1.
DR   EnsemblGenomes-Tr; AT1G35870.1.
DR   EnsemblGenomes-Tr; AT1G35920.1.
DR   EnsemblGenomes-Tr; AT1G35930.1.
DR   EnsemblGenomes-Tr; AT1G35940.1.
DR   EnsemblGenomes-Tr; AT1G35950.1.
DR   EnsemblGenomes-Tr; AT1G35960.1.
DR   EnsemblGenomes-Tr; AT1G35970.1.
DR   EnsemblGenomes-Tr; AT1G35980.1.
DR   EnsemblGenomes-Tr; AT1G35990.1.
DR   EnsemblGenomes-Tr; AT1G35995.1.
DR   EnsemblGenomes-Tr; AT1G36010.1.
DR   EnsemblGenomes-Tr; AT1G36035.1.
DR   EnsemblGenomes-Tr; AT1G36040.1.
DR   EnsemblGenomes-Tr; AT1G36080.1.
DR   EnsemblGenomes-Tr; AT1G36090.1.
DR   EnsemblGenomes-Tr; AT1G36105.1.
DR   EnsemblGenomes-Tr; AT1G36110.1.
DR   EnsemblGenomes-Tr; AT1G36120.1.
DR   EnsemblGenomes-Tr; AT1G36130.1.
DR   EnsemblGenomes-Tr; AT1G36140.1.
DR   EnsemblGenomes-Tr; AT1G36185.1.
DR   EnsemblGenomes-Tr; AT1G36190.1.
DR   EnsemblGenomes-Tr; AT1G36200.1.
DR   EnsemblGenomes-Tr; AT1G36210.1.
DR   EnsemblGenomes-Tr; AT1G36220.1.
DR   EnsemblGenomes-Tr; AT1G36225.1.
DR   EnsemblGenomes-Tr; AT1G36250.1.
DR   EnsemblGenomes-Tr; AT1G36260.1.
DR   EnsemblGenomes-Tr; AT1G36270.1.
DR   EnsemblGenomes-Tr; AT1G36290.1.
DR   EnsemblGenomes-Tr; AT1G36300.1.
DR   EnsemblGenomes-Tr; AT1G36305.1.
DR   EnsemblGenomes-Tr; AT1G36330.1.
DR   EnsemblGenomes-Tr; AT1G36350.1.
DR   EnsemblGenomes-Tr; AT1G36360.1.
DR   EnsemblGenomes-Tr; AT1G36395.1.
DR   EnsemblGenomes-Tr; AT1G36400.1.
DR   EnsemblGenomes-Tr; AT1G36403.1.
DR   EnsemblGenomes-Tr; AT1G36406.1.
DR   EnsemblGenomes-Tr; AT1G36420.1.
DR   EnsemblGenomes-Tr; AT1G36430.1.
DR   EnsemblGenomes-Tr; AT1G36440.1.
DR   EnsemblGenomes-Tr; AT1G36441.1.
DR   EnsemblGenomes-Tr; AT1G36445.1.
DR   EnsemblGenomes-Tr; AT1G36450.1.
DR   EnsemblGenomes-Tr; AT1G36460.1.
DR   EnsemblGenomes-Tr; AT1G36470.1.
DR   EnsemblGenomes-Tr; AT1G36480.1.
DR   EnsemblGenomes-Tr; AT1G36485.1.
DR   EnsemblGenomes-Tr; AT1G36490.1.
DR   EnsemblGenomes-Tr; AT1G36495.1.
DR   EnsemblGenomes-Tr; AT1G36500.1.
DR   EnsemblGenomes-Tr; AT1G36520.1.
DR   EnsemblGenomes-Tr; AT1G36530.1.
DR   EnsemblGenomes-Tr; AT1G36540.1.
DR   EnsemblGenomes-Tr; AT1G36550.1.
DR   EnsemblGenomes-Tr; AT1G36560.1.
DR   EnsemblGenomes-Tr; AT1G36570.1.
DR   EnsemblGenomes-Tr; AT1G36590.1.
DR   EnsemblGenomes-Tr; AT1G36595.1.
DR   EnsemblGenomes-Tr; AT1G36600.1.
DR   EnsemblGenomes-Tr; AT1G36605.1.
DR   EnsemblGenomes-Tr; AT1G36610.1.
DR   EnsemblGenomes-Tr; AT1G36620.1.
DR   EnsemblGenomes-Tr; AT1G36630.1.
DR   EnsemblGenomes-Tr; AT1G36650.1.
DR   EnsemblGenomes-Tr; AT1G36660.1.
DR   EnsemblGenomes-Tr; AT1G36670.1.
DR   EnsemblGenomes-Tr; AT1G36680.1.
DR   EnsemblGenomes-Tr; AT1G36690.1.
DR   EnsemblGenomes-Tr; AT1G36700.1.
DR   EnsemblGenomes-Tr; AT1G36710.1.
DR   EnsemblGenomes-Tr; AT1G36720.1.
DR   EnsemblGenomes-Tr; AT1G36740.1.
DR   EnsemblGenomes-Tr; AT1G36750.1.
DR   EnsemblGenomes-Tr; AT1G36763.1.
DR   EnsemblGenomes-Tr; AT1G36770.1.
DR   EnsemblGenomes-Tr; AT1G36775.1.
DR   EnsemblGenomes-Tr; AT1G36790.1.
DR   EnsemblGenomes-Tr; AT1G36795.1.
DR   EnsemblGenomes-Tr; AT1G36800.1.
DR   EnsemblGenomes-Tr; AT1G36810.1.
DR   EnsemblGenomes-Tr; AT1G36830.1.
DR   EnsemblGenomes-Tr; AT1G36840.1.
DR   EnsemblGenomes-Tr; AT1G36850.1.
DR   EnsemblGenomes-Tr; AT1G36880.1.
DR   EnsemblGenomes-Tr; AT1G36890.1.
DR   EnsemblGenomes-Tr; AT1G36910.1.
DR   EnsemblGenomes-Tr; AT1G36915.1.
DR   EnsemblGenomes-Tr; AT1G36927.1.
DR   EnsemblGenomes-Tr; AT1G36933.1.
DR   EnsemblGenomes-Tr; AT1G36936.1.
DR   EnsemblGenomes-Tr; AT1G36975.1.
DR   EnsemblGenomes-Tr; AT1G36992.1.
DR   EnsemblGenomes-Tr; AT1G37012.1.
DR   EnsemblGenomes-Tr; AT1G37015.1.
DR   EnsemblGenomes-Tr; AT1G37030.1.
DR   EnsemblGenomes-Tr; AT1G37035.1.
DR   EnsemblGenomes-Tr; AT1G37036.1.
DR   EnsemblGenomes-Tr; AT1G37037.1.
DR   EnsemblGenomes-Tr; AT1G37038.1.
DR   EnsemblGenomes-Tr; AT1G37040.1.
DR   EnsemblGenomes-Tr; AT1G37045.1.
DR   EnsemblGenomes-Tr; AT1G37050.1.
DR   EnsemblGenomes-Tr; AT1G37057.1.
DR   EnsemblGenomes-Tr; AT1G37060.1.
DR   EnsemblGenomes-Tr; AT1G37063.1.
DR   EnsemblGenomes-Tr; AT1G37070.1.
DR   EnsemblGenomes-Tr; AT1G37080.1.
DR   EnsemblGenomes-Tr; AT1G37090.1.
DR   EnsemblGenomes-Tr; AT1G37095.1.
DR   EnsemblGenomes-Tr; AT1G37100.1.
DR   EnsemblGenomes-Tr; AT1G37110.1.
DR   EnsemblGenomes-Tr; AT1G37120.1.
DR   EnsemblGenomes-Tr; AT1G37160.1.
DR   EnsemblGenomes-Tr; AT1G37170.1.
DR   EnsemblGenomes-Tr; AT1G37180.1.
DR   EnsemblGenomes-Tr; AT1G37190.1.
DR   EnsemblGenomes-Tr; AT1G37200.1.
DR   EnsemblGenomes-Tr; AT1G37210.1.
DR   EnsemblGenomes-Tr; AT1G37275.1.
DR   EnsemblGenomes-Tr; AT1G37340.1.
DR   EnsemblGenomes-Tr; AT1G37405.1.
DR   EnsemblGenomes-Tr; AT1G37471.1.
DR   EnsemblGenomes-Tr; AT1G37537.1.
DR   EnsemblGenomes-Tr; AT1G37603.1.
DR   EnsemblGenomes-Tr; AT1G37669.1.
DR   EnsemblGenomes-Tr; AT1G37735.1.
DR   EnsemblGenomes-Tr; AT1G37801.1.
DR   EnsemblGenomes-Tr; AT1G37867.1.
DR   EnsemblGenomes-Tr; AT1G37933.1.
DR   EnsemblGenomes-Tr; AT1G37999.1.
DR   EnsemblGenomes-Tr; AT1G38140.1.
DR   EnsemblGenomes-Tr; AT1G38149.1.
DR   EnsemblGenomes-Tr; AT1G38158.1.
DR   EnsemblGenomes-Tr; AT1G38167.1.
DR   EnsemblGenomes-Tr; AT1G38176.1.
DR   EnsemblGenomes-Tr; AT1G38185.1.
DR   EnsemblGenomes-Tr; AT1G38194.1.
DR   EnsemblGenomes-Tr; AT1G38203.1.
DR   EnsemblGenomes-Tr; AT1G38212.1.
DR   EnsemblGenomes-Tr; AT1G38221.1.
DR   EnsemblGenomes-Tr; AT1G38230.1.
DR   EnsemblGenomes-Tr; AT1G38240.1.
DR   EnsemblGenomes-Tr; AT1G38250.1.
DR   EnsemblGenomes-Tr; AT1G38260.1.
DR   EnsemblGenomes-Tr; AT1G38270.1.
DR   EnsemblGenomes-Tr; AT1G38280.1.
DR   EnsemblGenomes-Tr; AT1G38290.1.
DR   EnsemblGenomes-Tr; AT1G38300.1.
DR   EnsemblGenomes-Tr; AT1G38310.1.
DR   EnsemblGenomes-Tr; AT1G38320.1.
DR   EnsemblGenomes-Tr; AT1G38330.1.
DR   EnsemblGenomes-Tr; AT1G38340.1.
DR   EnsemblGenomes-Tr; AT1G38350.1.
DR   EnsemblGenomes-Tr; AT1G38360.1.
DR   EnsemblGenomes-Tr; AT1G38380.1.
DR   EnsemblGenomes-Tr; AT1G38390.1.
DR   EnsemblGenomes-Tr; AT1G38400.1.
DR   EnsemblGenomes-Tr; AT1G38410.1.
DR   EnsemblGenomes-Tr; AT1G38416.1.
DR   EnsemblGenomes-Tr; AT1G38423.1.
DR   EnsemblGenomes-Tr; AT1G38430.1.
DR   EnsemblGenomes-Tr; AT1G38440.1.
DR   EnsemblGenomes-Tr; AT1G38450.1.
DR   EnsemblGenomes-Tr; AT1G38460.1.
DR   EnsemblGenomes-Tr; AT1G38550.1.
DR   EnsemblGenomes-Tr; AT1G38710.1.
DR   EnsemblGenomes-Tr; AT1G38870.1.
DR   EnsemblGenomes-Tr; AT1G39030.1.
DR   EnsemblGenomes-Tr; AT1G39110.1.
DR   EnsemblGenomes-Tr; AT1G39190.1.
DR   EnsemblGenomes-Tr; AT1G39270.1.
DR   EnsemblGenomes-Tr; AT1G39350.1.
DR   EnsemblGenomes-Tr; AT1G39430.1.
DR   EnsemblGenomes-Tr; AT1G39510.1.
DR   EnsemblGenomes-Tr; AT1G39511.1.
DR   EnsemblGenomes-Tr; AT1G39513.1.
DR   EnsemblGenomes-Tr; AT1G39515.1.
DR   EnsemblGenomes-Tr; AT1G39590.1.
DR   EnsemblGenomes-Tr; AT1G39670.1.
DR   EnsemblGenomes-Tr; AT1G39750.1.
DR   EnsemblGenomes-Tr; AT1G39830.1.
DR   EnsemblGenomes-Tr; AT1G39910.1.
DR   EnsemblGenomes-Tr; AT1G39990.1.
DR   EnsemblGenomes-Tr; AT1G40069.1.
DR   EnsemblGenomes-Tr; AT1G40070.1.
DR   EnsemblGenomes-Tr; AT1G40071.1.
DR   EnsemblGenomes-Tr; AT1G40072.1.
DR   EnsemblGenomes-Tr; AT1G40073.1.
DR   EnsemblGenomes-Tr; AT1G40074.1.
DR   EnsemblGenomes-Tr; AT1G40075.1.
DR   EnsemblGenomes-Tr; AT1G40076.1.
DR   EnsemblGenomes-Tr; AT1G40077.1.
DR   EnsemblGenomes-Tr; AT1G40078.1.
DR   EnsemblGenomes-Tr; AT1G40079.1.
DR   EnsemblGenomes-Tr; AT1G40080.1.
DR   EnsemblGenomes-Tr; AT1G40081.1.
DR   EnsemblGenomes-Tr; AT1G40084.1.
DR   EnsemblGenomes-Tr; AT1G40085.1.
DR   EnsemblGenomes-Tr; AT1G40089.1.
DR   EnsemblGenomes-Tr; AT1G40091.1.
DR   EnsemblGenomes-Tr; AT1G40093.1.
DR   EnsemblGenomes-Tr; AT1G40095.1.
DR   EnsemblGenomes-Tr; AT1G40097.1.
DR   EnsemblGenomes-Tr; AT1G40099.1.
DR   EnsemblGenomes-Tr; AT1G40100.1.
DR   EnsemblGenomes-Tr; AT1G40101.1.
DR   EnsemblGenomes-Tr; AT1G40103.1.
DR   EnsemblGenomes-Tr; AT1G40105.1.
DR   EnsemblGenomes-Tr; AT1G40106.1.
DR   EnsemblGenomes-Tr; AT1G40107.1.
DR   EnsemblGenomes-Tr; AT1G40109.1.
DR   EnsemblGenomes-Tr; AT1G40112.1.
DR   EnsemblGenomes-Tr; AT1G40113.1.
DR   EnsemblGenomes-Tr; AT1G40115.1.
DR   EnsemblGenomes-Tr; AT1G40117.1.
DR   EnsemblGenomes-Tr; AT1G40118.1.
DR   EnsemblGenomes-Tr; AT1G40119.1.
DR   EnsemblGenomes-Tr; AT1G40121.1.
DR   EnsemblGenomes-Tr; AT1G40123.1.
DR   EnsemblGenomes-Tr; AT1G40124.1.
DR   EnsemblGenomes-Tr; AT1G40125.1.
DR   EnsemblGenomes-Tr; AT1G40127.1.
DR   EnsemblGenomes-Tr; AT1G40130.1.
DR   EnsemblGenomes-Tr; AT1G40131.1.
DR   EnsemblGenomes-Tr; AT1G40133.1.
DR   EnsemblGenomes-Tr; AT1G40135.1.
DR   EnsemblGenomes-Tr; AT1G40136.1.
DR   EnsemblGenomes-Tr; AT1G40137.1.
DR   EnsemblGenomes-Tr; AT1G40139.1.
DR   EnsemblGenomes-Tr; AT1G40141.1.
DR   EnsemblGenomes-Tr; AT1G40143.1.
DR   EnsemblGenomes-Tr; AT1G40150.1.
DR   EnsemblGenomes-Tr; AT1G40230.1.
DR   EnsemblGenomes-Tr; AT1G40310.1.
DR   EnsemblGenomes-Tr; AT1G40470.1.
DR   EnsemblGenomes-Tr; AT1G40630.1.
DR   EnsemblGenomes-Tr; AT1G41115.1.
DR   EnsemblGenomes-Tr; AT1G41600.1.
DR   EnsemblGenomes-Tr; AT1G41630.1.
DR   EnsemblGenomes-Tr; AT1G41650.1.
DR   EnsemblGenomes-Tr; AT1G41660.1.
DR   EnsemblGenomes-Tr; AT1G41680.1.
DR   EnsemblGenomes-Tr; AT1G41690.1.
DR   EnsemblGenomes-Tr; AT1G41700.1.
DR   EnsemblGenomes-Tr; AT1G41710.1.
DR   EnsemblGenomes-Tr; AT1G41720.1.
DR   EnsemblGenomes-Tr; AT1G41723.1.
DR   EnsemblGenomes-Tr; AT1G41726.1.
DR   EnsemblGenomes-Tr; AT1G41730.1.
DR   EnsemblGenomes-Tr; AT1G41740.1.
DR   EnsemblGenomes-Tr; AT1G41743.1.
DR   EnsemblGenomes-Tr; AT1G41746.1.
DR   EnsemblGenomes-Tr; AT1G41750.1.
DR   EnsemblGenomes-Tr; AT1G41755.1.
DR   EnsemblGenomes-Tr; AT1G41760.1.
DR   EnsemblGenomes-Tr; AT1G41770.1.
DR   EnsemblGenomes-Tr; AT1G41775.1.
DR   EnsemblGenomes-Tr; AT1G41790.1.
DR   EnsemblGenomes-Tr; AT1G41795.1.
DR   EnsemblGenomes-Tr; AT1G41797.1.
DR   EnsemblGenomes-Tr; AT1G41798.1.
DR   EnsemblGenomes-Tr; AT1G41803.1.
DR   EnsemblGenomes-Tr; AT1G41810.1.
DR   EnsemblGenomes-Tr; AT1G41825.1.
DR   EnsemblGenomes-Tr; AT1G41827.1.
DR   EnsemblGenomes-Tr; AT1G41835.1.
DR   EnsemblGenomes-Tr; AT1G41840.1.
DR   EnsemblGenomes-Tr; AT1G41850.1.
DR   EnsemblGenomes-Tr; AT1G41855.1.
DR   EnsemblGenomes-Tr; AT1G41860.1.
DR   EnsemblGenomes-Tr; AT1G41870.1.
DR   EnsemblGenomes-Tr; AT1G41890.1.
DR   EnsemblGenomes-Tr; AT1G41893.1.
DR   EnsemblGenomes-Tr; AT1G41896.1.
DR   EnsemblGenomes-Tr; AT1G41900.1.
DR   EnsemblGenomes-Tr; AT1G41910.1.
DR   EnsemblGenomes-Tr; AT1G41930.1.
DR   EnsemblGenomes-Tr; AT1G42003.1.
DR   EnsemblGenomes-Tr; AT1G42040.1.
DR   EnsemblGenomes-Tr; AT1G42045.1.
DR   EnsemblGenomes-Tr; AT1G42050.1.
DR   EnsemblGenomes-Tr; AT1G42060.1.
DR   EnsemblGenomes-Tr; AT1G42070.1.
DR   EnsemblGenomes-Tr; AT1G42090.1.
DR   EnsemblGenomes-Tr; AT1G42100.1.
DR   EnsemblGenomes-Tr; AT1G42110.1.
DR   EnsemblGenomes-Tr; AT1G42120.1.
DR   EnsemblGenomes-Tr; AT1G42130.1.
DR   EnsemblGenomes-Tr; AT1G42140.1.
DR   EnsemblGenomes-Tr; AT1G42150.1.
DR   EnsemblGenomes-Tr; AT1G42160.1.
DR   EnsemblGenomes-Tr; AT1G42170.1.
DR   EnsemblGenomes-Tr; AT1G42180.1.
DR   EnsemblGenomes-Tr; AT1G42200.1.
DR   EnsemblGenomes-Tr; AT1G42210.1.
DR   EnsemblGenomes-Tr; AT1G42220.1.
DR   EnsemblGenomes-Tr; AT1G42230.1.
DR   EnsemblGenomes-Tr; AT1G42240.1.
DR   EnsemblGenomes-Tr; AT1G42250.1.
DR   EnsemblGenomes-Tr; AT1G42260.1.
DR   EnsemblGenomes-Tr; AT1G42270.1.
DR   EnsemblGenomes-Tr; AT1G42280.1.
DR   EnsemblGenomes-Tr; AT1G42290.1.
DR   EnsemblGenomes-Tr; AT1G42300.1.
DR   EnsemblGenomes-Tr; AT1G42310.1.
DR   EnsemblGenomes-Tr; AT1G42320.1.
DR   EnsemblGenomes-Tr; AT1G42350.1.
DR   EnsemblGenomes-Tr; AT1G42360.1.
DR   EnsemblGenomes-Tr; AT1G42365.1.
DR   EnsemblGenomes-Tr; AT1G42367.1.
DR   EnsemblGenomes-Tr; AT1G42370.1.
DR   EnsemblGenomes-Tr; AT1G42375.1.
DR   EnsemblGenomes-Tr; AT1G42377.1.
DR   EnsemblGenomes-Tr; AT1G42380.1.
DR   EnsemblGenomes-Tr; AT1G42385.1.
DR   EnsemblGenomes-Tr; AT1G42390.1.
DR   EnsemblGenomes-Tr; AT1G42393.1.
DR   EnsemblGenomes-Tr; AT1G42396.1.
DR   EnsemblGenomes-Tr; AT1G42400.1.
DR   EnsemblGenomes-Tr; AT1G42410.1.
DR   EnsemblGenomes-Tr; AT1G42420.1.
DR   EnsemblGenomes-Tr; AT1G42450.1.
DR   EnsemblGenomes-Tr; AT1G42460.1.
DR   EnsemblGenomes-Tr; AT1G42490.1.
DR   EnsemblGenomes-Tr; AT1G42500.1.
DR   EnsemblGenomes-Tr; AT1G42510.1.
DR   EnsemblGenomes-Tr; AT1G42515.1.
DR   EnsemblGenomes-Tr; AT1G42520.1.
DR   EnsemblGenomes-Tr; AT1G42530.1.
DR   EnsemblGenomes-Tr; AT1G42570.1.
DR   EnsemblGenomes-Tr; AT1G42580.1.
DR   EnsemblGenomes-Tr; AT1G42590.1.
DR   EnsemblGenomes-Tr; AT1G42595.1.
DR   EnsemblGenomes-Tr; AT1G42600.1.
DR   EnsemblGenomes-Tr; AT1G42602.1.
DR   EnsemblGenomes-Tr; AT1G42605.1.
DR   EnsemblGenomes-Tr; AT1G42610.1.
DR   EnsemblGenomes-Tr; AT1G42620.1.
DR   EnsemblGenomes-Tr; AT1G42630.1.
DR   EnsemblGenomes-Tr; AT1G42635.1.
DR   EnsemblGenomes-Tr; AT1G42650.1.
DR   EnsemblGenomes-Tr; AT1G42655.1.
DR   EnsemblGenomes-Tr; AT1G42690.1.
DR   EnsemblGenomes-Tr; AT1G42695.1.
DR   EnsemblGenomes-Tr; AT1G42697.1.
DR   EnsemblGenomes-Tr; AT1G42698.1.
DR   EnsemblGenomes-Tr; AT1G42703.1.
DR   EnsemblGenomes-Tr; AT1G42705.1.
DR   EnsemblGenomes-Tr; AT1G42718.1.
DR   EnsemblGenomes-Tr; AT1G42727.1.
DR   EnsemblGenomes-Tr; AT1G42736.1.
DR   EnsemblGenomes-Tr; AT1G42740.1.
DR   EnsemblGenomes-Tr; AT1G42745.1.
DR   EnsemblGenomes-Tr; AT1G42780.1.
DR   EnsemblGenomes-Tr; AT1G42816.1.
DR   EnsemblGenomes-Tr; AT1G42852.1.
DR   EnsemblGenomes-Tr; AT1G42888.1.
DR   EnsemblGenomes-Tr; AT1G42924.1.
DR   EnsemblGenomes-Tr; AT1G43030.1.
DR   EnsemblGenomes-Tr; AT1G43050.1.
DR   EnsemblGenomes-Tr; AT1G43060.1.
DR   EnsemblGenomes-Tr; AT1G43070.1.
DR   EnsemblGenomes-Tr; AT1G43110.1.
DR   EnsemblGenomes-Tr; AT1G43120.1.
DR   EnsemblGenomes-Tr; AT1G43150.1.
DR   EnsemblGenomes-Tr; AT1G43180.1.
DR   EnsemblGenomes-Tr; AT1G43195.1.
DR   EnsemblGenomes-Tr; AT1G43200.1.
DR   EnsemblGenomes-Tr; AT1G43205.1.
DR   EnsemblGenomes-Tr; AT1G43210.1.
DR   EnsemblGenomes-Tr; AT1G43220.2.
DR   EnsemblGenomes-Tr; AT1G43230.1.
DR   EnsemblGenomes-Tr; AT1G43240.1.
DR   EnsemblGenomes-Tr; AT1G43250.1.
DR   EnsemblGenomes-Tr; AT1G43270.1.
DR   EnsemblGenomes-Tr; AT1G43280.1.
DR   EnsemblGenomes-Tr; AT1G43290.1.
DR   EnsemblGenomes-Tr; AT1G43300.1.
DR   EnsemblGenomes-Tr; AT1G43387.1.
DR   EnsemblGenomes-Tr; AT1G43444.1.
DR   EnsemblGenomes-Tr; AT1G43502.1.
DR   EnsemblGenomes-Tr; AT1G43570.1.
DR   EnsemblGenomes-Tr; AT1G43575.1.
DR   EnsemblGenomes-Tr; AT1G43590.1.
DR   EnsemblGenomes-Tr; AT1G43660.1.
DR   EnsemblGenomes-Tr; AT1G43675.1.
DR   EnsemblGenomes-Tr; AT1G43715.1.
DR   EnsemblGenomes-Tr; AT1G43723.1.
DR   EnsemblGenomes-Tr; AT1G43724.1.
DR   EnsemblGenomes-Tr; AT1G43725.1.
DR   EnsemblGenomes-Tr; AT1G43740.1.
DR   EnsemblGenomes-Tr; AT1G43745.1.
DR   EnsemblGenomes-Tr; AT1G43750.1.
DR   EnsemblGenomes-Tr; AT1G43755.1.
DR   EnsemblGenomes-Tr; AT1G43763.1.
DR   EnsemblGenomes-Tr; AT1G43765.1.
DR   EnsemblGenomes-Tr; AT1G43766.1.
DR   EnsemblGenomes-Tr; AT1G43775.1.
DR   EnsemblGenomes-Tr; AT1G43777.1.
DR   EnsemblGenomes-Tr; AT1G43781.1.
DR   EnsemblGenomes-Tr; AT1G43785.1.
DR   EnsemblGenomes-Tr; AT1G43820.1.
DR   EnsemblGenomes-Tr; AT1G43830.1.
DR   EnsemblGenomes-Tr; AT1G43835.1.
DR   EnsemblGenomes-Tr; AT1G43840.1.
DR   EnsemblGenomes-Tr; AT1G43845.1.
DR   EnsemblGenomes-Tr; AT1G43870.1.
DR   EnsemblGenomes-Tr; AT1G43880.1.
DR   EnsemblGenomes-Tr; AT1G43883.1.
DR   EnsemblGenomes-Tr; AT1G43886.1.
DR   EnsemblGenomes-Tr; AT1G43895.1.
DR   EnsemblGenomes-Tr; AT1G43897.1.
DR   EnsemblGenomes-Tr; AT1G43920.1.
DR   EnsemblGenomes-Tr; AT1G43930.1.
DR   EnsemblGenomes-Tr; AT1G43940.1.
DR   EnsemblGenomes-Tr; AT1G43960.1.
DR   EnsemblGenomes-Tr; AT1G43990.1.
DR   EnsemblGenomes-Tr; AT1G43995.1.
DR   EnsemblGenomes-Tr; AT1G43997.1.
DR   EnsemblGenomes-Tr; AT1G44040.1.
DR   EnsemblGenomes-Tr; AT1G44045.1.
DR   EnsemblGenomes-Tr; AT1G44060.1.
DR   EnsemblGenomes-Tr; AT1G44070.1.
DR   EnsemblGenomes-Tr; AT1G44075.1.
DR   EnsemblGenomes-Tr; AT1G44125.1.
DR   EnsemblGenomes-Tr; AT1G44140.1.
DR   EnsemblGenomes-Tr; AT1G44150.1.
DR   EnsemblGenomes-Tr; AT1G44286.1.
DR   EnsemblGenomes-Tr; AT1G44382.1.
DR   EnsemblGenomes-Tr; AT1G44446.2.
DR   EnsemblGenomes-Tr; AT1G44446.3.
DR   EnsemblGenomes-Tr; AT1G44510.1.
DR   EnsemblGenomes-Tr; AT1G44641.1.
DR   EnsemblGenomes-Tr; AT1G44707.1.
DR   EnsemblGenomes-Tr; AT1G44750.2.
DR   EnsemblGenomes-Tr; AT1G44750.3.
DR   EnsemblGenomes-Tr; AT1G44840.1.
DR   EnsemblGenomes-Tr; AT1G44850.1.
DR   EnsemblGenomes-Tr; AT1G44860.1.
DR   EnsemblGenomes-Tr; AT1G44870.1.
DR   EnsemblGenomes-Tr; AT1G44875.1.
DR   EnsemblGenomes-Tr; AT1G44880.1.
DR   EnsemblGenomes-Tr; AT1G44910.2.
DR   EnsemblGenomes-Tr; AT1G44935.1.
DR   EnsemblGenomes-Tr; AT1G45020.1.
DR   EnsemblGenomes-Tr; AT1G45030.1.
DR   EnsemblGenomes-Tr; AT1G45035.1.
DR   EnsemblGenomes-Tr; AT1G45040.1.
DR   EnsemblGenomes-Tr; AT1G45070.1.
DR   EnsemblGenomes-Tr; AT1G45080.1.
DR   EnsemblGenomes-Tr; AT1G45090.1.
DR   EnsemblGenomes-Tr; AT1G45120.1.
DR   EnsemblGenomes-Tr; AT1G45140.1.
DR   EnsemblGenomes-Tr; AT1G45170.2.
DR   EnsemblGenomes-Tr; AT1G45191.1.
DR   EnsemblGenomes-Tr; AT1G45211.1.
DR   EnsemblGenomes-Tr; AT1G45225.1.
DR   EnsemblGenomes-Tr; AT1G45227.1.
DR   EnsemblGenomes-Tr; AT1G45234.1.
DR   EnsemblGenomes-Tr; AT1G45236.1.
DR   EnsemblGenomes-Tr; AT1G45238.1.
DR   EnsemblGenomes-Tr; AT1G45240.1.
DR   EnsemblGenomes-Tr; AT1G45242.1.
DR   EnsemblGenomes-Tr; AT1G45244.1.
DR   EnsemblGenomes-Tr; AT1G45246.1.
DR   EnsemblGenomes-Tr; AT1G45256.2.
DR   EnsemblGenomes-Tr; AT1G45760.1.
DR   EnsemblGenomes-Tr; AT1G45832.1.
DR   EnsemblGenomes-Tr; AT1G45904.1.
DR   EnsemblGenomes-Tr; AT1G46048.1.
DR   EnsemblGenomes-Tr; AT1G46120.1.
DR   EnsemblGenomes-Tr; AT1G46192.1.
DR   EnsemblGenomes-Tr; AT1G46552.1.
DR   EnsemblGenomes-Tr; AT1G46554.1.
DR   EnsemblGenomes-Tr; AT1G46624.1.
DR   EnsemblGenomes-Tr; AT1G47230.1.
DR   EnsemblGenomes-Tr; AT1G47290.1.
DR   EnsemblGenomes-Tr; AT1G47320.1.
DR   EnsemblGenomes-Tr; AT1G47360.1.
DR   EnsemblGenomes-Tr; AT1G47405.1.
DR   EnsemblGenomes-Tr; AT1G47430.1.
DR   EnsemblGenomes-Tr; AT1G47435.1.
DR   EnsemblGenomes-Tr; AT1G47440.1.
DR   EnsemblGenomes-Tr; AT1G47460.1.
DR   EnsemblGenomes-Tr; AT1G47465.1.
DR   EnsemblGenomes-Tr; AT1G47490.2.
DR   EnsemblGenomes-Tr; AT1G47520.1.
DR   EnsemblGenomes-Tr; AT1G47565.1.
DR   EnsemblGenomes-Tr; AT1G47590.1.
DR   EnsemblGenomes-Tr; AT1G47595.1.
DR   EnsemblGenomes-Tr; AT1G47606.1.
DR   EnsemblGenomes-Tr; AT1G47625.1.
DR   EnsemblGenomes-Tr; AT1G47630.1.
DR   EnsemblGenomes-Tr; AT1G47650.1.
DR   EnsemblGenomes-Tr; AT1G47705.1.
DR   EnsemblGenomes-Tr; AT1G47783.1.
DR   EnsemblGenomes-Tr; AT1G47816.1.
DR   EnsemblGenomes-Tr; AT1G47860.1.
DR   EnsemblGenomes-Tr; AT1G47880.1.
DR   EnsemblGenomes-Tr; AT1G47910.1.
DR   EnsemblGenomes-Tr; AT1G47930.1.
DR   EnsemblGenomes-Tr; AT1G47950.1.
DR   EnsemblGenomes-Tr; AT1G48080.1.
DR   EnsemblGenomes-Tr; AT1G48250.1.
DR   EnsemblGenomes-Tr; AT1G48267.1.
DR   EnsemblGenomes-Tr; AT1G48268.1.
DR   EnsemblGenomes-Tr; AT1G48290.1.
DR   EnsemblGenomes-Tr; AT1G48315.1.
DR   EnsemblGenomes-Tr; AT1G48340.1.
DR   EnsemblGenomes-Tr; AT1G48360.1.
DR   EnsemblGenomes-Tr; AT1G48360.3.
DR   EnsemblGenomes-Tr; AT1G48380.2.
DR   EnsemblGenomes-Tr; AT1G48422.1.
DR   EnsemblGenomes-Tr; AT1G48520.2.
DR   EnsemblGenomes-Tr; AT1G48625.1.
DR   EnsemblGenomes-Tr; AT1G48680.1.
DR   EnsemblGenomes-Tr; AT1G48698.1.
DR   EnsemblGenomes-Tr; AT1G48710.1.
DR   EnsemblGenomes-Tr; AT1G48742.1.
DR   EnsemblGenomes-Tr; AT1G48810.1.
DR   EnsemblGenomes-Tr; AT1G48890.1.
DR   EnsemblGenomes-Tr; AT1G49020.1.
DR   EnsemblGenomes-Tr; AT1G49060.1.
DR   EnsemblGenomes-Tr; AT1G49070.1.
DR   EnsemblGenomes-Tr; AT1G49080.1.
DR   EnsemblGenomes-Tr; AT1G49090.1.
DR   EnsemblGenomes-Tr; AT1G49160.1.
DR   EnsemblGenomes-Tr; AT1G49190.1.
DR   EnsemblGenomes-Tr; AT1G49190.2.
DR   EnsemblGenomes-Tr; AT1G49280.1.
DR   EnsemblGenomes-Tr; AT1G49370.1.
DR   EnsemblGenomes-Tr; AT1G49440.1.
DR   EnsemblGenomes-Tr; AT1G49460.1.
DR   EnsemblGenomes-Tr; AT1G49550.1.
DR   EnsemblGenomes-Tr; AT1G49610.1.
DR   EnsemblGenomes-Tr; AT1G49690.1.
DR   EnsemblGenomes-Tr; AT1G49730.2.
DR   EnsemblGenomes-Tr; AT1G49730.3.
DR   EnsemblGenomes-Tr; AT1G49730.4.
DR   EnsemblGenomes-Tr; AT1G49832.1.
DR   EnsemblGenomes-Tr; AT1G49952.1.
DR   EnsemblGenomes-Tr; AT1G50055.1.
DR   EnsemblGenomes-Tr; AT1G50070.1.
DR   EnsemblGenomes-Tr; AT1G50100.1.
DR   EnsemblGenomes-Tr; AT1G50130.1.
DR   EnsemblGenomes-Tr; AT1G50210.1.
DR   EnsemblGenomes-Tr; AT1G50330.1.
DR   EnsemblGenomes-Tr; AT1G50550.1.
DR   EnsemblGenomes-Tr; AT1G50659.1.
DR   EnsemblGenomes-Tr; AT1G50735.1.
DR   EnsemblGenomes-Tr; AT1G50810.1.
DR   EnsemblGenomes-Tr; AT1G50850.1.
DR   EnsemblGenomes-Tr; AT1G50860.1.
DR   EnsemblGenomes-Tr; AT1G51050.1.
DR   EnsemblGenomes-Tr; AT1G51085.1.
DR   EnsemblGenomes-Tr; AT1G51175.1.
DR   EnsemblGenomes-Tr; AT1G51340.1.
DR   EnsemblGenomes-Tr; AT1G51590.2.
DR   EnsemblGenomes-Tr; AT1G51645.1.
DR   EnsemblGenomes-Tr; AT1G51680.2.
DR   EnsemblGenomes-Tr; AT1G51690.2.
DR   EnsemblGenomes-Tr; AT1G51750.1.
DR   EnsemblGenomes-Tr; AT1G51802.1.
DR   EnsemblGenomes-Tr; AT1G51890.2.
DR   EnsemblGenomes-Tr; AT1G52010.1.
DR   EnsemblGenomes-Tr; AT1G52020.1.
DR   EnsemblGenomes-Tr; AT1G52085.1.
DR   EnsemblGenomes-Tr; AT1G52087.1.
DR   EnsemblGenomes-Tr; AT1G52090.1.
DR   EnsemblGenomes-Tr; AT1G52170.1.
DR   EnsemblGenomes-Tr; AT1G52185.1.
DR   EnsemblGenomes-Tr; AT1G52210.1.
DR   EnsemblGenomes-Tr; AT1G52211.1.
DR   EnsemblGenomes-Tr; AT1G52347.1.
DR   EnsemblGenomes-Tr; AT1G52350.1.
DR   EnsemblGenomes-Tr; AT1G52500.1.
DR   EnsemblGenomes-Tr; AT1G52560.2.
DR   EnsemblGenomes-Tr; AT1G52610.1.
DR   EnsemblGenomes-Tr; AT1G52615.1.
DR   EnsemblGenomes-Tr; AT1G52615.2.
DR   EnsemblGenomes-Tr; AT1G52696.1.
DR   EnsemblGenomes-Tr; AT1G52710.2.
DR   EnsemblGenomes-Tr; AT1G52840.1.
DR   EnsemblGenomes-Tr; AT1G52850.1.
DR   EnsemblGenomes-Tr; AT1G52860.1.
DR   EnsemblGenomes-Tr; AT1G52942.1.
DR   EnsemblGenomes-Tr; AT1G52960.1.
DR   EnsemblGenomes-Tr; AT1G53020.1.
DR   EnsemblGenomes-Tr; AT1G53220.1.
DR   EnsemblGenomes-Tr; AT1G53233.1.
DR   EnsemblGenomes-Tr; AT1G53410.1.
DR   EnsemblGenomes-Tr; AT1G53630.1.
DR   EnsemblGenomes-Tr; AT1G53670.2.
DR   EnsemblGenomes-Tr; AT1G53683.1.
DR   EnsemblGenomes-Tr; AT1G53687.1.
DR   EnsemblGenomes-Tr; AT1G53801.1.
DR   EnsemblGenomes-Tr; AT1G53810.1.
DR   EnsemblGenomes-Tr; AT1G53870.2.
DR   EnsemblGenomes-Tr; AT1G53890.2.
DR   EnsemblGenomes-Tr; AT1G54020.1.
DR   EnsemblGenomes-Tr; AT1G54020.3.
DR   EnsemblGenomes-Tr; AT1G54035.1.
DR   EnsemblGenomes-Tr; AT1G54040.1.
DR   EnsemblGenomes-Tr; AT1G54180.2.
DR   EnsemblGenomes-Tr; AT1G54355.1.
DR   EnsemblGenomes-Tr; AT1G54390.1.
DR   EnsemblGenomes-Tr; AT1G54430.1.
DR   EnsemblGenomes-Tr; AT1G54600.1.
DR   EnsemblGenomes-Tr; AT1G54660.1.
DR   EnsemblGenomes-Tr; AT1G54670.1.
DR   EnsemblGenomes-Tr; AT1G54730.1.
DR   EnsemblGenomes-Tr; AT1G54730.3.
DR   EnsemblGenomes-Tr; AT1G54750.1.
DR   EnsemblGenomes-Tr; AT1G54790.1.
DR   EnsemblGenomes-Tr; AT1G54905.1.
DR   EnsemblGenomes-Tr; AT1G54923.1.
DR   EnsemblGenomes-Tr; AT1G54926.1.
DR   EnsemblGenomes-Tr; AT1G54955.1.
DR   EnsemblGenomes-Tr; AT1G54985.1.
DR   EnsemblGenomes-Tr; AT1G55035.1.
DR   EnsemblGenomes-Tr; AT1G55100.1.
DR   EnsemblGenomes-Tr; AT1G55221.1.
DR   EnsemblGenomes-Tr; AT1G55250.2.
DR   EnsemblGenomes-Tr; AT1G55310.2.
DR   EnsemblGenomes-Tr; AT1G55310.3.
DR   EnsemblGenomes-Tr; AT1G55320.2.
DR   EnsemblGenomes-Tr; AT1G55400.1.
DR   EnsemblGenomes-Tr; AT1G55410.1.
DR   EnsemblGenomes-Tr; AT1G55470.1.
DR   EnsemblGenomes-Tr; AT1G55525.1.
DR   EnsemblGenomes-Tr; AT1G55591.1.
DR   EnsemblGenomes-Tr; AT1G55604.1.
DR   EnsemblGenomes-Tr; AT1G55620.1.
DR   EnsemblGenomes-Tr; AT1G55625.1.
DR   EnsemblGenomes-Tr; AT1G55810.2.
DR   EnsemblGenomes-Tr; AT1G55870.2.
DR   EnsemblGenomes-Tr; AT1G55964.1.
DR   EnsemblGenomes-Tr; AT1G56165.1.
DR   EnsemblGenomes-Tr; AT1G56242.1.
DR   EnsemblGenomes-Tr; AT1G56390.1.
DR   EnsemblGenomes-Tr; AT1G56470.1.
DR   EnsemblGenomes-Tr; AT1G56480.1.
DR   EnsemblGenomes-Tr; AT1G56490.1.
DR   EnsemblGenomes-Tr; AT1G56605.1.
DR   EnsemblGenomes-Tr; AT1G56612.1.
DR   EnsemblGenomes-Tr; AT1G56612.2.
DR   EnsemblGenomes-Tr; AT1G56612.3.
DR   EnsemblGenomes-Tr; AT1G56640.1.
DR   EnsemblGenomes-Tr; AT1G56675.1.
DR   EnsemblGenomes-Tr; AT1G56730.1.
DR   EnsemblGenomes-Tr; AT1G56740.1.
DR   EnsemblGenomes-Tr; AT1G56750.1.
DR   EnsemblGenomes-Tr; AT1G56760.1.
DR   EnsemblGenomes-Tr; AT1G56770.1.
DR   EnsemblGenomes-Tr; AT1G56780.1.
DR   EnsemblGenomes-Tr; AT1G56790.1.
DR   EnsemblGenomes-Tr; AT1G56800.1.
DR   EnsemblGenomes-Tr; AT1G56810.1.
DR   EnsemblGenomes-Tr; AT1G56820.1.
DR   EnsemblGenomes-Tr; AT1G56830.1.
DR   EnsemblGenomes-Tr; AT1G56840.1.
DR   EnsemblGenomes-Tr; AT1G56850.1.
DR   EnsemblGenomes-Tr; AT1G56860.1.
DR   EnsemblGenomes-Tr; AT1G56870.1.
DR   EnsemblGenomes-Tr; AT1G56880.1.
DR   EnsemblGenomes-Tr; AT1G56890.1.
DR   EnsemblGenomes-Tr; AT1G56900.1.
DR   EnsemblGenomes-Tr; AT1G56910.1.
DR   EnsemblGenomes-Tr; AT1G56920.1.
DR   EnsemblGenomes-Tr; AT1G56930.1.
DR   EnsemblGenomes-Tr; AT1G56940.1.
DR   EnsemblGenomes-Tr; AT1G56950.1.
DR   EnsemblGenomes-Tr; AT1G56960.1.
DR   EnsemblGenomes-Tr; AT1G56970.1.
DR   EnsemblGenomes-Tr; AT1G56980.1.
DR   EnsemblGenomes-Tr; AT1G56990.1.
DR   EnsemblGenomes-Tr; AT1G57000.1.
DR   EnsemblGenomes-Tr; AT1G57010.1.
DR   EnsemblGenomes-Tr; AT1G57020.1.
DR   EnsemblGenomes-Tr; AT1G57030.1.
DR   EnsemblGenomes-Tr; AT1G57040.1.
DR   EnsemblGenomes-Tr; AT1G57050.1.
DR   EnsemblGenomes-Tr; AT1G57060.1.
DR   EnsemblGenomes-Tr; AT1G57070.1.
DR   EnsemblGenomes-Tr; AT1G57080.1.
DR   EnsemblGenomes-Tr; AT1G57090.1.
DR   EnsemblGenomes-Tr; AT1G57100.1.
DR   EnsemblGenomes-Tr; AT1G57110.1.
DR   EnsemblGenomes-Tr; AT1G57120.1.
DR   EnsemblGenomes-Tr; AT1G57130.1.
DR   EnsemblGenomes-Tr; AT1G57140.1.
DR   EnsemblGenomes-Tr; AT1G57150.1.
DR   EnsemblGenomes-Tr; AT1G57160.1.
DR   EnsemblGenomes-Tr; AT1G57170.1.
DR   EnsemblGenomes-Tr; AT1G57180.1.
DR   EnsemblGenomes-Tr; AT1G57190.1.
DR   EnsemblGenomes-Tr; AT1G57200.1.
DR   EnsemblGenomes-Tr; AT1G57210.1.
DR   EnsemblGenomes-Tr; AT1G57220.1.
DR   EnsemblGenomes-Tr; AT1G57230.1.
DR   EnsemblGenomes-Tr; AT1G57240.1.
DR   EnsemblGenomes-Tr; AT1G57250.1.
DR   EnsemblGenomes-Tr; AT1G57260.1.
DR   EnsemblGenomes-Tr; AT1G57270.1.
DR   EnsemblGenomes-Tr; AT1G57280.1.
DR   EnsemblGenomes-Tr; AT1G57290.1.
DR   EnsemblGenomes-Tr; AT1G57300.1.
DR   EnsemblGenomes-Tr; AT1G57310.1.
DR   EnsemblGenomes-Tr; AT1G57320.1.
DR   EnsemblGenomes-Tr; AT1G57330.1.
DR   EnsemblGenomes-Tr; AT1G57340.1.
DR   EnsemblGenomes-Tr; AT1G57350.1.
DR   EnsemblGenomes-Tr; AT1G57360.1.
DR   EnsemblGenomes-Tr; AT1G57370.1.
DR   EnsemblGenomes-Tr; AT1G57380.1.
DR   EnsemblGenomes-Tr; AT1G57390.1.
DR   EnsemblGenomes-Tr; AT1G57400.1.
DR   EnsemblGenomes-Tr; AT1G57410.1.
DR   EnsemblGenomes-Tr; AT1G57420.1.
DR   EnsemblGenomes-Tr; AT1G57430.1.
DR   EnsemblGenomes-Tr; AT1G57440.1.
DR   EnsemblGenomes-Tr; AT1G57450.1.
DR   EnsemblGenomes-Tr; AT1G57460.1.
DR   EnsemblGenomes-Tr; AT1G57470.1.
DR   EnsemblGenomes-Tr; AT1G57480.1.
DR   EnsemblGenomes-Tr; AT1G57490.1.
DR   EnsemblGenomes-Tr; AT1G57500.1.
DR   EnsemblGenomes-Tr; AT1G57510.1.
DR   EnsemblGenomes-Tr; AT1G57520.1.
DR   EnsemblGenomes-Tr; AT1G57530.1.
DR   EnsemblGenomes-Tr; AT1G57640.1.
DR   EnsemblGenomes-Tr; AT1G57710.1.
DR   EnsemblGenomes-Tr; AT1G57740.1.
DR   EnsemblGenomes-Tr; AT1G57810.1.
DR   EnsemblGenomes-Tr; AT1G57820.2.
DR   EnsemblGenomes-Tr; AT1G57835.1.
DR   EnsemblGenomes-Tr; AT1G57840.1.
DR   EnsemblGenomes-Tr; AT1G57943.2.
DR   EnsemblGenomes-Tr; AT1G58010.1.
DR   EnsemblGenomes-Tr; AT1G58020.1.
DR   EnsemblGenomes-Tr; AT1G58040.1.
DR   EnsemblGenomes-Tr; AT1G58100.2.
DR   EnsemblGenomes-Tr; AT1G58130.1.
DR   EnsemblGenomes-Tr; AT1G58140.1.
DR   EnsemblGenomes-Tr; AT1G58561.1.
DR   EnsemblGenomes-Tr; AT1G58590.1.
DR   EnsemblGenomes-Tr; AT1G58590.2.
DR   EnsemblGenomes-Tr; AT1G58807.2.
DR   EnsemblGenomes-Tr; AT1G58808.1.
DR   EnsemblGenomes-Tr; AT1G58889.1.
DR   EnsemblGenomes-Tr; AT1G59124.1.
DR   EnsemblGenomes-Tr; AT1G59265.1.
DR   EnsemblGenomes-Tr; AT1G59570.1.
DR   EnsemblGenomes-Tr; AT1G59640.1.
DR   EnsemblGenomes-Tr; AT1G59680.1.
DR   EnsemblGenomes-Tr; AT1G59750.2.
DR   EnsemblGenomes-Tr; AT1G59770.1.
DR   EnsemblGenomes-Tr; AT1G59830.2.
DR   EnsemblGenomes-Tr; AT1G59880.1.
DR   EnsemblGenomes-Tr; AT1G60020.1.
DR   EnsemblGenomes-Tr; AT1G60025.1.
DR   EnsemblGenomes-Tr; AT1G60072.1.
DR   EnsemblGenomes-Tr; AT1G60073.1.
DR   EnsemblGenomes-Tr; AT1G60075.1.
DR   EnsemblGenomes-Tr; AT1G60120.1.
DR   EnsemblGenomes-Tr; AT1G60150.1.
DR   EnsemblGenomes-Tr; AT1G60180.1.
DR   EnsemblGenomes-Tr; AT1G60290.1.
DR   EnsemblGenomes-Tr; AT1G60310.1.
DR   EnsemblGenomes-Tr; AT1G60330.1.
DR   EnsemblGenomes-Tr; AT1G60480.1.
DR   EnsemblGenomes-Tr; AT1G60505.1.
DR   EnsemblGenomes-Tr; AT1G60505.2.
DR   EnsemblGenomes-Tr; AT1G60510.1.
DR   EnsemblGenomes-Tr; AT1G60520.1.
DR   EnsemblGenomes-Tr; AT1G60525.1.
DR   EnsemblGenomes-Tr; AT1G60525.2.
DR   EnsemblGenomes-Tr; AT1G60540.1.
DR   EnsemblGenomes-Tr; AT1G60545.1.
DR   EnsemblGenomes-Tr; AT1G60580.1.
DR   EnsemblGenomes-Tr; AT1G60600.1.
DR   EnsemblGenomes-Tr; AT1G60730.2.
DR   EnsemblGenomes-Tr; AT1G60730.3.
DR   EnsemblGenomes-Tr; AT1G60820.1.
DR   EnsemblGenomes-Tr; AT1G60835.1.
DR   EnsemblGenomes-Tr; AT1G60840.1.
DR   EnsemblGenomes-Tr; AT1G60910.1.
DR   EnsemblGenomes-Tr; AT1G61020.1.
DR   EnsemblGenomes-Tr; AT1G61224.1.
DR   EnsemblGenomes-Tr; AT1G61226.1.
DR   EnsemblGenomes-Tr; AT1G61275.1.
DR   EnsemblGenomes-Tr; AT1G61360.2.
DR   EnsemblGenomes-Tr; AT1G61390.2.
DR   EnsemblGenomes-Tr; AT1G61510.1.
DR   EnsemblGenomes-Tr; AT1G61542.1.
DR   EnsemblGenomes-Tr; AT1G61650.1.
DR   EnsemblGenomes-Tr; AT1G61660.2.
DR   EnsemblGenomes-Tr; AT1G61665.1.
DR   EnsemblGenomes-Tr; AT1G61685.1.
DR   EnsemblGenomes-Tr; AT1G61732.1.
DR   EnsemblGenomes-Tr; AT1G61830.1.
DR   EnsemblGenomes-Tr; AT1G61880.1.
DR   EnsemblGenomes-Tr; AT1G61900.2.
DR   EnsemblGenomes-Tr; AT1G61910.1.
DR   EnsemblGenomes-Tr; AT1G61940.1.
DR   EnsemblGenomes-Tr; AT1G62035.1.
DR   EnsemblGenomes-Tr; AT1G62055.1.
DR   EnsemblGenomes-Tr; AT1G62075.1.
DR   EnsemblGenomes-Tr; AT1G62090.1.
DR   EnsemblGenomes-Tr; AT1G62095.1.
DR   EnsemblGenomes-Tr; AT1G62214.1.
DR   EnsemblGenomes-Tr; AT1G62230.1.
DR   EnsemblGenomes-Tr; AT1G62355.1.
DR   EnsemblGenomes-Tr; AT1G62460.1.
DR   EnsemblGenomes-Tr; AT1G62550.1.
DR   EnsemblGenomes-Tr; AT1G62650.1.
DR   EnsemblGenomes-Tr; AT1G62695.1.
DR   EnsemblGenomes-Tr; AT1G62766.1.
DR   EnsemblGenomes-Tr; AT1G62835.1.
DR   EnsemblGenomes-Tr; AT1G62860.1.
DR   EnsemblGenomes-Tr; AT1G62890.1.
DR   EnsemblGenomes-Tr; AT1G63005.1.
DR   EnsemblGenomes-Tr; AT1G63040.1.
DR   EnsemblGenomes-Tr; AT1G63260.2.
DR   EnsemblGenomes-Tr; AT1G63260.3.
DR   EnsemblGenomes-Tr; AT1G63340.1.
DR   EnsemblGenomes-Tr; AT1G63390.1.
DR   EnsemblGenomes-Tr; AT1G63510.1.
DR   EnsemblGenomes-Tr; AT1G63760.1.
DR   EnsemblGenomes-Tr; AT1G63790.1.
DR   EnsemblGenomes-Tr; AT1G63835.1.
DR   EnsemblGenomes-Tr; AT1G63920.1.
DR   EnsemblGenomes-Tr; AT1G63970.2.
DR   EnsemblGenomes-Tr; AT1G64035.1.
DR   EnsemblGenomes-Tr; AT1G64120.1.
DR   EnsemblGenomes-Tr; AT1G64240.1.
DR   EnsemblGenomes-Tr; AT1G64250.1.
DR   EnsemblGenomes-Tr; AT1G64270.1.
DR   EnsemblGenomes-Tr; AT1G64410.1.
DR   EnsemblGenomes-Tr; AT1G64420.1.
DR   EnsemblGenomes-Tr; AT1G64470.1.
DR   EnsemblGenomes-Tr; AT1G64560.1.
DR   EnsemblGenomes-Tr; AT1G64563.1.
DR   EnsemblGenomes-Tr; AT1G64572.1.
DR   EnsemblGenomes-Tr; AT1G64618.1.
DR   EnsemblGenomes-Tr; AT1G64730.1.
DR   EnsemblGenomes-Tr; AT1G64860.2.
DR   EnsemblGenomes-Tr; AT1G65347.1.
DR   EnsemblGenomes-Tr; AT1G65365.1.
DR   EnsemblGenomes-Tr; AT1G65385.1.
DR   EnsemblGenomes-Tr; AT1G65485.1.
DR   EnsemblGenomes-Tr; AT1G65585.1.
DR   EnsemblGenomes-Tr; AT1G65642.1.
DR   EnsemblGenomes-Tr; AT1G65750.1.
DR   EnsemblGenomes-Tr; AT1G65830.1.
DR   EnsemblGenomes-Tr; AT1G65875.1.
DR   EnsemblGenomes-Tr; AT1G65940.1.
DR   EnsemblGenomes-Tr; AT1G66010.1.
DR   EnsemblGenomes-Tr; AT1G66173.1.
DR   EnsemblGenomes-Tr; AT1G66240.2.
DR   EnsemblGenomes-Tr; AT1G66270.2.
DR   EnsemblGenomes-Tr; AT1G66534.1.
DR   EnsemblGenomes-Tr; AT1G66610.2.
DR   EnsemblGenomes-Tr; AT1G66660.1.
DR   EnsemblGenomes-Tr; AT1G66710.1.
DR   EnsemblGenomes-Tr; AT1G66725.1.
DR   EnsemblGenomes-Tr; AT1G66783.1.
DR   EnsemblGenomes-Tr; AT1G66795.1.
DR   EnsemblGenomes-Tr; AT1G66990.1.
DR   EnsemblGenomes-Tr; AT1G67010.1.
DR   EnsemblGenomes-Tr; AT1G67105.1.
DR   EnsemblGenomes-Tr; AT1G67130.1.
DR   EnsemblGenomes-Tr; AT1G67195.1.
DR   EnsemblGenomes-Tr; AT1G67195.2.
DR   EnsemblGenomes-Tr; AT1G67200.1.
DR   EnsemblGenomes-Tr; AT1G67238.1.
DR   EnsemblGenomes-Tr; AT1G67240.1.
DR   EnsemblGenomes-Tr; AT1G67280.2.
DR   EnsemblGenomes-Tr; AT1G67328.1.
DR   EnsemblGenomes-Tr; AT1G67365.1.
DR   EnsemblGenomes-Tr; AT1G67455.1.
DR   EnsemblGenomes-Tr; AT1G67481.1.
DR   EnsemblGenomes-Tr; AT1G67490.2.
DR   EnsemblGenomes-Tr; AT1G67520.1.
DR   EnsemblGenomes-Tr; AT1G67610.1.
DR   EnsemblGenomes-Tr; AT1G67626.1.
DR   EnsemblGenomes-Tr; AT1G67645.1.
DR   EnsemblGenomes-Tr; AT1G67792.1.
DR   EnsemblGenomes-Tr; AT1G68010.2.
DR   EnsemblGenomes-Tr; AT1G68020.1.
DR   EnsemblGenomes-Tr; AT1G68200.2.
DR   EnsemblGenomes-Tr; AT1G68240.2.
DR   EnsemblGenomes-Tr; AT1G68285.1.
DR   EnsemblGenomes-Tr; AT1G68530.2.
DR   EnsemblGenomes-Tr; AT1G68568.1.
DR   EnsemblGenomes-Tr; AT1G68735.1.
DR   EnsemblGenomes-Tr; AT1G68770.1.
DR   EnsemblGenomes-Tr; AT1G68860.1.
DR   EnsemblGenomes-Tr; AT1G68872.1.
DR   EnsemblGenomes-Tr; AT1G68910.2.
DR   EnsemblGenomes-Tr; AT1G68910.3.
DR   EnsemblGenomes-Tr; AT1G68950.1.
DR   EnsemblGenomes-Tr; AT1G68970.1.
DR   EnsemblGenomes-Tr; AT1G69000.1.
DR   EnsemblGenomes-Tr; AT1G69110.1.
DR   EnsemblGenomes-Tr; AT1G69130.1.
DR   EnsemblGenomes-Tr; AT1G69140.1.
DR   EnsemblGenomes-Tr; AT1G69252.1.
DR   EnsemblGenomes-Tr; AT1G69252.2.
DR   EnsemblGenomes-Tr; AT1G69300.1.
DR   EnsemblGenomes-Tr; AT1G69400.2.
DR   EnsemblGenomes-Tr; AT1G69543.1.
DR   EnsemblGenomes-Tr; AT1G69572.1.
DR   EnsemblGenomes-Tr; AT1G69587.1.
DR   EnsemblGenomes-Tr; AT1G69587.2.
DR   EnsemblGenomes-Tr; AT1G69590.1.
DR   EnsemblGenomes-Tr; AT1G69720.2.
DR   EnsemblGenomes-Tr; AT1G69792.1.
DR   EnsemblGenomes-Tr; AT1G69795.1.
DR   EnsemblGenomes-Tr; AT1G69797.1.
DR   EnsemblGenomes-Tr; AT1G69950.1.
DR   EnsemblGenomes-Tr; AT1G69970.2.
DR   EnsemblGenomes-Tr; AT1G69981.1.
DR   EnsemblGenomes-Tr; AT1G70010.1.
DR   EnsemblGenomes-Tr; AT1G70050.1.
DR   EnsemblGenomes-Tr; AT1G70185.1.
DR   EnsemblGenomes-Tr; AT1G70518.1.
DR   EnsemblGenomes-Tr; AT1G70581.1.
DR   EnsemblGenomes-Tr; AT1G70645.1.
DR   EnsemblGenomes-Tr; AT1G70700.2.
DR   EnsemblGenomes-Tr; AT1G70885.1.
DR   EnsemblGenomes-Tr; AT1G71002.1.
DR   EnsemblGenomes-Tr; AT1G71528.1.
DR   EnsemblGenomes-Tr; AT1G71691.1.
DR   EnsemblGenomes-Tr; AT1G71700.1.
DR   EnsemblGenomes-Tr; AT1G71828.1.
DR   EnsemblGenomes-Tr; AT1G72130.2.
DR   EnsemblGenomes-Tr; AT1G72131.1.
DR   EnsemblGenomes-Tr; AT1G72320.2.
DR   EnsemblGenomes-Tr; AT1G72320.3.
DR   EnsemblGenomes-Tr; AT1G72330.2.
DR   EnsemblGenomes-Tr; AT1G72330.3.
DR   EnsemblGenomes-Tr; AT1G72770.2.
DR   EnsemblGenomes-Tr; AT1G72780.1.
DR   EnsemblGenomes-Tr; AT1G72852.1.
DR   EnsemblGenomes-Tr; AT1G72855.1.
DR   EnsemblGenomes-Tr; AT1G72930.2.
DR   EnsemblGenomes-Tr; AT1G72990.2.
DR   EnsemblGenomes-Tr; AT1G73175.1.
DR   EnsemblGenomes-Tr; AT1G73445.1.
DR   EnsemblGenomes-Tr; AT1G73680.2.
DR   EnsemblGenomes-Tr; AT1G73687.1.
DR   EnsemblGenomes-Tr; AT1G73900.1.
DR   EnsemblGenomes-Tr; AT1G74205.1.
DR   EnsemblGenomes-Tr; AT1G74453.1.
DR   EnsemblGenomes-Tr; AT1G74456.1.
DR   EnsemblGenomes-Tr; AT1G74457.1.
DR   EnsemblGenomes-Tr; AT1G74545.1.
DR   EnsemblGenomes-Tr; AT1G74570.1.
DR   EnsemblGenomes-Tr; AT1G74610.1.
DR   EnsemblGenomes-Tr; AT1G74710.2.
DR   EnsemblGenomes-Tr; AT1G75070.1.
DR   EnsemblGenomes-Tr; AT1G75163.1.
DR   EnsemblGenomes-Tr; AT1G75166.1.
DR   EnsemblGenomes-Tr; AT1G75250.1.
DR   EnsemblGenomes-Tr; AT1G75261.1.
DR   EnsemblGenomes-Tr; AT1G75295.1.
DR   EnsemblGenomes-Tr; AT1G75295.2.
DR   EnsemblGenomes-Tr; AT1G75295.3.
DR   EnsemblGenomes-Tr; AT1G75394.1.
DR   EnsemblGenomes-Tr; AT1G75480.1.
DR   EnsemblGenomes-Tr; AT1G75570.1.
DR   EnsemblGenomes-Tr; AT1G75610.1.
DR   EnsemblGenomes-Tr; AT1G75650.1.
DR   EnsemblGenomes-Tr; AT1G75740.1.
DR   EnsemblGenomes-Tr; AT1G75880.2.
DR   EnsemblGenomes-Tr; AT1G75890.2.
DR   EnsemblGenomes-Tr; AT1G75891.1.
DR   EnsemblGenomes-Tr; AT1G75920.2.
DR   EnsemblGenomes-Tr; AT1G75920.3.
DR   EnsemblGenomes-Tr; AT1G75920.4.
DR   EnsemblGenomes-Tr; AT1G75970.1.
DR   EnsemblGenomes-Tr; AT1G76000.1.
DR   EnsemblGenomes-Tr; AT1G76040.1.
DR   EnsemblGenomes-Tr; AT1G76050.1.
DR   EnsemblGenomes-Tr; AT1G76062.1.
DR   EnsemblGenomes-Tr; AT1G76135.1.
DR   EnsemblGenomes-Tr; AT1G76320.2.
DR   EnsemblGenomes-Tr; AT1G76330.1.
DR   EnsemblGenomes-Tr; AT1G76405.1.
DR   EnsemblGenomes-Tr; AT1G76650.2.
DR   EnsemblGenomes-Tr; AT1G76878.1.
DR   EnsemblGenomes-Tr; AT1G76892.1.
DR   EnsemblGenomes-Tr; AT1G76911.1.
DR   EnsemblGenomes-Tr; AT1G76930.1.
DR   EnsemblGenomes-Tr; AT1G76930.2.
DR   EnsemblGenomes-Tr; AT1G77040.1.
DR   EnsemblGenomes-Tr; AT1G77080.3.
DR   EnsemblGenomes-Tr; AT1G77080.5.
DR   EnsemblGenomes-Tr; AT1G77095.1.
DR   EnsemblGenomes-Tr; AT1G77131.1.
DR   EnsemblGenomes-Tr; AT1G77138.1.
DR   EnsemblGenomes-Tr; AT1G77190.1.
DR   EnsemblGenomes-Tr; AT1G77235.1.
DR   EnsemblGenomes-Tr; AT1G77560.1.
DR   EnsemblGenomes-Tr; AT1G77580.1.
DR   EnsemblGenomes-Tr; AT1G77810.2.
DR   EnsemblGenomes-Tr; AT1G77820.1.
DR   EnsemblGenomes-Tr; AT1G77992.1.
DR   EnsemblGenomes-Tr; AT1G78095.1.
DR   EnsemblGenomes-Tr; AT1G78206.1.
DR   EnsemblGenomes-Tr; AT1G78250.1.
DR   EnsemblGenomes-Tr; AT1G78265.1.
DR   EnsemblGenomes-Tr; AT1G78265.2.
DR   EnsemblGenomes-Tr; AT1G78330.1.
DR   EnsemblGenomes-Tr; AT1G78350.1.
DR   EnsemblGenomes-Tr; AT1G78355.1.
DR   EnsemblGenomes-Tr; AT1G78478.1.
DR   EnsemblGenomes-Tr; AT1G78510.2.
DR   EnsemblGenomes-Tr; AT1G78865.1.
DR   EnsemblGenomes-Tr; AT1G78870.1.
DR   EnsemblGenomes-Tr; AT1G78870.3.
DR   EnsemblGenomes-Tr; AT1G79075.1.
DR   EnsemblGenomes-Tr; AT1G79075.2.
DR   EnsemblGenomes-Tr; AT1G79230.3.
DR   EnsemblGenomes-Tr; AT1G79240.1.
DR   EnsemblGenomes-Tr; AT1G79245.1.
DR   EnsemblGenomes-Tr; AT1G79290.1.
DR   EnsemblGenomes-Tr; AT1G79300.1.
DR   EnsemblGenomes-Tr; AT1G79430.1.
DR   EnsemblGenomes-Tr; AT1G79450.2.
DR   EnsemblGenomes-Tr; AT1G79529.1.
DR   EnsemblGenomes-Tr; AT1G79630.2.
DR   EnsemblGenomes-Tr; AT1G79630.3.
DR   EnsemblGenomes-Tr; AT1G79650.2.
DR   EnsemblGenomes-Tr; AT1G79820.3.
DR   EnsemblGenomes-Tr; AT1G79870.2.
DR   EnsemblGenomes-Tr; AT1G79930.2.
DR   EnsemblGenomes-Tr; AT1G79980.1.
DR   EnsemblGenomes-Tr; AT1G80020.1.
DR   EnsemblGenomes-Tr; AT1G80250.1.
DR   EnsemblGenomes-Tr; AT1G80325.1.
DR   EnsemblGenomes-Tr; AT1G80325.2.
DR   EnsemblGenomes-Tr; AT1G80380.1.
DR   EnsemblGenomes-Tr; AT1G80430.1.
DR   EnsemblGenomes-Tr; AT1G80490.1.
DR   EnsemblGenomes-Tr; AT1G80570.1.
DR   EnsemblGenomes-Tr; AT1G80570.3.
DR   EnsemblGenomes-Tr; AT1G80640.2.
DR   EnsemblGenomes-Tr; AT1G80800.1.
DR   EnsemblGenomes-Tr; AT1G81001.1.
DR   EnsemblGenomes-Tr; AT1G81020.1.
DR   EuropePMC; PMC4768703; 26925343.
DR   EuropePMC; PMC6220446; 30400807.
DR   GOA; F4HQD4.
DR   GOA; F4HX15.
DR   GOA; F4HX80.
DR   GOA; F4I443.
DR   GOA; F4IA73.
DR   GOA; F4IAR2.
DR   GOA; F4IC29.
DR   GOA; F4IDU9.
DR   GOA; O80735.
DR   GOA; P0C2C9.
DR   GOA; P0C2F6.
DR   GOA; P0C8K8.
DR   GOA; P0CAY3.
DR   GOA; P0CAY5.
DR   GOA; P0CAY7.
DR   GOA; P0DKB7.
DR   GOA; P0DKI9.
DR   GOA; P82647.
DR   GOA; Q0WN71.
DR   GOA; Q2V4F7.
DR   GOA; Q6DUW8.
DR   GOA; Q700C2.
DR   GOA; Q84L09.
DR   GOA; Q8VWV6.
DR   GOA; Q94HW2.
DR   GOA; Q9C6B6.
DR   GOA; Q9C7F1.
DR   GOA; Q9C7I1.
DR   GOA; Q9C7I9.
DR   GOA; Q9C7P1.
DR   GOA; Q9C8K1.
DR   GOA; Q9C8M4.
DR   GOA; Q9C918.
DR   GOA; Q9C927.
DR   GOA; Q9C966.
DR   GOA; Q9CAA7.
DR   GOA; Q9CAC7.
DR   GOA; Q9CAN9.
DR   GOA; Q9CAR5.
DR   GOA; Q9FZ92.
DR   GOA; Q9LG11.
DR   GOA; Q9LMS5.
DR   GOA; Q9LP10.
DR   GOA; Q9LQ54.
DR   GOA; Q9LQX4.
DR   GOA; Q9LR73.
DR   GOA; Q9S9M3.
DR   GOA; Q9SA16.
DR   GOA; Q9SGW8.
DR   GOA; Q9SH40.
DR   GOA; Q9SHG5.
DR   GOA; Q9SKW7.
DR   GOA; Q9SSB4.
DR   GOA; Q9SX90.
DR   GOA; Q9SYL8.
DR   GOA; Q9XI81.
DR   GOA; Q9ZU27.
DR   InterPro; IPR001584; Integrase_cat-core.
DR   InterPro; IPR010851; DEFL.
DR   InterPro; IPR013103; RVT_2.
DR   InterPro; IPR025724; GAG-pre-integrase_dom.
DR   InterPro; IPR029040; RPABC4/Spt4.
DR   InterPro; IPR039537; Retrotran_Ty1/copia-like.
DR   InterPro; IPR039639; IDA-like.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00003; U1.
DR   RFAM; RF00004; U2.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00007; U12.
DR   RFAM; RF00015; U4.
DR   RFAM; RF00020; U5.
DR   RFAM; RF00026; U6.
DR   RFAM; RF00070; SNORD29.
DR   RFAM; RF00075; mir-166.
DR   RFAM; RF00097; snoR71.
DR   RFAM; RF00133; SNORD33.
DR   RFAM; RF00134; snoZ196.
DR   RFAM; RF00135; snoZ223.
DR   RFAM; RF00160; snoZ159.
DR   RFAM; RF00201; snoZ278.
DR   RFAM; RF00203; snoR160.
DR   RFAM; RF00221; SNORD43.
DR   RFAM; RF00296; snoR16.
DR   RFAM; RF00303; snoR86.
DR   RFAM; RF00304; snoZ279_R105_R108.
DR   RFAM; RF00307; snoR98.
DR   RFAM; RF00316; snoR43.
DR   RFAM; RF00328; snoZ161_228.
DR   RFAM; RF00344; snoZ267.
DR   RFAM; RF00348; snoR9_plant.
DR   RFAM; RF00353; snoR31_Z110_Z27.
DR   RFAM; RF00356; snoR32_R81.
DR   RFAM; RF00357; snoR44_J54.
DR   RFAM; RF00358; snoZ101.
DR   RFAM; RF00445; mir-399.
DR   RFAM; RF00451; mir-395.
DR   RFAM; RF00619; U6atac.
DR   RFAM; RF00638; MIR159.
DR   RFAM; RF00640; MIR167_1.
DR   RFAM; RF00643; MIR171_1.
DR   RFAM; RF00645; MIR169_2.
DR   RFAM; RF00688; MIR394.
DR   RFAM; RF00768; MIR405.
DR   RFAM; RF00845; MIR158.
DR   RFAM; RF00865; MIR169_5.
DR   RFAM; RF00893; MIR854.
DR   RFAM; RF01059; mir-598.
DR   RFAM; RF01155; snoR101.
DR   RFAM; RF01180; snoR110.
DR   RFAM; RF01198; snoR69Y.
DR   RFAM; RF01215; snoR97.
DR   RFAM; RF01228; snoR111.
DR   RFAM; RF01231; snoR74.
DR   RFAM; RF01236; snoU19.
DR   RFAM; RF01279; snoR53Y.
DR   RFAM; RF01280; snoR14.
DR   RFAM; RF01281; snoR35.
DR   RFAM; RF01285; snoU31b.
DR   RFAM; RF01289; snoR17.
DR   RFAM; RF01301; snoR4a.
DR   RFAM; RF01302; snoU36a.
DR   RFAM; RF01420; snoR113.
DR   RFAM; RF01421; snoR114.
DR   RFAM; RF01422; snoR116.
DR   RFAM; RF01423; snoR117.
DR   RFAM; RF01430; snoR134.
DR   RFAM; RF01432; snoR143.
DR   RFAM; RF01845; enod40.
DR   RFAM; RF01847; Plant_U3.
DR   RFAM; RF01855; Plant_SRP.
DR   TAIR; 1000429988; AT1G08115.
DR   TAIR; 1000430036; AT1G61275.
DR   TAIR; 1000430083; AT1G03746.
DR   TAIR; 1000430084; AT1G03515.
DR   TAIR; 1000430085; AT1G55625.
DR   TAIR; 1000430089; AT1G19376.
DR   TAIR; 1000430090; AT1G80250.
DR   TAIR; 1000530129; AT1G52615.
DR   TAIR; 1000629412; AT1G45238.
DR   TAIR; 1000629413; AT1G45234.
DR   TAIR; 1000629414; AT1G45246.
DR   TAIR; 1000629415; AT1G45244.
DR   TAIR; 1000629416; AT1G45242.
DR   TAIR; 1000629417; AT1G45236.
DR   TAIR; 1000629418; AT1G45240.
DR   TAIR; 1001029410; AT1G48267.
DR   TAIR; 1001029418; AT1G73687.
DR   TAIR; 1001029420; AT1G48742.
DR   TAIR; 1001029421; AT1G01183.
DR   TAIR; 1001029430; AT1G26235.
DR   TAIR; 1001029437; AT1G66783.
DR   TAIR; 1001029440; AT1G66795.
DR   TAIR; 1001029441; AT1G12013.
DR   TAIR; 1001029466; AT1G50055.
DR   TAIR; 1001029469; AT1G18075.
DR   TAIR; 1001029478; AT1G66725.
DR   TAIR; 1001029479; AT1G26233.
DR   TAIR; 1001029487; AT1G69587.
DR   TAIR; 1001029491; AT1G67195.
DR   TAIR; 1501129450; AT1G01448.
DR   TAIR; 1501129453; AT1G02952.
DR   TAIR; 1501129454; AT1G04295.
DR   TAIR; 1501129460; AT1G06265.
DR   TAIR; 1501129464; AT1G07728.
DR   TAIR; 1501129475; AT1G11185.
DR   TAIR; 1501129477; AT1G11592.
DR   TAIR; 1501129478; AT1G11735.
DR   TAIR; 1501129486; AT1G13448.
DR   TAIR; 1501129487; AT1G14518.
DR   TAIR; 1501129488; AT1G15175.
DR   TAIR; 1501129489; AT1G15405.
DR   TAIR; 1501129494; AT1G18415.
DR   TAIR; 1501129495; AT1G18735.
DR   TAIR; 1501129498; AT1G19371.
DR   TAIR; 1501129500; AT1G20375.
DR   TAIR; 1501129501; AT1G20515.
DR   TAIR; 1501129514; AT1G25098.
DR   TAIR; 1501129515; AT1G26208.
DR   TAIR; 1501129516; AT1G26218.
DR   TAIR; 1501129517; AT1G26558.
DR   TAIR; 1501129519; AT1G26973.
DR   TAIR; 1501129520; AT1G26975.
DR   TAIR; 1501129521; AT1G26985.
DR   TAIR; 1501129526; AT1G28685.
DR   TAIR; 1501129528; AT1G29071.
DR   TAIR; 1501129529; AT1G29265.
DR   TAIR; 1501129530; AT1G29357.
DR   TAIR; 1501129532; AT1G29785.
DR   TAIR; 1501129534; AT1G30282.
DR   TAIR; 1501129537; AT1G31173.
DR   TAIR; 1501129538; AT1G31258.
DR   TAIR; 1501129539; AT1G31358.
DR   TAIR; 1501129540; AT1G32582.
DR   TAIR; 1501129541; AT1G33415.
DR   TAIR; 1501129542; AT1G33615.
DR   TAIR; 1501129543; AT1G34418.
DR   TAIR; 1501129554; AT1G34844.
DR   TAIR; 1501129564; AT1G43765.
DR   TAIR; 1501129576; AT1G48315.
DR   TAIR; 1501129578; AT1G49952.
DR   TAIR; 1501129581; AT1G51645.
DR   TAIR; 1501129583; AT1G52185.
DR   TAIR; 1501129584; AT1G52347.
DR   TAIR; 1501129588; AT1G53233.
DR   TAIR; 1501129591; AT1G53683.
DR   TAIR; 1501129592; AT1G53687.
DR   TAIR; 1501129594; AT1G54355.
DR   TAIR; 1501129597; AT1G55525.
DR   TAIR; 1501129598; AT1G56165.
DR   TAIR; 1501129599; AT1G56242.
DR   TAIR; 1501129600; AT1G56612.
DR   TAIR; 1501129607; AT1G58590.
DR   TAIR; 1501129608; AT1G60025.
DR   TAIR; 1501129609; AT1G60505.
DR   TAIR; 1501129610; AT1G60525.
DR   TAIR; 1501129611; AT1G60545.
DR   TAIR; 1501129619; AT1G62035.
DR   TAIR; 1501129621; AT1G62355.
DR   TAIR; 1501129624; AT1G63005.
DR   TAIR; 1501129629; AT1G67365.
DR   TAIR; 1501129630; AT1G68568.
DR   TAIR; 1501129634; AT1G69792.
DR   TAIR; 1501129635; AT1G69795.
DR   TAIR; 1501129636; AT1G69797.
DR   TAIR; 1501129637; AT1G72855.
DR   TAIR; 1501129640; AT1G75295.
DR   TAIR; 1501129642; AT1G76135.
DR   TAIR; 1501129645; AT1G77235.
DR   TAIR; 1501129647; AT1G78265.
DR   TAIR; 1501129648; AT1G79075.
DR   TAIR; 1501129651; AT1G80325.
DR   TAIR; 1501130138; AT1G01046.
DR   TAIR; 1501130149; AT1G04425.
DR   TAIR; 1501130157; AT1G07051.
DR   TAIR; 1501130158; AT1G07119.
DR   TAIR; 1501130165; AT1G09421.
DR   TAIR; 1501130169; AT1G10682.
DR   TAIR; 1501130171; AT1G11175.
DR   TAIR; 1501130177; AT1G12294.
DR   TAIR; 1501130183; AT1G14071.
DR   TAIR; 1501130192; AT1G16489.
DR   TAIR; 1501130196; AT1G17255.
DR   TAIR; 1501130198; AT1G18382.
DR   TAIR; 1501130202; AT1G18879.
DR   TAIR; 1501130204; AT1G19464.
DR   TAIR; 1501130205; AT1G19968.
DR   TAIR; 1501130212; AT1G21202.
DR   TAIR; 1501130220; AT1G22403.
DR   TAIR; 1501130227; AT1G24068.
DR   TAIR; 1501130242; AT1G25175.
DR   TAIR; 1501130256; AT1G27921.
DR   TAIR; 1501130270; AT1G31485.
DR   TAIR; 1501130272; AT1G31935.
DR   TAIR; 1501130274; AT1G32172.
DR   TAIR; 1501130276; AT1G32713.
DR   TAIR; 1501130277; AT1G32992.
DR   TAIR; 1501130289; AT1G35501.
DR   TAIR; 1501130290; AT1G35545.
DR   TAIR; 1501130294; AT1G36992.
DR   TAIR; 1501130306; AT1G46554.
DR   TAIR; 1501130330; AT1G53801.
DR   TAIR; 1501130337; AT1G55591.
DR   TAIR; 1501130344; AT1G60072.
DR   TAIR; 1501130345; AT1G60073.
DR   TAIR; 1501130349; AT1G61224.
DR   TAIR; 1501130350; AT1G61226.
DR   TAIR; 1501130355; AT1G61732.
DR   TAIR; 1501130368; AT1G64563.
DR   TAIR; 1501130369; AT1G64618.
DR   TAIR; 1501130379; AT1G66173.
DR   TAIR; 1501130384; AT1G67105.
DR   TAIR; 1501130385; AT1G67238.
DR   TAIR; 1501130386; AT1G67328.
DR   TAIR; 1501130387; AT1G67481.
DR   TAIR; 1501130388; AT1G67792.
DR   TAIR; 1501130393; AT1G69252.
DR   TAIR; 1501130394; AT1G69572.
DR   TAIR; 1501130395; AT1G70185.
DR   TAIR; 1501130397; AT1G70581.
DR   TAIR; 1501130398; AT1G70645.
DR   TAIR; 1501130402; AT1G71002.
DR   TAIR; 1501130403; AT1G71528.
DR   TAIR; 1501130414; AT1G75891.
DR   TAIR; 1501130415; AT1G76062.
DR   TAIR; 1501130417; AT1G76878.
DR   TAIR; 1501130418; AT1G76892.
DR   TAIR; 1501130421; AT1G77138.
DR   TAIR; 1501130425; AT1G77992.
DR   TAIR; 1501130427; AT1G78206.
DR   TAIR; 1501130428; AT1G78478.
DR   TAIR; 1501130431; AT1G79529.
DR   TAIR; 1501132936; AT1G34392.
DR   TAIR; 1501132951; AT1G48698.
DR   TAIR; 1501132961; AT1G57835.
DR   TAIR; 1501132962; AT1G58808.
DR   TAIR; 1501132964; AT1G64572.
DR   TAIR; 1501132967; AT1G68872.
DR   TAIR; 1501132970; AT1G70518.
DR   TAIR; 1501132971; AT1G71828.
DR   TAIR; 1501132973; AT1G74545.
DR   TAIR; 1501165912; AT1G03545.
DR   TAIR; 1501165913; AT1G05562.
DR   TAIR; 1501165915; AT1G06002.
DR   TAIR; 1501165916; AT1G07128.
DR   TAIR; 1501165917; AT1G08592.
DR   TAIR; 1501165921; AT1G15002.
DR   TAIR; 1501165922; AT1G16635.
DR   TAIR; 1501165923; AT1G17232.
DR   TAIR; 1501165924; AT1G18745.
DR   TAIR; 1501165926; AT1G20691.
DR   TAIR; 1501165928; AT1G21529.
DR   TAIR; 1501165929; AT1G23052.
DR   TAIR; 1501165938; AT1G44125.
DR   TAIR; 1501165941; AT1G49832.
DR   TAIR; 1501165942; AT1G50659.
DR   TAIR; 1501165952; AT1G72852.
DR   TAIR; 1501165953; AT1G74205.
DR   TAIR; 1501165955; AT1G78865.
DR   TAIR; 228259; AT1G75740.
DR   TAIR; 228260; AT1G75650.
DR   TAIR; 228261; AT1G75570.
DR   TAIR; 228262; AT1G33370.
DR   TAIR; 228267; AT1G07100.
DR   TAIR; 228271; AT1G17670.
DR   TAIR; 228272; AT1G17570.
DR   TAIR; 228273; AT1G17660.
DR   TAIR; 228276; AT1G12015.
DR   TAIR; 228278; AT1G06480.
DR   TAIR; 228279; AT1G06610.
DR   TAIR; 228283; AT1G53220.
DR   TAIR; 228284; AT1G53410.
DR   TAIR; 228285; AT1G49460.
DR   TAIR; 228286; AT1G49280.
DR   TAIR; 228290; AT1G52860.
DR   TAIR; 228293; AT1G49690.
DR   TAIR; 228299; AT1G68860.
DR   TAIR; 228300; AT1G68770.
DR   TAIR; 228304; AT1G20250.
DR   TAIR; 228305; AT1G71700.
DR   TAIR; 228310; AT1G18430.
DR   TAIR; 228313; AT1G64420.
DR   TAIR; 228316; AT1G76330.
DR   TAIR; 228317; AT1G13840.
DR   TAIR; 228318; AT1G13850.
DR   TAIR; 228326; AT1G79980.
DR   TAIR; 228329; AT1G19373.
DR   TAIR; 228330; AT1G42120.
DR   TAIR; 228334; AT1G52350.
DR   TAIR; 228335; AT1G04320.
DR   TAIR; 228337; AT1G65830.
DR   TAIR; 228338; AT1G28890.
DR   TAIR; 228339; AT1G28880.
DR   TAIR; 228340; AT1G28790.
DR   TAIR; 228341; AT1G28870.
DR   TAIR; 228342; AT1G28780.
DR   TAIR; 228343; AT1G28860.
DR   TAIR; 228344; AT1G28770.
DR   TAIR; 228345; AT1G28850.
DR   TAIR; 228346; AT1G28750.
DR   TAIR; 228347; AT1G28840.
DR   TAIR; 228348; AT1G28740.
DR   TAIR; 228349; AT1G28830.
DR   TAIR; 228350; AT1G28730.
DR   TAIR; 228351; AT1G28820.
DR   TAIR; 228352; AT1G28720.
DR   TAIR; 228353; AT1G28810.
DR   TAIR; 228354; AT1G28800.
DR   TAIR; 228355; AT1G28990.
DR   TAIR; 228356; AT1G28980.
DR   TAIR; 228357; AT1G28970.
DR   TAIR; 228358; AT1G28950.
DR   TAIR; 228359; AT1G28940.
DR   TAIR; 228360; AT1G28930.
DR   TAIR; 228361; AT1G28920.
DR   TAIR; 228362; AT1G28910.
DR   TAIR; 228363; AT1G28900.
DR   TAIR; 228365; AT1G74570.
DR   TAIR; 228366; AT1G74610.
DR   TAIR; 228367; AT1G74456.
DR   TAIR; 228368; AT1G74453.
DR   TAIR; 228371; AT1G70050.
DR   TAIR; 228372; AT1G03570.
DR   TAIR; 228373; AT1G03640.
DR   TAIR; 228374; AT1G03506.
DR   TAIR; 228375; AT1G03502.
DR   TAIR; 228376; AT1G03743.
DR   TAIR; 228378; AT1G48080.
DR   TAIR; 228379; AT1G13720.
DR   TAIR; 228383; AT1G03935.
DR   TAIR; 228388; AT1G64120.
DR   TAIR; 228391; AT1G02760.
DR   TAIR; 228393; AT1G07580.
DR   TAIR; 228394; AT1G75163.
DR   TAIR; 228395; AT1G75166.
DR   TAIR; 228396; AT1G77040.
DR   TAIR; 228397; AT1G01870.
DR   TAIR; 228398; AT1G01890.
DR   TAIR; 228399; AT1G60840.
DR   TAIR; 228400; AT1G60820.
DR   TAIR; 228401; AT1G59880.
DR   TAIR; 228404; AT1G69300.
DR   TAIR; 228407; AT1G07760.
DR   TAIR; 228408; AT1G07702.
DR   TAIR; 228409; AT1G63790.
DR   TAIR; 228411; AT1G21420.
DR   TAIR; 228412; AT1G11640.
DR   TAIR; 228413; AT1G56950.
DR   TAIR; 228414; AT1G56930.
DR   TAIR; 228415; AT1G56920.
DR   TAIR; 228416; AT1G56900.
DR   TAIR; 228417; AT1G56890.
DR   TAIR; 228418; AT1G56870.
DR   TAIR; 228419; AT1G56860.
DR   TAIR; 228420; AT1G56840.
DR   TAIR; 228421; AT1G56830.
DR   TAIR; 228422; AT1G56810.
DR   TAIR; 228423; AT1G57400.
DR   TAIR; 228424; AT1G57380.
DR   TAIR; 228425; AT1G57370.
DR   TAIR; 228426; AT1G57350.
DR   TAIR; 228427; AT1G57340.
DR   TAIR; 228428; AT1G57320.
DR   TAIR; 228429; AT1G57310.
DR   TAIR; 228430; AT1G56800.
DR   TAIR; 228431; AT1G57290.
DR   TAIR; 228432; AT1G57280.
DR   TAIR; 228433; AT1G56780.
DR   TAIR; 228434; AT1G57260.
DR   TAIR; 228435; AT1G56770.
DR   TAIR; 228436; AT1G56750.
DR   TAIR; 228437; AT1G56740.
DR   TAIR; 228438; AT1G57250.
DR   TAIR; 228439; AT1G57230.
DR   TAIR; 228440; AT1G57220.
DR   TAIR; 228441; AT1G57200.
DR   TAIR; 228442; AT1G57190.
DR   TAIR; 228443; AT1G57170.
DR   TAIR; 228444; AT1G57160.
DR   TAIR; 228445; AT1G57140.
DR   TAIR; 228446; AT1G57130.
DR   TAIR; 228447; AT1G57110.
DR   TAIR; 228448; AT1G57510.
DR   TAIR; 228449; AT1G57480.
DR   TAIR; 228450; AT1G57450.
DR   TAIR; 228451; AT1G57420.
DR   TAIR; 228452; AT1G57390.
DR   TAIR; 228453; AT1G57360.
DR   TAIR; 228454; AT1G57330.
DR   TAIR; 228455; AT1G57300.
DR   TAIR; 228456; AT1G57240.
DR   TAIR; 228457; AT1G57270.
DR   TAIR; 228458; AT1G57210.
DR   TAIR; 228459; AT1G57180.
DR   TAIR; 228460; AT1G57150.
DR   TAIR; 228461; AT1G57120.
DR   TAIR; 228462; AT1G57090.
DR   TAIR; 228463; AT1G57060.
DR   TAIR; 228464; AT1G57030.
DR   TAIR; 228465; AT1G57000.
DR   TAIR; 228466; AT1G56970.
DR   TAIR; 228467; AT1G57530.
DR   TAIR; 228468; AT1G57100.
DR   TAIR; 228469; AT1G57520.
DR   TAIR; 228470; AT1G57080.
DR   TAIR; 228471; AT1G57500.
DR   TAIR; 228472; AT1G57070.
DR   TAIR; 228473; AT1G57490.
DR   TAIR; 228474; AT1G57470.
DR   TAIR; 228475; AT1G57050.
DR   TAIR; 228476; AT1G57460.
DR   TAIR; 228477; AT1G57040.
DR   TAIR; 228478; AT1G57440.
DR   TAIR; 228479; AT1G57020.
DR   TAIR; 228480; AT1G57430.
DR   TAIR; 228481; AT1G57010.
DR   TAIR; 228482; AT1G57410.
DR   TAIR; 228483; AT1G56990.
DR   TAIR; 228484; AT1G56980.
DR   TAIR; 228485; AT1G56960.
DR   TAIR; 228486; AT1G56940.
DR   TAIR; 228487; AT1G56910.
DR   TAIR; 228488; AT1G56880.
DR   TAIR; 228489; AT1G56850.
DR   TAIR; 228490; AT1G56820.
DR   TAIR; 228491; AT1G56790.
DR   TAIR; 228492; AT1G56760.
DR   TAIR; 228493; AT1G56730.
DR   TAIR; 228497; AT1G30430.
DR   TAIR; 228500; AT1G49020.
DR   TAIR; 228501; AT1G43820.
DR   TAIR; 228502; AT1G31110.
DR   TAIR; 228504; AT1G29210.
DR   TAIR; 228506; AT1G72780.
DR   TAIR; 228510; AT1G20820.
DR   TAIR; 228513; AT1G50100.
DR   TAIR; 228514; AT1G50070.
DR   TAIR; 228516; AT1G63510.
DR   TAIR; 228518; AT1G73900.
DR   TAIR; 228520; AT1G13010.
DR   TAIR; 228521; AT1G13240.
DR   TAIR; 228523; AT1G78250.
DR   TAIR; 228526; AT1G16450.
DR   TAIR; 228528; AT1G06880.
DR   TAIR; 228529; AT1G06860.
DR   TAIR; 228530; AT1G69130.
DR   TAIR; 228533; AT1G32385.
DR   TAIR; 228534; AT1G80430.
DR   TAIR; 228535; AT1G20420.
DR   TAIR; 228536; AT1G12510.
DR   TAIR; 228537; AT1G12590.
DR   TAIR; 228538; AT1G18820.
DR   TAIR; 228540; AT1G01270.
DR   TAIR; 228541; AT1G32620.
DR   TAIR; 228545; AT1G36350.
DR   TAIR; 228546; AT1G08950.
DR   TAIR; 228547; AT1G08870.
DR   TAIR; 228548; AT1G09110.
DR   TAIR; 228550; AT1G60580.
DR   TAIR; 228552; AT1G61880.
DR   TAIR; 228553; AT1G61910.
DR   TAIR; 228554; AT1G21800.
DR   TAIR; 228556; AT1G75070.
DR   TAIR; 228557; AT1G52170.
DR   TAIR; 228560; AT1G15090.
DR   TAIR; 228561; AT1G15450.
DR   TAIR; 228567; AT1G10440.
DR   TAIR; 228571; AT1G77190.
DR   TAIR; 228573; AT1G02600.
DR   TAIR; 228574; AT1G02480.
DR   TAIR; 228577; AT1G22320.
DR   TAIR; 228578; AT1G15650.
DR   TAIR; 228583; AT1G30830.
DR   TAIR; 228586; AT1G11010.
DR   TAIR; 228587; AT1G11030.
DR   TAIR; 228590; AT1G04720.
DR   TAIR; 228591; AT1G26490.
DR   TAIR; 228592; AT1G26430.
DR   TAIR; 228594; AT1G20210.
DR   TAIR; 228595; AT1G20170.
DR   TAIR; 228596; AT1G20040.
DR   TAIR; 228597; AT1G20015.
DR   TAIR; 228599; AT1G05980.
DR   TAIR; 228601; AT1G54670.
DR   TAIR; 228604; AT1G24080.
DR   TAIR; 228606; AT1G08240.
DR   TAIR; 228607; AT1G11550.
DR   TAIR; 228609; AT1G16100.
DR   TAIR; 228615; AT1G05390.
DR   TAIR; 228618; AT1G59570.
DR   TAIR; 228619; AT1G75970.
DR   TAIR; 228620; AT1G76000.
DR   TAIR; 228624; AT1G77560.
DR   TAIR; 228627; AT1G69000.
DR   TAIR; 228628; AT1G68950.
DR   TAIR; 228629; AT1G68970.
DR   TAIR; 228632; AT1G61020.
DR   TAIR; 228633; AT1G60910.
DR   TAIR; 228636; AT1G57710.
DR   TAIR; 228641; AT1G79300.
DR   TAIR; 228642; AT1G79240.
DR   TAIR; 228643; AT1G79290.
DR   UniProtKB/Swiss-Prot; F4HQD4; HSP7P_ARATH.
DR   UniProtKB/Swiss-Prot; F4HX15; LPAI_ARATH.
DR   UniProtKB/Swiss-Prot; F4HX80; ALT4_ARATH.
DR   UniProtKB/Swiss-Prot; F4I443; BARD1_ARATH.
DR   UniProtKB/Swiss-Prot; F4IA73; GSTUL_ARATH.
DR   UniProtKB/Swiss-Prot; F4IAR2; KN14O_ARATH.
DR   UniProtKB/Swiss-Prot; F4IC29; HIP28_ARATH.
DR   UniProtKB/Swiss-Prot; F4IDU9; THNL1_ARATH.
DR   UniProtKB/Swiss-Prot; O64600; FB81_ARATH.
DR   UniProtKB/Swiss-Prot; O80735; JAL16_ARATH.
DR   UniProtKB/Swiss-Prot; O80741; FB351_ARATH.
DR   UniProtKB/Swiss-Prot; P0C2C9; FBX12_ARATH.
DR   UniProtKB/Swiss-Prot; P0C2F6; RNHX1_ARATH.
DR   UniProtKB/Swiss-Prot; P0C8K8; ARI6_ARATH.
DR   UniProtKB/Swiss-Prot; P0CAY3; DF105_ARATH.
DR   UniProtKB/Swiss-Prot; P0CAY5; DF166_ARATH.
DR   UniProtKB/Swiss-Prot; P0CAY7; DF290_ARATH.
DR   UniProtKB/Swiss-Prot; P0CB27; FB3_ARATH.
DR   UniProtKB/Swiss-Prot; P0DKB7; LPXC2_ARATH.
DR   UniProtKB/Swiss-Prot; P0DKI9; P165A_ARATH.
DR   UniProtKB/Swiss-Prot; P59278; Y1745_ARATH.
DR   UniProtKB/Swiss-Prot; P82647; DF227_ARATH.
DR   UniProtKB/Swiss-Prot; Q0WN71; DF123_ARATH.
DR   UniProtKB/Swiss-Prot; Q2V4F7; DF278_ARATH.
DR   UniProtKB/Swiss-Prot; Q6DUW8; IDL5_ARATH.
DR   UniProtKB/Swiss-Prot; Q700C2; SPL16_ARATH.
DR   UniProtKB/Swiss-Prot; Q84L09; GONS2_ARATH.
DR   UniProtKB/Swiss-Prot; Q8VWV6; WRK61_ARATH.
DR   UniProtKB/Swiss-Prot; Q94HW2; POLR1_ARATH.
DR   UniProtKB/Swiss-Prot; Q9C6B6; HRD3B_ARATH.
DR   UniProtKB/Swiss-Prot; Q9C7F1; PPR61_ARATH.
DR   UniProtKB/Swiss-Prot; Q9C7I1; ATL34_ARATH.
DR   UniProtKB/Swiss-Prot; Q9C7I9; ARFT_ARATH.
DR   UniProtKB/Swiss-Prot; Q9C7P1; C3H10_ARATH.
DR   UniProtKB/Swiss-Prot; Q9C8K1; BGL36_ARATH.
DR   UniProtKB/Swiss-Prot; Q9C8M4; RPBCL_ARATH.
DR   UniProtKB/Swiss-Prot; Q9C918; UBC38_ARATH.
DR   UniProtKB/Swiss-Prot; Q9C927; PPA5_ARATH.
DR   UniProtKB/Swiss-Prot; Q9C966; IAA15_ARATH.
DR   UniProtKB/Swiss-Prot; Q9CAA7; PUB42_ARATH.
DR   UniProtKB/Swiss-Prot; Q9CAC7; CRRS4_ARATH.
DR   UniProtKB/Swiss-Prot; Q9CAN9; ERF26_ARATH.
DR   UniProtKB/Swiss-Prot; Q9CAR5; GAGT4_ARATH.
DR   UniProtKB/Swiss-Prot; Q9FYI3; FB23_ARATH.
DR   UniProtKB/Swiss-Prot; Q9FZ92; RH44_ARATH.
DR   UniProtKB/Swiss-Prot; Q9FZE7; FB41_ARATH.
DR   UniProtKB/Swiss-Prot; Q9LG11; HAC4_ARATH.
DR   UniProtKB/Swiss-Prot; Q9LM89; FB12_ARATH.
DR   UniProtKB/Swiss-Prot; Q9LMS5; GDL3_ARATH.
DR   UniProtKB/Swiss-Prot; Q9LNF6; FB48_ARATH.
DR   UniProtKB/Swiss-Prot; Q9LP10; Y1920_ARATH.
DR   UniProtKB/Swiss-Prot; Q9LP59; FBK20_ARATH.
DR   UniProtKB/Swiss-Prot; Q9LQ36; LOR1_ARATH.
DR   UniProtKB/Swiss-Prot; Q9LQ54; DRL12_ARATH.
DR   UniProtKB/Swiss-Prot; Q9LQX4; DOF13_ARATH.
DR   UniProtKB/Swiss-Prot; Q9LR73; 3AT2_ARATH.
DR   UniProtKB/Swiss-Prot; Q9S9M3; WAKLC_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SA01; FB25_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SA16; P2A09_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SGW8; P4KG2_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SGX9; ESFL1_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SH40; CRRS8_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SHG5; C72C1_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SKW7; PCP10_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SSB4; PRS7B_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SX90; PUP20_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SYL8; Y1786_ARATH.
DR   UniProtKB/Swiss-Prot; Q9XI81; FUT7_ARATH.
DR   UniProtKB/Swiss-Prot; Q9ZU27; PPR76_ARATH.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..30427671
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="1"
FT                   /ecotype="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   gene            3631..5899
FT                   /gene="NAC001"
FT                   /gene_synonym="ANAC001"
FT                   /gene_synonym="NAC domain containing protein 1"
FT                   /gene_synonym="T25K16.1"
FT                   /gene_synonym="T25K16_1"
FT                   /locus_tag="AT1G01010"
FT   mRNA            join(3631..3913,3996..4276,4486..4605,4706..5095,
FT                   5174..5326,5439..5899)
FT                   /gene="NAC001"
FT                   /gene_synonym="ANAC001"
FT                   /gene_synonym="NAC domain containing protein 1"
FT                   /gene_synonym="T25K16.1"
FT                   /gene_synonym="T25K16_1"
FT                   /locus_tag="AT1G01010"
FT                   /product="NAC domain containing protein 1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP621258.1,INSD:BP779869.1,INSD:AV826635.1,
FT                   INSD:EL124732.1,INSD:AV810144.1,INSD:BP788378.1,
FT                   INSD:BP562468.2,INSD:AV795918.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT001115.1,INSD:AF439834.1,INSD:AK226863.1"
FT   CDS_pept        join(3760..3913,3996..4276,4486..4605,4706..5095,
FT                   5174..5326,5439..5630)
FT                   /codon_start=1
FT                   /gene="NAC001"
FT                   /gene_synonym="ANAC001"
FT                   /gene_synonym="NAC domain containing protein 1"
FT                   /gene_synonym="T25K16.1"
FT                   /gene_synonym="T25K16_1"
FT                   /locus_tag="AT1G01010"
FT                   /product="NAC domain containing protein 1"
FT                   /note="NAC domain containing protein 1 (NAC001); FUNCTIONS
FT                   IN: sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: multicellular organismal
FT                   development, regulation of transcription; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 7 plant
FT                   structures; EXPRESSED DURING: 4 anthesis, C globular stage,
FT                   petal differentiation and expansion stage; CONTAINS
FT                   InterPro DOMAIN/s: No apical meristem (NAM) protein
FT                   (InterPro:IPR003441); BEST Arabidopsis thaliana protein
FT                   match is: NAC domain containing protein 69
FT                   (TAIR:AT4G01550.1); Has 2503 Blast hits to 2496 proteins in
FT                   69 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 2502; Viruses - 0; Other Eukaryotes - 1
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q0WV96"
FT                   /db_xref="InterPro:IPR003441"
FT                   /db_xref="InterPro:IPR036093"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WV96"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP621258.1,INSD:BP779869.1,INSD:AV826635.1,
FT                   INSD:EL124732.1,INSD:AV810144.1,INSD:BP788378.1,
FT                   INSD:BP562468.2,INSD:AV795918.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT001115.1,INSD:AF439834.1,INSD:AK226863.1"
FT                   /protein_id="AEE27216.1"
FT                   /translation="MEDQVGFGFRPNDEELVGHYLRNKIEGNTSRDVEVAISEVNICSY
FT                   DPWNLRFQSKYKSRDAMWYFFSRRENNKGNRQSRTTVSGKWKLTGESVEVKDQWGFCSE
FT                   GFRGKIGHKRVLVFLDGRYPDKTKSDWVIHEFHYDLLPEHQRTYVICRLEYKGDDADIL
FT                   SAYAIDPTPAFVPNMTSSAGSVVNQSRQRNSGSYNTYSEYDSANHGQQFNENSNIMQQQ
FT                   PLQGSFNPLLEYDFANHGGQWLSDYIDLQQQVPYLAPYENESEMIWKHVIEENFEFLVD
FT                   ERTSMQQHYSDHRPKKPVSGVLPDDSSDTETGSMIFEDTSSSTDSVGSSDEPGHTRIDD
FT                   IPSLNIIEPLHNYKAQEQPKQQSKEKVISSQKSECEWKMAEDSIKIPPSTNTVKQSWIV
FT                   LENAQWNYLKNMIIGVLLFISVISWIILVG"
FT   gene            complement(6788..9130)
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT   mRNA            complement(join(6788..7069,7157..7232,7384..7450,
FT                   7564..7649,7762..7835,7942..7987,8236..8325,8417..8464,
FT                   8594..9130))
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT   mRNA            complement(join(6788..7069,7157..7232,7384..7450,
FT                   7564..7649,7762..7835,7942..7987,8236..8464,8594..9130))
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT   mRNA            complement(join(6788..7069,7157..7232,7384..7450,
FT                   7564..7649,7762..7835,7942..7987,8236..8325,8417..8464,
FT                   8571..9130))
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH846835.1,INSD:AU227271.1,INSD:EG512767.1,
FT                   INSD:EG452794.1,INSD:EL102675.1,INSD:EG512768.1,
FT                   INSD:EH959539.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY758070.1"
FT   mRNA            complement(join(6788..7069,7157..7232,7384..7450,
FT                   7564..7649,7762..7835,7942..7987,8236..8464,8571..9130))
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT   mRNA            complement(join(6788..7069,7157..7450,7564..7649,
FT                   8236..8325,8417..8464,8594..8737))
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT   mRNA            complement(join(6788..7069,7157..7450,7564..7649,
FT                   7762..7835,7942..7987,8236..8325,8417..8464,8571..8737))
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH846835.1,INSD:BE521342.1,INSD:BE521343.1,
FT                   INSD:EL102675.1,INSD:BE521341.1,INSD:EH959539.1"
FT   CDS_pept        complement(join(6915..7069,7157..7232,7384..7450,
FT                   7564..7649,7762..7835,7942..7987,8236..8325,8417..8464,
FT                   8571..8666))
FT                   /codon_start=1
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT                   /note="ARV1; CONTAINS InterPro DOMAIN/s: Arv1-like protein
FT                   (InterPro:IPR007290); BEST Arabidopsis thaliana protein
FT                   match is: Arv1-like protein (TAIR:AT4G01510.1); Has 311
FT                   Blast hits to 311 proteins in 154 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 110; Fungi - 115; Plants - 42;
FT                   Viruses - 0; Other Eukaryotes - 44 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01020"
FT                   /db_xref="GOA:Q5MK24"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5MK24"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH846835.1,INSD:AU227271.1,INSD:EG512767.1,
FT                   INSD:EG452794.1,INSD:EL102675.1,INSD:EG512768.1,
FT                   INSD:EH959539.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY758070.1"
FT                   /protein_id="AEE27217.1"
FT                   /translation="MAASEHRCVGCGFRVKSLFIQYSPGNIRLMKCGNCKEVADEYIEC
FT                   ERMIIFIDLILHRPKVYRHVLYNAINPATVNIQHLLWKLVFAYLLLDCYRSLLLRKSDE
FT                   ESSFSDSPVLLSIKVLIGVLSANAAFIISFAIATKGLLNEVSRRREIMLGIFISSYFKI
FT                   FLLAMLVWEFPMSVIFFVDILLLTSNSMALKVMTESTMTRCIAVCLIAHLIRFLVGQIF
FT                   EPTIFLIQIGSLLQYMSYFFRIV"
FT   CDS_pept        complement(join(6915..7069,7157..7232,7384..7450,
FT                   7564..7649,7762..7835,7942..7987,8236..8442))
FT                   /codon_start=1
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01020"
FT                   /db_xref="GOA:A0A1P8AS22"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AS22"
FT                   /protein_id="ANM59418.1"
FT                   /translation="MSTSSVNAWSVLITFFPFLGVSLFLSNFGFWFFNCFLWQIIFIDL
FT                   ILHRPKVYRHVLYNAINPATVNIQHLLWKLVFAYLLLDCYRSLLLRKSDEESSFSDSPV
FT                   LLSIKVLIGVLSANAAFIISFAIATKGLLNEVSRRREIMLGIFISSYFKIFLLAMLVWE
FT                   FPMSVIFFVDILLLTSNSMALKVMTESTMTRCIAVCLIAHLIRFLVGQIFEPTIFLIQI
FT                   GSLLQYMSYFFRIV"
FT   CDS_pept        complement(join(6915..7069,7157..7232,7384..7450,
FT                   7564..7649,7762..7835,7942..7987,8236..8442))
FT                   /codon_start=1
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT                   /db_xref="GOA:A0A1P8AS22"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AS22"
FT                   /protein_id="ANM59420.1"
FT                   /translation="MSTSSVNAWSVLITFFPFLGVSLFLSNFGFWFFNCFLWQIIFIDL
FT                   ILHRPKVYRHVLYNAINPATVNIQHLLWKLVFAYLLLDCYRSLLLRKSDEESSFSDSPV
FT                   LLSIKVLIGVLSANAAFIISFAIATKGLLNEVSRRREIMLGIFISSYFKIFLLAMLVWE
FT                   FPMSVIFFVDILLLTSNSMALKVMTESTMTRCIAVCLIAHLIRFLVGQIFEPTIFLIQI
FT                   GSLLQYMSYFFRIV"
FT   CDS_pept        complement(join(6915..7069,7157..7232,7384..7450,
FT                   7564..7649,7762..7835,7942..7987,8236..8325,8417..8419))
FT                   /codon_start=1
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01020"
FT                   /db_xref="GOA:Q5MK24"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5MK24"
FT                   /protein_id="ANM59419.1"
FT                   /translation="MIIFIDLILHRPKVYRHVLYNAINPATVNIQHLLWKLVFAYLLLD
FT                   CYRSLLLRKSDEESSFSDSPVLLSIKVLIGVLSANAAFIISFAIATKGLLNEVSRRREI
FT                   MLGIFISSYFKIFLLAMLVWEFPMSVIFFVDILLLTSNSMALKVMTESTMTRCIAVCLI
FT                   AHLIRFLVGQIFEPTIFLIQIGSLLQYMSYFFRIV"
FT   CDS_pept        complement(join(7315..7450,7564..7649,7762..7835,
FT                   7942..7987,8236..8325,8417..8464,8571..8666))
FT                   /codon_start=1
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT                   /note="ARV1; CONTAINS InterPro DOMAIN/s: Arv1-like protein
FT                   (InterPro:IPR007290); BEST Arabidopsis thaliana protein
FT                   match is: Arv1-like protein (TAIR:AT4G01510.1); Has 35333
FT                   Blast hits to 34131 proteins in 2444 species: Archae - 798;
FT                   Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531;
FT                   Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01020"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01020.2"
FT                   /db_xref="GOA:F4HQG4"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniProtKB/TrEMBL:F4HQG4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH846835.1,INSD:BE521342.1,INSD:BE521343.1,
FT                   INSD:EL102675.1,INSD:BE521341.1,INSD:EH959539.1"
FT                   /protein_id="AEE27218.1"
FT                   /translation="MAASEHRCVGCGFRVKSLFIQYSPGNIRLMKCGNCKEVADEYIEC
FT                   ERMIIFIDLILHRPKVYRHVLYNAINPATVNIQHLLWKLVFAYLLLDCYRSLLLRKSDE
FT                   ESSFSDSPVLLSIKVLIGVLSANAAFIISFAIATKGLLNEVSRRREIMLGIFISSYFKI
FT                   FLLAMLVCCSFTSHLIPNIEVPNFLSIP"
FT   CDS_pept        complement(join(7315..7450,7564..7649,8236..8325,
FT                   8417..8419))
FT                   /codon_start=1
FT                   /gene="ARV1"
FT                   /gene_synonym="T25K16.2"
FT                   /gene_synonym="T25K16_2"
FT                   /locus_tag="AT1G01020"
FT                   /product="ARV1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01020"
FT                   /db_xref="GOA:A0A1P8ARY9"
FT                   /db_xref="InterPro:IPR007290"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8ARY9"
FT                   /protein_id="ANM59421.1"
FT                   /translation="MIIFIDLILHRPKVYRHVLYNAINPATVNIQVLIGVLSANAAFII
FT                   SFAIATKGLLNEVSRRREIMLGIFISSYFKIFLLAMLVCCSFTSHLIPNIEVPNFLSIP
FT                   "
FT   gene            11101..11372
FT                   /locus_tag="AT1G03987"
FT   ncRNA           11101..11372
FT                   /locus_tag="AT1G03987"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(11649..13714)
FT                   /gene="NGA3"
FT                   /gene_synonym="NGATHA3"
FT                   /gene_synonym="T25K16.3"
FT                   /gene_synonym="T25K16_3"
FT                   /locus_tag="AT1G01030"
FT   mRNA            complement(join(11649..12354,12424..13173,13335..13714))
FT                   /gene="NGA3"
FT                   /gene_synonym="NGATHA3"
FT                   /gene_synonym="T25K16.3"
FT                   /gene_synonym="T25K16_3"
FT                   /locus_tag="AT1G01030"
FT                   /product="AP2/B3-like transcriptional factor family
FT                   protein"
FT   mRNA            complement(join(11649..13173,13335..13714))
FT                   /gene="NGA3"
FT                   /gene_synonym="NGATHA3"
FT                   /gene_synonym="T25K16.3"
FT                   /gene_synonym="T25K16_3"
FT                   /locus_tag="AT1G01030"
FT                   /product="AP2/B3-like transcriptional factor family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR355295.1,INSD:EH891927.1,INSD:DN604552.1,
FT                   INSD:EH913921.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX814729.1"
FT   CDS_pept        complement(join(11864..12354,12424..12940))
FT                   /codon_start=1
FT                   /gene="NGA3"
FT                   /gene_synonym="NGATHA3"
FT                   /gene_synonym="T25K16.3"
FT                   /gene_synonym="T25K16_3"
FT                   /locus_tag="AT1G01030"
FT                   /product="AP2/B3-like transcriptional factor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01030"
FT                   /db_xref="GOA:A0A1P8AT85"
FT                   /db_xref="InterPro:IPR003340"
FT                   /db_xref="InterPro:IPR015300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AT85"
FT                   /protein_id="ANM59847.1"
FT                   /translation="MDLSLAPTTTTSSDQEQDRDQELTSNIGASSSSGPSGNNNNLPMM
FT                   MIPPPEKEHMFDKVVTPSDVGKLNRLVIPKQHAERYFPLDSSNNQNGTLLNFQDRNGKM
FT                   WRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSFQRGIGDESERSKLYIDWRHRPD
FT                   MSLVQAHQFEYNSVPIHRGLNIGNHQRSYYNTQRQEFVGYGYGNLAGRCYYTGSPLDHR
FT                   NIVGSEPLVIDSVPVVPGRLTPVMLPPLPPPPSTAGKRLRLFGVNMECGNDYNQQEESW
FT                   LVPRGEIGASSSSSSALRLNLSTDHDDDNDDGDDGDDDQFAKKGKSSLSLNFNP"
FT   CDS_pept        complement(11864..12940)
FT                   /codon_start=1
FT                   /gene="NGA3"
FT                   /gene_synonym="NGATHA3"
FT                   /gene_synonym="T25K16.3"
FT                   /gene_synonym="T25K16_3"
FT                   /locus_tag="AT1G01030"
FT                   /product="AP2/B3-like transcriptional factor family
FT                   protein"
FT                   /note="NGATHA3 (NGA3); CONTAINS InterPro DOMAIN/s:
FT                   Transcriptional factor B3 (InterPro:IPR003340); BEST
FT                   Arabidopsis thaliana protein match is: AP2/B3-like
FT                   transcriptional factor family protein (TAIR:AT4G01500.1);
FT                   Has 1380 Blast hits to 1379 proteins in 72 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 1380;
FT                   Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01030.1"
FT                   /db_xref="GOA:Q9MAN1"
FT                   /db_xref="InterPro:IPR003340"
FT                   /db_xref="InterPro:IPR015300"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9MAN1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR355295.1,INSD:EH891927.1,INSD:DN604552.1,
FT                   INSD:EH913921.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX814729.1"
FT                   /protein_id="AEE27219.1"
FT                   /translation="MDLSLAPTTTTSSDQEQDRDQELTSNIGASSSSGPSGNNNNLPMM
FT                   MIPPPEKEHMFDKVVTPSDVGKLNRLVIPKQHAERYFPLDSSNNQNGTLLNFQDRNGKM
FT                   WRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSFQRGIGDESERSKLYIDWRHRPD
FT                   MSLVQAHQFGNFGFNFNFPTTSQYSNRFHPLPEYNSVPIHRGLNIGNHQRSYYNTQRQE
FT                   FVGYGYGNLAGRCYYTGSPLDHRNIVGSEPLVIDSVPVVPGRLTPVMLPPLPPPPSTAG
FT                   KRLRLFGVNMECGNDYNQQEESWLVPRGEIGASSSSSSALRLNLSTDHDDDNDDGDDGD
FT                   DDQFAKKGKSSLSLNFNP"
FT   gene            23121..31227
FT                   /gene="DCL1"
FT                   /gene_synonym="ABNORMAL SUSPENSOR 1"
FT                   /gene_synonym="ASU1"
FT                   /gene_synonym="ATDCL1"
FT                   /gene_synonym="CAF"
FT                   /gene_synonym="CARPEL FACTORY"
FT                   /gene_synonym="dicer-like 1"
FT                   /gene_synonym="DICER-LIKE 1"
FT                   /gene_synonym="EMB60"
FT                   /gene_synonym="EMB76"
FT                   /gene_synonym="EMBRYO DEFECTIVE 60"
FT                   /gene_synonym="EMBRYO DEFECTIVE 76"
FT                   /gene_synonym="SHORT INTEGUMENTS 1"
FT                   /gene_synonym="SIN1"
FT                   /gene_synonym="SUS1"
FT                   /gene_synonym="SUSPENSOR 1"
FT                   /gene_synonym="T25K16.4"
FT                   /gene_synonym="T25K16_4"
FT                   /locus_tag="AT1G01040"
FT                   /note="Encodes a Dicer homolog. Dicer is a RNA helicase
FT                   involved in microRNA processing. Mutations in this locus
FT                   can result in embryo lethality. Embryo shape at seed
FT                   maturity is globular-elongate. Other mutants convert the
FT                   floral meristems to an indeterminate state, others yet show
FT                   defects in ovule development. mRNA is expressed in all
FT                   shoot tissues. DCL1 is able to produce miRNAs and siRNAs."
FT   mRNA            join(23121..24451,24542..24655,24752..24962,25041..25435,
FT                   25524..25743,25825..25997,26081..26203,26292..26452,
FT                   26543..26776,26862..27012,27099..27281,27372..27533,
FT                   27618..27713,27803..28431,28708..28805,28890..29080,
FT                   29160..30065,30147..30311,30410..30816,30902..31227)
FT                   /gene="DCL1"
FT                   /gene_synonym="ABNORMAL SUSPENSOR 1"
FT                   /gene_synonym="ASU1"
FT                   /gene_synonym="ATDCL1"
FT                   /gene_synonym="CAF"
FT                   /gene_synonym="CARPEL FACTORY"
FT                   /gene_synonym="dicer-like 1"
FT                   /gene_synonym="DICER-LIKE 1"
FT                   /gene_synonym="EMB60"
FT                   /gene_synonym="EMB76"
FT                   /gene_synonym="EMBRYO DEFECTIVE 60"
FT                   /gene_synonym="EMBRYO DEFECTIVE 76"
FT                   /gene_synonym="SHORT INTEGUMENTS 1"
FT                   /gene_synonym="SIN1"
FT                   /gene_synonym="SUS1"
FT                   /gene_synonym="SUSPENSOR 1"
FT                   /gene_synonym="T25K16.4"
FT                   /gene_synonym="T25K16_4"
FT                   /locus_tag="AT1G01040"
FT                   /product="dicer-like 1"
FT   gene            complement(23312..24099)
FT                   /locus_tag="AT1G03993"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT1G01040"
FT   ncRNA           complement(23312..24099)
FT                   /locus_tag="AT1G03993"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   mRNA            join(23416..24451,24542..24655,24752..24962,25041..25435,
FT                   25524..25743,25825..25997,26081..26203,26292..26452,
FT                   26543..26776,26862..27012,27099..27281,27372..27536,
FT                   27618..27713,27803..28431,28708..28805,28890..29080,
FT                   29160..30065,30147..30311,30410..30816,30902..31120)
FT                   /gene="DCL1"
FT                   /gene_synonym="ABNORMAL SUSPENSOR 1"
FT                   /gene_synonym="ASU1"
FT                   /gene_synonym="ATDCL1"
FT                   /gene_synonym="CAF"
FT                   /gene_synonym="CARPEL FACTORY"
FT                   /gene_synonym="dicer-like 1"
FT                   /gene_synonym="DICER-LIKE 1"
FT                   /gene_synonym="EMB60"
FT                   /gene_synonym="EMB76"
FT                   /gene_synonym="EMBRYO DEFECTIVE 60"
FT                   /gene_synonym="EMBRYO DEFECTIVE 76"
FT                   /gene_synonym="SHORT INTEGUMENTS 1"
FT                   /gene_synonym="SIN1"
FT                   /gene_synonym="SUS1"
FT                   /gene_synonym="SUSPENSOR 1"
FT                   /gene_synonym="T25K16.4"
FT                   /gene_synonym="T25K16_4"
FT                   /locus_tag="AT1G01040"
FT                   /product="dicer-like 1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH948322.1,INSD:EH830906.1,INSD:EG522515.1,
FT                   INSD:BP571785.1,INSD:AI100063.1,INSD:EL120669.1,
FT                   INSD:EH988836.1,INSD:DR373797.1,INSD:BP629851.1,
FT                   INSD:AI996152.1,INSD:EH866522.1,INSD:EL096532.1,
FT                   INSD:EL281260.1,INSD:AV806514.1,INSD:AV815743.1,
FT                   INSD:ES104193.1,INSD:AV783898.1,INSD:DR380507.1,
FT                   INSD:BP575972.1,INSD:ES185316.1,INSD:H36434.1,
FT                   INSD:ES210801.1,INSD:BP563653.1,INSD:EH902174.1,
FT                   INSD:Z29202.1,INSD:BP789125.1,INSD:BP655894.1,
FT                   INSD:EL137132.1,INSD:BP568979.1,INSD:BP783219.1,
FT                   INSD:ES098400.1,INSD:BP787533.1,INSD:EH971167.1,
FT                   INSD:AV787299.1,INSD:AV781745.1,INSD:EH901232.1,
FT                   INSD:AV535286.1,INSD:BU636534.1,INSD:ES159107.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF187317.1,INSD:AF292940.1"
FT   CDS_pept        join(23519..24451,24542..24655,24752..24962,25041..25435,
FT                   25524..25743,25825..25997,26081..26203,26292..26452,
FT                   26543..26776,26862..27012,27099..27281,27372..27536,
FT                   27618..27713,27803..28431,28708..28805,28890..29080,
FT                   29160..30065,30147..30311,30410..30816,30902..31079)
FT                   /codon_start=1
FT                   /gene="DCL1"
FT                   /gene_synonym="ABNORMAL SUSPENSOR 1"
FT                   /gene_synonym="ASU1"
FT                   /gene_synonym="ATDCL1"
FT                   /gene_synonym="CAF"
FT                   /gene_synonym="CARPEL FACTORY"
FT                   /gene_synonym="dicer-like 1"
FT                   /gene_synonym="DICER-LIKE 1"
FT                   /gene_synonym="EMB60"
FT                   /gene_synonym="EMB76"
FT                   /gene_synonym="EMBRYO DEFECTIVE 60"
FT                   /gene_synonym="EMBRYO DEFECTIVE 76"
FT                   /gene_synonym="SHORT INTEGUMENTS 1"
FT                   /gene_synonym="SIN1"
FT                   /gene_synonym="SUS1"
FT                   /gene_synonym="SUSPENSOR 1"
FT                   /gene_synonym="T25K16.4"
FT                   /gene_synonym="T25K16_4"
FT                   /locus_tag="AT1G01040"
FT                   /product="dicer-like 1"
FT                   /note="dicer-like 1 (DCL1); CONTAINS InterPro DOMAIN/s:
FT                   Restriction endonuclease, type I, R subunit/Type III, Res
FT                   subunit (InterPro:IPR006935), Double-stranded RNA-binding
FT                   (InterPro:IPR001159), Argonaute/Dicer protein, PAZ
FT                   (InterPro:IPR003100), Ribonuclease III
FT                   (InterPro:IPR000999), Double-stranded RNA-binding-like
FT                   (InterPro:IPR014720), DEAD-like helicase, N-terminal
FT                   (InterPro:IPR014001), DNA/RNA helicase, C-terminal
FT                   (InterPro:IPR001650), Dicer double-stranded RNA-binding
FT                   fold (InterPro:IPR005034), Helicase, superfamily 1/2,
FT                   ATP-binding domain (InterPro:IPR014021); BEST Arabidopsis
FT                   thaliana protein match is: dicer-like 3
FT                   (TAIR:AT3G43920.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01040"
FT                   /db_xref="GOA:F4HQG6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003100"
FT                   /db_xref="InterPro:IPR005034"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036085"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="InterPro:IPR038248"
FT                   /db_xref="UniProtKB/TrEMBL:F4HQG6"
FT                   /protein_id="AEE27221.1"
FT                   /translation="MVMEDEPREATIKPSYWLDACEDISCDLIDDLVSEFDPSSVAVNE
FT                   STDENGVINDFFGGIDHILDSIKNGGGLPNNGVSDTNSQINEVTVTPQVIAKETVKENG
FT                   LQKNGGKRDEFSKEEGDKDRKRARVCSYQSERSNLSGRGHVNNSREGDRFMNRKRTRNW
FT                   DEAGNNKKKRECNNYRRDGRDREVRGYWERDKVGSNELVYRSGTWEADHERDVKKVSGG
FT                   NRECDVKAEENKSKPEERKEKVVEEQARRYQLDVLEQAKAKNTIAFLETGAGKTLIAIL
FT                   LIKSVHKDLMSQNRKMLSVFLVPKVPLVYQQAEVIRNQTCFQVGHYCGEMGQDFWDSRR
FT                   WQREFESKQVLVMTAQILLNILRHSIIRMETIDLLILDECHHAVKKHPYSLVMSEFYHT
FT                   TPKDKRPAIFGMTASPVNLKGVSSQVDCAIKIRNLETKLDSTVCTIKDRKELEKHVPMP
FT                   SEIVVEYDKAATMWSLHETIKQMIAAVEEAAQASSRKSKWQFMGARDAGAKDELRQVYG
FT                   VSERTESDGAANLIHKLRAINYTLAELGQWCAYKVGQSFLSALQSDERVNFQVDVKFQE
FT                   SYLSEVVSLLQCELLEGAAAEKVAAEVGKPENGNAHDEMEEGELPDDPVVSGGEHVDEV
FT                   IGAAVADGKVTPKVQSLIKLLLKYQHTADFRAIVFVERVVAALVLPKVFAELPSLSFIR
FT                   CASMIGHNNSQEMKSSQMQDTISKFRDGHVTLLVATSVAEEGLDIRQCNVVMRFDLAKT
FT                   VLAYIQSRGRARKPGSDYILMVERGNVSHAAFLRNARNSEETLRKEAIERTDLSHLKDT
FT                   SRLISIDAVPGTVYKVEATGAMVSLNSAVGLVHFYCSQLPGDRYAILRPEFSMEKHEKP
FT                   GGHTEYSCRLQLPCNAPFEILEGPVCSSMRLAQQAVCLAACKKLHEMGAFTDMLLPDKG
FT                   SGQDAEKADQDDEGEPVPGTARHREFYPEGVADVLKGEWVSSGKEVCESSKLFHLYMYN
FT                   VRCVDFGSSKDPFLSEVSEFAILFGNELDAEVVLSMSMDLYVARAMITKASLAFKGSLD
FT                   ITENQLSSLKKFHVRLMSIVLDVDVEPSTTPWDPAKAYLFVPVTDNTSMEPIKGINWEL
FT                   VEKITKTTAWDNPLQRARPDVYLGTNERTLGGDRREYGFGKLRHNIVFGQKSHPTYGIR
FT                   GAVASFDVVRASGLLPVRDAFEKEVEEDLSKGKLMMADGCMVAEDLIGKIVTAAHSGKR
FT                   FYVDSICYDMSAETSFPRKEGYLGPLEYNTYADYYKQKYGVDLNCKQQPLIKGRGVSYC
FT                   KNLLSPRFEQSGESETVLDKTYYVFLPPELCVVHPLSGSLIRGAQRLPSIMRRVESMLL
FT                   AVQLKNLISYPIPTSKILEALTAASCQETFCYERAELLGDAYLKWVVSRFLFLKYPQKH
FT                   EGQLTRMRQQMVSNMVLYQFALVKGLQSYIQADRFAPSRWSAPGVPPVFDEDTKDGGSS
FT                   FFDEEQKPVSEENSDVFEDGEMEDGELEGDLSSYRVLSSKTLADVVEALIGVYYVEGGK
FT                   IAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVLKSIDFVGLERALKYEFKEKGLLVE
FT                   AITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFFTYTSLPPGRLTDLRAAAVNNENF
FT                   ARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGFNSFGLGDCKAPKVLGDIVE
FT                   SIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQAEGLEYKASR
FT                   SGNTATVEVFIDGVQVGVAQNPQKKMAQKLAARNALAALKEKEIAESKEKHINNGNAGE
FT                   DQGENENGNKKNGHQPFTRQTLNDICLRKNWPMPSYRCVKEGGPAHAKRFTFGVRVNTS
FT                   DRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKTFS"
FT   CDS_pept        join(23519..24451,24542..24655,24752..24962,25041..25435,
FT                   25524..25743,25825..25997,26081..26203,26292..26452,
FT                   26543..26776,26862..27012,27099..27281,27372..27533,
FT                   27618..27713,27803..28431,28708..28805,28890..29080,
FT                   29160..30065,30147..30311,30410..30816,30902..31079)
FT                   /codon_start=1
FT                   /gene="DCL1"
FT                   /gene_synonym="ABNORMAL SUSPENSOR 1"
FT                   /gene_synonym="ASU1"
FT                   /gene_synonym="ATDCL1"
FT                   /gene_synonym="CAF"
FT                   /gene_synonym="CARPEL FACTORY"
FT                   /gene_synonym="dicer-like 1"
FT                   /gene_synonym="DICER-LIKE 1"
FT                   /gene_synonym="EMB60"
FT                   /gene_synonym="EMB76"
FT                   /gene_synonym="EMBRYO DEFECTIVE 60"
FT                   /gene_synonym="EMBRYO DEFECTIVE 76"
FT                   /gene_synonym="SHORT INTEGUMENTS 1"
FT                   /gene_synonym="SIN1"
FT                   /gene_synonym="SUS1"
FT                   /gene_synonym="SUSPENSOR 1"
FT                   /gene_synonym="T25K16.4"
FT                   /gene_synonym="T25K16_4"
FT                   /locus_tag="AT1G01040"
FT                   /product="dicer-like 1"
FT                   /note="dicer-like 1 (DCL1); CONTAINS InterPro DOMAIN/s:
FT                   Restriction endonuclease, type I, R subunit/Type III, Res
FT                   subunit (InterPro:IPR006935), Double-stranded RNA-binding
FT                   (InterPro:IPR001159), Argonaute/Dicer protein, PAZ
FT                   (InterPro:IPR003100), Ribonuclease III
FT                   (InterPro:IPR000999), Double-stranded RNA-binding-like
FT                   (InterPro:IPR014720), DEAD-like helicase, N-terminal
FT                   (InterPro:IPR014001), DNA/RNA helicase, C-terminal
FT                   (InterPro:IPR001650), Helicase, superfamily 1/2,
FT                   ATP-binding domain (InterPro:IPR014021), Dicer
FT                   double-stranded RNA-binding fold (InterPro:IPR005034); BEST
FT                   Arabidopsis thaliana protein match is: dicer-like 3
FT                   (TAIR:AT3G43920.2); Has 21958 Blast hits to 17420 proteins
FT                   in 2982 species: Archae - 328; Bacteria - 11461; Metazoa -
FT                   3615; Fungi - 1668; Plants - 1373; Viruses - 45; Other
FT                   Eukaryotes - 3468 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9SP32"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003100"
FT                   /db_xref="InterPro:IPR005034"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036085"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="InterPro:IPR038248"
FT                   /db_xref="PDB:2LRS"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SP32"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH948322.1,INSD:EH830906.1,INSD:EG522515.1,
FT                   INSD:BP571785.1,INSD:AI100063.1,INSD:EL120669.1,
FT                   INSD:EH988836.1,INSD:DR373797.1,INSD:BP629851.1,
FT                   INSD:AI996152.1,INSD:EH866522.1,INSD:EL096532.1,
FT                   INSD:EL281260.1,INSD:AV806514.1,INSD:AV815743.1,
FT                   INSD:ES104193.1,INSD:AV783898.1,INSD:DR380507.1,
FT                   INSD:BP575972.1,INSD:ES185316.1,INSD:H36434.1,
FT                   INSD:ES210801.1,INSD:BP563653.1,INSD:EH902174.1,
FT                   INSD:Z29202.1,INSD:BP789125.1,INSD:BP655894.1,
FT                   INSD:EL137132.1,INSD:BP568979.1,INSD:BP783219.1,
FT                   INSD:ES098400.1,INSD:BP787533.1,INSD:EH971167.1,
FT                   INSD:AV787299.1,INSD:AV781745.1,INSD:EH901232.1,
FT                   INSD:AV535286.1,INSD:BU636534.1,INSD:ES159107.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF187317.1,INSD:AF292940.1"
FT                   /protein_id="AEE27220.1"
FT                   /translation="MVMEDEPREATIKPSYWLDACEDISCDLIDDLVSEFDPSSVAVNE
FT                   STDENGVINDFFGGIDHILDSIKNGGGLPNNGVSDTNSQINEVTVTPQVIAKETVKENG
FT                   LQKNGGKRDEFSKEEGDKDRKRARVCSYQSERSNLSGRGHVNNSREGDRFMNRKRTRNW
FT                   DEAGNNKKKRECNNYRRDGRDREVRGYWERDKVGSNELVYRSGTWEADHERDVKKVSGG
FT                   NRECDVKAEENKSKPEERKEKVVEEQARRYQLDVLEQAKAKNTIAFLETGAGKTLIAIL
FT                   LIKSVHKDLMSQNRKMLSVFLVPKVPLVYQQAEVIRNQTCFQVGHYCGEMGQDFWDSRR
FT                   WQREFESKQVLVMTAQILLNILRHSIIRMETIDLLILDECHHAVKKHPYSLVMSEFYHT
FT                   TPKDKRPAIFGMTASPVNLKGVSSQVDCAIKIRNLETKLDSTVCTIKDRKELEKHVPMP
FT                   SEIVVEYDKAATMWSLHETIKQMIAAVEEAAQASSRKSKWQFMGARDAGAKDELRQVYG
FT                   VSERTESDGAANLIHKLRAINYTLAELGQWCAYKVGQSFLSALQSDERVNFQVDVKFQE
FT                   SYLSEVVSLLQCELLEGAAAEKVAAEVGKPENGNAHDEMEEGELPDDPVVSGGEHVDEV
FT                   IGAAVADGKVTPKVQSLIKLLLKYQHTADFRAIVFVERVVAALVLPKVFAELPSLSFIR
FT                   CASMIGHNNSQEMKSSQMQDTISKFRDGHVTLLVATSVAEEGLDIRQCNVVMRFDLAKT
FT                   VLAYIQSRGRARKPGSDYILMVERGNVSHAAFLRNARNSEETLRKEAIERTDLSHLKDT
FT                   SRLISIDAVPGTVYKVEATGAMVSLNSAVGLVHFYCSQLPGDRYAILRPEFSMEKHEKP
FT                   GGHTEYSCRLQLPCNAPFEILEGPVCSSMRLAQQAVCLAACKKLHEMGAFTDMLLPDKG
FT                   SGQDAEKADQDDEGEPVPGTARHREFYPEGVADVLKGEWVSSGKEVCESSKLFHLYMYN
FT                   VRCVDFGSSKDPFLSEVSEFAILFGNELDAEVLSMSMDLYVARAMITKASLAFKGSLDI
FT                   TENQLSSLKKFHVRLMSIVLDVDVEPSTTPWDPAKAYLFVPVTDNTSMEPIKGINWELV
FT                   EKITKTTAWDNPLQRARPDVYLGTNERTLGGDRREYGFGKLRHNIVFGQKSHPTYGIRG
FT                   AVASFDVVRASGLLPVRDAFEKEVEEDLSKGKLMMADGCMVAEDLIGKIVTAAHSGKRF
FT                   YVDSICYDMSAETSFPRKEGYLGPLEYNTYADYYKQKYGVDLNCKQQPLIKGRGVSYCK
FT                   NLLSPRFEQSGESETVLDKTYYVFLPPELCVVHPLSGSLIRGAQRLPSIMRRVESMLLA
FT                   VQLKNLISYPIPTSKILEALTAASCQETFCYERAELLGDAYLKWVVSRFLFLKYPQKHE
FT                   GQLTRMRQQMVSNMVLYQFALVKGLQSYIQADRFAPSRWSAPGVPPVFDEDTKDGGSSF
FT                   FDEEQKPVSEENSDVFEDGEMEDGELEGDLSSYRVLSSKTLADVVEALIGVYYVEGGKI
FT                   AANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVLKSIDFVGLERALKYEFKEKGLLVEA
FT                   ITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFFTYTSLPPGRLTDLRAAAVNNENFA
FT                   RVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGFNSFGLGDCKAPKVLGDIVES
FT                   IAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQAEGLEYKASRS
FT                   GNTATVEVFIDGVQVGVAQNPQKKMAQKLAARNALAALKEKEIAESKEKHINNGNAGED
FT                   QGENENGNKKNGHQPFTRQTLNDICLRKNWPMPSYRCVKEGGPAHAKRFTFGVRVNTSD
FT                   RGWTDECIGEPMPSVKKAKDSAAVLLLELLNKTFS"
FT   gene            28500..28706
FT                   /gene="MIR838"
FT                   /gene_synonym="microRNA838A"
FT                   /gene_synonym="MIR838A"
FT                   /gene_synonym="p_MI0005394"
FT                   /locus_tag="AT1G01046"
FT                   /note="Encodes a microRNA of unknown function. MicroRNAs
FT                   are regulatory RNAs with a mature length of 21-nucleotides
FT                   that are processed from hairpin precursors by Dicer-like
FT                   enzymes. MicroRNAs can negatively regulate gene expression
FT                   by attenuating translation or by directing mRNA cleavage.
FT                   Mature sequence: UUUUCUUCUACUUCUUGCACA"
FT   precursor_RNA   28500..28706
FT                   /gene="MIR838"
FT                   /gene_synonym="microRNA838A"
FT                   /gene_synonym="MIR838A"
FT                   /gene_synonym="p_MI0005394"
FT                   /locus_tag="AT1G01046"
FT                   /product="microRNA ath-MIR838 precursor"
FT   ncRNA           28635..28655
FT                   /gene="MIR838"
FT                   /gene_synonym="microRNA838A"
FT                   /gene_synonym="MIR838A"
FT                   /gene_synonym="p_MI0005394"
FT                   /locus_tag="AT1G01046"
FT                   /product="microRNA ath-miR838"
FT                   /note="mature miRNA accession:MIMAT0004260"
FT                   /ncRNA_class="miRNA"
FT   gene            complement(31170..33171)
FT                   /gene="PPa1"
FT                   /gene_synonym="AtPPa1"
FT                   /gene_synonym="pyrophosphorylase 1"
FT                   /gene_synonym="T25K16.5"
FT                   /gene_synonym="T25K16_5"
FT                   /locus_tag="AT1G01050"
FT                   /note="Encodes a soluble protein with inorganic
FT                   pyrophosphatase activity that is highly specific for
FT                   Mg-inorganic pyrophosphate."
FT   mRNA            complement(join(31170..31424,31521..31602,31693..31813,
FT                   31933..31998,32088..32195,32282..32347,32431..32459,
FT                   32547..32670,33029..33171))
FT                   /gene="PPa1"
FT                   /gene_synonym="AtPPa1"
FT                   /gene_synonym="pyrophosphorylase 1"
FT                   /gene_synonym="T25K16.5"
FT                   /gene_synonym="T25K16_5"
FT                   /locus_tag="AT1G01050"
FT                   /product="pyrophosphorylase 1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG522515.1,INSD:EL059006.1,INSD:BP571785.1,
FT                   INSD:AV824702.1,INSD:ES089629.1,INSD:DR243199.1,
FT                   INSD:EL113114.1,INSD:EL245240.1,INSD:DR243195.1,
FT                   INSD:ES077272.1,INSD:ES070901.1,INSD:DR243202.1,
FT                   INSD:AV550260.1,INSD:AA651141.1,INSD:EL107286.1,
FT                   INSD:ES044197.1,INSD:EL192394.1,INSD:AV783898.1,
FT                   INSD:EH829812.1,INSD:ES102149.1,INSD:AV538108.1,
FT                   INSD:EL983594.1,INSD:EH994199.1,INSD:DR243196.1,
FT                   INSD:BP789125.1,INSD:ES210908.1,INSD:BP843121.1,
FT                   INSD:BP560532.2,INSD:BP655894.1,INSD:BP783219.1,
FT                   INSD:BP787533.1,INSD:ES013757.1,INSD:CB255415.1,
FT                   INSD:EL046866.1,INSD:DR243203.1,INSD:ES068352.1,
FT                   INSD:EL163299.1,INSD:EH830906.1,INSD:AV823010.1,
FT                   INSD:EH882263.1,INSD:DR373797.1,INSD:BP629851.1,
FT                   INSD:EH948412.1,INSD:ES152334.1,INSD:EH866522.1,
FT                   INSD:EL035678.1,INSD:AV806514.1,INSD:ES215833.1,
FT                   INSD:EH869605.1,INSD:BP561551.2,INSD:EH802646.1,
FT                   INSD:EH851524.1,INSD:DR243197.1,INSD:EH986917.1,
FT                   INSD:ES078505.1,INSD:T76782.1,INSD:EL330414.1,
FT                   INSD:CK118158.1,INSD:ES179229.1,INSD:ES210801.1,
FT                   INSD:EH841510.1,INSD:ES160062.1,INSD:EH902174.1,
FT                   INSD:EL056989.1,INSD:ES212464.1,INSD:EH889916.1,
FT                   INSD:DR243201.1,INSD:EL197398.1,INSD:Z29202.1,
FT                   INSD:EL198551.1,INSD:DR243200.1,INSD:AI994013.1,
FT                   INSD:ES078471.1,INSD:ES113165.1,INSD:ES098400.1,
FT                   INSD:EH796247.1,INSD:AV787299.1,INSD:EH901232.1,
FT                   INSD:AV535286.1,INSD:BP797802.1,INSD:AV549347.1,
FT                   INSD:AV561492.1,INSD:EH994184.1,INSD:N97307.1,
FT                   INSD:EL027766.1,INSD:AI994042.1,INSD:ES159107.1,
FT                   INSD:EL222213.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX841824.1,INSD:AK226833.1,INSD:AY085015.1,
FT                   INSD:AY081555.1,INSD:AY057668.1,INSD:AY065201.1,
FT                   INSD:BT001144.1,INSD:AY052717.1"
FT   mRNA            complement(join(31382..31424,31521..31602,31693..31813,
FT                   31933..31998,32088..32195,32282..32347,32431..32459,
FT                   32547..32670,32839..33009))
FT                   /gene="PPa1"
FT                   /gene_synonym="AtPPa1"
FT                   /gene_synonym="pyrophosphorylase 1"
FT                   /gene_synonym="T25K16.5"
FT                   /gene_synonym="T25K16_5"
FT                   /locus_tag="AT1G01050"
FT                   /product="pyrophosphorylase 1"
FT   CDS_pept        complement(join(31382..31424,31521..31602,31693..31813,
FT                   31933..31998,32088..32195,32282..32347,32431..32459,
FT                   32547..32670))
FT                   /codon_start=1
FT                   /gene="PPa1"
FT                   /gene_synonym="AtPPa1"
FT                   /gene_synonym="pyrophosphorylase 1"
FT                   /gene_synonym="T25K16.5"
FT                   /gene_synonym="T25K16_5"
FT                   /locus_tag="AT1G01050"
FT                   /product="pyrophosphorylase 1"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01050"
FT                   /db_xref="GOA:Q93V56"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="PDB:4LUG"
FT                   /db_xref="PDB:5LS0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93V56"
FT                   /protein_id="ANM60177.1"
FT                   /translation="MSEETKDNQRLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGA
FT                   PQIFNVVVEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDV
FT                   LVIMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLS
FT                   EIRRFFEDYKKNENKEVAVNDFLPSESAVEAIQYSMDLYAEYILHTLRR"
FT   CDS_pept        complement(join(31382..31424,31521..31602,31693..31813,
FT                   31933..31998,32088..32195,32282..32347,32431..32459,
FT                   32547..32670))
FT                   /codon_start=1
FT                   /gene="PPa1"
FT                   /gene_synonym="AtPPa1"
FT                   /gene_synonym="pyrophosphorylase 1"
FT                   /gene_synonym="T25K16.5"
FT                   /gene_synonym="T25K16_5"
FT                   /locus_tag="AT1G01050"
FT                   /product="pyrophosphorylase 1"
FT                   /note="pyrophosphorylase 1 (PPa1); FUNCTIONS IN: inorganic
FT                   diphosphatase activity; INVOLVED IN: phosphate metabolic
FT                   process, metabolic process; LOCATED IN: nucleus, membrane,
FT                   cytoplasm; EXPRESSED IN: 24 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Inorganic pyrophosphatase (InterPro:IPR008162); BEST
FT                   Arabidopsis thaliana protein match is: pyrophosphorylase 3
FT                   (TAIR:AT2G46860.1); Has 5987 Blast hits to 5987 proteins in
FT                   1845 species: Archae - 172; Bacteria - 4313; Metazoa - 247;
FT                   Fungi - 261; Plants - 270; Viruses - 0; Other Eukaryotes -
FT                   724 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q93V56"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="PDB:4LUG"
FT                   /db_xref="PDB:5LS0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93V56"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG522515.1,INSD:EL059006.1,INSD:BP571785.1,
FT                   INSD:AV824702.1,INSD:ES089629.1,INSD:DR243199.1,
FT                   INSD:EL113114.1,INSD:EL245240.1,INSD:DR243195.1,
FT                   INSD:ES077272.1,INSD:ES070901.1,INSD:DR243202.1,
FT                   INSD:AV550260.1,INSD:AA651141.1,INSD:EL107286.1,
FT                   INSD:ES044197.1,INSD:EL192394.1,INSD:AV783898.1,
FT                   INSD:EH829812.1,INSD:ES102149.1,INSD:AV538108.1,
FT                   INSD:EL983594.1,INSD:EH994199.1,INSD:DR243196.1,
FT                   INSD:BP789125.1,INSD:ES210908.1,INSD:BP843121.1,
FT                   INSD:BP560532.2,INSD:BP655894.1,INSD:BP783219.1,
FT                   INSD:BP787533.1,INSD:ES013757.1,INSD:CB255415.1,
FT                   INSD:EL046866.1,INSD:DR243203.1,INSD:ES068352.1,
FT                   INSD:EL163299.1,INSD:EH830906.1,INSD:AV823010.1,
FT                   INSD:EH882263.1,INSD:DR373797.1,INSD:BP629851.1,
FT                   INSD:EH948412.1,INSD:ES152334.1,INSD:EH866522.1,
FT                   INSD:EL035678.1,INSD:AV806514.1,INSD:ES215833.1,
FT                   INSD:EH869605.1,INSD:BP561551.2,INSD:EH802646.1,
FT                   INSD:EH851524.1,INSD:DR243197.1,INSD:EH986917.1,
FT                   INSD:ES078505.1,INSD:T76782.1,INSD:EL330414.1,
FT                   INSD:CK118158.1,INSD:ES179229.1,INSD:ES210801.1,
FT                   INSD:EH841510.1,INSD:ES160062.1,INSD:EH902174.1,
FT                   INSD:EL056989.1,INSD:ES212464.1,INSD:EH889916.1,
FT                   INSD:DR243201.1,INSD:EL197398.1,INSD:Z29202.1,
FT                   INSD:EL198551.1,INSD:DR243200.1,INSD:AI994013.1,
FT                   INSD:ES078471.1,INSD:ES113165.1,INSD:ES098400.1,
FT                   INSD:EH796247.1,INSD:AV787299.1,INSD:EH901232.1,
FT                   INSD:AV535286.1,INSD:BP797802.1,INSD:AV549347.1,
FT                   INSD:AV561492.1,INSD:EH994184.1,INSD:N97307.1,
FT                   INSD:EL027766.1,INSD:AI994042.1,INSD:ES159107.1,
FT                   INSD:EL222213.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX841824.1,INSD:AK226833.1,INSD:AY085015.1,
FT                   INSD:AY081555.1,INSD:AY057668.1,INSD:AY065201.1,
FT                   INSD:BT001144.1,INSD:AY052717.1"
FT                   /protein_id="AEE27222.1"
FT                   /translation="MSEETKDNQRLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGA
FT                   PQIFNVVVEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDV
FT                   LVIMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLS
FT                   EIRRFFEDYKKNENKEVAVNDFLPSESAVEAIQYSMDLYAEYILHTLRR"
FT   gene            32727..33009
FT                   /locus_tag="AT1G03997"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT1G01050"
FT   ncRNA           32727..33009
FT                   /locus_tag="AT1G03997"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(33365..37871)
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /note="LHY encodes a myb-related putative transcription
FT                   factor involved in circadian rhythm along with another myb
FT                   transcription factor CCA1"
FT   mRNA            complement(join(33365..33589,33981..34327,34401..35474,
FT                   35567..35647,35730..35999,36090..36171,36624..36685,
FT                   36810..36921,37023..37203,37373..37871))
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT   mRNA            complement(join(33379..33589,33981..34327,34401..35474,
FT                   35567..35647,35730..35963,36624..36685,36810..36921,
FT                   37023..37203,37373..37398,37569..37757))
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY519507.1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR262753.1,INSD:EG520850.1,INSD:AV442073.1,
FT                   INSD:EL285160.1,INSD:EH811528.1,INSD:AV821864.1,
FT                   INSD:AV793100.1,INSD:EL221576.1,INSD:AV807028.1,
FT                   INSD:AA713203.1,INSD:AV809310.1,INSD:AA650979.1,
FT                   INSD:AV786398.1,INSD:EG465569.1,INSD:AV793959.1,
FT                   INSD:EL071273.1,INSD:BP787483.1,INSD:AV805408.1,
FT                   INSD:AV439916.1,INSD:DR750570.1,INSD:CF773267.1,
FT                   INSD:R30439.1,INSD:AV525957.1,INSD:DR750341.1,
FT                   INSD:EG517069.1,INSD:EH853476.1,INSD:EH957137.1,
FT                   INSD:BP793781.1,INSD:AV518592.1,INSD:DR262755.1,
FT                   INSD:BP611805.1,INSD:DN604658.1,INSD:EL210103.1,
FT                   INSD:BP783401.1,INSD:AV519727.1,INSD:EH965397.1,
FT                   INSD:BX836221.1,INSD:AV794517.1,INSD:EH897895.1,
FT                   INSD:BP785164.1,INSD:ES162100.1,INSD:AV519209.1,
FT                   INSD:DR750333.1,INSD:EL125752.1,INSD:EG520849.1,
FT                   INSD:EG517068.1,INSD:EL187904.1,INSD:EL098580.1,
FT                   INSD:EH906782.1,INSD:EL269840.1,INSD:EL310869.1,
FT                   INSD:AV816640.1,INSD:EH922478.1,INSD:BX835664.1,
FT                   INSD:EL011803.1,INSD:EH968369.1,INSD:EL201800.1,
FT                   INSD:EL206414.1,INSD:AV792580.1,INSD:DR750340.1,
FT                   INSD:BP604428.1,INSD:AV519732.1"
FT   mRNA            complement(join(33662..34327,34401..35474,35567..35647,
FT                   35730..35963,36624..36685,36810..36921,37023..37398,
FT                   37569..37871))
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT   mRNA            complement(join(33662..34327,34401..35474,35567..35647,
FT                   35730..35963,36624..36685,36810..36921,37023..37203,
FT                   37373..37398,37569..37840))
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR262753.1,INSD:EG520850.1,INSD:AV442073.1,
FT                   INSD:EL285160.1,INSD:EH811528.1,INSD:AV793100.1,
FT                   INSD:EL221576.1,INSD:AV807028.1,INSD:BX839544.1,
FT                   INSD:AA713203.1,INSD:AV809310.1,INSD:AA650979.1,
FT                   INSD:AV786398.1,INSD:AV793959.1,INSD:EL071273.1,
FT                   INSD:BX840279.1,INSD:BP787483.1,INSD:AV439916.1,
FT                   INSD:AV805408.1,INSD:DR750570.1,INSD:CF773267.1,
FT                   INSD:R30439.1,INSD:AV525957.1,INSD:DR750341.1,
FT                   INSD:EG517069.1,INSD:EH853476.1,INSD:EH957137.1,
FT                   INSD:AV528276.1,INSD:BP793781.1,INSD:AV518592.1,
FT                   INSD:DR262755.1,INSD:BP611805.1,INSD:DN604658.1,
FT                   INSD:EL210103.1,INSD:BP783401.1,INSD:AV519727.1,
FT                   INSD:EH965397.1,INSD:BX836221.1,INSD:AV794517.1,
FT                   INSD:EH897895.1,INSD:BP785164.1,INSD:AV519209.1,
FT                   INSD:DR750333.1,INSD:EL125752.1,INSD:EG520849.1,
FT                   INSD:EG517068.1,INSD:EL187904.1,INSD:EL098580.1,
FT                   INSD:EH906782.1,INSD:EL269840.1,INSD:EL310869.1,
FT                   INSD:AV816640.1,INSD:EH922478.1,INSD:BX835664.1,
FT                   INSD:EL011803.1,INSD:EH968369.1,INSD:EL201800.1,
FT                   INSD:EL206414.1,INSD:AV792580.1,INSD:DR750340.1,
FT                   INSD:BP604428.1,INSD:AV519732.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AJ006404.1,INSD:AY519507.1,INSD:BX817115.1"
FT   mRNA            complement(join(33666..34327,34401..35471,35567..35647,
FT                   35730..35963,36624..36685,36810..36921,37023..37203,
FT                   37373..37398,37569..37780))
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR262753.1,INSD:AV528276.1,INSD:AV442073.1,
FT                   INSD:EH811528.1,INSD:DR262755.1,INSD:EL210103.1,
FT                   INSD:EL221576.1,INSD:DN604658.1,INSD:BX839544.1,
FT                   INSD:EL125752.1,INSD:DR750333.1,INSD:EG517068.1,
FT                   INSD:EL187904.1,INSD:EL098580.1,INSD:EL071273.1,
FT                   INSD:EH906782.1,INSD:EL269840.1,INSD:EL310869.1,
FT                   INSD:BP781603.1,INSD:BX840279.1,INSD:EL011803.1,
FT                   INSD:EH968369.1,INSD:EL201800.1,INSD:DR750570.1,
FT                   INSD:DR750340.1,INSD:R30439.1,INSD:AV525957.1,
FT                   INSD:DR750341.1,INSD:EG517069.1,INSD:BP790455.1,
FT                   INSD:BP782731.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY519507.1"
FT   mRNA            complement(join(33666..34327,34401..35474,35567..35647,
FT                   35730..35963,36624..36685,36810..36921,37023..37203,
FT                   37373..37780))
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR262753.1,INSD:EG520850.1,INSD:AV442073.1,
FT                   INSD:EL285160.1,INSD:EH811528.1,INSD:AV793100.1,
FT                   INSD:EL221576.1,INSD:AV807028.1,INSD:BX839544.1,
FT                   INSD:DR262754.1,INSD:AA713203.1,INSD:AV809310.1,
FT                   INSD:AA650979.1,INSD:AV786398.1,INSD:AV793959.1,
FT                   INSD:EL071273.1,INSD:BX840279.1,INSD:BP787483.1,
FT                   INSD:AV805408.1,INSD:AV439916.1,INSD:DR750570.1,
FT                   INSD:CF773267.1,INSD:R30439.1,INSD:AV525957.1,
FT                   INSD:DR750341.1,INSD:EG517069.1,INSD:EH853476.1,
FT                   INSD:DR262751.1,INSD:EH900352.1,INSD:EH957137.1,
FT                   INSD:AV528276.1,INSD:BP793781.1,INSD:AV518592.1,
FT                   INSD:DR262755.1,INSD:BP611805.1,INSD:DR262752.1,
FT                   INSD:EL210103.1,INSD:BP783401.1,INSD:AV519727.1,
FT                   INSD:EH965397.1,INSD:BX836221.1,INSD:AV794517.1,
FT                   INSD:EH897895.1,INSD:BP785164.1,INSD:AV519209.1,
FT                   INSD:EL125752.1,INSD:EG520849.1,INSD:EG517068.1,
FT                   INSD:EL187904.1,INSD:EL098580.1,INSD:EH906782.1,
FT                   INSD:EL269840.1,INSD:EL310869.1,INSD:AV816640.1,
FT                   INSD:EH922478.1,INSD:BX835664.1,INSD:EL011803.1,
FT                   INSD:EH968369.1,INSD:EL201800.1,INSD:EL206414.1,
FT                   INSD:AV792580.1,INSD:BP604428.1,INSD:AV519732.1,
FT                   INSD:EL069143.1"
FT   mRNA            complement(join(33967..34327,34401..35474,35567..35647,
FT                   35730..35999,36090..36171,36624..36685,36810..36921,
FT                   37023..37203,37373..37871))
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT   mRNA            complement(join(33967..34327,34401..35474,35567..35647,
FT                   35730..35963,36624..36685,36810..36921,37023..37230))
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT   CDS_pept        complement(join(33992..34327,34401..35471,35567..35647,
FT                   35730..35963,36624..36685,36810..36921,37023..37061))
FT                   /codon_start=1
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /note="LATE ELONGATED HYPOCOTYL (LHY); CONTAINS InterPro
FT                   DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005), Myb,
FT                   DNA-binding (InterPro:IPR014778), Homeodomain-like
FT                   (InterPro:IPR009057), Myb-like DNA-binding domain, SHAQKYF
FT                   class (InterPro:IPR006447), HTH transcriptional regulator,
FT                   Myb-type, DNA-binding (InterPro:IPR017930); BEST
FT                   Arabidopsis thaliana protein match is: circadian clock
FT                   associated 1 (TAIR:AT2G46830.1); Has 2567 Blast hits to
FT                   2041 proteins in 275 species: Archae - 2; Bacteria - 252;
FT                   Metazoa - 294; Fungi - 166; Plants - 1044; Viruses - 30;
FT                   Other Eukaryotes - 779 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01060"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01060.4"
FT                   /db_xref="GOA:F4HQG9"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:F4HQG9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR262753.1,INSD:EG520850.1,INSD:AV442073.1,
FT                   INSD:EL285160.1,INSD:EH811528.1,INSD:AV793100.1,
FT                   INSD:EL221576.1,INSD:AV807028.1,INSD:BX839544.1,
FT                   INSD:DR262754.1,INSD:AA713203.1,INSD:AV809310.1,
FT                   INSD:AA650979.1,INSD:AV786398.1,INSD:AV793959.1,
FT                   INSD:EL071273.1,INSD:BX840279.1,INSD:BP787483.1,
FT                   INSD:AV805408.1,INSD:AV439916.1,INSD:DR750570.1,
FT                   INSD:CF773267.1,INSD:R30439.1,INSD:AV525957.1,
FT                   INSD:DR750341.1,INSD:EG517069.1,INSD:EH853476.1,
FT                   INSD:DR262751.1,INSD:EH900352.1,INSD:EH957137.1,
FT                   INSD:AV528276.1,INSD:BP793781.1,INSD:AV518592.1,
FT                   INSD:DR262755.1,INSD:BP611805.1,INSD:DR262752.1,
FT                   INSD:EL210103.1,INSD:BP783401.1,INSD:AV519727.1,
FT                   INSD:EH965397.1,INSD:BX836221.1,INSD:AV794517.1,
FT                   INSD:EH897895.1,INSD:BP785164.1,INSD:AV519209.1,
FT                   INSD:EL125752.1,INSD:EG520849.1,INSD:EG517068.1,
FT                   INSD:EL187904.1,INSD:EL098580.1,INSD:EH906782.1,
FT                   INSD:EL269840.1,INSD:EL310869.1,INSD:AV816640.1,
FT                   INSD:EH922478.1,INSD:BX835664.1,INSD:EL011803.1,
FT                   INSD:EH968369.1,INSD:EL201800.1,INSD:EL206414.1,
FT                   INSD:AV792580.1,INSD:BP604428.1,INSD:AV519732.1,
FT                   INSD:EL069143.1"
FT                   /protein_id="AEE27226.1"
FT                   /translation="MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRA
FT                   WQRIEEHIGTKTAVQIRSHAQKFFTKLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPY
FT                   PRKPGNNGTSSSQVSSAKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCS
FT                   GVSTVNKYPLPTKVSGDIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHFH
FT                   ADIVNGNIAKCPQNHPSGMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPACH
FT                   SQDDYRSFLQISSTFSNLIMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSSP
FT                   PSITAIAAATVAAATAWWASHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQPF
FT                   EKQNTALQDQNLASKSPASSSDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTAQ
FT                   KKNLVDRSSCGSNTPSGSDAETDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDNN
FT                   SNNNATTDSWKEVSEEGRIAFQALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNFK
FT                   SQDSCAADQEGVVMIGVGTCKSLKTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCKR
FT                   LRLEGEAST"
FT   CDS_pept        complement(join(33992..34327,34401..35474,35567..35647,
FT                   35730..35963,36624..36685,36810..36921,37023..37061))
FT                   /codon_start=1
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /db_xref="GOA:Q6R0H1"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6R0H1"
FT                   /protein_id="ANM58172.1"
FT                   /translation="MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRA
FT                   WQRIEEHIGTKTAVQIRSHAQKFFTKLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPY
FT                   PRKPGNNGTSSSQVSSAKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCS
FT                   GVSTVNKYPLPTKQVSGDIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHF
FT                   HADIVNGNIAKCPQNHPSGMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPAC
FT                   HSQDDYRSFLQISSTFSNLIMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSS
FT                   PPSITAIAAATVAAATAWWASHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQP
FT                   FEKQNTALQDQNLASKSPASSSDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTA
FT                   QKKNLVDRSSCGSNTPSGSDAETDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDN
FT                   NSNNNATTDSWKEVSEEGRIAFQALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNF
FT                   KSQDSCAADQEGVVMIGVGTCKSLKTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCK
FT                   RLRLEGEAST"
FT   CDS_pept        complement(join(33992..34327,34401..35474,35567..35647,
FT                   35730..35963,36624..36685,36810..36921,37023..37061))
FT                   /codon_start=1
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /db_xref="GOA:Q6R0H1"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6R0H1"
FT                   /protein_id="ANM58174.1"
FT                   /translation="MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRA
FT                   WQRIEEHIGTKTAVQIRSHAQKFFTKLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPY
FT                   PRKPGNNGTSSSQVSSAKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCS
FT                   GVSTVNKYPLPTKQVSGDIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHF
FT                   HADIVNGNIAKCPQNHPSGMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPAC
FT                   HSQDDYRSFLQISSTFSNLIMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSS
FT                   PPSITAIAAATVAAATAWWASHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQP
FT                   FEKQNTALQDQNLASKSPASSSDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTA
FT                   QKKNLVDRSSCGSNTPSGSDAETDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDN
FT                   NSNNNATTDSWKEVSEEGRIAFQALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNF
FT                   KSQDSCAADQEGVVMIGVGTCKSLKTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCK
FT                   RLRLEGEAST"
FT   CDS_pept        complement(join(33992..34327,34401..35474,35567..35647,
FT                   35730..35963,36624..36685,36810..36921,37023..37061))
FT                   /codon_start=1
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /note="LATE ELONGATED HYPOCOTYL (LHY); CONTAINS InterPro
FT                   DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005),
FT                   Homeodomain-like (InterPro:IPR009057), Myb, DNA-binding
FT                   (InterPro:IPR014778), HTH transcriptional regulator,
FT                   Myb-type, DNA-binding (InterPro:IPR017930), Myb-like
FT                   DNA-binding domain, SHAQKYF class (InterPro:IPR006447);
FT                   BEST Arabidopsis thaliana protein match is: circadian clock
FT                   associated 1 (TAIR:AT2G46830.1); Has 2469 Blast hits to
FT                   2022 proteins in 280 species: Archae - 2; Bacteria - 257;
FT                   Metazoa - 292; Fungi - 162; Plants - 1048; Viruses - 29;
FT                   Other Eukaryotes - 679 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q6R0H1"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6R0H1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR262753.1,INSD:EG520850.1,INSD:AV442073.1,
FT                   INSD:EL285160.1,INSD:EH811528.1,INSD:AV793100.1,
FT                   INSD:EL221576.1,INSD:AV807028.1,INSD:BX839544.1,
FT                   INSD:AA713203.1,INSD:AV809310.1,INSD:AA650979.1,
FT                   INSD:AV786398.1,INSD:AV793959.1,INSD:EL071273.1,
FT                   INSD:BX840279.1,INSD:BP787483.1,INSD:AV439916.1,
FT                   INSD:AV805408.1,INSD:DR750570.1,INSD:CF773267.1,
FT                   INSD:R30439.1,INSD:AV525957.1,INSD:DR750341.1,
FT                   INSD:EG517069.1,INSD:EH853476.1,INSD:EH957137.1,
FT                   INSD:AV528276.1,INSD:BP793781.1,INSD:AV518592.1,
FT                   INSD:DR262755.1,INSD:BP611805.1,INSD:DN604658.1,
FT                   INSD:EL210103.1,INSD:BP783401.1,INSD:AV519727.1,
FT                   INSD:EH965397.1,INSD:BX836221.1,INSD:AV794517.1,
FT                   INSD:EH897895.1,INSD:BP785164.1,INSD:AV519209.1,
FT                   INSD:DR750333.1,INSD:EL125752.1,INSD:EG520849.1,
FT                   INSD:EG517068.1,INSD:EL187904.1,INSD:EL098580.1,
FT                   INSD:EH906782.1,INSD:EL269840.1,INSD:EL310869.1,
FT                   INSD:AV816640.1,INSD:EH922478.1,INSD:BX835664.1,
FT                   INSD:EL011803.1,INSD:EH968369.1,INSD:EL201800.1,
FT                   INSD:EL206414.1,INSD:AV792580.1,INSD:DR750340.1,
FT                   INSD:BP604428.1,INSD:AV519732.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AJ006404.1,INSD:AY519507.1,INSD:BX817115.1"
FT                   /protein_id="AEE27223.1"
FT                   /translation="MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRA
FT                   WQRIEEHIGTKTAVQIRSHAQKFFTKLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPY
FT                   PRKPGNNGTSSSQVSSAKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCS
FT                   GVSTVNKYPLPTKQVSGDIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHF
FT                   HADIVNGNIAKCPQNHPSGMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPAC
FT                   HSQDDYRSFLQISSTFSNLIMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSS
FT                   PPSITAIAAATVAAATAWWASHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQP
FT                   FEKQNTALQDQNLASKSPASSSDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTA
FT                   QKKNLVDRSSCGSNTPSGSDAETDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDN
FT                   NSNNNATTDSWKEVSEEGRIAFQALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNF
FT                   KSQDSCAADQEGVVMIGVGTCKSLKTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCK
FT                   RLRLEGEAST"
FT   CDS_pept        complement(join(33992..34327,34401..35474,35567..35647,
FT                   35730..35963,36624..36685,36810..36921,37023..37061))
FT                   /codon_start=1
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /note="LATE ELONGATED HYPOCOTYL (LHY); CONTAINS InterPro
FT                   DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005),
FT                   Homeodomain-like (InterPro:IPR009057), Myb, DNA-binding
FT                   (InterPro:IPR014778), HTH transcriptional regulator,
FT                   Myb-type, DNA-binding (InterPro:IPR017930), Myb-like
FT                   DNA-binding domain, SHAQKYF class (InterPro:IPR006447);
FT                   BEST Arabidopsis thaliana protein match is: circadian clock
FT                   associated 1 (TAIR:AT2G46830.1); Has 2469 Blast hits to
FT                   2022 proteins in 280 species: Archae - 2; Bacteria - 257;
FT                   Metazoa - 292; Fungi - 162; Plants - 1048; Viruses - 29;
FT                   Other Eukaryotes - 679 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q6R0H1"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6R0H1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR262753.1,INSD:EG520850.1,INSD:AV442073.1,
FT                   INSD:EL285160.1,INSD:EH811528.1,INSD:AV821864.1,
FT                   INSD:AV793100.1,INSD:EL221576.1,INSD:AV807028.1,
FT                   INSD:AA713203.1,INSD:AV809310.1,INSD:AA650979.1,
FT                   INSD:AV786398.1,INSD:EG465569.1,INSD:AV793959.1,
FT                   INSD:EL071273.1,INSD:BP787483.1,INSD:AV805408.1,
FT                   INSD:AV439916.1,INSD:DR750570.1,INSD:CF773267.1,
FT                   INSD:R30439.1,INSD:AV525957.1,INSD:DR750341.1,
FT                   INSD:EG517069.1,INSD:EH853476.1,INSD:EH957137.1,
FT                   INSD:BP793781.1,INSD:AV518592.1,INSD:DR262755.1,
FT                   INSD:BP611805.1,INSD:DN604658.1,INSD:EL210103.1,
FT                   INSD:BP783401.1,INSD:AV519727.1,INSD:EH965397.1,
FT                   INSD:BX836221.1,INSD:AV794517.1,INSD:EH897895.1,
FT                   INSD:BP785164.1,INSD:ES162100.1,INSD:AV519209.1,
FT                   INSD:DR750333.1,INSD:EL125752.1,INSD:EG520849.1,
FT                   INSD:EG517068.1,INSD:EL187904.1,INSD:EL098580.1,
FT                   INSD:EH906782.1,INSD:EL269840.1,INSD:EL310869.1,
FT                   INSD:AV816640.1,INSD:EH922478.1,INSD:BX835664.1,
FT                   INSD:EL011803.1,INSD:EH968369.1,INSD:EL201800.1,
FT                   INSD:EL206414.1,INSD:AV792580.1,INSD:DR750340.1,
FT                   INSD:BP604428.1,INSD:AV519732.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY519507.1"
FT                   /protein_id="AEE27224.1"
FT                   /translation="MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRA
FT                   WQRIEEHIGTKTAVQIRSHAQKFFTKLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPY
FT                   PRKPGNNGTSSSQVSSAKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCS
FT                   GVSTVNKYPLPTKQVSGDIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHF
FT                   HADIVNGNIAKCPQNHPSGMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPAC
FT                   HSQDDYRSFLQISSTFSNLIMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSS
FT                   PPSITAIAAATVAAATAWWASHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQP
FT                   FEKQNTALQDQNLASKSPASSSDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTA
FT                   QKKNLVDRSSCGSNTPSGSDAETDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDN
FT                   NSNNNATTDSWKEVSEEGRIAFQALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNF
FT                   KSQDSCAADQEGVVMIGVGTCKSLKTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCK
FT                   RLRLEGEAST"
FT   CDS_pept        complement(join(33992..34327,34401..35474,35567..35647,
FT                   35730..35963,36624..36685,36810..36921,37023..37061))
FT                   /codon_start=1
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /note="LATE ELONGATED HYPOCOTYL (LHY); CONTAINS InterPro
FT                   DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005),
FT                   Homeodomain-like (InterPro:IPR009057), Myb, DNA-binding
FT                   (InterPro:IPR014778), HTH transcriptional regulator,
FT                   Myb-type, DNA-binding (InterPro:IPR017930), Myb-like
FT                   DNA-binding domain, SHAQKYF class (InterPro:IPR006447);
FT                   BEST Arabidopsis thaliana protein match is: circadian clock
FT                   associated 1 (TAIR:AT2G46830.1); Has 35333 Blast hits to
FT                   34131 proteins in 2444 species: Archae - 798; Bacteria -
FT                   22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses -
FT                   0; Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01060"
FT                   /db_xref="GOA:Q6R0H1"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6R0H1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR262753.1,INSD:AV528276.1,INSD:AV442073.1,
FT                   INSD:EH811528.1,INSD:DR262755.1,INSD:EL210103.1,
FT                   INSD:EL221576.1,INSD:DN604658.1,INSD:BX839544.1,
FT                   INSD:EL125752.1,INSD:DR750333.1,INSD:EG517068.1,
FT                   INSD:EL187904.1,INSD:EL098580.1,INSD:EL071273.1,
FT                   INSD:EH906782.1,INSD:EL269840.1,INSD:EL310869.1,
FT                   INSD:BP781603.1,INSD:BX840279.1,INSD:EL011803.1,
FT                   INSD:EH968369.1,INSD:EL201800.1,INSD:DR750570.1,
FT                   INSD:DR750340.1,INSD:R30439.1,INSD:AV525957.1,
FT                   INSD:DR750341.1,INSD:EG517069.1,INSD:BP790455.1,
FT                   INSD:BP782731.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY519507.1"
FT                   /protein_id="AEE27225.1"
FT                   /translation="MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRA
FT                   WQRIEEHIGTKTAVQIRSHAQKFFTKLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPY
FT                   PRKPGNNGTSSSQVSSAKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCS
FT                   GVSTVNKYPLPTKQVSGDIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHF
FT                   HADIVNGNIAKCPQNHPSGMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPAC
FT                   HSQDDYRSFLQISSTFSNLIMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSS
FT                   PPSITAIAAATVAAATAWWASHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQP
FT                   FEKQNTALQDQNLASKSPASSSDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTA
FT                   QKKNLVDRSSCGSNTPSGSDAETDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDN
FT                   NSNNNATTDSWKEVSEEGRIAFQALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNF
FT                   KSQDSCAADQEGVVMIGVGTCKSLKTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCK
FT                   RLRLEGEAST"
FT   CDS_pept        complement(join(33992..34327,34401..35474,35567..35647,
FT                   35730..35999,36090..36171,36624..36685,36810..36836))
FT                   /codon_start=1
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01060"
FT                   /db_xref="GOA:F4HQH3"
FT                   /db_xref="UniProtKB/TrEMBL:F4HQH3"
FT                   /protein_id="ANM58173.1"
FT                   /translation="MEELGNELKNILGQRLLFRSEVMHKSSSQSHPYGNQTSLPYRTGH
FT                   EVTLSSLPRKIRFGKAHSFWFTFQLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPYPR
FT                   KPGNNGTSSSQVSSAKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCSGV
FT                   STVNKYPLPTKQVSGDIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHFHA
FT                   DIVNGNIAKCPQNHPSGMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPACHS
FT                   QDDYRSFLQISSTFSNLIMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSSPP
FT                   SITAIAAATVAAATAWWASHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQPFE
FT                   KQNTALQDQNLASKSPASSSDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTAQK
FT                   KNLVDRSSCGSNTPSGSDAETDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDNNS
FT                   NNNATTDSWKEVSEEGRIAFQALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNFKS
FT                   QDSCAADQEGVVMIGVGTCKSLKTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCKRL
FT                   RLEGEAST"
FT   CDS_pept        complement(join(33992..34327,34401..35474,35567..35647,
FT                   35730..35999,36090..36171,36624..36685,36810..36836))
FT                   /codon_start=1
FT                   /gene="LHY"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL"
FT                   /gene_synonym="LATE ELONGATED HYPOCOTYL 1"
FT                   /gene_synonym="LHY1"
FT                   /gene_synonym="T25K16.6"
FT                   /gene_synonym="T25K16_6"
FT                   /locus_tag="AT1G01060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /note="LATE ELONGATED HYPOCOTYL (LHY); FUNCTIONS IN: DNA
FT                   binding, sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: in 11 processes; EXPRESSED IN: 22
FT                   plant structures; EXPRESSED DURING: 13 growth stages; BEST
FT                   Arabidopsis thaliana protein match is: circadian clock
FT                   associated 1 (TAIR:AT2G46830.1)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01060.5"
FT                   /db_xref="GOA:F4HQH3"
FT                   /db_xref="UniProtKB/TrEMBL:F4HQH3"
FT                   /protein_id="AEE27227.1"
FT                   /translation="MEELGNELKNILGQRLLFRSEVMHKSSSQSHPYGNQTSLPYRTGH
FT                   EVTLSSLPRKIRFGKAHSFWFTFQLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPYPR
FT                   KPGNNGTSSSQVSSAKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCSGV
FT                   STVNKYPLPTKQVSGDIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHFHA
FT                   DIVNGNIAKCPQNHPSGMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPACHS
FT                   QDDYRSFLQISSTFSNLIMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSSPP
FT                   SITAIAAATVAAATAWWASHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQPFE
FT                   KQNTALQDQNLASKSPASSSDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTAQK
FT                   KNLVDRSSCGSNTPSGSDAETDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDNNS
FT                   NNNATTDSWKEVSEEGRIAFQALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNFKS
FT                   QDSCAADQEGVVMIGVGTCKSLKTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCKRL
FT                   RLEGEAST"
FT   gene            complement(38444..41017)
FT                   /gene="UMAMIT28"
FT                   /gene_synonym="T25K16.7"
FT                   /gene_synonym="T25K16_7"
FT                   /gene_synonym="Usually multiple acids move in and out
FT                   Transporters 28"
FT                   /locus_tag="AT1G01070"
FT                   /note="nodulin MtN21-like transporter family protein"
FT   mRNA            complement(join(38444..39054,39136..39287,39409..39814,
FT                   40213..40329,40473..40535,40675..41017))
FT                   /gene="UMAMIT28"
FT                   /gene_synonym="T25K16.7"
FT                   /gene_synonym="T25K16_7"
FT                   /gene_synonym="Usually multiple acids move in and out
FT                   Transporters 28"
FT                   /locus_tag="AT1G01070"
FT                   /product="nodulin MtN21 /EamA-like transporter family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR333275.1,INSD:EH960684.1,INSD:DR333276.1,
FT                   INSD:DR373232.1,INSD:EH931186.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT015826.1,INSD:BT020209.1,INSD:AY089039.1"
FT   mRNA            complement(join(38752..39054,39136..39287,39409..39814,
FT                   40213..40329,40473..40945))
FT                   /gene="UMAMIT28"
FT                   /gene_synonym="T25K16.7"
FT                   /gene_synonym="T25K16_7"
FT                   /gene_synonym="Usually multiple acids move in and out
FT                   Transporters 28"
FT                   /locus_tag="AT1G01070"
FT                   /product="nodulin MtN21 /EamA-like transporter family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH960684.1,INSD:DR373232.1,INSD:EH931186.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX816126.1"
FT   CDS_pept        complement(join(38898..39054,39136..39287,39409..39814,
FT                   40213..40329,40473..40535,40675..40877))
FT                   /codon_start=1
FT                   /gene="UMAMIT28"
FT                   /gene_synonym="T25K16.7"
FT                   /gene_synonym="T25K16_7"
FT                   /gene_synonym="Usually multiple acids move in and out
FT                   Transporters 28"
FT                   /locus_tag="AT1G01070"
FT                   /product="nodulin MtN21 /EamA-like transporter family
FT                   protein"
FT                   /note="nodulin MtN21 /EamA-like transporter family protein;
FT                   LOCATED IN: membrane; EXPRESSED IN: 17 plant structures;
FT                   EXPRESSED DURING: 7 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF6, transmembrane
FT                   (InterPro:IPR000620); BEST Arabidopsis thaliana protein
FT                   match is: nodulin MtN21 /EamA-like transporter family
FT                   protein (TAIR:AT1G11460.1); Has 3211 Blast hits to 3199
FT                   proteins in 599 species: Archae - 23; Bacteria - 1686;
FT                   Metazoa - 4; Fungi - 6; Plants - 1233; Viruses - 0; Other
FT                   Eukaryotes - 259 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01070.1"
FT                   /db_xref="GOA:Q5XEZ0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR030184"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEZ0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR333275.1,INSD:EH960684.1,INSD:DR333276.1,
FT                   INSD:DR373232.1,INSD:EH931186.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT015826.1,INSD:BT020209.1,INSD:AY089039.1"
FT                   /protein_id="AEE27229.1"
FT                   /translation="MAGDMQGVRVVEKYSPVIVMVMSNVAMGSVNALVKKALDVGVNHM
FT                   VIGAYRMAISALILVPFAYVLERKTRPQITFRLMVDHFVSGLLGASLMQFFFLLGLSYT
FT                   SATVSCALVSMLPAITFALALIFRTENVKILKTKAGMLKVIGTLICISGALFLTFYKGP
FT                   QISNSHSHSHGGASHNNNDQDKANNWLLGCLYLTIGTVLLSLWMLFQGTLSIKYPCKYS
FT                   STCLMSIFAAFQCALLSLYKSRDVNDWIIDDRFVITVIIYAGVVGQAMTTVATTWGIKK
FT                   LGAVFASAFFPLTLISATLFDFLILHTPLYLGSVIGSLVTITGLYMFLWGKNKETESST
FT                   ALSSGMDNEAQYTTPNKDNDSKSPV"
FT   CDS_pept        complement(join(38898..39054,39136..39287,39409..39814,
FT                   40213..40329,40473..40597))
FT                   /codon_start=1
FT                   /gene="UMAMIT28"
FT                   /gene_synonym="T25K16.7"
FT                   /gene_synonym="T25K16_7"
FT                   /gene_synonym="Usually multiple acids move in and out
FT                   Transporters 28"
FT                   /locus_tag="AT1G01070"
FT                   /product="nodulin MtN21 /EamA-like transporter family
FT                   protein"
FT                   /note="nodulin MtN21 /EamA-like transporter family protein;
FT                   LOCATED IN: membrane; EXPRESSED IN: 17 plant structures;
FT                   EXPRESSED DURING: 7 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF6, transmembrane
FT                   (InterPro:IPR000620); BEST Arabidopsis thaliana protein
FT                   match is: nodulin MtN21 /EamA-like transporter family
FT                   protein (TAIR:AT1G11450.2); Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01070"
FT                   /db_xref="GOA:Q5XEZ0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR030184"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XEZ0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH960684.1,INSD:DR373232.1,INSD:EH931186.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX816126.1"
FT                   /protein_id="AEE27228.1"
FT                   /translation="MLIYMYNFNEFSKEFLLLLNRKTRPQITFRLMVDHFVSGLLGASL
FT                   MQFFFLLGLSYTSATVSCALVSMLPAITFALALIFRTENVKILKTKAGMLKVIGTLICI
FT                   SGALFLTFYKGPQISNSHSHSHGGASHNNNDQDKANNWLLGCLYLTIGTVLLSLWMLFQ
FT                   GTLSIKYPCKYSSTCLMSIFAAFQCALLSLYKSRDVNDWIIDDRFVITVIIYAGVVGQA
FT                   MTTVATTWGIKKLGAVFASAFFPLTLISATLFDFLILHTPLYLGSVIGSLVTITGLYMF
FT                   LWGKNKETESSTALSSGMDNEAQYTTPNKDNDSKSPV"
FT   gene            complement(43087..43295)
FT                   /locus_tag="AT1G04003"
FT   ncRNA           complement(43087..43295)
FT                   /locus_tag="AT1G04003"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(44970..47059)
FT                   /gene_synonym="T25K16.19"
FT                   /gene_synonym="T25K16_19"
FT                   /locus_tag="AT1G01080"
FT   mRNA            complement(join(44970..45559,45646..45954,46044..46145,
FT                   46376..47059))
FT                   /gene_synonym="T25K16.19"
FT                   /gene_synonym="T25K16_19"
FT                   /locus_tag="AT1G01080"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH976658.1,INSD:DR326291.1,INSD:EH830851.1,
FT                   INSD:AV796372.1,INSD:DR326298.1,INSD:EL227681.1,
FT                   INSD:DR239547.1,INSD:DR326292.1,INSD:EG517150.1,
FT                   INSD:AF066871.1,INSD:DR326297.1,INSD:EL064291.1,
FT                   INSD:EL057454.1,INSD:EH970326.1,INSD:EL103429.1,
FT                   INSD:DR239585.1,INSD:EG513769.1,INSD:DR232463.1,
FT                   INSD:BP786153.1,INSD:AV556653.1,INSD:DR373419.1,
FT                   INSD:EL268375.1,INSD:EH973070.1,INSD:BP613432.1,
FT                   INSD:DR326294.1,INSD:EL217393.1,INSD:DR239584.1,
FT                   INSD:BP786560.1,INSD:EH968735.1,INSD:DR259580.1,
FT                   INSD:EL151156.1,INSD:CB262280.1,INSD:DR326290.1,
FT                   INSD:EH967120.1,INSD:AI099516.1,INSD:AI996061.1,
FT                   INSD:BP810876.1,INSD:EG514078.1,INSD:EL236484.1,
FT                   INSD:DR326293.1,INSD:EL052914.1,INSD:ES132460.1,
FT                   INSD:BP666924.1,INSD:BP783234.1,INSD:DR239556.1,
FT                   INSD:DR326299.1,INSD:EG517151.1,INSD:EH948741.1,
FT                   INSD:DR326289.1,INSD:DR326296.1,INSD:AV522419.1,
FT                   INSD:EH891680.1,INSD:BP844284.1,INSD:DR326300.1,
FT                   INSD:EH958364.1,INSD:ES120608.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF419554.1,INSD:AY086138.1,INSD:AY132012.1"
FT   mRNA            complement(join(44970..45954,46044..46145,46376..47059))
FT                   /gene_synonym="T25K16.19"
FT                   /gene_synonym="T25K16_19"
FT                   /locus_tag="AT1G01080"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT   mRNA            complement(join(45296..45559,45646..45954,46044..46145,
FT                   46373..47019))
FT                   /gene_synonym="T25K16.19"
FT                   /gene_synonym="T25K16_19"
FT                   /locus_tag="AT1G01080"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH976658.1,INSD:DR326290.1,INSD:EH967120.1,
FT                   INSD:EH830851.1,INSD:AV796372.1,INSD:EL227681.1,
FT                   INSD:AI996061.1,INSD:AI099516.1,INSD:DR239547.1,
FT                   INSD:BP810876.1,INSD:AF066871.1,INSD:DR326297.1,
FT                   INSD:EL064291.1,INSD:EL057454.1,INSD:EH970326.1,
FT                   INSD:EG514078.1,INSD:EL103429.1,INSD:EL236484.1,
FT                   INSD:EL052914.1,INSD:ES132460.1,INSD:DR239585.1,
FT                   INSD:BP666924.1,INSD:BE662758.1,INSD:DR232463.1,
FT                   INSD:EG513769.1,INSD:BP786153.1,INSD:AV556653.1,
FT                   INSD:DR373419.1,INSD:BP783234.1,INSD:DR239556.1,
FT                   INSD:DR326294.1,INSD:BP613432.1,INSD:EH973070.1,
FT                   INSD:EL217393.1,INSD:DR239584.1,INSD:EH948741.1,
FT                   INSD:BP786560.1,INSD:EL108171.1,INSD:AV522419.1,
FT                   INSD:BP844284.1,INSD:EH891680.1,INSD:EH968735.1,
FT                   INSD:DR259580.1,INSD:DR326295.1,INSD:EL151156.1,
FT                   INSD:EH958364.1,INSD:ES120608.1"
FT   CDS_pept        complement(join(45503..45559,45646..45954,46044..46145,
FT                   46376..46789))
FT                   /codon_start=1
FT                   /gene_synonym="T25K16.19"
FT                   /gene_synonym="T25K16_19"
FT                   /locus_tag="AT1G01080"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /note="RNA-binding (RRM/RBD/RNP motifs) family protein;
FT                   FUNCTIONS IN: RNA binding, nucleotide binding, nucleic acid
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: chloroplast stroma, nucleus, chloroplast, chloroplast
FT                   envelope; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: RNA
FT                   recognition motif, RNP-1 (InterPro:IPR000504),
FT                   Nucleotide-binding, alpha-beta plait (InterPro:IPR012677);
FT                   BEST Arabidopsis thaliana protein match is: RNA-binding
FT                   (RRM/RBD/RNP motifs) family protein (TAIR:AT1G60000.1); Has
FT                   509067 Blast hits to 499893 proteins in 22124 species:
FT                   Archae - 10819; Bacteria - 303967; Metazoa - 99035; Fungi -
FT                   14863; Plants - 31737; Viruses - 35534; Other Eukaryotes -
FT                   13112 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01080"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01080.1"
FT                   /db_xref="GOA:Q8W592"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q8W592"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH976658.1,INSD:DR326291.1,INSD:EH830851.1,
FT                   INSD:AV796372.1,INSD:DR326298.1,INSD:EL227681.1,
FT                   INSD:DR239547.1,INSD:DR326292.1,INSD:EG517150.1,
FT                   INSD:AF066871.1,INSD:DR326297.1,INSD:EL064291.1,
FT                   INSD:EL057454.1,INSD:EH970326.1,INSD:EL103429.1,
FT                   INSD:DR239585.1,INSD:EG513769.1,INSD:DR232463.1,
FT                   INSD:BP786153.1,INSD:AV556653.1,INSD:DR373419.1,
FT                   INSD:EL268375.1,INSD:EH973070.1,INSD:BP613432.1,
FT                   INSD:DR326294.1,INSD:EL217393.1,INSD:DR239584.1,
FT                   INSD:BP786560.1,INSD:EH968735.1,INSD:DR259580.1,
FT                   INSD:EL151156.1,INSD:CB262280.1,INSD:DR326290.1,
FT                   INSD:EH967120.1,INSD:AI099516.1,INSD:AI996061.1,
FT                   INSD:BP810876.1,INSD:EG514078.1,INSD:EL236484.1,
FT                   INSD:DR326293.1,INSD:EL052914.1,INSD:ES132460.1,
FT                   INSD:BP666924.1,INSD:BP783234.1,INSD:DR239556.1,
FT                   INSD:DR326299.1,INSD:EG517151.1,INSD:EH948741.1,
FT                   INSD:DR326289.1,INSD:DR326296.1,INSD:AV522419.1,
FT                   INSD:EH891680.1,INSD:BP844284.1,INSD:DR326300.1,
FT                   INSD:EH958364.1,INSD:ES120608.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF419554.1,INSD:AY086138.1,INSD:AY132012.1"
FT                   /protein_id="AEE27231.1"
FT                   /translation="MAASCFAIPLSSSSRSSHNAIPKYKTLISSSSYSYLESLKLQFSS
FT                   SNSFHHSSLSRPFVAQPLQIKVSSSELSVLDEEKEEEVVKGEAEPNKDSVVSKAEPVKK
FT                   PRPCELYVCNIPRSYDIAQLLDMFQPFGTVISVEVSRNPQTGESRGSGYVTMGSINSAK
FT                   IAIASLDGTEVGGREMRVRYSVDMNPGTRRNPEVLNSTPKKILMYESQHKVYVGNLPWF
FT                   TQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALSFNGTQYEGRR
FT                   IIVREGIEKSES"
FT   CDS_pept        complement(join(45503..45559,45646..45954,46044..46145,
FT                   46373..46789))
FT                   /codon_start=1
FT                   /gene_synonym="T25K16.19"
FT                   /gene_synonym="T25K16_19"
FT                   /locus_tag="AT1G01080"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /note="RNA-binding (RRM/RBD/RNP motifs) family protein;
FT                   FUNCTIONS IN: RNA binding, nucleotide binding, nucleic acid
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: chloroplast; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: RNA recognition motif, RNP-1
FT                   (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait
FT                   (InterPro:IPR012677); BEST Arabidopsis thaliana protein
FT                   match is: RNA-binding (RRM/RBD/RNP motifs) family protein
FT                   (TAIR:AT1G60000.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01080"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01080.2"
FT                   /db_xref="GOA:F4HQH8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:F4HQH8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH976658.1,INSD:DR326290.1,INSD:EH967120.1,
FT                   INSD:EH830851.1,INSD:AV796372.1,INSD:EL227681.1,
FT                   INSD:AI996061.1,INSD:AI099516.1,INSD:DR239547.1,
FT                   INSD:BP810876.1,INSD:AF066871.1,INSD:DR326297.1,
FT                   INSD:EL064291.1,INSD:EL057454.1,INSD:EH970326.1,
FT                   INSD:EG514078.1,INSD:EL103429.1,INSD:EL236484.1,
FT                   INSD:EL052914.1,INSD:ES132460.1,INSD:DR239585.1,
FT                   INSD:BP666924.1,INSD:BE662758.1,INSD:DR232463.1,
FT                   INSD:EG513769.1,INSD:BP786153.1,INSD:AV556653.1,
FT                   INSD:DR373419.1,INSD:BP783234.1,INSD:DR239556.1,
FT                   INSD:DR326294.1,INSD:BP613432.1,INSD:EH973070.1,
FT                   INSD:EL217393.1,INSD:DR239584.1,INSD:EH948741.1,
FT                   INSD:BP786560.1,INSD:EL108171.1,INSD:AV522419.1,
FT                   INSD:BP844284.1,INSD:EH891680.1,INSD:EH968735.1,
FT                   INSD:DR259580.1,INSD:DR326295.1,INSD:EL151156.1,
FT                   INSD:EH958364.1,INSD:ES120608.1"
FT                   /protein_id="AEE27232.1"
FT                   /translation="MAASCFAIPLSSSSRSSHNAIPKYKTLISSSSYSYLESLKLQFSS
FT                   SNSFHHSSLSRPFVAQPLQIKVSSSELSVLDEEKEEEVVKGEAEPNKDSVVSKAEPVKK
FT                   PRPCELYVCNIPRSYDIAQLLDMFQPFGTVISVEVVSRNPQTGESRGSGYVTMGSINSA
FT                   KIAIASLDGTEVGGREMRVRYSVDMNPGTRRNPEVLNSTPKKILMYESQHKVYVGNLPW
FT                   FTQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALSFNGTQYEGR
FT                   RIIVREGIEKSES"
FT   CDS_pept        complement(join(45610..45954,46044..46145,46376..46789))
FT                   /codon_start=1
FT                   /gene_synonym="T25K16.19"
FT                   /gene_synonym="T25K16_19"
FT                   /locus_tag="AT1G01080"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01080"
FT                   /db_xref="GOA:A0A1P8APK3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8APK3"
FT                   /protein_id="ANM58572.1"
FT                   /translation="MAASCFAIPLSSSSRSSHNAIPKYKTLISSSSYSYLESLKLQFSS
FT                   SNSFHHSSLSRPFVAQPLQIKVSSSELSVLDEEKEEEVVKGEAEPNKDSVVSKAEPVKK
FT                   PRPCELYVCNIPRSYDIAQLLDMFQPFGTVISVEVSRNPQTGESRGSGYVTMGSINSAK
FT                   IAIASLDGTEVGGREMRVRYSVDMNPGTRRNPEVLNSTPKKILMYESQHKVYVGNLPWF
FT                   TQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALSFNGTVKFVIH
FT                   KKNLA"
FT   gene            complement(47234..49304)
FT                   /gene="PDH-E1 ALPHA"
FT                   /gene_synonym="pyruvate dehydrogenase E1 alpha"
FT                   /gene_synonym="T25K16.8"
FT                   /gene_synonym="T25K16_8"
FT                   /locus_tag="AT1G01090"
FT                   /note="pyruvate dehydrogenase E1 alpha subunit"
FT   mRNA            complement(join(47234..47982,48075..48852,48936..49304))
FT                   /gene="PDH-E1 ALPHA"
FT                   /gene_synonym="pyruvate dehydrogenase E1 alpha"
FT                   /gene_synonym="T25K16.8"
FT                   /gene_synonym="T25K16_8"
FT                   /locus_tag="AT1G01090"
FT                   /product="pyruvate dehydrogenase E1 alpha"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP628250.1,INSD:EL195243.1,INSD:EH856422.1,
FT                   INSD:BX840037.1,INSD:BP629438.1,INSD:AV563516.1,
FT                   INSD:BP596295.1,INSD:BP605557.1,INSD:EG500047.1,
FT                   INSD:EL199576.1,INSD:EH798368.1,INSD:AV554012.1,
FT                   INSD:BP575870.1,INSD:DR348224.1,INSD:EH940966.1,
FT                   INSD:EL153075.1,INSD:EL058492.1,INSD:EG462517.1,
FT                   INSD:Z48416.1,INSD:EH905422.1,INSD:AV559265.1,
FT                   INSD:EH922338.1,INSD:AV535866.1,INSD:DR346976.1,
FT                   INSD:AV559839.1,INSD:EL045603.1,INSD:EL260021.1,
FT                   INSD:EL969357.1,INSD:EL163557.1,INSD:BE521557.1,
FT                   INSD:DR376884.1,INSD:BP622252.1,INSD:EL270299.1,
FT                   INSD:EL208824.1,INSD:EL068539.1,INSD:EL179846.1,
FT                   INSD:EL207008.1,INSD:AV787194.1,INSD:ES082906.1,
FT                   INSD:EL107819.1,INSD:EG517799.1,INSD:EG447147.1,
FT                   INSD:EL008595.1,INSD:BP864111.1,INSD:BP659781.1,
FT                   INSD:BX839266.1,INSD:BE525399.1,INSD:BP607249.1,
FT                   INSD:EL146557.1,INSD:EH883751.1,INSD:DR343172.1,
FT                   INSD:DR348212.1,INSD:EL109457.1,INSD:DR346977.1,
FT                   INSD:EL310145.1,INSD:DR376031.1,INSD:BP797917.1,
FT                   INSD:DR373474.1,INSD:DR343169.1,INSD:EL150464.1,
FT                   INSD:EL300123.1,INSD:DR193816.1,INSD:DR343171.1,
FT                   INSD:BP670010.1,INSD:EL119096.1,INSD:BE525392.1,
FT                   INSD:DR348220.1,INSD:EH948484.1,INSD:EL257962.1,
FT                   INSD:BE520696.1,INSD:EL140961.1,INSD:BE524629.1,
FT                   INSD:EL241737.1,INSD:BP612762.1,INSD:BP653262.1,
FT                   INSD:EH919913.1,INSD:EL338277.1,INSD:CF773626.1,
FT                   INSD:ES059737.1,INSD:ES094288.1,INSD:EH897429.1,
FT                   INSD:ES053203.1,INSD:BP643855.1,INSD:EL202451.1,
FT                   INSD:EH862718.1,INSD:EH814508.1,INSD:AI993673.1,
FT                   INSD:AV798622.1,INSD:AV559742.1,INSD:EL091887.1,
FT                   INSD:DR348209.1,INSD:EL269628.1,INSD:DR380661.1,
FT                   INSD:DR348205.1,INSD:EL129579.1,INSD:EL293476.1,
FT                   INSD:DR348204.1,INSD:EL292874.1,INSD:AV522098.1,
FT                   INSD:EH941146.1,INSD:AV547397.1,INSD:EG517784.1,
FT                   INSD:EL263201.1,INSD:EL085611.1,INSD:BE521558.1,
FT                   INSD:EL088005.1,INSD:BP812894.1,INSD:BP569374.1,
FT                   INSD:EL291203.1,INSD:ES062337.1,INSD:EL174215.1,
FT                   INSD:EG517783.1,INSD:EL261734.1,INSD:EH864819.1,
FT                   INSD:EL264705.1,INSD:DR348208.1,INSD:EL306814.1,
FT                   INSD:AV829843.1,INSD:EH858983.1,INSD:ES181332.1,
FT                   INSD:EL313769.1,INSD:BP856884.1,INSD:ES055035.1,
FT                   INSD:EL231011.1,INSD:DR348210.1,INSD:DR348202.1,
FT                   INSD:EH847183.1,INSD:EH916324.1,INSD:BX835986.1,
FT                   INSD:DR381624.1,INSD:CF773635.1,INSD:EH953753.1,
FT                   INSD:BP830775.1,INSD:EL083618.1,INSD:EL027493.1,
FT                   INSD:EL298821.1,INSD:AV557740.1,INSD:BP849187.1,
FT                   INSD:EL214742.1,INSD:DR348213.1,INSD:EH846729.1,
FT                   INSD:AV545292.1,INSD:EG423996.1,INSD:BP634007.1,
FT                   INSD:BE526130.1,INSD:DR346974.1,INSD:EL984157.1,
FT                   INSD:EL294109.1,INSD:EL091120.1,INSD:DR348218.1,
FT                   INSD:N65567.1,INSD:BE527594.1,INSD:AV522256.1,
FT                   INSD:EH895580.1,INSD:BX840016.1,INSD:BX839733.1,
FT                   INSD:DR383189.1,INSD:DR348207.1,INSD:EH905583.1,
FT                   INSD:EL035656.1,INSD:AV824670.1,INSD:BP851505.1,
FT                   INSD:AV827561.1,INSD:EL175930.1,INSD:EH796202.1,
FT                   INSD:EL987593.1,INSD:DR193817.1,INSD:EH966602.1,
FT                   INSD:EH897919.1,INSD:ES088750.1,INSD:EL281691.1,
FT                   INSD:DR348223.1,INSD:DR348211.1,INSD:DR348203.1,
FT                   INSD:EH904503.1,INSD:EH956639.1,INSD:EL187528.1,
FT                   INSD:EL306346.1,INSD:EG445433.1,INSD:EH870568.1,
FT                   INSD:DR348206.1,INSD:BP583832.1,INSD:EL313754.1,
FT                   INSD:EL996020.1,INSD:EL140442.1,INSD:EL097947.1,
FT                   INSD:BP844363.1,INSD:DR381326.1,INSD:EL214395.1,
FT                   INSD:BP605494.1,INSD:BE523776.1,INSD:EH882018.1,
FT                   INSD:ES119491.1,INSD:EL314782.1,INSD:DR348396.1,
FT                   INSD:BP660202.1,INSD:EG462516.1,INSD:EL217480.1,
FT                   INSD:DR348395.1,INSD:BP596480.1,INSD:EH917300.1,
FT                   INSD:BP816336.1,INSD:EH864038.1,INSD:EL124864.1,
FT                   INSD:ES086699.1,INSD:EL231147.1,INSD:DR348214.1,
FT                   INSD:AV816207.1,INSD:EL047850.1,INSD:EL218708.1,
FT                   INSD:EL212728.1,INSD:BE520815.1,INSD:DR348221.1,
FT                   INSD:EH832951.1,INSD:BP567044.1,INSD:AV542850.1,
FT                   INSD:ES077188.1,INSD:EL084549.1,INSD:EL993742.1,
FT                   INSD:BP810724.1,INSD:EL094491.1,INSD:DR348222.1,
FT                   INSD:EL274210.1,INSD:BP606919.1,INSD:EH973857.1,
FT                   INSD:EH859879.1,INSD:EH932650.1,INSD:EH886591.1,
FT                   INSD:EL192299.1,INSD:BP574275.1,INSD:DR348216.1,
FT                   INSD:EG445432.1,INSD:EH954461.1,INSD:AV808865.1,
FT                   INSD:EL338704.1,INSD:EL068676.1,INSD:AV540196.1,
FT                   INSD:BP812520.1,INSD:CB261062.1,INSD:DR346975.1,
FT                   INSD:EG517800.1,INSD:EH988511.1,INSD:ES138293.1,
FT                   INSD:CB255771.1,INSD:ES078460.1,INSD:EH941202.1,
FT                   INSD:EL026272.1,INSD:AV550023.1,INSD:EH903340.1,
FT                   INSD:EL199598.1,INSD:ES029481.1,INSD:EG446174.1,
FT                   INSD:EL307123.1,INSD:DR348215.1,INSD:BP810098.1,
FT                   INSD:EG418262.1,INSD:BP857454.1,INSD:BE527603.1,
FT                   INSD:EL313824.1,INSD:DR343170.1,INSD:BP616422.1,
FT                   INSD:EH896229.1,INSD:BP821522.1,INSD:ES105039.1,
FT                   INSD:EL233898.1,INSD:EG448133.1,INSD:EH975205.1,
FT                   INSD:DR348201.1,INSD:Z48417.1,INSD:BE525391.1,
FT                   INSD:EL115570.1,INSD:ES079828.1,INSD:N65566.1,
FT                   INSD:EH939904.1,INSD:BP577167.1,INSD:EL267954.1,
FT                   INSD:BE529362.1,INSD:BP838981.1,INSD:DR295747.1,
FT                   INSD:EL099211.1,INSD:AV533032.1,INSD:DR348219.1,
FT                   INSD:BP640268.1,INSD:AV539704.1,INSD:BE520816.1,
FT                   INSD:BP605176.1,INSD:DR348217.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX815342.1,INSD:AY052721.1,INSD:U80185.1,
FT                   INSD:AK226909.1,INSD:AY063724.1,INSD:BX813802.1,
FT                   INSD:BX818597.1,INSD:BX815751.1,INSD:BX815365.1"
FT   CDS_pept        complement(join(47705..47982,48075..48852,48936..49166))
FT                   /codon_start=1
FT                   /gene="PDH-E1 ALPHA"
FT                   /gene_synonym="pyruvate dehydrogenase E1 alpha"
FT                   /gene_synonym="T25K16.8"
FT                   /gene_synonym="T25K16_8"
FT                   /locus_tag="AT1G01090"
FT                   /product="pyruvate dehydrogenase E1 alpha"
FT                   /note="pyruvate dehydrogenase E1 alpha (PDH-E1 ALPHA);
FT                   FUNCTIONS IN: pyruvate dehydrogenase (acetyl-transferring)
FT                   activity; INVOLVED IN: oxidation reduction, glycolysis,
FT                   metabolic process; LOCATED IN: chloroplast, plastid,
FT                   chloroplast envelope; EXPRESSED IN: 25 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Dehydrogenase, E1 component (InterPro:IPR001017),
FT                   Pyruvate dehydrogenase (acetyl-transferring) E1 component,
FT                   alpha subunit, subgroup y (InterPro:IPR017597); BEST
FT                   Arabidopsis thaliana protein match is: pyruvate
FT                   dehydrogenase complex E1 alpha subunit (TAIR:AT1G59900.1);
FT                   Has 10065 Blast hits to 10059 proteins in 1888 species:
FT                   Archae - 130; Bacteria - 6136; Metazoa - 517; Fungi - 241;
FT                   Plants - 224; Viruses - 0; Other Eukaryotes - 2817 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:O24457"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:O24457"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP628250.1,INSD:EL195243.1,INSD:EH856422.1,
FT                   INSD:BX840037.1,INSD:BP629438.1,INSD:AV563516.1,
FT                   INSD:BP596295.1,INSD:BP605557.1,INSD:EG500047.1,
FT                   INSD:EL199576.1,INSD:EH798368.1,INSD:AV554012.1,
FT                   INSD:BP575870.1,INSD:DR348224.1,INSD:EH940966.1,
FT                   INSD:EL153075.1,INSD:EL058492.1,INSD:EG462517.1,
FT                   INSD:Z48416.1,INSD:EH905422.1,INSD:AV559265.1,
FT                   INSD:EH922338.1,INSD:AV535866.1,INSD:DR346976.1,
FT                   INSD:AV559839.1,INSD:EL045603.1,INSD:EL260021.1,
FT                   INSD:EL969357.1,INSD:EL163557.1,INSD:BE521557.1,
FT                   INSD:DR376884.1,INSD:BP622252.1,INSD:EL270299.1,
FT                   INSD:EL208824.1,INSD:EL068539.1,INSD:EL179846.1,
FT                   INSD:EL207008.1,INSD:AV787194.1,INSD:ES082906.1,
FT                   INSD:EL107819.1,INSD:EG517799.1,INSD:EG447147.1,
FT                   INSD:EL008595.1,INSD:BP864111.1,INSD:BP659781.1,
FT                   INSD:BX839266.1,INSD:BE525399.1,INSD:BP607249.1,
FT                   INSD:EL146557.1,INSD:EH883751.1,INSD:DR343172.1,
FT                   INSD:DR348212.1,INSD:EL109457.1,INSD:DR346977.1,
FT                   INSD:EL310145.1,INSD:DR376031.1,INSD:BP797917.1,
FT                   INSD:DR373474.1,INSD:DR343169.1,INSD:EL150464.1,
FT                   INSD:EL300123.1,INSD:DR193816.1,INSD:DR343171.1,
FT                   INSD:BP670010.1,INSD:EL119096.1,INSD:BE525392.1,
FT                   INSD:DR348220.1,INSD:EH948484.1,INSD:EL257962.1,
FT                   INSD:BE520696.1,INSD:EL140961.1,INSD:BE524629.1,
FT                   INSD:EL241737.1,INSD:BP612762.1,INSD:BP653262.1,
FT                   INSD:EH919913.1,INSD:EL338277.1,INSD:CF773626.1,
FT                   INSD:ES059737.1,INSD:ES094288.1,INSD:EH897429.1,
FT                   INSD:ES053203.1,INSD:BP643855.1,INSD:EL202451.1,
FT                   INSD:EH862718.1,INSD:EH814508.1,INSD:AI993673.1,
FT                   INSD:AV798622.1,INSD:AV559742.1,INSD:EL091887.1,
FT                   INSD:DR348209.1,INSD:EL269628.1,INSD:DR380661.1,
FT                   INSD:DR348205.1,INSD:EL129579.1,INSD:EL293476.1,
FT                   INSD:DR348204.1,INSD:EL292874.1,INSD:AV522098.1,
FT                   INSD:EH941146.1,INSD:AV547397.1,INSD:EG517784.1,
FT                   INSD:EL263201.1,INSD:EL085611.1,INSD:BE521558.1,
FT                   INSD:EL088005.1,INSD:BP812894.1,INSD:BP569374.1,
FT                   INSD:EL291203.1,INSD:ES062337.1,INSD:EL174215.1,
FT                   INSD:EG517783.1,INSD:EL261734.1,INSD:EH864819.1,
FT                   INSD:EL264705.1,INSD:DR348208.1,INSD:EL306814.1,
FT                   INSD:AV829843.1,INSD:EH858983.1,INSD:ES181332.1,
FT                   INSD:EL313769.1,INSD:BP856884.1,INSD:ES055035.1,
FT                   INSD:EL231011.1,INSD:DR348210.1,INSD:DR348202.1,
FT                   INSD:EH847183.1,INSD:EH916324.1,INSD:BX835986.1,
FT                   INSD:DR381624.1,INSD:CF773635.1,INSD:EH953753.1,
FT                   INSD:BP830775.1,INSD:EL083618.1,INSD:EL027493.1,
FT                   INSD:EL298821.1,INSD:AV557740.1,INSD:BP849187.1,
FT                   INSD:EL214742.1,INSD:DR348213.1,INSD:EH846729.1,
FT                   INSD:AV545292.1,INSD:EG423996.1,INSD:BP634007.1,
FT                   INSD:BE526130.1,INSD:DR346974.1,INSD:EL984157.1,
FT                   INSD:EL294109.1,INSD:EL091120.1,INSD:DR348218.1,
FT                   INSD:N65567.1,INSD:BE527594.1,INSD:AV522256.1,
FT                   INSD:EH895580.1,INSD:BX840016.1,INSD:BX839733.1,
FT                   INSD:DR383189.1,INSD:DR348207.1,INSD:EH905583.1,
FT                   INSD:EL035656.1,INSD:AV824670.1,INSD:BP851505.1,
FT                   INSD:AV827561.1,INSD:EL175930.1,INSD:EH796202.1,
FT                   INSD:EL987593.1,INSD:DR193817.1,INSD:EH966602.1,
FT                   INSD:EH897919.1,INSD:ES088750.1,INSD:EL281691.1,
FT                   INSD:DR348223.1,INSD:DR348211.1,INSD:DR348203.1,
FT                   INSD:EH904503.1,INSD:EH956639.1,INSD:EL187528.1,
FT                   INSD:EL306346.1,INSD:EG445433.1,INSD:EH870568.1,
FT                   INSD:DR348206.1,INSD:BP583832.1,INSD:EL313754.1,
FT                   INSD:EL996020.1,INSD:EL140442.1,INSD:EL097947.1,
FT                   INSD:BP844363.1,INSD:DR381326.1,INSD:EL214395.1,
FT                   INSD:BP605494.1,INSD:BE523776.1,INSD:EH882018.1,
FT                   INSD:ES119491.1,INSD:EL314782.1,INSD:DR348396.1,
FT                   INSD:BP660202.1,INSD:EG462516.1,INSD:EL217480.1,
FT                   INSD:DR348395.1,INSD:BP596480.1,INSD:EH917300.1,
FT                   INSD:BP816336.1,INSD:EH864038.1,INSD:EL124864.1,
FT                   INSD:ES086699.1,INSD:EL231147.1,INSD:DR348214.1,
FT                   INSD:AV816207.1,INSD:EL047850.1,INSD:EL218708.1,
FT                   INSD:EL212728.1,INSD:BE520815.1,INSD:DR348221.1,
FT                   INSD:EH832951.1,INSD:BP567044.1,INSD:AV542850.1,
FT                   INSD:ES077188.1,INSD:EL084549.1,INSD:EL993742.1,
FT                   INSD:BP810724.1,INSD:EL094491.1,INSD:DR348222.1,
FT                   INSD:EL274210.1,INSD:BP606919.1,INSD:EH973857.1,
FT                   INSD:EH859879.1,INSD:EH932650.1,INSD:EH886591.1,
FT                   INSD:EL192299.1,INSD:BP574275.1,INSD:DR348216.1,
FT                   INSD:EG445432.1,INSD:EH954461.1,INSD:AV808865.1,
FT                   INSD:EL338704.1,INSD:EL068676.1,INSD:AV540196.1,
FT                   INSD:BP812520.1,INSD:CB261062.1,INSD:DR346975.1,
FT                   INSD:EG517800.1,INSD:EH988511.1,INSD:ES138293.1,
FT                   INSD:CB255771.1,INSD:ES078460.1,INSD:EH941202.1,
FT                   INSD:EL026272.1,INSD:AV550023.1,INSD:EH903340.1,
FT                   INSD:EL199598.1,INSD:ES029481.1,INSD:EG446174.1,
FT                   INSD:EL307123.1,INSD:DR348215.1,INSD:BP810098.1,
FT                   INSD:EG418262.1,INSD:BP857454.1,INSD:BE527603.1,
FT                   INSD:EL313824.1,INSD:DR343170.1,INSD:BP616422.1,
FT                   INSD:EH896229.1,INSD:BP821522.1,INSD:ES105039.1,
FT                   INSD:EL233898.1,INSD:EG448133.1,INSD:EH975205.1,
FT                   INSD:DR348201.1,INSD:Z48417.1,INSD:BE525391.1,
FT                   INSD:EL115570.1,INSD:ES079828.1,INSD:N65566.1,
FT                   INSD:EH939904.1,INSD:BP577167.1,INSD:EL267954.1,
FT                   INSD:BE529362.1,INSD:BP838981.1,INSD:DR295747.1,
FT                   INSD:EL099211.1,INSD:AV533032.1,INSD:DR348219.1,
FT                   INSD:BP640268.1,INSD:AV539704.1,INSD:BE520816.1,
FT                   INSD:BP605176.1,INSD:DR348217.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX815342.1,INSD:AY052721.1,INSD:U80185.1,
FT                   INSD:AK226909.1,INSD:AY063724.1,INSD:BX813802.1,
FT                   INSD:BX818597.1,INSD:BX815751.1,INSD:BX815365.1"
FT                   /protein_id="AEE27233.1"
FT                   /translation="MATAFAPTKLTATVPLHGSHENRLLLPIRLAPPSSFLGSTRSLSL
FT                   RRLNHSNATRRSPVVSVQEVVKEKQSTNNTSLLITKEEGLELYEDMILGRSFEDMCAQM
FT                   YYRGKMFGFVHLYNGQEAVSTGFIKLLTKSDSVVSTYRDHVHALSKGVSARAVMSELFG
FT                   KVTGCCRGQGGSMHMFSKEHNMLGGFAFIGEGIPVATGAAFSSKYRREVLKQDCDDVTV
FT                   AFFGDGTCNNGQFFECLNMAALYKLPIIFVVENNLWAIGMSHLRATSDPEIWKKGPAFG
FT                   MPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFRGHSLADPDELRDAAEKA
FT                   KYAARDPIAALKKYLIENKLAKEAELKSIEKKIDELVEEAVEFADASPQPGRSQLLENV
FT                   FADPKGFGIGPDGRYRCEDPKFTEGTAQV"
FT   gene            complement(49909..51210)
FT                   /gene_synonym="T25K16.9"
FT                   /gene_synonym="T25K16_9"
FT                   /locus_tag="AT1G01100"
FT   mRNA            complement(join(49909..50337,50419..50631,50883..50963,
FT                   51126..51210))
FT                   /gene_synonym="T25K16.9"
FT                   /gene_synonym="T25K16_9"
FT                   /locus_tag="AT1G01100"
FT                   /product="60S acidic ribosomal protein family"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL282417.1,INSD:BP645001.1,INSD:ES093957.1,
FT                   INSD:BP658052.1,INSD:BP659894.1,INSD:BP586021.1,
FT                   INSD:ES074073.1,INSD:BP623145.1,INSD:ES016077.1,
FT                   INSD:BP577478.1,INSD:BP649434.1,INSD:BP633834.1,
FT                   INSD:EL067665.1,INSD:ES050513.1,INSD:EL092124.1,
FT                   INSD:CB263926.1,INSD:EL985143.1,INSD:EL177675.1,
FT                   INSD:EL996608.1,INSD:EH992669.1,INSD:ES118895.1,
FT                   INSD:BP597769.1,INSD:BP576990.1,INSD:ES110165.1,
FT                   INSD:ES059175.1,INSD:EH878787.1,INSD:BP651270.1,
FT                   INSD:DR203071.1,INSD:EH906153.1,INSD:BP645200.1,
FT                   INSD:BP633463.1,INSD:ES069648.1,INSD:EL324478.1,
FT                   INSD:EH892862.1,INSD:DR183442.1,INSD:BP665314.1,
FT                   INSD:BP580994.1,INSD:BP650221.1,INSD:ES175630.1,
FT                   INSD:DR377582.1,INSD:BP655343.1,INSD:ES105448.1,
FT                   INSD:BP623586.1,INSD:ES133837.1,INSD:ES144920.1,
FT                   INSD:EL065424.1,INSD:EH920304.1,INSD:ES137464.1,
FT                   INSD:ES020329.1,INSD:ES182779.1,INSD:ES215879.1,
FT                   INSD:EL065885.1,INSD:EH887322.1,INSD:BP654427.1,
FT                   INSD:ES203647.1,INSD:ES088148.1,INSD:BP575467.1,
FT                   INSD:EH798627.1,INSD:BP579634.1,INSD:ES128418.1,
FT                   INSD:BP644342.1,INSD:BP635904.1,INSD:ES133505.1,
FT                   INSD:BP653939.1,INSD:ES140228.1,INSD:ES122817.1,
FT                   INSD:BP644796.1,INSD:BP634664.1,INSD:ES181661.1,
FT                   INSD:ES104133.1,INSD:ES204655.1,INSD:EL298566.1,
FT                   INSD:EH893714.1,INSD:BP653941.1,INSD:EL326969.1,
FT                   INSD:BP648753.1,INSD:ES030547.1,INSD:EL240545.1,
FT                   INSD:BP641756.1,INSD:BP596190.1,INSD:BP652778.1,
FT                   INSD:EL968449.1,INSD:BP576648.1,INSD:AV795787.1,
FT                   INSD:EH868138.1,INSD:EL035022.1,INSD:BP646654.1,
FT                   INSD:BP574581.1,INSD:BP651781.1,INSD:ES059228.1,
FT                   INSD:BP668181.1,INSD:ES059823.1,INSD:BP653931.1,
FT                   INSD:ES049523.1,INSD:ES140406.1,INSD:ES081529.1,
FT                   INSD:AV795050.1,INSD:ES184893.1,INSD:EL283860.1,
FT                   INSD:CF774158.1,INSD:EL174160.1,INSD:DR345198.1,
FT                   INSD:ES033626.1,INSD:ES170975.1,INSD:BP655272.1,
FT                   INSD:BP639724.1,INSD:ES166802.1,INSD:ES170500.1,
FT                   INSD:BP579417.1,INSD:EL051375.1,INSD:BP628642.1,
FT                   INSD:EL244147.1,INSD:EL186558.1,INSD:AV542617.1,
FT                   INSD:EH993571.1,INSD:ES011850.1,INSD:EL131090.1,
FT                   INSD:BP626638.1,INSD:ES061279.1,INSD:DR371087.1,
FT                   INSD:EL056298.1,INSD:EG453960.1,INSD:BP648680.1,
FT                   INSD:ES100179.1,INSD:EH817750.1,INSD:EL992329.1,
FT                   INSD:ES013118.1,INSD:EL995834.1,INSD:BP656953.1,
FT                   INSD:BP634195.1,INSD:ES058389.1,INSD:EH898488.1,
FT                   INSD:BP637909.1,INSD:ES067767.1,INSD:EL315161.1,
FT                   INSD:EH866772.1,INSD:ES065015.1,INSD:DR376980.1,
FT                   INSD:ES064137.1,INSD:BP658890.1,INSD:AA728491.1,
FT                   INSD:EL992171.1,INSD:EH897642.1,INSD:BP637169.1,
FT                   INSD:BP651992.1,INSD:EH963419.1,INSD:ES123663.1,
FT                   INSD:EL034531.1,INSD:ES064675.1,INSD:ES187419.1,
FT                   INSD:ES153752.1,INSD:EG503579.1,INSD:ES021461.1,
FT                   INSD:ES160212.1,INSD:ES121358.1,INSD:BP623338.1,
FT                   INSD:BP647501.1,INSD:EH896331.1,INSD:CB262253.1,
FT                   INSD:ES104251.1,INSD:BP591577.1,INSD:ES011414.1,
FT                   INSD:ES097944.1,INSD:EL283008.1,INSD:BP638228.1,
FT                   INSD:ES112062.1,INSD:ES198802.1,INSD:BP637308.1,
FT                   INSD:EH859658.1,INSD:EG453959.1,INSD:EH858407.1,
FT                   INSD:BP643592.1,INSD:ES059035.1,INSD:ES185539.1,
FT                   INSD:BP665140.1,INSD:EL324100.1,INSD:EL306810.1,
FT                   INSD:EG503578.1,INSD:EH944977.1,INSD:EL995764.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY091176.1"
FT   mRNA            complement(join(50090..50337,50419..50447,50496..50631,
FT                   50883..50963,51126..51197))
FT                   /gene_synonym="T25K16.9"
FT                   /gene_synonym="T25K16_9"
FT                   /locus_tag="AT1G01100"
FT                   /product="60S acidic ribosomal protein family"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR203113.1,INSD:DR203076.1,INSD:BP836092.1,
FT                   INSD:DR345226.1,INSD:AV541434.1,INSD:DR345280.1,
FT                   INSD:BP659894.1,INSD:DR345184.1,INSD:BP819138.1,
FT                   INSD:DR203092.1,INSD:BP623145.1,INSD:BP577478.1,
FT                   INSD:BP826237.1,INSD:AV826465.2,INSD:BP826782.1,
FT                   INSD:BP827053.1,INSD:ES050513.1,INSD:CB263926.1,
FT                   INSD:DR183471.1,INSD:ES118895.1,INSD:DR345278.1,
FT                   INSD:BP597769.1,INSD:DR345274.1,INSD:DR345364.1,
FT                   INSD:BP651270.1,INSD:DR183461.1,INSD:DR345284.1,
FT                   INSD:BP812196.1,INSD:EH892862.1,INSD:DR345350.1,
FT                   INSD:ES175630.1,INSD:DR377582.1,INSD:ES105448.1,
FT                   INSD:DR345246.1,INSD:DR345281.1,INSD:DR345185.1,
FT                   INSD:DR183470.1,INSD:EL065424.1,INSD:DR345270.1,
FT                   INSD:DR345242.1,INSD:DR345222.1,INSD:BP832733.1,
FT                   INSD:DR211234.1,INSD:BP823118.1,INSD:DR203086.1,
FT                   INSD:DR345186.1,INSD:DR345187.1,INSD:ES128418.1,
FT                   INSD:BP635904.1,INSD:DR345307.1,INSD:DR345229.1,
FT                   INSD:DR345332.1,INSD:DR345225.1,INSD:ES204655.1,
FT                   INSD:BP594706.1,INSD:ES030547.1,INSD:BP820681.1,
FT                   INSD:BP596190.1,INSD:BP854995.2,INSD:EL968449.1,
FT                   INSD:DR345218.1,INSD:BP576648.1,INSD:DR345235.1,
FT                   INSD:AV795787.1,INSD:DR345339.1,INSD:DR345210.1,
FT                   INSD:DR345287.1,INSD:BP833991.1,INSD:DR345362.1,
FT                   INSD:DR345205.1,INSD:DR345312.1,INSD:DR183450.1,
FT                   INSD:DR345261.1,INSD:AA712509.1,INSD:DR203122.1,
FT                   INSD:CB258426.1,INSD:AV795050.1,INSD:DR345272.1,
FT                   INSD:BP836713.1,INSD:DR345198.1,INSD:ES170500.1,
FT                   INSD:DR203074.1,INSD:DR345331.1,INSD:DR345214.1,
FT                   INSD:DR345219.1,INSD:AV536016.1,INSD:ES061279.1,
FT                   INSD:BP839086.1,INSD:EG501916.1,INSD:DR183456.1,
FT                   INSD:DR345206.1,INSD:EH817750.1,INSD:EL992329.1,
FT                   INSD:EL995834.1,INSD:DR345315.1,INSD:BP656953.1,
FT                   INSD:DR345356.1,INSD:BP634195.1,INSD:DR203078.1,
FT                   INSD:DR345201.1,INSD:DR203088.1,INSD:EL315161.1,
FT                   INSD:BP658890.1,INSD:EH897642.1,INSD:DR345283.1,
FT                   INSD:DR183448.1,INSD:DR345337.1,INSD:DR345303.1,
FT                   INSD:DR345298.1,INSD:DR203117.1,INSD:DR345238.1,
FT                   INSD:BP835923.1,INSD:DR345310.1,INSD:DR345212.1,
FT                   INSD:BP623338.1,INSD:DR345237.1,INSD:BP647501.1,
FT                   INSD:BP815940.1,INSD:DR345180.1,INSD:CB262253.1,
FT                   INSD:DR183473.1,INSD:BP813384.1,INSD:DR203067.1,
FT                   INSD:ES198802.1,INSD:EG453959.1,INSD:DR203079.1,
FT                   INSD:DR203094.1,INSD:DR203101.1,INSD:ES185539.1,
FT                   INSD:DR345245.1,INSD:EH944977.1,INSD:DR183451.1,
FT                   INSD:DR345191.1,INSD:ES009832.1,INSD:DR345196.1,
FT                   INSD:DR345279.1,INSD:DR345195.1,INSD:BP645001.1,
FT                   INSD:DR345346.1,INSD:BP658052.1,INSD:ES074073.1,
FT                   INSD:DR183446.1,INSD:ES188004.1,INSD:DR345338.1,
FT                   INSD:CK118326.1,INSD:DR345277.1,INSD:EL092124.1,
FT                   INSD:BP866537.1,INSD:EL177675.1,INSD:EL996608.1,
FT                   INSD:DR345234.1,INSD:DR183445.1,INSD:ES059175.1,
FT                   INSD:BP819741.1,INSD:DR345286.1,INSD:DR345282.1,
FT                   INSD:DR183457.1,INSD:DR203069.1,INSD:DR345357.1,
FT                   INSD:DR345248.1,INSD:BP817508.1,INSD:ES069648.1,
FT                   INSD:DR203068.1,INSD:DR345183.1,INSD:DR345343.1,
FT                   INSD:BP580994.1,INSD:DR203087.1,INSD:DR345213.1,
FT                   INSD:BP655343.1,INSD:BP623586.1,INSD:DR203066.1,
FT                   INSD:DR345267.1,INSD:ES144920.1,INSD:DR345204.1,
FT                   INSD:DR345257.1,INSD:EG501917.1,INSD:CK120355.1,
FT                   INSD:EL065885.1,INSD:BP654427.1,INSD:ES088148.1,
FT                   INSD:ES203647.1,INSD:DR345363.1,INSD:EH798627.1,
FT                   INSD:BP822056.1,INSD:ES174549.1,INSD:DR345220.1,
FT                   INSD:ES133505.1,INSD:ES140228.1,INSD:DR203119.1,
FT                   INSD:ES104133.1,INSD:DR345291.1,INSD:BP805395.1,
FT                   INSD:DR345178.1,INSD:DR345254.1,INSD:DR345340.1,
FT                   INSD:DR203080.1,INSD:CK119207.1,INSD:DR345353.1,
FT                   INSD:BP651781.1,INSD:ES059228.1,INSD:BP841386.1,
FT                   INSD:DR203104.1,INSD:DR345290.1,INSD:ES059823.1,
FT                   INSD:DR345317.1,INSD:DR345320.1,INSD:DR183459.1,
FT                   INSD:DR345190.1,INSD:BP821880.1,INSD:ES081529.1,
FT                   INSD:DR203091.1,INSD:ES069520.1,INSD:CF774158.1,
FT                   INSD:EL174160.1,INSD:DR345200.1,INSD:DR345176.1,
FT                   INSD:BP628642.1,INSD:EL244147.1,INSD:DR183472.1,
FT                   INSD:DR345285.1,INSD:DR345324.1,INSD:ES011850.1,
FT                   INSD:EL131090.1,INSD:DR371087.1,INSD:BP819536.1,
FT                   INSD:DR345304.1,INSD:DR183468.1,INSD:DR203120.1,
FT                   INSD:DR203085.1,INSD:DR183453.1,INSD:EL992171.1,
FT                   INSD:DR345348.1,INSD:DR345344.1,INSD:BP637169.1,
FT                   INSD:DR183454.1,INSD:DR345349.1,INSD:ES064675.1,
FT                   INSD:ES187419.1,INSD:DR345334.1,INSD:DR345316.1,
FT                   INSD:DR345217.1,INSD:DR203121.1,INSD:ES153752.1,
FT                   INSD:DR377427.1,INSD:DR203070.1,INSD:ES160212.1,
FT                   INSD:DR203108.1,INSD:BP812696.2,INSD:DR203077.1,
FT                   INSD:BP591577.1,INSD:ES097944.1,INSD:ES011414.1,
FT                   INSD:DR183441.1,INSD:DR183443.1,INSD:EG481405.1,
FT                   INSD:DR345329.1,INSD:DR345223.1,INSD:EL306810.1,
FT                   INSD:DR345269.1,INSD:EL995764.1,INSD:DR203112.1,
FT                   INSD:EL282417.1,INSD:DR345203.1,INSD:BP586021.1,
FT                   INSD:BP850988.1,INSD:CB256228.1,INSD:DR345326.1,
FT                   INSD:BP649434.1,INSD:DR203100.1,INSD:DR345323.1,
FT                   INSD:ES134239.1,INSD:DR345305.1,INSD:DR203118.1,
FT                   INSD:DR345182.1,INSD:BP576990.1,INSD:BP818377.1,
FT                   INSD:ES110165.1,INSD:BP815985.1,INSD:BP838367.1,
FT                   INSD:BP633463.1,INSD:DR203084.1,INSD:DR345207.1,
FT                   INSD:BP665314.1,INSD:DR203102.1,INSD:ES133837.1,
FT                   INSD:DR183447.1,INSD:DR345221.1,INSD:ES137464.1,
FT                   INSD:DR345318.1,INSD:ES020329.1,INSD:ES215879.1,
FT                   INSD:ES182779.1,INSD:DR345244.1,INSD:DR183466.1,
FT                   INSD:BP575467.1,INSD:DR345321.1,INSD:BP653939.1,
FT                   INSD:ES122817.1,INSD:BP634664.1,INSD:BP644796.1,
FT                   INSD:ES181661.1,INSD:DR345351.1,INSD:DR183460.1,
FT                   INSD:DR345262.1,INSD:DR345341.1,INSD:DR345232.1,
FT                   INSD:DR183465.1,INSD:DR345360.1,INSD:DR345260.1,
FT                   INSD:BP641756.1,INSD:ES025614.1,INSD:BP652778.1,
FT                   INSD:CK118988.1,INSD:EH868138.1,INSD:DR345265.1,
FT                   INSD:BP646654.1,INSD:BP574581.1,INSD:DR345216.1,
FT                   INSD:DR345354.1,INSD:DR345359.1,INSD:EG481406.1,
FT                   INSD:DR345328.1,INSD:DR345236.1,INSD:DR345288.1,
FT                   INSD:DR345333.1,INSD:DR345175.1,INSD:EL283860.1,
FT                   INSD:DR345264.1,INSD:ES033626.1,INSD:DR345302.1,
FT                   INSD:ES166802.1,INSD:BP655272.1,INSD:BP831604.1,
FT                   INSD:EH926618.1,INSD:AV542617.1,INSD:DR345231.1,
FT                   INSD:DR345336.1,INSD:BP828975.1,INSD:ES013118.1,
FT                   INSD:DR203116.1,INSD:DR345308.1,INSD:DR203082.1,
FT                   INSD:DR345255.1,INSD:DR345289.1,INSD:DR183458.1,
FT                   INSD:DR345361.1,INSD:DR345300.1,INSD:DR345296.1,
FT                   INSD:BP637909.1,INSD:ES067767.1,INSD:DR183438.1,
FT                   INSD:DR345319.1,INSD:ES065015.1,INSD:DR376980.1,
FT                   INSD:ES064137.1,INSD:AV534619.1,INSD:DR345355.1,
FT                   INSD:BP651992.1,INSD:EH963419.1,INSD:DR345347.1,
FT                   INSD:EL034531.1,INSD:DR345224.1,INSD:ES022248.1,
FT                   INSD:DR345268.1,INSD:DR183462.1,INSD:DR345327.1,
FT                   INSD:DR203098.1,INSD:DR345209.1,INSD:DR203096.1,
FT                   INSD:EL283008.1,INSD:BP638228.1,INSD:ES112062.1,
FT                   INSD:DR345294.1,INSD:DR345202.1,INSD:BP804030.1,
FT                   INSD:BP816855.1,INSD:DR203075.1,INSD:DR203099.1,
FT                   INSD:EH858407.1,INSD:DR345345.1,INSD:DR345233.1,
FT                   INSD:ES059035.1,INSD:DR183455.1,INSD:DR203089.1,
FT                   INSD:DR345208.1,INSD:BP665140.1,INSD:ES205817.1,
FT                   INSD:BP829458.1,INSD:DR345271.1,INSD:DR345188.1,
FT                   INSD:DR203107.1,INSD:DR345297.1,INSD:DR183467.1,
FT                   INSD:DR203072.1,INSD:DR373214.1,INSD:DR345251.1,
FT                   INSD:ES016077.1,INSD:DR183449.1,INSD:DR203110.1,
FT                   INSD:DR345240.1,INSD:DR203095.1,INSD:BP633834.1,
FT                   INSD:EL067665.1,INSD:ES177128.1,INSD:DR345253.1,
FT                   INSD:EL985143.1,INSD:DR345273.1,INSD:DR345258.1,
FT                   INSD:EH878787.1,INSD:DR183464.1,INSD:DR183469.1,
FT                   INSD:BP830305.1,INSD:EH906153.1,INSD:BP645200.1,
FT                   INSD:EL324478.1,INSD:DR183442.1,INSD:DR345301.1,
FT                   INSD:DR303028.1,INSD:BP650221.1,INSD:DR345263.1,
FT                   INSD:BP814243.1,INSD:EH920304.1,INSD:DR203097.1,
FT                   INSD:EH887322.1,INSD:DR345259.1,INSD:BP579634.1,
FT                   INSD:DR345193.1,INSD:CK120689.1,INSD:BP644342.1,
FT                   INSD:DR345199.1,INSD:DR345211.1,INSD:BP834640.1,
FT                   INSD:DR345179.1,INSD:DR345299.1,INSD:DR345194.1,
FT                   INSD:EL298566.1,INSD:BP653941.1,INSD:BP838604.1,
FT                   INSD:DR345250.1,INSD:BP648753.1,INSD:EL240545.1,
FT                   INSD:DR203083.1,INSD:DR345241.1,INSD:DR345177.1,
FT                   INSD:EL072872.1,INSD:EL035022.1,INSD:DR345230.1,
FT                   INSD:DR345266.1,INSD:DR345313.1,INSD:DR345252.1,
FT                   INSD:ES121775.1,INSD:DR203073.1,INSD:DR229009.1,
FT                   INSD:BP668181.1,INSD:DR203105.1,INSD:BP827040.1,
FT                   INSD:BP653931.1,INSD:EL973337.1,INSD:ES049523.1,
FT                   INSD:ES140406.1,INSD:ES012214.1,INSD:DR183440.1,
FT                   INSD:DR345192.1,INSD:ES184893.1,INSD:DR345243.1,
FT                   INSD:DR345249.1,INSD:DR345292.1,INSD:DR345325.1,
FT                   INSD:EH925429.1,INSD:ES170975.1,INSD:BP639724.1,
FT                   INSD:DR345352.1,INSD:BP579417.1,INSD:DR203090.1,
FT                   INSD:DR203115.1,INSD:EL051375.1,INSD:DR345256.1,
FT                   INSD:DR203106.1,INSD:DR345189.1,INSD:DR203103.1,
FT                   INSD:DR345227.1,INSD:BP626638.1,INSD:EL056298.1,
FT                   INSD:EG453960.1,INSD:BP648680.1,INSD:ES100179.1,
FT                   INSD:DR183452.1,INSD:EL176378.1,INSD:DR345228.1,
FT                   INSD:DR345322.1,INSD:DR345306.1,INSD:BE844776.1,
FT                   INSD:DR370723.1,INSD:EH898488.1,INSD:DR203081.1,
FT                   INSD:DR345314.1,INSD:EH842137.1,INSD:DR345309.1,
FT                   INSD:DR345197.1,INSD:EH866772.1,INSD:AA728491.1,
FT                   INSD:BP833092.1,INSD:ES123663.1,INSD:DR196271.1,
FT                   INSD:DR345358.1,INSD:DR183463.1,INSD:BP815348.1,
FT                   INSD:DR345181.1,INSD:BP843883.1,INSD:DR372502.1,
FT                   INSD:ES021461.1,INSD:EG503579.1,INSD:DR345275.1,
FT                   INSD:DR345295.1,INSD:DR345293.1,INSD:DR203093.1,
FT                   INSD:DR345247.1,INSD:EH896331.1,INSD:ES104251.1,
FT                   INSD:DR183444.1,INSD:DR345311.1,INSD:DR345330.1,
FT                   INSD:DR203109.1,INSD:BP637308.1,INSD:EH859658.1,
FT                   INSD:DR183439.1,INSD:DR345215.1,INSD:DR345342.1,
FT                   INSD:DR345239.1,INSD:BP643592.1,INSD:DR345276.1,
FT                   INSD:BP848565.1,INSD:DR345335.1,INSD:EG503578.1,
FT                   INSD:BP838692.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX816971.1,INSD:AY091176.1,INSD:BX818525.1,
FT                   INSD:BX841793.1,INSD:AY050975.1"
FT   mRNA            complement(join(50090..50337,50419..50631,50883..50963,
FT                   51123..51187))
FT                   /gene_synonym="T25K16.9"
FT                   /gene_synonym="T25K16_9"
FT                   /locus_tag="AT1G01100"
FT                   /product="60S acidic ribosomal protein family"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL282417.1,INSD:BP645001.1,INSD:BP658052.1,
FT                   INSD:BP659894.1,INSD:BP586021.1,INSD:ES074073.1,
FT                   INSD:BP623145.1,INSD:ES016077.1,INSD:BP577478.1,
FT                   INSD:BP649434.1,INSD:BP633834.1,INSD:EL067665.1,
FT                   INSD:ES050513.1,INSD:EL092124.1,INSD:CB263926.1,
FT                   INSD:EL177675.1,INSD:EL985143.1,INSD:ES118895.1,
FT                   INSD:EL996608.1,INSD:BP597769.1,INSD:BP576990.1,
FT                   INSD:ES110165.1,INSD:ES059175.1,INSD:EH878787.1,
FT                   INSD:BP651270.1,INSD:EH906153.1,INSD:BP645200.1,
FT                   INSD:BP633463.1,INSD:ES069648.1,INSD:EL324478.1,
FT                   INSD:EH892862.1,INSD:DR183442.1,INSD:BP665314.1,
FT                   INSD:BP580994.1,INSD:BP650221.1,INSD:ES175630.1,
FT                   INSD:DR377582.1,INSD:BP655343.1,INSD:ES105448.1,
FT                   INSD:BP623586.1,INSD:ES133837.1,INSD:ES144920.1,
FT                   INSD:EL065424.1,INSD:ES137464.1,INSD:EH920304.1,
FT                   INSD:ES182779.1,INSD:ES215879.1,INSD:ES020329.1,
FT                   INSD:EL065885.1,INSD:EH887322.1,INSD:BP654427.1,
FT                   INSD:ES203647.1,INSD:ES088148.1,INSD:BP575467.1,
FT                   INSD:EH798627.1,INSD:BP579634.1,INSD:ES128418.1,
FT                   INSD:BP644342.1,INSD:BP635904.1,INSD:ES133505.1,
FT                   INSD:BP653939.1,INSD:ES140228.1,INSD:ES122817.1,
FT                   INSD:BP644796.1,INSD:BP634664.1,INSD:ES181661.1,
FT                   INSD:ES104133.1,INSD:ES204655.1,INSD:EL298566.1,
FT                   INSD:BP653941.1,INSD:BP648753.1,INSD:ES030547.1,
FT                   INSD:EL240545.1,INSD:BP641756.1,INSD:BP596190.1,
FT                   INSD:BP652778.1,INSD:EL968449.1,INSD:BP576648.1,
FT                   INSD:AV795787.1,INSD:EH868138.1,INSD:EL035022.1,
FT                   INSD:BP646654.1,INSD:BP574581.1,INSD:BP651781.1,
FT                   INSD:ES059228.1,INSD:BP668181.1,INSD:ES059823.1,
FT                   INSD:BP653931.1,INSD:ES049523.1,INSD:ES140406.1,
FT                   INSD:ES081529.1,INSD:AV795050.1,INSD:ES184893.1,
FT                   INSD:EL283860.1,INSD:CF774158.1,INSD:EL174160.1,
FT                   INSD:DR373802.1,INSD:DR345198.1,INSD:ES033626.1,
FT                   INSD:ES170975.1,INSD:BP655272.1,INSD:BP639724.1,
FT                   INSD:ES170500.1,INSD:ES166802.1,INSD:BP579417.1,
FT                   INSD:EL051375.1,INSD:BP628642.1,INSD:EL244147.1,
FT                   INSD:AV542617.1,INSD:ES011850.1,INSD:EL131090.1,
FT                   INSD:BP626638.1,INSD:ES061279.1,INSD:DR317036.1,
FT                   INSD:DR371087.1,INSD:EL056298.1,INSD:EG453960.1,
FT                   INSD:BP648680.1,INSD:ES100179.1,INSD:EL992329.1,
FT                   INSD:EH817750.1,INSD:ES013118.1,INSD:EL995834.1,
FT                   INSD:BP656953.1,INSD:BP634195.1,INSD:EH898488.1,
FT                   INSD:BP637909.1,INSD:ES067767.1,INSD:EL315161.1,
FT                   INSD:EH866772.1,INSD:ES065015.1,INSD:DR376980.1,
FT                   INSD:ES064137.1,INSD:BP658890.1,INSD:AA728491.1,
FT                   INSD:EL992171.1,INSD:EH897642.1,INSD:BP637169.1,
FT                   INSD:BP651992.1,INSD:EH963419.1,INSD:ES123663.1,
FT                   INSD:EL034531.1,INSD:ES064675.1,INSD:ES187419.1,
FT                   INSD:ES153752.1,INSD:EG503579.1,INSD:ES021461.1,
FT                   INSD:ES160212.1,INSD:BP623338.1,INSD:BP647501.1,
FT                   INSD:EH896331.1,INSD:CB262253.1,INSD:ES104251.1,
FT                   INSD:BP591577.1,INSD:ES011414.1,INSD:ES097944.1,
FT                   INSD:EL283008.1,INSD:BP638228.1,INSD:ES112062.1,
FT                   INSD:ES198802.1,INSD:BP637308.1,INSD:EH859658.1,
FT                   INSD:EG453959.1,INSD:EH858407.1,INSD:BP643592.1,
FT                   INSD:ES059035.1,INSD:ES185539.1,INSD:BP665140.1,
FT                   INSD:EL306810.1,INSD:EG503578.1,INSD:EH944977.1,
FT                   INSD:EL995764.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY086359.1,INSD:AY091176.1"
FT   mRNA            complement(join(50090..50337,50419..50631,50883..50963,
FT                   51064..51108))
FT                   /gene_synonym="T25K16.9"
FT                   /gene_synonym="T25K16_9"
FT                   /locus_tag="AT1G01100"
FT                   /product="60S acidic ribosomal protein family"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR345280.1,INSD:DR345203.1,INSD:DR345326.1,
FT                   INSD:BP649434.1,INSD:DR345323.1,INSD:ES134239.1,
FT                   INSD:ES118895.1,INSD:DR345278.1,INSD:DR345182.1,
FT                   INSD:BP576990.1,INSD:ES110165.1,INSD:DR345274.1,
FT                   INSD:DR345284.1,INSD:EH892862.1,INSD:DR345350.1,
FT                   INSD:ES175630.1,INSD:ES105448.1,INSD:DR345246.1,
FT                   INSD:ES133837.1,INSD:DR345185.1,INSD:EL065424.1,
FT                   INSD:ES137464.1,INSD:DR345318.1,INSD:DR345270.1,
FT                   INSD:DR345242.1,INSD:ES020329.1,INSD:DR345244.1,
FT                   INSD:DR345186.1,INSD:DR345187.1,INSD:ES128418.1,
FT                   INSD:DR345321.1,INSD:ES122817.1,INSD:DR345332.1,
FT                   INSD:DR345229.1,INSD:ES181661.1,INSD:DR345262.1,
FT                   INSD:DR345341.1,INSD:ES204655.1,INSD:DR345260.1,
FT                   INSD:BP596190.1,INSD:ES025614.1,INSD:EL968449.1,
FT                   INSD:EH868138.1,INSD:DR345265.1,INSD:DR345339.1,
FT                   INSD:DR345287.1,INSD:DR345362.1,INSD:DR345205.1,
FT                   INSD:DR345312.1,INSD:EG481406.1,INSD:DR345328.1,
FT                   INSD:DR345261.1,INSD:DR345288.1,INSD:DR345333.1,
FT                   INSD:DR345175.1,INSD:EL283860.1,INSD:DR345264.1,
FT                   INSD:DR345198.1,INSD:DR345302.1,INSD:ES166802.1,
FT                   INSD:ES170500.1,INSD:EH926618.1,INSD:AV542617.1,
FT                   INSD:DR345214.1,INSD:ES061279.1,INSD:DR345336.1,
FT                   INSD:DR345206.1,INSD:ES013118.1,INSD:DR345315.1,
FT                   INSD:DR345308.1,INSD:DR345289.1,INSD:DR345361.1,
FT                   INSD:DR345300.1,INSD:DR345296.1,INSD:ES067767.1,
FT                   INSD:DR345319.1,INSD:DR345201.1,INSD:ES065015.1,
FT                   INSD:ES064137.1,INSD:DR345355.1,INSD:DR345283.1,
FT                   INSD:EH963419.1,INSD:DR345347.1,INSD:DR345337.1,
FT                   INSD:DR345303.1,INSD:DR345298.1,INSD:DR345238.1,
FT                   INSD:ES022248.1,INSD:DR345268.1,INSD:DR345327.1,
FT                   INSD:DR345212.1,INSD:DR345237.1,INSD:DR203096.1,
FT                   INSD:DR345180.1,INSD:EL283008.1,INSD:ES112062.1,
FT                   INSD:DR345294.1,INSD:DR345202.1,INSD:EG453959.1,
FT                   INSD:DR345345.1,INSD:ES059035.1,INSD:ES185539.1,
FT                   INSD:ES205817.1,INSD:EH944977.1,INSD:DR345297.1,
FT                   INSD:ES009832.1,INSD:DR345191.1,INSD:DR345279.1,
FT                   INSD:BP645001.1,INSD:ES074073.1,INSD:DR345251.1,
FT                   INSD:ES188004.1,INSD:DR345338.1,INSD:DR183449.1,
FT                   INSD:EL067665.1,INSD:DR345277.1,INSD:ES177128.1,
FT                   INSD:EL092124.1,INSD:DR345253.1,INSD:EL985143.1,
FT                   INSD:DR345273.1,INSD:EL996608.1,INSD:DR345258.1,
FT                   INSD:ES059175.1,INSD:EH878787.1,INSD:DR345282.1,
FT                   INSD:DR345286.1,INSD:DR345248.1,INSD:EH906153.1,
FT                   INSD:ES069648.1,INSD:EL324478.1,INSD:DR183442.1,
FT                   INSD:DR345343.1,INSD:DR303028.1,INSD:DR345301.1,
FT                   INSD:DR345213.1,INSD:ES144920.1,INSD:DR345263.1,
FT                   INSD:DR345204.1,INSD:EH920304.1,INSD:EH887322.1,
FT                   INSD:DR345259.1,INSD:DR345363.1,INSD:EH798627.1,
FT                   INSD:ES174549.1,INSD:DR345193.1,INSD:ES133505.1,
FT                   INSD:DR345211.1,INSD:ES140228.1,INSD:DR345179.1,
FT                   INSD:ES104133.1,INSD:DR345291.1,INSD:BP653941.1,
FT                   INSD:DR345250.1,INSD:DR345254.1,INSD:DR345241.1,
FT                   INSD:DR345177.1,INSD:EL072872.1,INSD:EL035022.1,
FT                   INSD:DR345266.1,INSD:DR345313.1,INSD:ES121775.1,
FT                   INSD:ES059228.1,INSD:DR229009.1,INSD:ES059823.1,
FT                   INSD:DR345290.1,INSD:EL973337.1,INSD:ES049523.1,
FT                   INSD:ES140406.1,INSD:ES012214.1,INSD:DR183459.1,
FT                   INSD:DR345190.1,INSD:ES081529.1,INSD:ES069520.1,
FT                   INSD:DR345249.1,INSD:EL174160.1,INSD:DR345325.1,
FT                   INSD:EH925429.1,INSD:ES170975.1,INSD:DR345352.1,
FT                   INSD:DR345200.1,INSD:BP579417.1,INSD:DR203115.1,
FT                   INSD:EL051375.1,INSD:DR345256.1,INSD:EL244147.1,
FT                   INSD:DR345324.1,INSD:DR345285.1,INSD:ES011850.1,
FT                   INSD:EL131090.1,INSD:DR345189.1,INSD:EL056298.1,
FT                   INSD:EG453960.1,INSD:ES100179.1,INSD:DR345304.1,
FT                   INSD:EL176378.1,INSD:DR183468.1,INSD:DR345322.1,
FT                   INSD:DR345306.1,INSD:DR315424.1,INSD:DR345314.1,
FT                   INSD:EH842137.1,INSD:DR345197.1,INSD:EH866772.1,
FT                   INSD:DR345348.1,INSD:DR345344.1,INSD:DR183454.1,
FT                   INSD:DR345349.1,INSD:DR345358.1,INSD:ES064675.1,
FT                   INSD:ES187419.1,INSD:DR345334.1,INSD:DR345181.1,
FT                   INSD:DR345275.1,INSD:ES160212.1,INSD:DR345295.1,
FT                   INSD:DR345293.1,INSD:DR345247.1,INSD:EH896331.1,
FT                   INSD:ES097944.1,INSD:DR345311.1,INSD:DR345330.1,
FT                   INSD:EG481405.1,INSD:EH859658.1,INSD:DR345215.1,
FT                   INSD:DR345342.1,INSD:DR345276.1,INSD:DR345335.1,
FT                   INSD:EL306810.1,INSD:DR345269.1,INSD:EL995764.1"
FT   CDS_pept        complement(join(50284..50337,50419..50447,50496..50631,
FT                   50883..50954))
FT                   /codon_start=1
FT                   /gene_synonym="T25K16.9"
FT                   /gene_synonym="T25K16_9"
FT                   /locus_tag="AT1G01100"
FT                   /product="60S acidic ribosomal protein family"
FT                   /note="60S acidic ribosomal protein family; FUNCTIONS IN:
FT                   structural constituent of ribosome; INVOLVED IN:
FT                   translational elongation; LOCATED IN: cytosol, cytosolic
FT                   ribosome, ribosome, nucleus, plasma membrane; EXPRESSED IN:
FT                   25 plant structures; EXPRESSED DURING: 14 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Ribosomal protein 60S
FT                   (InterPro:IPR001813); BEST Arabidopsis thaliana protein
FT                   match is: 60S acidic ribosomal protein family
FT                   (TAIR:AT5G47700.2); Has 1446 Blast hits to 1446 proteins in
FT                   306 species: Archae - 3; Bacteria - 0; Metazoa - 542; Fungi
FT                   - 379; Plants - 324; Viruses - 0; Other Eukaryotes - 198
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01100"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01100.3"
FT                   /db_xref="GOA:A8MQK8"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:A8MQK8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR345280.1,INSD:DR345203.1,INSD:DR345326.1,
FT                   INSD:BP649434.1,INSD:DR345323.1,INSD:ES134239.1,
FT                   INSD:ES118895.1,INSD:DR345278.1,INSD:DR345182.1,
FT                   INSD:BP576990.1,INSD:ES110165.1,INSD:DR345274.1,
FT                   INSD:DR345284.1,INSD:EH892862.1,INSD:DR345350.1,
FT                   INSD:ES175630.1,INSD:ES105448.1,INSD:DR345246.1,
FT                   INSD:ES133837.1,INSD:DR345185.1,INSD:EL065424.1,
FT                   INSD:ES137464.1,INSD:DR345318.1,INSD:DR345270.1,
FT                   INSD:DR345242.1,INSD:ES020329.1,INSD:DR345244.1,
FT                   INSD:DR345186.1,INSD:DR345187.1,INSD:ES128418.1,
FT                   INSD:DR345321.1,INSD:ES122817.1,INSD:DR345332.1,
FT                   INSD:DR345229.1,INSD:ES181661.1,INSD:DR345262.1,
FT                   INSD:DR345341.1,INSD:ES204655.1,INSD:DR345260.1,
FT                   INSD:BP596190.1,INSD:ES025614.1,INSD:EL968449.1,
FT                   INSD:EH868138.1,INSD:DR345265.1,INSD:DR345339.1,
FT                   INSD:DR345287.1,INSD:DR345362.1,INSD:DR345205.1,
FT                   INSD:DR345312.1,INSD:EG481406.1,INSD:DR345328.1,
FT                   INSD:DR345261.1,INSD:DR345288.1,INSD:DR345333.1,
FT                   INSD:DR345175.1,INSD:EL283860.1,INSD:DR345264.1,
FT                   INSD:DR345198.1,INSD:DR345302.1,INSD:ES166802.1,
FT                   INSD:ES170500.1,INSD:EH926618.1,INSD:AV542617.1,
FT                   INSD:DR345214.1,INSD:ES061279.1,INSD:DR345336.1,
FT                   INSD:DR345206.1,INSD:ES013118.1,INSD:DR345315.1,
FT                   INSD:DR345308.1,INSD:DR345289.1,INSD:DR345361.1,
FT                   INSD:DR345300.1,INSD:DR345296.1,INSD:ES067767.1,
FT                   INSD:DR345319.1,INSD:DR345201.1,INSD:ES065015.1,
FT                   INSD:ES064137.1,INSD:DR345355.1,INSD:DR345283.1,
FT                   INSD:EH963419.1,INSD:DR345347.1,INSD:DR345337.1,
FT                   INSD:DR345303.1,INSD:DR345298.1,INSD:DR345238.1,
FT                   INSD:ES022248.1,INSD:DR345268.1,INSD:DR345327.1,
FT                   INSD:DR345212.1,INSD:DR345237.1,INSD:DR203096.1,
FT                   INSD:DR345180.1,INSD:EL283008.1,INSD:ES112062.1,
FT                   INSD:DR345294.1,INSD:DR345202.1,INSD:EG453959.1,
FT                   INSD:DR345345.1,INSD:ES059035.1,INSD:ES185539.1,
FT                   INSD:ES205817.1,INSD:EH944977.1,INSD:DR345297.1,
FT                   INSD:ES009832.1,INSD:DR345191.1,INSD:DR345279.1,
FT                   INSD:BP645001.1,INSD:ES074073.1,INSD:DR345251.1,
FT                   INSD:ES188004.1,INSD:DR345338.1,INSD:DR183449.1,
FT                   INSD:EL067665.1,INSD:DR345277.1,INSD:ES177128.1,
FT                   INSD:EL092124.1,INSD:DR345253.1,INSD:EL985143.1,
FT                   INSD:DR345273.1,INSD:EL996608.1,INSD:DR345258.1,
FT                   INSD:ES059175.1,INSD:EH878787.1,INSD:DR345282.1,
FT                   INSD:DR345286.1,INSD:DR345248.1,INSD:EH906153.1,
FT                   INSD:ES069648.1,INSD:EL324478.1,INSD:DR183442.1,
FT                   INSD:DR345343.1,INSD:DR303028.1,INSD:DR345301.1,
FT                   INSD:DR345213.1,INSD:ES144920.1,INSD:DR345263.1,
FT                   INSD:DR345204.1,INSD:EH920304.1,INSD:EH887322.1,
FT                   INSD:DR345259.1,INSD:DR345363.1,INSD:EH798627.1,
FT                   INSD:ES174549.1,INSD:DR345193.1,INSD:ES133505.1,
FT                   INSD:DR345211.1,INSD:ES140228.1,INSD:DR345179.1,
FT                   INSD:ES104133.1,INSD:DR345291.1,INSD:BP653941.1,
FT                   INSD:DR345250.1,INSD:DR345254.1,INSD:DR345241.1,
FT                   INSD:DR345177.1,INSD:EL072872.1,INSD:EL035022.1,
FT                   INSD:DR345266.1,INSD:DR345313.1,INSD:ES121775.1,
FT                   INSD:ES059228.1,INSD:DR229009.1,INSD:ES059823.1,
FT                   INSD:DR345290.1,INSD:EL973337.1,INSD:ES049523.1,
FT                   INSD:ES140406.1,INSD:ES012214.1,INSD:DR183459.1,
FT                   INSD:DR345190.1,INSD:ES081529.1,INSD:ES069520.1,
FT                   INSD:DR345249.1,INSD:EL174160.1,INSD:DR345325.1,
FT                   INSD:EH925429.1,INSD:ES170975.1,INSD:DR345352.1,
FT                   INSD:DR345200.1,INSD:BP579417.1,INSD:DR203115.1,
FT                   INSD:EL051375.1,INSD:DR345256.1,INSD:EL244147.1,
FT                   INSD:DR345324.1,INSD:DR345285.1,INSD:ES011850.1,
FT                   INSD:EL131090.1,INSD:DR345189.1,INSD:EL056298.1,
FT                   INSD:EG453960.1,INSD:ES100179.1,INSD:DR345304.1,
FT                   INSD:EL176378.1,INSD:DR183468.1,INSD:DR345322.1,
FT                   INSD:DR345306.1,INSD:DR315424.1,INSD:DR345314.1,
FT                   INSD:EH842137.1,INSD:DR345197.1,INSD:EH866772.1,
FT                   INSD:DR345348.1,INSD:DR345344.1,INSD:DR183454.1,
FT                   INSD:DR345349.1,INSD:DR345358.1,INSD:ES064675.1,
FT                   INSD:ES187419.1,INSD:DR345334.1,INSD:DR345181.1,
FT                   INSD:DR345275.1,INSD:ES160212.1,INSD:DR345295.1,
FT                   INSD:DR345293.1,INSD:DR345247.1,INSD:EH896331.1,
FT                   INSD:ES097944.1,INSD:DR345311.1,INSD:DR345330.1,
FT                   INSD:EG481405.1,INSD:EH859658.1,INSD:DR345215.1,
FT                   INSD:DR345342.1,INSD:DR345276.1,INSD:DR345335.1,
FT                   INSD:EL306810.1,INSD:DR345269.1,INSD:EL995764.1"
FT                   /protein_id="AEE27236.1"
FT                   /translation="MSTVGELACSYAVMILEDEGIAITADKIATLVKAAGVSIESYWPM
FT                   LFAKMAEKRNVTDLIMNVGAGGGGAAPAAEEKKKDEPAEESDGDLGFGLFD"
FT   CDS_pept        complement(join(50284..50337,50419..50631,50883..50954))
FT                   /codon_start=1
FT                   /gene_synonym="T25K16.9"
FT                   /gene_synonym="T25K16_9"
FT                   /locus_tag="AT1G01100"
FT                   /product="60S acidic ribosomal protein family"
FT                   /note="60S acidic ribosomal protein family; FUNCTIONS IN:
FT                   structural constituent of ribosome; INVOLVED IN:
FT                   translational elongation; LOCATED IN: cytosol, cytosolic
FT                   ribosome, ribosome, nucleus, plasma membrane; EXPRESSED IN:
FT                   25 plant structures; EXPRESSED DURING: 14 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Ribosomal protein 60S
FT                   (InterPro:IPR001813); BEST Arabidopsis thaliana protein
FT                   match is: 60S acidic ribosomal protein family
FT                   (TAIR:AT5G47700.2); Has 2175 Blast hits to 2175 proteins in
FT                   383 species: Archae - 76; Bacteria - 0; Metazoa - 858;
FT                   Fungi - 474; Plants - 451; Viruses - 0; Other Eukaryotes -
FT                   316 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8LCW9"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LCW9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL282417.1,INSD:BP645001.1,INSD:BP658052.1,
FT                   INSD:BP659894.1,INSD:BP586021.1,INSD:ES074073.1,
FT                   INSD:BP623145.1,INSD:ES016077.1,INSD:BP577478.1,
FT                   INSD:BP649434.1,INSD:BP633834.1,INSD:EL067665.1,
FT                   INSD:ES050513.1,INSD:EL092124.1,INSD:CB263926.1,
FT                   INSD:EL177675.1,INSD:EL985143.1,INSD:ES118895.1,
FT                   INSD:EL996608.1,INSD:BP597769.1,INSD:BP576990.1,
FT                   INSD:ES110165.1,INSD:ES059175.1,INSD:EH878787.1,
FT                   INSD:BP651270.1,INSD:EH906153.1,INSD:BP645200.1,
FT                   INSD:BP633463.1,INSD:ES069648.1,INSD:EL324478.1,
FT                   INSD:EH892862.1,INSD:DR183442.1,INSD:BP665314.1,
FT                   INSD:BP580994.1,INSD:BP650221.1,INSD:ES175630.1,
FT                   INSD:DR377582.1,INSD:BP655343.1,INSD:ES105448.1,
FT                   INSD:BP623586.1,INSD:ES133837.1,INSD:ES144920.1,
FT                   INSD:EL065424.1,INSD:ES137464.1,INSD:EH920304.1,
FT                   INSD:ES182779.1,INSD:ES215879.1,INSD:ES020329.1,
FT                   INSD:EL065885.1,INSD:EH887322.1,INSD:BP654427.1,
FT                   INSD:ES203647.1,INSD:ES088148.1,INSD:BP575467.1,
FT                   INSD:EH798627.1,INSD:BP579634.1,INSD:ES128418.1,
FT                   INSD:BP644342.1,INSD:BP635904.1,INSD:ES133505.1,
FT                   INSD:BP653939.1,INSD:ES140228.1,INSD:ES122817.1,
FT                   INSD:BP644796.1,INSD:BP634664.1,INSD:ES181661.1,
FT                   INSD:ES104133.1,INSD:ES204655.1,INSD:EL298566.1,
FT                   INSD:BP653941.1,INSD:BP648753.1,INSD:ES030547.1,
FT                   INSD:EL240545.1,INSD:BP641756.1,INSD:BP596190.1,
FT                   INSD:BP652778.1,INSD:EL968449.1,INSD:BP576648.1,
FT                   INSD:AV795787.1,INSD:EH868138.1,INSD:EL035022.1,
FT                   INSD:BP646654.1,INSD:BP574581.1,INSD:BP651781.1,
FT                   INSD:ES059228.1,INSD:BP668181.1,INSD:ES059823.1,
FT                   INSD:BP653931.1,INSD:ES049523.1,INSD:ES140406.1,
FT                   INSD:ES081529.1,INSD:AV795050.1,INSD:ES184893.1,
FT                   INSD:EL283860.1,INSD:CF774158.1,INSD:EL174160.1,
FT                   INSD:DR373802.1,INSD:DR345198.1,INSD:ES033626.1,
FT                   INSD:ES170975.1,INSD:BP655272.1,INSD:BP639724.1,
FT                   INSD:ES170500.1,INSD:ES166802.1,INSD:BP579417.1,
FT                   INSD:EL051375.1,INSD:BP628642.1,INSD:EL244147.1,
FT                   INSD:AV542617.1,INSD:ES011850.1,INSD:EL131090.1,
FT                   INSD:BP626638.1,INSD:ES061279.1,INSD:DR317036.1,
FT                   INSD:DR371087.1,INSD:EL056298.1,INSD:EG453960.1,
FT                   INSD:BP648680.1,INSD:ES100179.1,INSD:EL992329.1,
FT                   INSD:EH817750.1,INSD:ES013118.1,INSD:EL995834.1,
FT                   INSD:BP656953.1,INSD:BP634195.1,INSD:EH898488.1,
FT                   INSD:BP637909.1,INSD:ES067767.1,INSD:EL315161.1,
FT                   INSD:EH866772.1,INSD:ES065015.1,INSD:DR376980.1,
FT                   INSD:ES064137.1,INSD:BP658890.1,INSD:AA728491.1,
FT                   INSD:EL992171.1,INSD:EH897642.1,INSD:BP637169.1,
FT                   INSD:BP651992.1,INSD:EH963419.1,INSD:ES123663.1,
FT                   INSD:EL034531.1,INSD:ES064675.1,INSD:ES187419.1,
FT                   INSD:ES153752.1,INSD:EG503579.1,INSD:ES021461.1,
FT                   INSD:ES160212.1,INSD:BP623338.1,INSD:BP647501.1,
FT                   INSD:EH896331.1,INSD:CB262253.1,INSD:ES104251.1,
FT                   INSD:BP591577.1,INSD:ES011414.1,INSD:ES097944.1,
FT                   INSD:EL283008.1,INSD:BP638228.1,INSD:ES112062.1,
FT                   INSD:ES198802.1,INSD:BP637308.1,INSD:EH859658.1,
FT                   INSD:EG453959.1,INSD:EH858407.1,INSD:BP643592.1,
FT                   INSD:ES059035.1,INSD:ES185539.1,INSD:BP665140.1,
FT                   INSD:EL306810.1,INSD:EG503578.1,INSD:EH944977.1,
FT                   INSD:EL995764.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY086359.1,INSD:AY091176.1"
FT                   /protein_id="AEE27234.1"
FT                   /translation="MSTVGELACSYAVMILEDEGIAITADKIATLVKAAGVSIESYWPM
FT                   LFAKMAEKRNVTDLIMNVGAGGGGGAPVAAAAPAAGGGAAAAPAAEEKKKDEPAEESDG
FT                   DLGFGLFD"
FT   CDS_pept        complement(join(50284..50337,50419..50631,50883..50954))
FT                   /codon_start=1
FT                   /gene_synonym="T25K16.9"
FT                   /gene_synonym="T25K16_9"
FT                   /locus_tag="AT1G01100"
FT                   /product="60S acidic ribosomal protein family"
FT                   /note="60S acidic ribosomal protein family; FUNCTIONS IN:
FT                   structural constituent of ribosome; INVOLVED IN:
FT                   translational elongation; LOCATED IN: cytosol, cytosolic
FT                   ribosome, ribosome, nucleus, plasma membrane; EXPRESSED IN:
FT                   25 plant structures; EXPRESSED DURING: 14 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Ribosomal protein 60S
FT                   (InterPro:IPR001813); BEST Arabidopsis thaliana protein
FT                   match is: 60S acidic ribosomal protein family
FT                   (TAIR:AT5G47700.2); Has 2175 Blast hits to 2175 proteins in
FT                   383 species: Archae - 76; Bacteria - 0; Metazoa - 858;
FT                   Fungi - 474; Plants - 451; Viruses - 0; Other Eukaryotes -
FT                   316 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8LCW9"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LCW9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR203113.1,INSD:DR203076.1,INSD:BP836092.1,
FT                   INSD:DR345226.1,INSD:AV541434.1,INSD:DR345280.1,
FT                   INSD:BP659894.1,INSD:DR345184.1,INSD:BP819138.1,
FT                   INSD:DR203092.1,INSD:BP623145.1,INSD:BP577478.1,
FT                   INSD:BP826237.1,INSD:AV826465.2,INSD:BP826782.1,
FT                   INSD:BP827053.1,INSD:ES050513.1,INSD:CB263926.1,
FT                   INSD:DR183471.1,INSD:ES118895.1,INSD:DR345278.1,
FT                   INSD:BP597769.1,INSD:DR345274.1,INSD:DR345364.1,
FT                   INSD:BP651270.1,INSD:DR183461.1,INSD:DR345284.1,
FT                   INSD:BP812196.1,INSD:EH892862.1,INSD:DR345350.1,
FT                   INSD:ES175630.1,INSD:DR377582.1,INSD:ES105448.1,
FT                   INSD:DR345246.1,INSD:DR345281.1,INSD:DR345185.1,
FT                   INSD:DR183470.1,INSD:EL065424.1,INSD:DR345270.1,
FT                   INSD:DR345242.1,INSD:DR345222.1,INSD:BP832733.1,
FT                   INSD:DR211234.1,INSD:BP823118.1,INSD:DR203086.1,
FT                   INSD:DR345186.1,INSD:DR345187.1,INSD:ES128418.1,
FT                   INSD:BP635904.1,INSD:DR345307.1,INSD:DR345229.1,
FT                   INSD:DR345332.1,INSD:DR345225.1,INSD:ES204655.1,
FT                   INSD:BP594706.1,INSD:ES030547.1,INSD:BP820681.1,
FT                   INSD:BP596190.1,INSD:BP854995.2,INSD:EL968449.1,
FT                   INSD:DR345218.1,INSD:BP576648.1,INSD:DR345235.1,
FT                   INSD:AV795787.1,INSD:DR345339.1,INSD:DR345210.1,
FT                   INSD:DR345287.1,INSD:BP833991.1,INSD:DR345362.1,
FT                   INSD:DR345205.1,INSD:DR345312.1,INSD:DR183450.1,
FT                   INSD:DR345261.1,INSD:AA712509.1,INSD:DR203122.1,
FT                   INSD:CB258426.1,INSD:AV795050.1,INSD:DR345272.1,
FT                   INSD:BP836713.1,INSD:DR345198.1,INSD:ES170500.1,
FT                   INSD:DR203074.1,INSD:DR345331.1,INSD:DR345214.1,
FT                   INSD:DR345219.1,INSD:AV536016.1,INSD:ES061279.1,
FT                   INSD:BP839086.1,INSD:EG501916.1,INSD:DR183456.1,
FT                   INSD:DR345206.1,INSD:EH817750.1,INSD:EL992329.1,
FT                   INSD:EL995834.1,INSD:DR345315.1,INSD:BP656953.1,
FT                   INSD:DR345356.1,INSD:BP634195.1,INSD:DR203078.1,
FT                   INSD:DR345201.1,INSD:DR203088.1,INSD:EL315161.1,
FT                   INSD:BP658890.1,INSD:EH897642.1,INSD:DR345283.1,
FT                   INSD:DR183448.1,INSD:DR345337.1,INSD:DR345303.1,
FT                   INSD:DR345298.1,INSD:DR203117.1,INSD:DR345238.1,
FT                   INSD:BP835923.1,INSD:DR345310.1,INSD:DR345212.1,
FT                   INSD:BP623338.1,INSD:DR345237.1,INSD:BP647501.1,
FT                   INSD:BP815940.1,INSD:DR345180.1,INSD:CB262253.1,
FT                   INSD:DR183473.1,INSD:BP813384.1,INSD:DR203067.1,
FT                   INSD:ES198802.1,INSD:EG453959.1,INSD:DR203079.1,
FT                   INSD:DR203094.1,INSD:DR203101.1,INSD:ES185539.1,
FT                   INSD:DR345245.1,INSD:EH944977.1,INSD:DR183451.1,
FT                   INSD:DR345191.1,INSD:ES009832.1,INSD:DR345196.1,
FT                   INSD:DR345279.1,INSD:DR345195.1,INSD:BP645001.1,
FT                   INSD:DR345346.1,INSD:BP658052.1,INSD:ES074073.1,
FT                   INSD:DR183446.1,INSD:ES188004.1,INSD:DR345338.1,
FT                   INSD:CK118326.1,INSD:DR345277.1,INSD:EL092124.1,
FT                   INSD:BP866537.1,INSD:EL177675.1,INSD:EL996608.1,
FT                   INSD:DR345234.1,INSD:DR183445.1,INSD:ES059175.1,
FT                   INSD:BP819741.1,INSD:DR345286.1,INSD:DR345282.1,
FT                   INSD:DR183457.1,INSD:DR203069.1,INSD:DR345357.1,
FT                   INSD:DR345248.1,INSD:BP817508.1,INSD:ES069648.1,
FT                   INSD:DR203068.1,INSD:DR345183.1,INSD:DR345343.1,
FT                   INSD:BP580994.1,INSD:DR203087.1,INSD:DR345213.1,
FT                   INSD:BP655343.1,INSD:BP623586.1,INSD:DR203066.1,
FT                   INSD:DR345267.1,INSD:ES144920.1,INSD:DR345204.1,
FT                   INSD:DR345257.1,INSD:EG501917.1,INSD:CK120355.1,
FT                   INSD:EL065885.1,INSD:BP654427.1,INSD:ES088148.1,
FT                   INSD:ES203647.1,INSD:DR345363.1,INSD:EH798627.1,
FT                   INSD:BP822056.1,INSD:ES174549.1,INSD:DR345220.1,
FT                   INSD:ES133505.1,INSD:ES140228.1,INSD:DR203119.1,
FT                   INSD:ES104133.1,INSD:DR345291.1,INSD:BP805395.1,
FT                   INSD:DR345178.1,INSD:DR345254.1,INSD:DR345340.1,
FT                   INSD:DR203080.1,INSD:CK119207.1,INSD:DR345353.1,
FT                   INSD:BP651781.1,INSD:ES059228.1,INSD:BP841386.1,
FT                   INSD:DR203104.1,INSD:DR345290.1,INSD:ES059823.1,
FT                   INSD:DR345317.1,INSD:DR345320.1,INSD:DR183459.1,
FT                   INSD:DR345190.1,INSD:BP821880.1,INSD:ES081529.1,
FT                   INSD:DR203091.1,INSD:ES069520.1,INSD:CF774158.1,
FT                   INSD:EL174160.1,INSD:DR345200.1,INSD:DR345176.1,
FT                   INSD:BP628642.1,INSD:EL244147.1,INSD:DR183472.1,
FT                   INSD:DR345285.1,INSD:DR345324.1,INSD:ES011850.1,
FT                   INSD:EL131090.1,INSD:DR371087.1,INSD:BP819536.1,
FT                   INSD:DR345304.1,INSD:DR183468.1,INSD:DR203120.1,
FT                   INSD:DR203085.1,INSD:DR183453.1,INSD:EL992171.1,
FT                   INSD:DR345348.1,INSD:DR345344.1,INSD:BP637169.1,
FT                   INSD:DR183454.1,INSD:DR345349.1,INSD:ES064675.1,
FT                   INSD:ES187419.1,INSD:DR345334.1,INSD:DR345316.1,
FT                   INSD:DR345217.1,INSD:DR203121.1,INSD:ES153752.1,
FT                   INSD:DR377427.1,INSD:DR203070.1,INSD:ES160212.1,
FT                   INSD:DR203108.1,INSD:BP812696.2,INSD:DR203077.1,
FT                   INSD:BP591577.1,INSD:ES097944.1,INSD:ES011414.1,
FT                   INSD:DR183441.1,INSD:DR183443.1,INSD:EG481405.1,
FT                   INSD:DR345329.1,INSD:DR345223.1,INSD:EL306810.1,
FT                   INSD:DR345269.1,INSD:EL995764.1,INSD:DR203112.1,
FT                   INSD:EL282417.1,INSD:DR345203.1,INSD:BP586021.1,
FT                   INSD:BP850988.1,INSD:CB256228.1,INSD:DR345326.1,
FT                   INSD:BP649434.1,INSD:DR203100.1,INSD:DR345323.1,
FT                   INSD:ES134239.1,INSD:DR345305.1,INSD:DR203118.1,
FT                   INSD:DR345182.1,INSD:BP576990.1,INSD:BP818377.1,
FT                   INSD:ES110165.1,INSD:BP815985.1,INSD:BP838367.1,
FT                   INSD:BP633463.1,INSD:DR203084.1,INSD:DR345207.1,
FT                   INSD:BP665314.1,INSD:DR203102.1,INSD:ES133837.1,
FT                   INSD:DR183447.1,INSD:DR345221.1,INSD:ES137464.1,
FT                   INSD:DR345318.1,INSD:ES020329.1,INSD:ES215879.1,
FT                   INSD:ES182779.1,INSD:DR345244.1,INSD:DR183466.1,
FT                   INSD:BP575467.1,INSD:DR345321.1,INSD:BP653939.1,
FT                   INSD:ES122817.1,INSD:BP634664.1,INSD:BP644796.1,
FT                   INSD:ES181661.1,INSD:DR345351.1,INSD:DR183460.1,
FT                   INSD:DR345262.1,INSD:DR345341.1,INSD:DR345232.1,
FT                   INSD:DR183465.1,INSD:DR345360.1,INSD:DR345260.1,
FT                   INSD:BP641756.1,INSD:ES025614.1,INSD:BP652778.1,
FT                   INSD:CK118988.1,INSD:EH868138.1,INSD:DR345265.1,
FT                   INSD:BP646654.1,INSD:BP574581.1,INSD:DR345216.1,
FT                   INSD:DR345354.1,INSD:DR345359.1,INSD:EG481406.1,
FT                   INSD:DR345328.1,INSD:DR345236.1,INSD:DR345288.1,
FT                   INSD:DR345333.1,INSD:DR345175.1,INSD:EL283860.1,
FT                   INSD:DR345264.1,INSD:ES033626.1,INSD:DR345302.1,
FT                   INSD:ES166802.1,INSD:BP655272.1,INSD:BP831604.1,
FT                   INSD:EH926618.1,INSD:AV542617.1,INSD:DR345231.1,
FT                   INSD:DR345336.1,INSD:BP828975.1,INSD:ES013118.1,
FT                   INSD:DR203116.1,INSD:DR345308.1,INSD:DR203082.1,
FT                   INSD:DR345255.1,INSD:DR345289.1,INSD:DR183458.1,
FT                   INSD:DR345361.1,INSD:DR345300.1,INSD:DR345296.1,
FT                   INSD:BP637909.1,INSD:ES067767.1,INSD:DR183438.1,
FT                   INSD:DR345319.1,INSD:ES065015.1,INSD:DR376980.1,
FT                   INSD:ES064137.1,INSD:AV534619.1,INSD:DR345355.1,
FT                   INSD:BP651992.1,INSD:EH963419.1,INSD:DR345347.1,
FT                   INSD:EL034531.1,INSD:DR345224.1,INSD:ES022248.1,
FT                   INSD:DR345268.1,INSD:DR183462.1,INSD:DR345327.1,
FT                   INSD:DR203098.1,INSD:DR345209.1,INSD:DR203096.1,
FT                   INSD:EL283008.1,INSD:BP638228.1,INSD:ES112062.1,
FT                   INSD:DR345294.1,INSD:DR345202.1,INSD:BP804030.1,
FT                   INSD:BP816855.1,INSD:DR203075.1,INSD:DR203099.1,
FT                   INSD:EH858407.1,INSD:DR345345.1,INSD:DR345233.1,
FT                   INSD:ES059035.1,INSD:DR183455.1,INSD:DR203089.1,
FT                   INSD:DR345208.1,INSD:BP665140.1,INSD:ES205817.1,
FT                   INSD:BP829458.1,INSD:DR345271.1,INSD:DR345188.1,
FT                   INSD:DR203107.1,INSD:DR345297.1,INSD:DR183467.1,
FT                   INSD:DR203072.1,INSD:DR373214.1,INSD:DR345251.1,
FT                   INSD:ES016077.1,INSD:DR183449.1,INSD:DR203110.1,
FT                   INSD:DR345240.1,INSD:DR203095.1,INSD:BP633834.1,
FT                   INSD:EL067665.1,INSD:ES177128.1,INSD:DR345253.1,
FT                   INSD:EL985143.1,INSD:DR345273.1,INSD:DR345258.1,
FT                   INSD:EH878787.1,INSD:DR183464.1,INSD:DR183469.1,
FT                   INSD:BP830305.1,INSD:EH906153.1,INSD:BP645200.1,
FT                   INSD:EL324478.1,INSD:DR183442.1,INSD:DR345301.1,
FT                   INSD:DR303028.1,INSD:BP650221.1,INSD:DR345263.1,
FT                   INSD:BP814243.1,INSD:EH920304.1,INSD:DR203097.1,
FT                   INSD:EH887322.1,INSD:DR345259.1,INSD:BP579634.1,
FT                   INSD:DR345193.1,INSD:CK120689.1,INSD:BP644342.1,
FT                   INSD:DR345199.1,INSD:DR345211.1,INSD:BP834640.1,
FT                   INSD:DR345179.1,INSD:DR345299.1,INSD:DR345194.1,
FT                   INSD:EL298566.1,INSD:BP653941.1,INSD:BP838604.1,
FT                   INSD:DR345250.1,INSD:BP648753.1,INSD:EL240545.1,
FT                   INSD:DR203083.1,INSD:DR345241.1,INSD:DR345177.1,
FT                   INSD:EL072872.1,INSD:EL035022.1,INSD:DR345230.1,
FT                   INSD:DR345266.1,INSD:DR345313.1,INSD:DR345252.1,
FT                   INSD:ES121775.1,INSD:DR203073.1,INSD:DR229009.1,
FT                   INSD:BP668181.1,INSD:DR203105.1,INSD:BP827040.1,
FT                   INSD:BP653931.1,INSD:EL973337.1,INSD:ES049523.1,
FT                   INSD:ES140406.1,INSD:ES012214.1,INSD:DR183440.1,
FT                   INSD:DR345192.1,INSD:ES184893.1,INSD:DR345243.1,
FT                   INSD:DR345249.1,INSD:DR345292.1,INSD:DR345325.1,
FT                   INSD:EH925429.1,INSD:ES170975.1,INSD:BP639724.1,
FT                   INSD:DR345352.1,INSD:BP579417.1,INSD:DR203090.1,
FT                   INSD:DR203115.1,INSD:EL051375.1,INSD:DR345256.1,
FT                   INSD:DR203106.1,INSD:DR345189.1,INSD:DR203103.1,
FT                   INSD:DR345227.1,INSD:BP626638.1,INSD:EL056298.1,
FT                   INSD:EG453960.1,INSD:BP648680.1,INSD:ES100179.1,
FT                   INSD:DR183452.1,INSD:EL176378.1,INSD:DR345228.1,
FT                   INSD:DR345322.1,INSD:DR345306.1,INSD:BE844776.1,
FT                   INSD:DR370723.1,INSD:EH898488.1,INSD:DR203081.1,
FT                   INSD:DR345314.1,INSD:EH842137.1,INSD:DR345309.1,
FT                   INSD:DR345197.1,INSD:EH866772.1,INSD:AA728491.1,
FT                   INSD:BP833092.1,INSD:ES123663.1,INSD:DR196271.1,
FT                   INSD:DR345358.1,INSD:DR183463.1,INSD:BP815348.1,
FT                   INSD:DR345181.1,INSD:BP843883.1,INSD:DR372502.1,
FT                   INSD:ES021461.1,INSD:EG503579.1,INSD:DR345275.1,
FT                   INSD:DR345295.1,INSD:DR345293.1,INSD:DR203093.1,
FT                   INSD:DR345247.1,INSD:EH896331.1,INSD:ES104251.1,
FT                   INSD:DR183444.1,INSD:DR345311.1,INSD:DR345330.1,
FT                   INSD:DR203109.1,INSD:BP637308.1,INSD:EH859658.1,
FT                   INSD:DR183439.1,INSD:DR345215.1,INSD:DR345342.1,
FT                   INSD:DR345239.1,INSD:BP643592.1,INSD:DR345276.1,
FT                   INSD:BP848565.1,INSD:DR345335.1,INSD:EG503578.1,
FT                   INSD:BP838692.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX816971.1,INSD:AY091176.1,INSD:BX818525.1,
FT                   INSD:BX841793.1,INSD:AY050975.1"
FT                   /protein_id="AEE27235.1"
FT                   /translation="MSTVGELACSYAVMILEDEGIAITADKIATLVKAAGVSIESYWPM
FT                   LFAKMAEKRNVTDLIMNVGAGGGGGAPVAAAAPAAGGGAAAAPAAEEKKKDEPAEESDG
FT                   DLGFGLFD"
FT   CDS_pept        complement(join(50284..50337,50419..50631,50883..50954))
FT                   /codon_start=1
FT                   /gene_synonym="T25K16.9"
FT                   /gene_synonym="T25K16_9"
FT                   /locus_tag="AT1G01100"
FT                   /product="60S acidic ribosomal protein family"
FT                   /note="60S acidic ribosomal protein family; FUNCTIONS IN:
FT                   structural constituent of ribosome; INVOLVED IN:
FT                   translational elongation; LOCATED IN: cytosol, cytosolic
FT                   ribosome, ribosome, nucleus, plasma membrane; EXPRESSED IN:
FT                   25 plant structures; EXPRESSED DURING: 14 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Ribosomal protein 60S
FT                   (InterPro:IPR001813); BEST Arabidopsis thaliana protein
FT                   match is: 60S acidic ribosomal protein family
FT                   (TAIR:AT5G47700.2); Has 2175 Blast hits to 2175 proteins in
FT                   383 species: Archae - 76; Bacteria - 0; Metazoa - 858;
FT                   Fungi - 474; Plants - 451; Viruses - 0; Other Eukaryotes -
FT                   316 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01100"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01100.1"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01100.2"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01100.4"
FT                   /db_xref="GOA:Q8LCW9"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LCW9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL282417.1,INSD:BP645001.1,INSD:ES093957.1,
FT                   INSD:BP658052.1,INSD:BP659894.1,INSD:BP586021.1,
FT                   INSD:ES074073.1,INSD:BP623145.1,INSD:ES016077.1,
FT                   INSD:BP577478.1,INSD:BP649434.1,INSD:BP633834.1,
FT                   INSD:EL067665.1,INSD:ES050513.1,INSD:EL092124.1,
FT                   INSD:CB263926.1,INSD:EL985143.1,INSD:EL177675.1,
FT                   INSD:EL996608.1,INSD:EH992669.1,INSD:ES118895.1,
FT                   INSD:BP597769.1,INSD:BP576990.1,INSD:ES110165.1,
FT                   INSD:ES059175.1,INSD:EH878787.1,INSD:BP651270.1,
FT                   INSD:DR203071.1,INSD:EH906153.1,INSD:BP645200.1,
FT                   INSD:BP633463.1,INSD:ES069648.1,INSD:EL324478.1,
FT                   INSD:EH892862.1,INSD:DR183442.1,INSD:BP665314.1,
FT                   INSD:BP580994.1,INSD:BP650221.1,INSD:ES175630.1,
FT                   INSD:DR377582.1,INSD:BP655343.1,INSD:ES105448.1,
FT                   INSD:BP623586.1,INSD:ES133837.1,INSD:ES144920.1,
FT                   INSD:EL065424.1,INSD:EH920304.1,INSD:ES137464.1,
FT                   INSD:ES020329.1,INSD:ES182779.1,INSD:ES215879.1,
FT                   INSD:EL065885.1,INSD:EH887322.1,INSD:BP654427.1,
FT                   INSD:ES203647.1,INSD:ES088148.1,INSD:BP575467.1,
FT                   INSD:EH798627.1,INSD:BP579634.1,INSD:ES128418.1,
FT                   INSD:BP644342.1,INSD:BP635904.1,INSD:ES133505.1,
FT                   INSD:BP653939.1,INSD:ES140228.1,INSD:ES122817.1,
FT                   INSD:BP644796.1,INSD:BP634664.1,INSD:ES181661.1,
FT                   INSD:ES104133.1,INSD:ES204655.1,INSD:EL298566.1,
FT                   INSD:EH893714.1,INSD:BP653941.1,INSD:EL326969.1,
FT                   INSD:BP648753.1,INSD:ES030547.1,INSD:EL240545.1,
FT                   INSD:BP641756.1,INSD:BP596190.1,INSD:BP652778.1,
FT                   INSD:EL968449.1,INSD:BP576648.1,INSD:AV795787.1,
FT                   INSD:EH868138.1,INSD:EL035022.1,INSD:BP646654.1,
FT                   INSD:BP574581.1,INSD:BP651781.1,INSD:ES059228.1,
FT                   INSD:BP668181.1,INSD:ES059823.1,INSD:BP653931.1,
FT                   INSD:ES049523.1,INSD:ES140406.1,INSD:ES081529.1,
FT                   INSD:AV795050.1,INSD:ES184893.1,INSD:EL283860.1,
FT                   INSD:CF774158.1,INSD:EL174160.1,INSD:DR345198.1,
FT                   INSD:ES033626.1,INSD:ES170975.1,INSD:BP655272.1,
FT                   INSD:BP639724.1,INSD:ES166802.1,INSD:ES170500.1,
FT                   INSD:BP579417.1,INSD:EL051375.1,INSD:BP628642.1,
FT                   INSD:EL244147.1,INSD:EL186558.1,INSD:AV542617.1,
FT                   INSD:EH993571.1,INSD:ES011850.1,INSD:EL131090.1,
FT                   INSD:BP626638.1,INSD:ES061279.1,INSD:DR371087.1,
FT                   INSD:EL056298.1,INSD:EG453960.1,INSD:BP648680.1,
FT                   INSD:ES100179.1,INSD:EH817750.1,INSD:EL992329.1,
FT                   INSD:ES013118.1,INSD:EL995834.1,INSD:BP656953.1,
FT                   INSD:BP634195.1,INSD:ES058389.1,INSD:EH898488.1,
FT                   INSD:BP637909.1,INSD:ES067767.1,INSD:EL315161.1,
FT                   INSD:EH866772.1,INSD:ES065015.1,INSD:DR376980.1,
FT                   INSD:ES064137.1,INSD:BP658890.1,INSD:AA728491.1,
FT                   INSD:EL992171.1,INSD:EH897642.1,INSD:BP637169.1,
FT                   INSD:BP651992.1,INSD:EH963419.1,INSD:ES123663.1,
FT                   INSD:EL034531.1,INSD:ES064675.1,INSD:ES187419.1,
FT                   INSD:ES153752.1,INSD:EG503579.1,INSD:ES021461.1,
FT                   INSD:ES160212.1,INSD:ES121358.1,INSD:BP623338.1,
FT                   INSD:BP647501.1,INSD:EH896331.1,INSD:CB262253.1,
FT                   INSD:ES104251.1,INSD:BP591577.1,INSD:ES011414.1,
FT                   INSD:ES097944.1,INSD:EL283008.1,INSD:BP638228.1,
FT                   INSD:ES112062.1,INSD:ES198802.1,INSD:BP637308.1,
FT                   INSD:EH859658.1,INSD:EG453959.1,INSD:EH858407.1,
FT                   INSD:BP643592.1,INSD:ES059035.1,INSD:ES185539.1,
FT                   INSD:BP665140.1,INSD:EL324100.1,INSD:EL306810.1,
FT                   INSD:EG503578.1,INSD:EH944977.1,INSD:EL995764.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY091176.1"
FT                   /protein_id="AEE27237.1"
FT                   /translation="MSTVGELACSYAVMILEDEGIAITADKIATLVKAAGVSIESYWPM
FT                   LFAKMAEKRNVTDLIMNVGAGGGGGAPVAAAAPAAGGGAAAAPAAEEKKKDEPAEESDG
FT                   DLGFGLFD"
FT   gene            51953..54737
FT                   /gene="IQD18"
FT                   /gene_synonym="IQ-domain 18"
FT                   /gene_synonym="T25K16.10"
FT                   /gene_synonym="T25K16_10"
FT                   /locus_tag="AT1G01110"
FT   mRNA            join(51953..52346,52434..52730,52938..53183,53484..53624,
FT                   53703..54737)
FT                   /gene="IQD18"
FT                   /gene_synonym="IQ-domain 18"
FT                   /gene_synonym="T25K16.10"
FT                   /gene_synonym="T25K16_10"
FT                   /locus_tag="AT1G01110"
FT                   /product="IQ-domain 18"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES057331.1,INSD:ES045982.1,INSD:DR293820.1,
FT                   INSD:CA781362.1,INSD:ES055317.1,INSD:DR380858.1,
FT                   INSD:DR293822.1,INSD:EH958716.1,INSD:ES204447.1,
FT                   INSD:ES008246.1"
FT   mRNA            join(52061..52730,52938..53183,53484..53624,53703..54689)
FT                   /gene="IQD18"
FT                   /gene_synonym="IQ-domain 18"
FT                   /gene_synonym="T25K16.10"
FT                   /gene_synonym="T25K16_10"
FT                   /locus_tag="AT1G01110"
FT                   /product="IQ-domain 18"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR293821.1,INSD:ES045982.1,INSD:DR293820.1,
FT                   INSD:CA781362.1,INSD:ES055317.1,INSD:DR380858.1,
FT                   INSD:DR293822.1,INSD:EH958716.1,INSD:ES204447.1,
FT                   INSD:ES008246.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY085363.1"
FT   CDS_pept        join(52239..52346,52434..52730,52938..53183,53484..53624,
FT                   53703..54494)
FT                   /codon_start=1
FT                   /gene="IQD18"
FT                   /gene_synonym="IQ-domain 18"
FT                   /gene_synonym="T25K16.10"
FT                   /gene_synonym="T25K16_10"
FT                   /locus_tag="AT1G01110"
FT                   /product="IQ-domain 18"
FT                   /note="IQ-domain 18 (IQD18); FUNCTIONS IN:
FT                   molecular_function unknown; EXPRESSED IN: 10 plant
FT                   structures; EXPRESSED DURING: 6 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: IQ calmodulin-binding region
FT                   (InterPro:IPR000048); BEST Arabidopsis thaliana protein
FT                   match is: IQ-domain 17 (TAIR:AT4G00820.1); Has 30201 Blast
FT                   hits to 17322 proteins in 780 species: Archae - 12;
FT                   Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants -
FT                   5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01110.2"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR025064"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MAM4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES057331.1,INSD:ES045982.1,INSD:DR293820.1,
FT                   INSD:CA781362.1,INSD:ES055317.1,INSD:DR380858.1,
FT                   INSD:DR293822.1,INSD:EH958716.1,INSD:ES204447.1,
FT                   INSD:ES008246.1"
FT                   /protein_id="AEE27239.1"
FT                   /translation="MGKKNGSSSWLTAVKRAFRSPTKKDHSNDVEEDEEKKREKRRWFR
FT                   KPATQESPVKSSGISPPAPQEDSLNVNSKPSPETAPSYATTTPPSNAGKPPSAVVPIAT
FT                   SASKTLAPRRIYYARENYAAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAK
FT                   MTLRCMQALVRVQSRVLDQRKRLSHDGSRKSAFSDSHAVFESRYLQDLSDRQSMSREGS
FT                   SAAEDWDDRPHTIDAVKVMLQRRRDTALRHDKTNLSQAFSQKMWRTVGNQSTEGHHEVE
FT                   LEEERPKWLDRWMATRPWDKRASSRASVDQRVSVKTVEIDTSQPYSRTGAGSPSRGQRP
FT                   SSPSRTSHHYQSRNNFSATPSPAKSRPILIRSASPRCQRDPREDRDRAAYSYTSNTPSL
FT                   RSNYSFTARSGCSISTTMVNNASLLPNYMASTESAKARIRSHSAPRQRPSTPERDRAGL
FT                   VKKRLSYPVPPPAEYEDNNSLRSPSFKSVAGSHFGGMLEQQSNYSSCCTESNGVEISPA
FT                   STSDFRNWLR"
FT   CDS_pept        join(53022..53183,53484..53624,53703..54494)
FT                   /codon_start=1
FT                   /gene="IQD18"
FT                   /gene_synonym="IQ-domain 18"
FT                   /gene_synonym="T25K16.10"
FT                   /gene_synonym="T25K16_10"
FT                   /locus_tag="AT1G01110"
FT                   /product="IQ-domain 18"
FT                   /note="IQ-domain 18 (IQD18); FUNCTIONS IN:
FT                   molecular_function unknown; LOCATED IN: mitochondrion;
FT                   EXPRESSED IN: 10 plant structures; EXPRESSED DURING: 6
FT                   growth stages; BEST Arabidopsis thaliana protein match is:
FT                   IQ-domain 17 (TAIR:AT4G00820.1); Has 1112 Blast hits to 678
FT                   proteins in 50 species: Archae - 0; Bacteria - 10; Metazoa
FT                   - 109; Fungi - 16; Plants - 528; Viruses - 4; Other
FT                   Eukaryotes - 445 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01110"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01110.1"
FT                   /db_xref="InterPro:IPR025064"
FT                   /db_xref="UniProtKB/TrEMBL:B3H705"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR293821.1,INSD:ES045982.1,INSD:DR293820.1,
FT                   INSD:CA781362.1,INSD:ES055317.1,INSD:DR380858.1,
FT                   INSD:DR293822.1,INSD:EH958716.1,INSD:ES204447.1,
FT                   INSD:ES008246.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY085363.1"
FT                   /protein_id="AEE27238.1"
FT                   /translation="MTLRCMQALVRVQSRVLDQRKRLSHDGSRKSAFSDSHAVFESRYL
FT                   QDLSDRQSMSREGSSAAEDWDDRPHTIDAVKVMLQRRRDTALRHDKTNLSQAFSQKMWR
FT                   TVGNQSTEGHHEVELEEERPKWLDRWMATRPWDKRASSRASVDQRVSVKTVEIDTSQPY
FT                   SRTGAGSPSRGQRPSSPSRTSHHYQSRNNFSATPSPAKSRPILIRSASPRCQRDPREDR
FT                   DRAAYSYTSNTPSLRSNYSFTARSGCSISTTMVNNASLLPNYMASTESAKARIRSHSAP
FT                   RQRPSTPERDRAGLVKKRLSYPVPPPAEYEDNNSLRSPSFKSVAGSHFGGMLEQQSNYS
FT                   SCCTESNGVEISPASTSDFRNWLR"
FT   gene            complement(57164..59215)
FT                   /gene="KCS1"
FT                   /gene_synonym="3-ketoacyl-CoA synthase 1"
FT                   /gene_synonym="T25K16.11"
FT                   /gene_synonym="T25K16_11"
FT                   /locus_tag="AT1G01120"
FT                   /note="Encodes a condensing enzyme KCS1 (3-ketoacyl-CoA
FT                   synthase 1) which is involved in the critical fatty acid
FT                   elongation process in wax biosynthesis."
FT   mRNA            complement(57164..59215)
FT                   /gene="KCS1"
FT                   /gene_synonym="3-ketoacyl-CoA synthase 1"
FT                   /gene_synonym="T25K16.11"
FT                   /gene_synonym="T25K16_11"
FT                   /locus_tag="AT1G01120"
FT                   /product="3-ketoacyl-CoA synthase 1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP830277.1,INSD:BX840254.1,INSD:BP832693.1,
FT                   INSD:DR262933.1,INSD:BE522554.1,INSD:BP614297.1,
FT                   INSD:BE522553.1,INSD:ES040041.1,INSD:BP796729.1,
FT                   INSD:ES034156.1,INSD:EH819571.1,INSD:EL093119.1,
FT                   INSD:BP782151.1,INSD:BP777411.1,INSD:EL086421.1,
FT                   INSD:BP601790.1,INSD:EL059556.1,INSD:BP787435.1,
FT                   INSD:EL211028.1,INSD:AV550701.1,INSD:BP612682.1,
FT                   INSD:BP666921.1,INSD:DR356484.1,INSD:EH915374.1,
FT                   INSD:AA394957.1,INSD:BP836351.1,INSD:AV525396.1,
FT                   INSD:AV518820.1,INSD:AV793797.1,INSD:EL066416.1,
FT                   INSD:AV567670.1,INSD:EL045278.1,INSD:Z26005.1,
FT                   INSD:BP604225.1,INSD:T42377.1,INSD:AI999379.1,
FT                   INSD:AV806994.1,INSD:EG528556.1,INSD:EH943560.1,
FT                   INSD:EH819558.1,INSD:BP792870.1,INSD:DR262932.1,
FT                   INSD:EL223512.1,INSD:AV533301.1,INSD:AV538426.1,
FT                   INSD:EG528554.1,INSD:EL284818.1,INSD:ES139508.1,
FT                   INSD:EL012555.1,INSD:EL236670.1,INSD:EL115111.1,
FT                   INSD:EL222104.1,INSD:BP824813.2,INSD:AV800578.1,
FT                   INSD:DR356485.1,INSD:EL041820.1,INSD:BP840959.1,
FT                   INSD:EG528557.1,INSD:EL213812.1,INSD:BP608777.1,
FT                   INSD:AV815250.1,INSD:ES040469.1,INSD:EH929683.1,
FT                   INSD:BP598814.1,INSD:AV809340.1,INSD:N96054.1,
FT                   INSD:BP602678.1,INSD:EL195963.1,INSD:EL216331.1,
FT                   INSD:EL086792.1,INSD:BP601605.1,INSD:EL028053.1,
FT                   INSD:EL304824.1,INSD:BP834386.1,INSD:EL053375.1,
FT                   INSD:T44368.1,INSD:ES127589.1,INSD:EG528558.1,
FT                   INSD:ES051227.1,INSD:BP784987.1,INSD:EH952048.1,
FT                   INSD:EL076983.1,INSD:BP599087.1,INSD:AV829943.1,
FT                   INSD:BP596852.1,INSD:EL303624.1,INSD:BP617133.1,
FT                   INSD:BP572081.1,INSD:BP782647.1,INSD:EL107911.1,
FT                   INSD:EL261999.1,INSD:BP602626.1,INSD:BP606596.1,
FT                   INSD:BP811968.2"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX815372.1,INSD:AY096568.1,INSD:AY074285.1,
FT                   INSD:AK221191.1,INSD:AK226831.1"
FT   CDS_pept        complement(57392..58978)
FT                   /codon_start=1
FT                   /gene="KCS1"
FT                   /gene_synonym="3-ketoacyl-CoA synthase 1"
FT                   /gene_synonym="T25K16.11"
FT                   /gene_synonym="T25K16_11"
FT                   /locus_tag="AT1G01120"
FT                   /product="3-ketoacyl-CoA synthase 1"
FT                   /note="3-ketoacyl-CoA synthase 1 (KCS1); FUNCTIONS IN:
FT                   fatty acid elongase activity, acyltransferase activity;
FT                   INVOLVED IN: in 7 processes; LOCATED IN: cytosolic
FT                   ribosome, endoplasmic reticulum, membrane; EXPRESSED IN: 29
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Thiolase-like
FT                   (InterPro:IPR016039), Very-long-chain 3-ketoacyl-CoA
FT                   synthase (InterPro:IPR012392),
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III
FT                   C-terminal (InterPro:IPR013747), FAE1/Type III polyketide
FT                   synthase-like protein (InterPro:IPR013601), Thiolase-like,
FT                   subgroup (InterPro:IPR016038); BEST Arabidopsis thaliana
FT                   protein match is: 3-ketoacyl-CoA synthase 11
FT                   (TAIR:AT2G26640.1); Has 3961 Blast hits to 3946 proteins in
FT                   966 species: Archae - 0; Bacteria - 1388; Metazoa - 0;
FT                   Fungi - 5; Plants - 2408; Viruses - 0; Other Eukaryotes -
FT                   160 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9MAM3"
FT                   /db_xref="InterPro:IPR012392"
FT                   /db_xref="InterPro:IPR013601"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9MAM3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP830277.1,INSD:BX840254.1,INSD:BP832693.1,
FT                   INSD:DR262933.1,INSD:BE522554.1,INSD:BP614297.1,
FT                   INSD:BE522553.1,INSD:ES040041.1,INSD:BP796729.1,
FT                   INSD:ES034156.1,INSD:EH819571.1,INSD:EL093119.1,
FT                   INSD:BP782151.1,INSD:BP777411.1,INSD:EL086421.1,
FT                   INSD:BP601790.1,INSD:EL059556.1,INSD:BP787435.1,
FT                   INSD:EL211028.1,INSD:AV550701.1,INSD:BP612682.1,
FT                   INSD:BP666921.1,INSD:DR356484.1,INSD:EH915374.1,
FT                   INSD:AA394957.1,INSD:BP836351.1,INSD:AV525396.1,
FT                   INSD:AV518820.1,INSD:AV793797.1,INSD:EL066416.1,
FT                   INSD:AV567670.1,INSD:EL045278.1,INSD:Z26005.1,
FT                   INSD:BP604225.1,INSD:T42377.1,INSD:AI999379.1,
FT                   INSD:AV806994.1,INSD:EG528556.1,INSD:EH943560.1,
FT                   INSD:EH819558.1,INSD:BP792870.1,INSD:DR262932.1,
FT                   INSD:EL223512.1,INSD:AV533301.1,INSD:AV538426.1,
FT                   INSD:EG528554.1,INSD:EL284818.1,INSD:ES139508.1,
FT                   INSD:EL012555.1,INSD:EL236670.1,INSD:EL115111.1,
FT                   INSD:EL222104.1,INSD:BP824813.2,INSD:AV800578.1,
FT                   INSD:DR356485.1,INSD:EL041820.1,INSD:BP840959.1,
FT                   INSD:EG528557.1,INSD:EL213812.1,INSD:BP608777.1,
FT                   INSD:AV815250.1,INSD:ES040469.1,INSD:EH929683.1,
FT                   INSD:BP598814.1,INSD:AV809340.1,INSD:N96054.1,
FT                   INSD:BP602678.1,INSD:EL195963.1,INSD:EL216331.1,
FT                   INSD:EL086792.1,INSD:BP601605.1,INSD:EL028053.1,
FT                   INSD:EL304824.1,INSD:BP834386.1,INSD:EL053375.1,
FT                   INSD:T44368.1,INSD:ES127589.1,INSD:EG528558.1,
FT                   INSD:ES051227.1,INSD:BP784987.1,INSD:EH952048.1,
FT                   INSD:EL076983.1,INSD:BP599087.1,INSD:AV829943.1,
FT                   INSD:BP596852.1,INSD:EL303624.1,INSD:BP617133.1,
FT                   INSD:BP572081.1,INSD:BP782647.1,INSD:EL107911.1,
FT                   INSD:EL261999.1,INSD:BP602626.1,INSD:BP606596.1,
FT                   INSD:BP811968.2"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX815372.1,INSD:AY096568.1,INSD:AY074285.1,
FT                   INSD:AK221191.1,INSD:AK226831.1"
FT                   /protein_id="AEE27241.1"
FT                   /translation="MERTNSIEMDRERLTAEMAFRDSSSAVIRIRRRLPDLLTSVKLKY
FT                   VKLGLHNSCNVTTILFFLIILPLTGTVLVQLTGLTFDTFSELWSNQAVQLDTATRLTCL
FT                   VFLSFVLTLYVANRSKPVYLVDFSCYKPEDERKISVDSFLTMTEENGSFTDDTVQFQQR
FT                   ISNRAGLGDETYLPRGITSTPPKLNMSEARAEAEAVMFGALDSLFEKTGIKPAEVGILI
FT                   VNCSLFNPTPSLSAMIVNHYKMREDIKSYNLGGMGCSAGLISIDLANNLLKANPNSYAV
FT                   VVSTENITLNWYFGNDRSMLLCNCIFRMGGAAILLSNRRQDRKKSKYSLVNVVRTHKGS
FT                   DDKNYNCVYQKEDERGTIGVSLARELMSVAGDALKTNITTLGPMVLPLSEQLMFLISLV
FT                   KRKMFKLKVKPYIPDFKLAFEHFCIHAGGRAVLDEVQKNLDLKDWHMEPSRMTLHRFGN
FT                   TSSSSLWYEMAYTEAKGRVKAGDRLWQIAFGSGFKCNSAVWKALRPVSTEEMTGNAWAG
FT                   SIDQYPVKVVQ"
FT   gene            complement(61905..63811)
FT                   /gene_synonym="F6F3.33"
FT                   /locus_tag="AT1G01130"
FT   mRNA            complement(join(61905..61949,62050..62124,63557..63811))
FT                   /gene_synonym="F6F3.33"
FT                   /locus_tag="AT1G01130"
FT                   /product="CBL-interacting Serine/Threonine-kinase"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG522745.1,INSD:EG484799.1,INSD:EG484793.1,
FT                   INSD:EG484789.1,INSD:EG484795.1,INSD:EG484791.1,
FT                   INSD:EG525242.1,INSD:EG525262.1,INSD:EG525263.1,
FT                   INSD:EG525253.1,INSD:EG525247.1,INSD:EG503287.1,
FT                   INSD:EG484780.1,INSD:EG525249.1,INSD:EG525265.1,
FT                   INSD:EG525255.1,INSD:EG525261.1,INSD:EG525258.1,
FT                   INSD:EG484788.1,INSD:EG525250.1,INSD:EG484786.1,
FT                   INSD:ES125848.1,INSD:EG525260.1,INSD:EG484798.1,
FT                   INSD:EG484792.1,INSD:EG484781.1,INSD:EG484797.1,
FT                   INSD:EG484790.1,INSD:EG525248.1,INSD:EG525243.1,
FT                   INSD:EG525246.1,INSD:EH890172.1,INSD:EG523013.1,
FT                   INSD:EG502798.1,INSD:EG484779.1,INSD:EG484800.1,
FT                   INSD:EG503298.1,INSD:EG525259.1,INSD:EG525264.1,
FT                   INSD:EG525257.1,INSD:EG525251.1,INSD:EG484801.1,
FT                   INSD:EG484778.1,INSD:EG484782.1,INSD:EG525266.1,
FT                   INSD:ES031980.1,INSD:EG502832.1,INSD:EG525244.1,
FT                   INSD:EG525268.1,INSD:EG484787.1,INSD:ES176688.1,
FT                   INSD:EG525254.1,INSD:EG525252.1"
FT   CDS_pept        complement(join(61905..61949,62050..62124,63557..63811))
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.33"
FT                   /locus_tag="AT1G01130"
FT                   /product="CBL-interacting Serine/Threonine-kinase"
FT                   /note="CONTAINS InterPro DOMAIN/s: CBL-interacting protein
FT                   kinase (InterPro:IPR020660), Calcium/calmodulin-dependent
FT                   protein kinase-like (InterPro:IPR020636); BEST Arabidopsis
FT                   thaliana protein match is: unknown protein
FT                   (TAIR:AT5G47170.1); Has 176 Blast hits to 176 proteins in
FT                   20 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 176; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01130"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01130.1"
FT                   /db_xref="GOA:F4HQI8"
FT                   /db_xref="UniProtKB/TrEMBL:F4HQI8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG522745.1,INSD:EG484799.1,INSD:EG484793.1,
FT                   INSD:EG484789.1,INSD:EG484795.1,INSD:EG484791.1,
FT                   INSD:EG525242.1,INSD:EG525262.1,INSD:EG525263.1,
FT                   INSD:EG525253.1,INSD:EG525247.1,INSD:EG503287.1,
FT                   INSD:EG484780.1,INSD:EG525249.1,INSD:EG525265.1,
FT                   INSD:EG525255.1,INSD:EG525261.1,INSD:EG525258.1,
FT                   INSD:EG484788.1,INSD:EG525250.1,INSD:EG484786.1,
FT                   INSD:ES125848.1,INSD:EG525260.1,INSD:EG484798.1,
FT                   INSD:EG484792.1,INSD:EG484781.1,INSD:EG484797.1,
FT                   INSD:EG484790.1,INSD:EG525248.1,INSD:EG525243.1,
FT                   INSD:EG525246.1,INSD:EH890172.1,INSD:EG523013.1,
FT                   INSD:EG502798.1,INSD:EG484779.1,INSD:EG484800.1,
FT                   INSD:EG503298.1,INSD:EG525259.1,INSD:EG525264.1,
FT                   INSD:EG525257.1,INSD:EG525251.1,INSD:EG484801.1,
FT                   INSD:EG484778.1,INSD:EG484782.1,INSD:EG525266.1,
FT                   INSD:ES031980.1,INSD:EG502832.1,INSD:EG525244.1,
FT                   INSD:EG525268.1,INSD:EG484787.1,INSD:ES176688.1,
FT                   INSD:EG525254.1,INSD:EG525252.1"
FT                   /protein_id="AEE27242.1"
FT                   /translation="MEKRSDSESVEILGDWDSPPPEERIVMVSVPTSPESDYARSNQPK
FT                   EIESRVSDKETASASGEVAARRVLPPWMDPSYEWGGGKWKVFEVAPSLHVVELRKTGDD
FT                   TLEFHKFYKNIWIGGCSLEY"
FT   gene            complement(64166..67774)
FT                   /gene="CIPK9"
FT                   /gene_synonym="CBL-interacting protein kinase 9"
FT                   /gene_synonym="F6F3.28"
FT                   /gene_synonym="PKS6"
FT                   /gene_synonym="PROTEIN KINASE 6"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.12"
FT                   /gene_synonym="SnRK3.12"
FT                   /locus_tag="AT1G01140"
FT                   /note="Encodes a CBL-interacting protein kinase with
FT                   similarity to SOS2"
FT   mRNA            complement(join(64166..64475,64582..64656,64751..64807,
FT                   64901..65017,65110..65217,65331..65456,65563..65652,
FT                   65739..65864,66107..66160,66262..66342,66450..66557,
FT                   66678..66749,66835..66897,67324..67774))
FT                   /gene="CIPK9"
FT                   /gene_synonym="CBL-interacting protein kinase 9"
FT                   /gene_synonym="F6F3.28"
FT                   /gene_synonym="PKS6"
FT                   /gene_synonym="PROTEIN KINASE 6"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.12"
FT                   /gene_synonym="SnRK3.12"
FT                   /locus_tag="AT1G01140"
FT                   /product="CBL-interacting protein kinase 9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL035214.1,INSD:ES002693.1,INSD:BP630029.1,
FT                   INSD:ES176091.1,INSD:BP627397.1,INSD:BP852980.1,
FT                   INSD:EL087360.1,INSD:BP629580.1,INSD:EH847924.1,
FT                   INSD:EH798177.1,INSD:DR365409.1,INSD:ES159177.1,
FT                   INSD:EH795451.1,INSD:BP668812.1,INSD:BP613791.1,
FT                   INSD:BP635563.1,INSD:BP600864.1,INSD:ES141143.1,
FT                   INSD:EL182048.1,INSD:AV795034.1,INSD:EL204773.1,
FT                   INSD:EL211129.1,INSD:EL146905.1,INSD:AV816834.1,
FT                   INSD:BP607140.1,INSD:EH915951.1,INSD:EL081224.1,
FT                   INSD:EL209000.1,INSD:ES078198.1,INSD:EH884784.1,
FT                   INSD:BP823331.1,INSD:AV440328.1,INSD:BG459451.1,
FT                   INSD:CB259664.1,INSD:EH825693.1,INSD:AV805656.1,
FT                   INSD:BP623099.1,INSD:AI997157.1,INSD:AV827866.1,
FT                   INSD:DR365408.1,INSD:DR292165.1,INSD:EH826415.1,
FT                   INSD:BP616311.1,INSD:AV807662.1,INSD:EL062528.1,
FT                   INSD:BP784053.1,INSD:AV782299.1,INSD:EH958447.1,
FT                   INSD:BP791602.1,INSD:EL278475.1,INSD:EL002880.1,
FT                   INSD:BP606257.1,INSD:BP632666.1,INSD:DR340108.1,
FT                   INSD:DR340107.1,INSD:EL104590.1,INSD:EH911387.1,
FT                   INSD:AV809366.1,INSD:EH954868.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF386999.1,INSD:AY093242.1,INSD:BX817129.1"
FT   mRNA            complement(join(64167..64475,64570..64656,64751..64807,
FT                   64901..65017,65110..65217,65331..65456,65563..65652,
FT                   65739..65864,66107..66160,66262..66342,66450..66557,
FT                   66678..66749,66835..66897,67324..67625))
FT                   /gene="CIPK9"
FT                   /gene_synonym="CBL-interacting protein kinase 9"
FT                   /gene_synonym="F6F3.28"
FT                   /gene_synonym="PKS6"
FT                   /gene_synonym="PROTEIN KINASE 6"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.12"
FT                   /gene_synonym="SnRK3.12"
FT                   /locus_tag="AT1G01140"
FT                   /product="CBL-interacting protein kinase 9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL035214.1,INSD:AV440328.1,INSD:ES002693.1,
FT                   INSD:BG459451.1,INSD:ES176091.1,INSD:CB259664.1,
FT                   INSD:AV805656.1,INSD:EH825693.1,INSD:BP852980.1,
FT                   INSD:EL087360.1,INSD:AV827866.1,INSD:DR365408.1,
FT                   INSD:EH847924.1,INSD:EH798177.1,INSD:DR292165.1,
FT                   INSD:EH826415.1,INSD:DR365409.1,INSD:ES159177.1,
FT                   INSD:EH795451.1,INSD:EL062528.1,INSD:EL278475.1,
FT                   INSD:ES141143.1,INSD:EL182048.1,INSD:EL002880.1,
FT                   INSD:EL204773.1,INSD:BP632666.1,INSD:EL211129.1,
FT                   INSD:EL146905.1,INSD:EL104590.1,INSD:EH911387.1,
FT                   INSD:EH915951.1,INSD:EL081224.1,INSD:ES078198.1,
FT                   INSD:EH954868.1,INSD:EL209000.1,INSD:EH884784.1,
FT                   INSD:BP823331.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AF339147.1"
FT   mRNA            complement(join(64167..64475,64582..64656,64751..64807,
FT                   64901..65017,65110..65217,65331..65456,65563..65652,
FT                   65733..65864,66107..66160,66262..66342,66450..66557,
FT                   66678..66749,66835..66897,67324..67625))
FT                   /gene="CIPK9"
FT                   /gene_synonym="CBL-interacting protein kinase 9"
FT                   /gene_synonym="F6F3.28"
FT                   /gene_synonym="PKS6"
FT                   /gene_synonym="PROTEIN KINASE 6"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.12"
FT                   /gene_synonym="SnRK3.12"
FT                   /locus_tag="AT1G01140"
FT                   /product="CBL-interacting protein kinase 9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL035214.1,INSD:ES002693.1,INSD:BP630029.1,
FT                   INSD:BP627397.1,INSD:BP852980.1,INSD:EL087360.1,
FT                   INSD:BP629580.1,INSD:EH884272.1,INSD:EH847924.1,
FT                   INSD:EH798177.1,INSD:DR365409.1,INSD:ES159177.1,
FT                   INSD:EH795451.1,INSD:BP668812.1,INSD:BP613791.1,
FT                   INSD:BP635563.1,INSD:BP600864.1,INSD:ES141143.1,
FT                   INSD:EL182048.1,INSD:AV795034.1,INSD:EL204773.1,
FT                   INSD:EL211129.1,INSD:EL146905.1,INSD:AV816834.1,
FT                   INSD:BP607140.1,INSD:EH915951.1,INSD:EL081224.1,
FT                   INSD:EL209000.1,INSD:ES078198.1,INSD:EH884784.1,
FT                   INSD:BP823331.1,INSD:AV440328.1,INSD:CB259664.1,
FT                   INSD:EH825693.1,INSD:AV805656.1,INSD:BP623099.1,
FT                   INSD:AV827866.1,INSD:AI997157.1,INSD:DR365408.1,
FT                   INSD:DR292165.1,INSD:EH826415.1,INSD:BP616311.1,
FT                   INSD:AV807662.1,INSD:EL062528.1,INSD:BP784053.1,
FT                   INSD:AV782299.1,INSD:EH958447.1,INSD:BP791602.1,
FT                   INSD:EL278475.1,INSD:EL002880.1,INSD:BP606257.1,
FT                   INSD:BP632666.1,INSD:DR340108.1,INSD:DR340107.1,
FT                   INSD:EL104590.1,INSD:EH911387.1,INSD:AV809366.1,
FT                   INSD:EH954868.1"
FT   CDS_pept        complement(join(64398..64475,64582..64656,64751..64807,
FT                   64901..65017,65110..65217,65331..65456,65563..65652,
FT                   65739..65864,66107..66160,66262..66342,66450..66557,
FT                   66678..66749,66835..66897,67324..67512))
FT                   /codon_start=1
FT                   /gene="CIPK9"
FT                   /gene_synonym="CBL-interacting protein kinase 9"
FT                   /gene_synonym="F6F3.28"
FT                   /gene_synonym="PKS6"
FT                   /gene_synonym="PROTEIN KINASE 6"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.12"
FT                   /gene_synonym="SnRK3.12"
FT                   /locus_tag="AT1G01140"
FT                   /product="CBL-interacting protein kinase 9"
FT                   /note="CBL-interacting protein kinase 9 (CIPK9); FUNCTIONS
FT                   IN: protein serine/threonine kinase activity, protein
FT                   kinase activity, kinase activity, ATP binding; INVOLVED IN:
FT                   in 6 processes; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), NAF/FISL domain (InterPro:IPR018451),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), CBL-interacting protein
FT                   kinase (InterPro:IPR020660), NAF domain
FT                   (InterPro:IPR004041), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Calcium/calmodulin-dependent protein
FT                   kinase-like (InterPro:IPR020636), Tyrosine-protein kinase,
FT                   catalytic domain (InterPro:IPR020635); BEST Arabidopsis
FT                   thaliana protein match is: CBL-interacting protein kinase
FT                   23 (TAIR:AT1G30270.1); Has 130203 Blast hits to 128118
FT                   proteins in 4349 species: Archae - 165; Bacteria - 15262;
FT                   Metazoa - 47961; Fungi - 13206; Plants - 31482; Viruses -
FT                   522; Other Eukaryotes - 21605 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9MAM1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9MAM1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL035214.1,INSD:ES002693.1,INSD:BP630029.1,
FT                   INSD:ES176091.1,INSD:BP627397.1,INSD:BP852980.1,
FT                   INSD:EL087360.1,INSD:BP629580.1,INSD:EH847924.1,
FT                   INSD:EH798177.1,INSD:DR365409.1,INSD:ES159177.1,
FT                   INSD:EH795451.1,INSD:BP668812.1,INSD:BP613791.1,
FT                   INSD:BP635563.1,INSD:BP600864.1,INSD:ES141143.1,
FT                   INSD:EL182048.1,INSD:AV795034.1,INSD:EL204773.1,
FT                   INSD:EL211129.1,INSD:EL146905.1,INSD:AV816834.1,
FT                   INSD:BP607140.1,INSD:EH915951.1,INSD:EL081224.1,
FT                   INSD:EL209000.1,INSD:ES078198.1,INSD:EH884784.1,
FT                   INSD:BP823331.1,INSD:AV440328.1,INSD:BG459451.1,
FT                   INSD:CB259664.1,INSD:EH825693.1,INSD:AV805656.1,
FT                   INSD:BP623099.1,INSD:AI997157.1,INSD:AV827866.1,
FT                   INSD:DR365408.1,INSD:DR292165.1,INSD:EH826415.1,
FT                   INSD:BP616311.1,INSD:AV807662.1,INSD:EL062528.1,
FT                   INSD:BP784053.1,INSD:AV782299.1,INSD:EH958447.1,
FT                   INSD:BP791602.1,INSD:EL278475.1,INSD:EL002880.1,
FT                   INSD:BP606257.1,INSD:BP632666.1,INSD:DR340108.1,
FT                   INSD:DR340107.1,INSD:EL104590.1,INSD:EH911387.1,
FT                   INSD:AV809366.1,INSD:EH954868.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF386999.1,INSD:AY093242.1,INSD:BX817129.1"
FT                   /protein_id="AEE27244.1"
FT                   /translation="MSGSRRKATPASRTRVGNYEMGRTLGEGSFAKVKYAKNTVTGDQA
FT                   AIKILDREKVFRHKMVEQLKREISTMKLIKHPNVVEIIEVMASKTKIYIVLELVNGGEL
FT                   FDKIAQQGRLKEDEARRYFQQLINAVDYCHSRGVYHRDLKPENLILDANGVLKVSDFGL
FT                   SAFSRQVREDGLLHTACGTPNYVAPEVLSDKGYDGAAADVWSCGVILFVLMAGYLPFDE
FT                   PNLMTLYKRICKAEFSCPPWFSQGAKRVIKRILEPNPITRISIAELLEDEWFKKGYKPP
FT                   SFDQDDEDITIDDVDAAFSNSKECLVTEKKEKPVSMNAFELISSSSEFSLENLFEKQAQ
FT                   LVKKETRFTSQRSASEIMSKMEETAKPLGFNVRKDNYKIKMKGDKSGRKGQLSVATEVF
FT                   EVAPSLHVVELRKTGGDTLEFHKFYKNFSSGLKDVVWNTDAAAEEQKQ"
FT   CDS_pept        complement(join(64398..64475,64570..64656,64751..64807,
FT                   64901..65017,65110..65217,65331..65456,65563..65652,
FT                   65739..65864,66107..66160,66262..66342,66450..66557,
FT                   66678..66749,66835..66897,67324..67512))
FT                   /codon_start=1
FT                   /gene="CIPK9"
FT                   /gene_synonym="CBL-interacting protein kinase 9"
FT                   /gene_synonym="F6F3.28"
FT                   /gene_synonym="PKS6"
FT                   /gene_synonym="PROTEIN KINASE 6"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.12"
FT                   /gene_synonym="SnRK3.12"
FT                   /locus_tag="AT1G01140"
FT                   /product="CBL-interacting protein kinase 9"
FT                   /note="CBL-interacting protein kinase 9 (CIPK9); FUNCTIONS
FT                   IN: protein serine/threonine kinase activity, protein
FT                   kinase activity, kinase activity, ATP binding; INVOLVED IN:
FT                   in 6 processes; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), NAF/FISL domain
FT                   (InterPro:IPR018451), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), NAF domain
FT                   (InterPro:IPR004041), CBL-interacting protein kinase
FT                   (InterPro:IPR020660), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Calcium/calmodulin-dependent protein
FT                   kinase-like (InterPro:IPR020636); BEST Arabidopsis thaliana
FT                   protein match is: CBL-interacting protein kinase 23
FT                   (TAIR:AT1G30270.1); Has 130572 Blast hits to 128490
FT                   proteins in 4426 species: Archae - 165; Bacteria - 15544;
FT                   Metazoa - 48044; Fungi - 13206; Plants - 31490; Viruses -
FT                   522; Other Eukaryotes - 21601 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01140"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01140.1"
FT                   /db_xref="GOA:Q9MAM1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9MAM1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL035214.1,INSD:AV440328.1,INSD:ES002693.1,
FT                   INSD:BG459451.1,INSD:ES176091.1,INSD:CB259664.1,
FT                   INSD:AV805656.1,INSD:EH825693.1,INSD:BP852980.1,
FT                   INSD:EL087360.1,INSD:AV827866.1,INSD:DR365408.1,
FT                   INSD:EH847924.1,INSD:EH798177.1,INSD:DR292165.1,
FT                   INSD:EH826415.1,INSD:DR365409.1,INSD:ES159177.1,
FT                   INSD:EH795451.1,INSD:EL062528.1,INSD:EL278475.1,
FT                   INSD:ES141143.1,INSD:EL182048.1,INSD:EL002880.1,
FT                   INSD:EL204773.1,INSD:BP632666.1,INSD:EL211129.1,
FT                   INSD:EL146905.1,INSD:EL104590.1,INSD:EH911387.1,
FT                   INSD:EH915951.1,INSD:EL081224.1,INSD:ES078198.1,
FT                   INSD:EH954868.1,INSD:EL209000.1,INSD:EH884784.1,
FT                   INSD:BP823331.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AF339147.1"
FT                   /protein_id="AEE27245.1"
FT                   /translation="MSGSRRKATPASRTRVGNYEMGRTLGEGSFAKVKYAKNTVTGDQA
FT                   AIKILDREKVFRHKMVEQLKREISTMKLIKHPNVVEIIEVMASKTKIYIVLELVNGGEL
FT                   FDKIAQQGRLKEDEARRYFQQLINAVDYCHSRGVYHRDLKPENLILDANGVLKVSDFGL
FT                   SAFSRQVREDGLLHTACGTPNYVAPEVLSDKGYDGAAADVWSCGVILFVLMAGYLPFDE
FT                   PNLMTLYKRICKAEFSCPPWFSQGAKRVIKRILEPNPITRISIAELLEDEWFKKGYKPP
FT                   SFDQDDEDITIDDVDAAFSNSKECLVTEKKEKPVSMNAFELISSSSEFSLENLFEKQAQ
FT                   LVKKETRFTSQRSASEIMSKMEETAKPLGFNVRKDNYKIKMKGDKSGRKGQLSVATEVF
FT                   EVAPSLHVVELRKTGGDTLEFHKVCDSFYKNFSSGLKDVVWNTDAAAEEQKQ"
FT   CDS_pept        complement(join(64398..64475,64582..64656,64751..64807,
FT                   64901..65017,65110..65217,65331..65456,65563..65652,
FT                   65733..65864,66107..66160,66262..66342,66450..66557,
FT                   66678..66749,66835..66897,67324..67512))
FT                   /codon_start=1
FT                   /gene="CIPK9"
FT                   /gene_synonym="CBL-interacting protein kinase 9"
FT                   /gene_synonym="F6F3.28"
FT                   /gene_synonym="PKS6"
FT                   /gene_synonym="PROTEIN KINASE 6"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.12"
FT                   /gene_synonym="SnRK3.12"
FT                   /locus_tag="AT1G01140"
FT                   /product="CBL-interacting protein kinase 9"
FT                   /note="CBL-interacting protein kinase 9 (CIPK9); FUNCTIONS
FT                   IN: protein serine/threonine kinase activity, protein
FT                   kinase activity, kinase activity, ATP binding; INVOLVED IN:
FT                   in 6 processes; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), NAF/FISL domain
FT                   (InterPro:IPR018451), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), NAF domain
FT                   (InterPro:IPR004041), CBL-interacting protein kinase
FT                   (InterPro:IPR020660), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Calcium/calmodulin-dependent protein
FT                   kinase-like (InterPro:IPR020636); BEST Arabidopsis thaliana
FT                   protein match is: CBL-interacting protein kinase 23
FT                   (TAIR:AT1G30270.1); Has 130491 Blast hits to 128500
FT                   proteins in 4421 species: Archae - 165; Bacteria - 15543;
FT                   Metazoa - 48035; Fungi - 13165; Plants - 31462; Viruses -
FT                   522; Other Eukaryotes - 21599 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01140"
FT                   /db_xref="GOA:Q9MAM1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9MAM1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL035214.1,INSD:ES002693.1,INSD:BP630029.1,
FT                   INSD:BP627397.1,INSD:BP852980.1,INSD:EL087360.1,
FT                   INSD:BP629580.1,INSD:EH884272.1,INSD:EH847924.1,
FT                   INSD:EH798177.1,INSD:DR365409.1,INSD:ES159177.1,
FT                   INSD:EH795451.1,INSD:BP668812.1,INSD:BP613791.1,
FT                   INSD:BP635563.1,INSD:BP600864.1,INSD:ES141143.1,
FT                   INSD:EL182048.1,INSD:AV795034.1,INSD:EL204773.1,
FT                   INSD:EL211129.1,INSD:EL146905.1,INSD:AV816834.1,
FT                   INSD:BP607140.1,INSD:EH915951.1,INSD:EL081224.1,
FT                   INSD:EL209000.1,INSD:ES078198.1,INSD:EH884784.1,
FT                   INSD:BP823331.1,INSD:AV440328.1,INSD:CB259664.1,
FT                   INSD:EH825693.1,INSD:AV805656.1,INSD:BP623099.1,
FT                   INSD:AV827866.1,INSD:AI997157.1,INSD:DR365408.1,
FT                   INSD:DR292165.1,INSD:EH826415.1,INSD:BP616311.1,
FT                   INSD:AV807662.1,INSD:EL062528.1,INSD:BP784053.1,
FT                   INSD:AV782299.1,INSD:EH958447.1,INSD:BP791602.1,
FT                   INSD:EL278475.1,INSD:EL002880.1,INSD:BP606257.1,
FT                   INSD:BP632666.1,INSD:DR340108.1,INSD:DR340107.1,
FT                   INSD:EL104590.1,INSD:EH911387.1,INSD:AV809366.1,
FT                   INSD:EH954868.1"
FT                   /protein_id="AEE27243.1"
FT                   /translation="MSGSRRKATPASRTRVGNYEMGRTLGEGSFAKVKYAKNTVTGDQA
FT                   AIKILDREKVFRHKMVEQLKREISTMKLIKHPNVVEIIEVMASKTKIYIVLELVNGGEL
FT                   FDKIAQQGRLKEDEARRYFQQLINAVDYCHSRGVYHRDLKPENLILDANGVLKVSDFGL
FT                   SAFSRQVREDGLLHTACGTPNYVAPEVLSDKGYDGAAADVWSCGVILFVLMAGYLPFDE
FT                   PNLMTLYKRVRICKAEFSCPPWFSQGAKRVIKRILEPNPITRISIAELLEDEWFKKGYK
FT                   PPSFDQDDEDITIDDVDAAFSNSKECLVTEKKEKPVSMNAFELISSSSEFSLENLFEKQ
FT                   AQLVKKETRFTSQRSASEIMSKMEETAKPLGFNVRKDNYKIKMKGDKSGRKGQLSVATE
FT                   VFEVAPSLHVVELRKTGGDTLEFHKFYKNFSSGLKDVVWNTDAAAEEQKQ"
FT   gene            complement(69911..72138)
FT                   /gene_synonym="F6F3.30"
FT                   /locus_tag="AT1G01150"
FT   mRNA            complement(join(69911..70285,70840..70968,71041..71721,
FT                   71942..72138))
FT                   /gene_synonym="F6F3.30"
FT                   /locus_tag="AT1G01150"
FT                   /product="Homeodomain-like protein with RING/FYVE/PHD-type
FT                   zinc finger domain-containing protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG491379.1,INSD:EG491383.1,INSD:EG491386.1,
FT                   INSD:EG491391.1,INSD:EG491392.1,INSD:EG491384.1,
FT                   INSD:EG491381.1,INSD:EG491378.1,INSD:EG491376.1,
FT                   INSD:EG491389.1,INSD:EG491395.1,INSD:EG491371.1,
FT                   INSD:EG491377.1,INSD:EG491390.1,INSD:EG491375.1,
FT                   INSD:EG491372.1,INSD:EG491388.1,INSD:EG491382.1,
FT                   INSD:EG491380.1,INSD:EG491394.1,INSD:EG491387.1,
FT                   INSD:EG491393.1"
FT   mRNA            complement(join(70035..70233,70896..70968,71041..71721,
FT                   71942..72138))
FT                   /gene_synonym="F6F3.30"
FT                   /locus_tag="AT1G01150"
FT                   /product="Homeodomain-like protein with RING/FYVE/PHD-type
FT                   zinc finger domain-containing protein"
FT   CDS_pept        complement(join(70115..70233,70896..70968,71041..71721,
FT                   71942..71998))
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.30"
FT                   /locus_tag="AT1G01150"
FT                   /product="Homeodomain-like protein with RING/FYVE/PHD-type
FT                   zinc finger domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01150"
FT                   /db_xref="GOA:A0A1P8AUM7"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AUM7"
FT                   /protein_id="ANM60371.1"
FT                   /translation="MVSDLPLDEDDIALLKSPYIGEIVEEIGFVREKRIAHCIVQCDDG
FT                   GDEDVNSAPNIFTYDNVPLKKRHYLGTSDTFRSFEPLNEHACIVCDIADDGVVPCSGNE
FT                   CPLAVHRKCVELDCEDPATFYCPYCWFKEQATRSTALRTRGVAAAKTLVQYGCSELRSG
FT                   DIVMTRENSQLENGSDNSLPMQLHENLHQLQELVKHLKARNSQLDESTDQFIDMEKSCG
FT                   EAYAVVNDQPKRVLWTVNEEKMLREGVEKFSDTINKNMPWKKILEMGKEIGDQNGEGKK
FT                   RRSDEEDESNRNHPKIRICGMVFVKPIT"
FT   CDS_pept        complement(join(70115..70285,70840..70968,71041..71721,
FT                   71942..71998))
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.30"
FT                   /locus_tag="AT1G01150"
FT                   /product="Homeodomain-like protein with RING/FYVE/PHD-type
FT                   zinc finger domain-containing protein"
FT                   /note="Homeodomain-like protein with RING/FYVE/PHD-type
FT                   zinc finger domain; FUNCTIONS IN: DNA binding, zinc ion
FT                   binding; INVOLVED IN: regulation of transcription;
FT                   EXPRESSED IN: 8 plant structures; EXPRESSED DURING: 4
FT                   anthesis, petal differentiation and expansion stage, E
FT                   expanded cotyledon stage, D bilateral stage; CONTAINS
FT                   InterPro DOMAIN/s: Homeodomain-like (InterPro:IPR009057),
FT                   Zinc finger, PHD-type, conserved site (InterPro:IPR019786),
FT                   Zinc finger, FYVE/PHD-type (InterPro:IPR011011),
FT                   Homeodomain-related (InterPro:IPR012287), MYB-like
FT                   (InterPro:IPR017877); BEST Arabidopsis thaliana protein
FT                   match is: TRF-like 10 (TAIR:AT5G03780.1); Has 94 Blast hits
FT                   to 77 proteins in 18 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 5; Fungi - 0; Plants - 86; Viruses - 0; Other
FT                   Eukaryotes - 3 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01150"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01150.1"
FT                   /db_xref="GOA:F4HQJ2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="UniProtKB/TrEMBL:F4HQJ2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG491379.1,INSD:EG491383.1,INSD:EG491386.1,
FT                   INSD:EG491391.1,INSD:EG491392.1,INSD:EG491384.1,
FT                   INSD:EG491381.1,INSD:EG491378.1,INSD:EG491376.1,
FT                   INSD:EG491389.1,INSD:EG491395.1,INSD:EG491371.1,
FT                   INSD:EG491377.1,INSD:EG491390.1,INSD:EG491375.1,
FT                   INSD:EG491372.1,INSD:EG491388.1,INSD:EG491382.1,
FT                   INSD:EG491380.1,INSD:EG491394.1,INSD:EG491387.1,
FT                   INSD:EG491393.1"
FT                   /protein_id="AEE27246.1"
FT                   /translation="MVSDLPLDEDDIALLKSPYIGEIVEEIGFVREKRIAHCIVQCDDG
FT                   GDEDVNSAPNIFTYDNVPLKKRHYLGTSDTFRSFEPLNEHACIVCDIADDGVVPCSGNE
FT                   CPLAVHRKCVELDCEDPATFYCPYCWFKEQATRSTALRTRGVAAAKTLVQYGCSELRSG
FT                   DIVMTRENSQLENGSDNSLPMQLHENLHQLQELVKHLKARNSQLDESTDQFIDMEKSCG
FT                   EAYAVVNDQPKRVLWTVNEEKMLREGVEKFSDTINKNMPWKKILEMGKGIFHTTRNSSD
FT                   LKDKWRNMNYLDLVEVEIDIIIVVAEIGDQNGEGKKRRSDEEDESNRNHPKIRICGMVF
FT                   VKPIT"
FT   mRNA            complement(join(70619..70968,71041..71721,71942..72138))
FT                   /gene_synonym="F6F3.30"
FT                   /locus_tag="AT1G01150"
FT                   /product="Homeodomain-like protein with RING/FYVE/PHD-type
FT                   zinc finger domain-containing protein"
FT   CDS_pept        complement(join(70828..70968,71041..71721,71942..71998))
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.30"
FT                   /locus_tag="AT1G01150"
FT                   /product="Homeodomain-like protein with RING/FYVE/PHD-type
FT                   zinc finger domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01150"
FT                   /db_xref="GOA:A0A1P8AUQ9"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AUQ9"
FT                   /protein_id="ANM60370.1"
FT                   /translation="MVSDLPLDEDDIALLKSPYIGEIVEEIGFVREKRIAHCIVQCDDG
FT                   GDEDVNSAPNIFTYDNVPLKKRHYLGTSDTFRSFEPLNEHACIVCDIADDGVVPCSGNE
FT                   CPLAVHRKCVELDCEDPATFYCPYCWFKEQATRSTALRTRGVAAAKTLVQYGCSELRSG
FT                   DIVMTRENSQLENGSDNSLPMQLHENLHQLQELVKHLKARNSQLDESTDQFIDMEKSCG
FT                   EAYAVVNDQPKRVLWTVNEEKMLREGVEKFSDTINKNMPWKKILEMGKGIFHTTRNSSD
FT                   LKDKWRNMVRM"
FT   gene            72339..74096
FT                   /gene="GIF2"
FT                   /gene_synonym="F6F3.29"
FT                   /gene_synonym="GRF1-interacting factor 2"
FT                   /locus_tag="AT1G01160"
FT                   /note="Arabidopsis thaliana GRF1-interacting factor 2
FT                   (GIF2) mRNA"
FT   mRNA            join(72339..72669,73087..73163,73287..73395,73488..73740,
FT                   73822..74096)
FT                   /gene="GIF2"
FT                   /gene_synonym="F6F3.29"
FT                   /gene_synonym="GRF1-interacting factor 2"
FT                   /locus_tag="AT1G01160"
FT                   /product="GRF1-interacting factor 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES196854.1,INSD:EH847280.1,INSD:EL051475.1,
FT                   INSD:BE530018.1,INSD:EH921359.1,INSD:H36066.1,
FT                   INSD:EL129047.1,INSD:BP584927.1,INSD:AU230317.1,
FT                   INSD:BP576014.1,INSD:EL263591.1,INSD:ES170211.1,
FT                   INSD:EL050425.1,INSD:EL991999.1,INSD:EL018630.1,
FT                   INSD:EL152428.1,INSD:EH889551.1,INSD:ES182075.1,
FT                   INSD:AI995719.1,INSD:ES039190.1,INSD:DR244441.1,
FT                   INSD:EL137885.1,INSD:DR378599.1,INSD:BP630850.1,
FT                   INSD:BP598859.1,INSD:BP862978.1,INSD:BP844949.1,
FT                   INSD:DR244443.1,INSD:ES191815.1,INSD:ES167179.1,
FT                   INSD:AU239051.1,INSD:EL238019.1,INSD:AV550033.1,
FT                   INSD:DR244442.1,INSD:BP847595.1,INSD:BP638938.1,
FT                   INSD:ES106922.1,INSD:ES200607.1,INSD:CF773210.1,
FT                   INSD:AV785233.1,INSD:BE038614.1,INSD:EH819492.1,
FT                   INSD:EH847530.1,INSD:EL973885.1,INSD:ES005198.1,
FT                   INSD:BE039533.1,INSD:BP844491.1,INSD:ES207516.1,
FT                   INSD:ES211121.1,INSD:EL992476.1,INSD:DR355195.1,
FT                   INSD:AV537923.1,INSD:BP666965.1,INSD:BP866794.1,
FT                   INSD:ES120038.1,INSD:EL281685.1,INSD:EH845075.1,
FT                   INSD:EL332238.1,INSD:ES046567.1,INSD:EL072897.1,
FT                   INSD:EL338473.1,INSD:EH954430.1,INSD:EL109725.1,
FT                   INSD:AV782048.1,INSD:EL220815.1,INSD:AV800424.1,
FT                   INSD:ES045681.1,INSD:ES139369.1,INSD:ES042427.1,
FT                   INSD:BP627610.1,INSD:BP858221.1,INSD:AV545121.1,
FT                   INSD:BP604933.1,INSD:F14391.1,INSD:BP666867.1,
FT                   INSD:ES153069.1,INSD:BP861750.1"
FT   mRNA            join(72357..72669,72915..73016,73087..73163,73287..73395,
FT                   73488..73740,73822..74096)
FT                   /gene="GIF2"
FT                   /gene_synonym="F6F3.29"
FT                   /gene_synonym="GRF1-interacting factor 2"
FT                   /locus_tag="AT1G01160"
FT                   /product="GRF1-interacting factor 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES196854.1,INSD:EH847280.1,INSD:EL051475.1,
FT                   INSD:BE530018.1,INSD:EH921359.1,INSD:H36066.1,
FT                   INSD:BP584927.1,INSD:EL129047.1,INSD:DR283667.1,
FT                   INSD:AU230317.1,INSD:BP576014.1,INSD:EL263591.1,
FT                   INSD:BP834088.1,INSD:ES170211.1,INSD:DR283664.1,
FT                   INSD:EL050425.1,INSD:EL018630.1,INSD:EL991999.1,
FT                   INSD:EL152428.1,INSD:EH889551.1,INSD:DR283670.1,
FT                   INSD:ES182075.1,INSD:AI995719.1,INSD:ES039190.1,
FT                   INSD:DR244441.1,INSD:F14390.1,INSD:EL137885.1,
FT                   INSD:BP812429.1,INSD:DR378599.1,INSD:BP630850.1,
FT                   INSD:BP598859.1,INSD:BP862978.1,INSD:BP844949.1,
FT                   INSD:DR244443.1,INSD:ES191815.1,INSD:DR283665.1,
FT                   INSD:AU239051.1,INSD:ES167179.1,INSD:EL238019.1,
FT                   INSD:AV550033.1,INSD:DR283668.1,INSD:DR244442.1,
FT                   INSD:BP847595.1,INSD:BP638938.1,INSD:ES106922.1,
FT                   INSD:CF773210.1,INSD:ES200607.1,INSD:AV785233.1,
FT                   INSD:BE038614.1,INSD:EH819492.1,INSD:AV824087.1,
FT                   INSD:EH847530.1,INSD:EL973885.1,INSD:BP823811.1,
FT                   INSD:ES005198.1,INSD:BE039533.1,INSD:BP844491.1,
FT                   INSD:ES207516.1,INSD:ES211121.1,INSD:EL992476.1,
FT                   INSD:DR355195.1,INSD:AV537923.1,INSD:DR283671.1,
FT                   INSD:BP666965.1,INSD:DR283666.1,INSD:BP866794.1,
FT                   INSD:ES120038.1,INSD:EL281685.1,INSD:EH845075.1,
FT                   INSD:EL332238.1,INSD:ES046567.1,INSD:EL072897.1,
FT                   INSD:EL338473.1,INSD:EL109725.1,INSD:EH954430.1,
FT                   INSD:AV782048.1,INSD:EL220815.1,INSD:AV800424.1,
FT                   INSD:ES045681.1,INSD:ES139369.1,INSD:ES042427.1,
FT                   INSD:DR283669.1,INSD:BP627610.1,INSD:BP858221.1,
FT                   INSD:BP836651.1,INSD:AV545121.1,INSD:BP604933.1,
FT                   INSD:F14391.1,INSD:BP666867.1,INSD:ES153069.1,
FT                   INSD:BP861750.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY102640.1,INSD:BX841803.1,INSD:AF410307.1,
FT                   INSD:AY102133.1"
FT   CDS_pept        join(72583..72669,72915..73016,73087..73163,73287..73395,
FT                   73488..73740,73822..73883)
FT                   /codon_start=1
FT                   /gene="GIF2"
FT                   /gene_synonym="F6F3.29"
FT                   /gene_synonym="GRF1-interacting factor 2"
FT                   /locus_tag="AT1G01160"
FT                   /product="GRF1-interacting factor 2"
FT                   /note="GRF1-interacting factor 2 (GIF2); FUNCTIONS IN:
FT                   protein binding, transcription coactivator activity;
FT                   INVOLVED IN: cell proliferation, leaf development; LOCATED
FT                   IN: nucleus; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: SSXT
FT                   (InterPro:IPR007726); BEST Arabidopsis thaliana protein
FT                   match is: GRF1-interacting factor 3 (TAIR:AT4G00850.1); Has
FT                   35 Blast hits to 35 proteins in 17 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 12; Fungi - 5; Plants - 17; Viruses
FT                   - 0; Other Eukaryotes - 1 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01160"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01160.2"
FT                   /db_xref="GOA:F4HQJ3"
FT                   /db_xref="InterPro:IPR007726"
FT                   /db_xref="UniProtKB/TrEMBL:F4HQJ3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES196854.1,INSD:EH847280.1,INSD:EL051475.1,
FT                   INSD:BE530018.1,INSD:EH921359.1,INSD:H36066.1,
FT                   INSD:EL129047.1,INSD:BP584927.1,INSD:AU230317.1,
FT                   INSD:BP576014.1,INSD:EL263591.1,INSD:ES170211.1,
FT                   INSD:EL050425.1,INSD:EL991999.1,INSD:EL018630.1,
FT                   INSD:EL152428.1,INSD:EH889551.1,INSD:ES182075.1,
FT                   INSD:AI995719.1,INSD:ES039190.1,INSD:DR244441.1,
FT                   INSD:EL137885.1,INSD:DR378599.1,INSD:BP630850.1,
FT                   INSD:BP598859.1,INSD:BP862978.1,INSD:BP844949.1,
FT                   INSD:DR244443.1,INSD:ES191815.1,INSD:ES167179.1,
FT                   INSD:AU239051.1,INSD:EL238019.1,INSD:AV550033.1,
FT                   INSD:DR244442.1,INSD:BP847595.1,INSD:BP638938.1,
FT                   INSD:ES106922.1,INSD:ES200607.1,INSD:CF773210.1,
FT                   INSD:AV785233.1,INSD:BE038614.1,INSD:EH819492.1,
FT                   INSD:EH847530.1,INSD:EL973885.1,INSD:ES005198.1,
FT                   INSD:BE039533.1,INSD:BP844491.1,INSD:ES207516.1,
FT                   INSD:ES211121.1,INSD:EL992476.1,INSD:DR355195.1,
FT                   INSD:AV537923.1,INSD:BP666965.1,INSD:BP866794.1,
FT                   INSD:ES120038.1,INSD:EL281685.1,INSD:EH845075.1,
FT                   INSD:EL332238.1,INSD:ES046567.1,INSD:EL072897.1,
FT                   INSD:EL338473.1,INSD:EH954430.1,INSD:EL109725.1,
FT                   INSD:AV782048.1,INSD:EL220815.1,INSD:AV800424.1,
FT                   INSD:ES045681.1,INSD:ES139369.1,INSD:ES042427.1,
FT                   INSD:BP627610.1,INSD:BP858221.1,INSD:AV545121.1,
FT                   INSD:BP604933.1,INSD:F14391.1,INSD:BP666867.1,
FT                   INSD:ES153069.1,INSD:BP861750.1"
FT                   /protein_id="AEE27248.1"
FT                   /translation="MQQQQSPQMFPMVPSIPPANNITTEQIQKMLGGSGNFESGFQEWT
FT                   LKLDACLMLLFCTFSWLDYLDENKKLIMAIMENQNLGKLAECAQYQALLQKNLMYLAAI
FT                   ADAQPPPPTPGPSPSTAVAAQMATPHSGMQPPSYFMQHPQASPAGIFAPRGPLQFGSPL
FT                   QFQDPQQQQQIHQQAMQGHMGIRPMGMTNNGMQHAMQQPETGLGGNVGLRGGKQDGADG
FT                   QGKDDGK"
FT   CDS_pept        join(72583..72669,73087..73163,73287..73395,73488..73740,
FT                   73822..73883)
FT                   /codon_start=1
FT                   /gene="GIF2"
FT                   /gene_synonym="F6F3.29"
FT                   /gene_synonym="GRF1-interacting factor 2"
FT                   /locus_tag="AT1G01160"
FT                   /product="GRF1-interacting factor 2"
FT                   /note="GRF1-interacting factor 2 (GIF2); CONTAINS InterPro
FT                   DOMAIN/s: SSXT (InterPro:IPR007726); BEST Arabidopsis
FT                   thaliana protein match is: GRF1-interacting factor 3
FT                   (TAIR:AT4G00850.1); Has 425 Blast hits to 425 proteins in
FT                   91 species: Archae - 0; Bacteria - 4; Metazoa - 291; Fungi
FT                   - 20; Plants - 89; Viruses - 0; Other Eukaryotes - 21
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01160.1"
FT                   /db_xref="GOA:Q9MAL9"
FT                   /db_xref="InterPro:IPR007726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9MAL9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES196854.1,INSD:EH847280.1,INSD:EL051475.1,
FT                   INSD:BE530018.1,INSD:EH921359.1,INSD:H36066.1,
FT                   INSD:BP584927.1,INSD:EL129047.1,INSD:DR283667.1,
FT                   INSD:AU230317.1,INSD:BP576014.1,INSD:EL263591.1,
FT                   INSD:BP834088.1,INSD:ES170211.1,INSD:DR283664.1,
FT                   INSD:EL050425.1,INSD:EL018630.1,INSD:EL991999.1,
FT                   INSD:EL152428.1,INSD:EH889551.1,INSD:DR283670.1,
FT                   INSD:ES182075.1,INSD:AI995719.1,INSD:ES039190.1,
FT                   INSD:DR244441.1,INSD:F14390.1,INSD:EL137885.1,
FT                   INSD:BP812429.1,INSD:DR378599.1,INSD:BP630850.1,
FT                   INSD:BP598859.1,INSD:BP862978.1,INSD:BP844949.1,
FT                   INSD:DR244443.1,INSD:ES191815.1,INSD:DR283665.1,
FT                   INSD:AU239051.1,INSD:ES167179.1,INSD:EL238019.1,
FT                   INSD:AV550033.1,INSD:DR283668.1,INSD:DR244442.1,
FT                   INSD:BP847595.1,INSD:BP638938.1,INSD:ES106922.1,
FT                   INSD:CF773210.1,INSD:ES200607.1,INSD:AV785233.1,
FT                   INSD:BE038614.1,INSD:EH819492.1,INSD:AV824087.1,
FT                   INSD:EH847530.1,INSD:EL973885.1,INSD:BP823811.1,
FT                   INSD:ES005198.1,INSD:BE039533.1,INSD:BP844491.1,
FT                   INSD:ES207516.1,INSD:ES211121.1,INSD:EL992476.1,
FT                   INSD:DR355195.1,INSD:AV537923.1,INSD:DR283671.1,
FT                   INSD:BP666965.1,INSD:DR283666.1,INSD:BP866794.1,
FT                   INSD:ES120038.1,INSD:EL281685.1,INSD:EH845075.1,
FT                   INSD:EL332238.1,INSD:ES046567.1,INSD:EL072897.1,
FT                   INSD:EL338473.1,INSD:EL109725.1,INSD:EH954430.1,
FT                   INSD:AV782048.1,INSD:EL220815.1,INSD:AV800424.1,
FT                   INSD:ES045681.1,INSD:ES139369.1,INSD:ES042427.1,
FT                   INSD:DR283669.1,INSD:BP627610.1,INSD:BP858221.1,
FT                   INSD:BP836651.1,INSD:AV545121.1,INSD:BP604933.1,
FT                   INSD:F14391.1,INSD:BP666867.1,INSD:ES153069.1,
FT                   INSD:BP861750.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY102640.1,INSD:BX841803.1,INSD:AF410307.1,
FT                   INSD:AY102133.1"
FT                   /protein_id="AEE27247.1"
FT                   /translation="MQQQQSPQMFPMVPSIPPANNITTEQIQKYLDENKKLIMAIMENQ
FT                   NLGKLAECAQYQALLQKNLMYLAAIADAQPPPPTPGPSPSTAVAAQMATPHSGMQPPSY
FT                   FMQHPQASPAGIFAPRGPLQFGSPLQFQDPQQQQQIHQQAMQGHMGIRPMGMTNNGMQH
FT                   AMQQPETGLGGNVGLRGGKQDGADGQGKDDGK"
FT   gene            complement(72646..73108)
FT                   /locus_tag="AT1G04007"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT1G01160"
FT   ncRNA           complement(72646..73108)
FT                   /locus_tag="AT1G04007"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(73931..74737)
FT                   /gene_synonym="F6F3.32"
FT                   /locus_tag="AT1G01170"
FT   mRNA            complement(join(73931..74250,74338..74455,74661..74737))
FT                   /gene_synonym="F6F3.32"
FT                   /locus_tag="AT1G01170"
FT                   /product="ozone-responsive stress-like protein (DUF1138)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL331975.1,INSD:EL028471.1,INSD:EH967555.1,
FT                   INSD:EL051475.1,INSD:EH921359.1,INSD:EL129047.1,
FT                   INSD:BP584927.1,INSD:AU230317.1,INSD:BP576014.1,
FT                   INSD:EL263591.1,INSD:ES170211.1,INSD:EL229911.1,
FT                   INSD:EL050425.1,INSD:AI995719.1,INSD:DR244441.1,
FT                   INSD:EL122980.1,INSD:DR378599.1,INSD:BP598859.1,
FT                   INSD:BP862978.1,INSD:BP844949.1,INSD:DR244443.1,
FT                   INSD:ES191815.1,INSD:AU239051.1,INSD:EL238019.1,
FT                   INSD:DR244442.1,INSD:BP847595.1,INSD:EH864292.1,
FT                   INSD:ES106922.1,INSD:CF773210.1,INSD:AV785233.1,
FT                   INSD:BE038614.1,INSD:EH819492.1,INSD:EL087596.1,
FT                   INSD:AV540105.1,INSD:DR355194.1,INSD:EL175943.1,
FT                   INSD:BE039533.1,INSD:EH865233.1,INSD:EH990791.1,
FT                   INSD:ES207516.1,INSD:EL105864.1,INSD:EL176346.1,
FT                   INSD:DR355195.1,INSD:AV537923.1,INSD:BP666965.1,
FT                   INSD:BP866794.1,INSD:EL109638.1,INSD:ES120038.1,
FT                   INSD:ES136512.1,INSD:EH845075.1,INSD:EL281685.1,
FT                   INSD:ES046567.1,INSD:EL072897.1,INSD:EL109725.1,
FT                   INSD:EL338473.1,INSD:AV782048.1,INSD:EL220815.1,
FT                   INSD:EH901714.1,INSD:AV800424.1,INSD:ES045681.1,
FT                   INSD:ES139369.1,INSD:BP627610.1,INSD:BP858221.1,
FT                   INSD:AV545121.1,INSD:BP604933.1,INSD:F14391.1,
FT                   INSD:BP666867.1,INSD:ES153069.1,INSD:AV537970.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX818169.1,INSD:AK118199.1,INSD:BT024529.1"
FT   mRNA            complement(join(73931..74250,74338..74449,74661..74731))
FT                   /gene_synonym="F6F3.32"
FT                   /locus_tag="AT1G01170"
FT                   /product="ozone-responsive stress-like protein (DUF1138)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL331975.1,INSD:EL028471.1,INSD:EH967555.1,
FT                   INSD:EL051475.1,INSD:EH921359.1,INSD:EL129047.1,
FT                   INSD:EL263591.1,INSD:ES170211.1,INSD:EL229911.1,
FT                   INSD:EL050425.1,INSD:EL122980.1,INSD:BP598859.1,
FT                   INSD:ES191815.1,INSD:EL238019.1,INSD:ES106922.1,
FT                   INSD:CF773210.1,INSD:AV785233.1,INSD:EH819492.1,
FT                   INSD:EL087596.1,INSD:AV540105.1,INSD:DR355194.1,
FT                   INSD:EL175943.1,INSD:EH990791.1,INSD:ES207516.1,
FT                   INSD:EL105864.1,INSD:EL176346.1,INSD:DR355195.1,
FT                   INSD:AV537923.1,INSD:BP666965.1,INSD:EL109638.1,
FT                   INSD:ES120038.1,INSD:ES136512.1,INSD:EL281685.1,
FT                   INSD:EH845075.1,INSD:ES046567.1,INSD:EL072897.1,
FT                   INSD:EL338473.1,INSD:EL109725.1,INSD:AV782048.1,
FT                   INSD:EL220815.1,INSD:AV800424.1,INSD:ES045681.1,
FT                   INSD:ES139369.1,INSD:BP627610.1,INSD:BP604933.1,
FT                   INSD:AV545121.1,INSD:F14391.1,INSD:ES153069.1,
FT                   INSD:BP861750.1,INSD:AV537970.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT024529.1"
FT   CDS_pept        complement(join(74105..74250,74338..74443))
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.32"
FT                   /locus_tag="AT1G01170"
FT                   /product="ozone-responsive stress-like protein (DUF1138)"
FT                   /note="Protein of unknown function (DUF1138); FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: response to
FT                   stress; LOCATED IN: mitochondrion, membrane; EXPRESSED IN:
FT                   23 plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Protein of unknown function
FT                   DUF1138 (InterPro:IPR009515); BEST Arabidopsis thaliana
FT                   protein match is: Protein of unknown function (DUF1138)
FT                   (TAIR:AT4G00860.1); Has 86 Blast hits to 86 proteins in 15
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 86; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01170"
FT                   /db_xref="GOA:Q2HIQ2"
FT                   /db_xref="InterPro:IPR009515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2HIQ2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL331975.1,INSD:EL028471.1,INSD:EH967555.1,
FT                   INSD:EL051475.1,INSD:EH921359.1,INSD:EL129047.1,
FT                   INSD:BP584927.1,INSD:AU230317.1,INSD:BP576014.1,
FT                   INSD:EL263591.1,INSD:ES170211.1,INSD:EL229911.1,
FT                   INSD:EL050425.1,INSD:AI995719.1,INSD:DR244441.1,
FT                   INSD:EL122980.1,INSD:DR378599.1,INSD:BP598859.1,
FT                   INSD:BP862978.1,INSD:BP844949.1,INSD:DR244443.1,
FT                   INSD:ES191815.1,INSD:AU239051.1,INSD:EL238019.1,
FT                   INSD:DR244442.1,INSD:BP847595.1,INSD:EH864292.1,
FT                   INSD:ES106922.1,INSD:CF773210.1,INSD:AV785233.1,
FT                   INSD:BE038614.1,INSD:EH819492.1,INSD:EL087596.1,
FT                   INSD:AV540105.1,INSD:DR355194.1,INSD:EL175943.1,
FT                   INSD:BE039533.1,INSD:EH865233.1,INSD:EH990791.1,
FT                   INSD:ES207516.1,INSD:EL105864.1,INSD:EL176346.1,
FT                   INSD:DR355195.1,INSD:AV537923.1,INSD:BP666965.1,
FT                   INSD:BP866794.1,INSD:EL109638.1,INSD:ES120038.1,
FT                   INSD:ES136512.1,INSD:EH845075.1,INSD:EL281685.1,
FT                   INSD:ES046567.1,INSD:EL072897.1,INSD:EL109725.1,
FT                   INSD:EL338473.1,INSD:AV782048.1,INSD:EL220815.1,
FT                   INSD:EH901714.1,INSD:AV800424.1,INSD:ES045681.1,
FT                   INSD:ES139369.1,INSD:BP627610.1,INSD:BP858221.1,
FT                   INSD:AV545121.1,INSD:BP604933.1,INSD:F14391.1,
FT                   INSD:BP666867.1,INSD:ES153069.1,INSD:AV537970.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX818169.1,INSD:AK118199.1,INSD:BT024529.1"
FT                   /protein_id="AEE27249.1"
FT                   /translation="MASGGKAKYIIGALIGSFGISYIFDKVISDNKIFGGTTPGTVSNK
FT                   EWWAATDEKFQAWPRTAGPPVVMNPISRQNFIVKTRPE"
FT   CDS_pept        complement(join(74105..74250,74338..74443))
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.32"
FT                   /locus_tag="AT1G01170"
FT                   /product="ozone-responsive stress-like protein (DUF1138)"
FT                   /note="Protein of unknown function (DUF1138); FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: response to
FT                   stress; LOCATED IN: membrane; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF1138
FT                   (InterPro:IPR009515); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF1138)
FT                   (TAIR:AT4G00860.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q2HIQ2"
FT                   /db_xref="InterPro:IPR009515"
FT                   /db_xref="UniProtKB/TrEMBL:Q2HIQ2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL331975.1,INSD:EL028471.1,INSD:EH967555.1,
FT                   INSD:EL051475.1,INSD:EH921359.1,INSD:EL129047.1,
FT                   INSD:EL263591.1,INSD:ES170211.1,INSD:EL229911.1,
FT                   INSD:EL050425.1,INSD:EL122980.1,INSD:BP598859.1,
FT                   INSD:ES191815.1,INSD:EL238019.1,INSD:ES106922.1,
FT                   INSD:CF773210.1,INSD:AV785233.1,INSD:EH819492.1,
FT                   INSD:EL087596.1,INSD:AV540105.1,INSD:DR355194.1,
FT                   INSD:EL175943.1,INSD:EH990791.1,INSD:ES207516.1,
FT                   INSD:EL105864.1,INSD:EL176346.1,INSD:DR355195.1,
FT                   INSD:AV537923.1,INSD:BP666965.1,INSD:EL109638.1,
FT                   INSD:ES120038.1,INSD:ES136512.1,INSD:EL281685.1,
FT                   INSD:EH845075.1,INSD:ES046567.1,INSD:EL072897.1,
FT                   INSD:EL338473.1,INSD:EL109725.1,INSD:AV782048.1,
FT                   INSD:EL220815.1,INSD:AV800424.1,INSD:ES045681.1,
FT                   INSD:ES139369.1,INSD:BP627610.1,INSD:BP604933.1,
FT                   INSD:AV545121.1,INSD:F14391.1,INSD:ES153069.1,
FT                   INSD:BP861750.1,INSD:AV537970.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT024529.1"
FT                   /protein_id="AEE27250.1"
FT                   /translation="MASGGKAKYIIGALIGSFGISYIFDKVISDNKIFGGTTPGTVSNK
FT                   EWWAATDEKFQAWPRTAGPPVVMNPISRQNFIVKTRPE"
FT   gene            74435..74683
FT                   /locus_tag="AT1G04013"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT1G01170"
FT   ncRNA           74435..74683
FT                   /locus_tag="AT1G04013"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            75390..76845
FT                   /gene_synonym="F6F3.5"
FT                   /locus_tag="AT1G01180"
FT   mRNA            75390..76845
FT                   /gene_synonym="F6F3.5"
FT                   /locus_tag="AT1G01180"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL040408.1,INSD:EH866963.1,INSD:EH872751.1,
FT                   INSD:EL008308.1,INSD:EL075872.1,INSD:EL071600.1,
FT                   INSD:EL298103.1,INSD:EG526142.1,INSD:EH819229.1,
FT                   INSD:EH968032.1,INSD:DR232319.1,INSD:BP848972.1,
FT                   INSD:BP851522.1,INSD:EL230691.1,INSD:EG526143.1,
FT                   INSD:EH902035.1,INSD:EH933279.1,INSD:EL099103.1"
FT   CDS_pept        75633..76556
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.5"
FT                   /locus_tag="AT1G01180"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; FUNCTIONS IN: methyltransferase
FT                   activity; INVOLVED IN: lipid biosynthetic process;
FT                   EXPRESSED IN: sperm cell, hypocotyl; CONTAINS InterPro
FT                   DOMAIN/s: Rhamnosyl O-methyltransferase/Cephalosporin
FT                   hydroxylase (InterPro:IPR007072); Has 274 Blast hits to 274
FT                   proteins in 51 species: Archae - 0; Bacteria - 75; Metazoa
FT                   - 2; Fungi - 0; Plants - 46; Viruses - 0; Other Eukaryotes
FT                   - 151 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01180"
FT                   /db_xref="GOA:F4HS78"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F4HS78"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL040408.1,INSD:EH866963.1,INSD:EH872751.1,
FT                   INSD:EL008308.1,INSD:EL075872.1,INSD:EL071600.1,
FT                   INSD:EL298103.1,INSD:EG526142.1,INSD:EH819229.1,
FT                   INSD:EH968032.1,INSD:DR232319.1,INSD:BP848972.1,
FT                   INSD:BP851522.1,INSD:EL230691.1,INSD:EG526143.1,
FT                   INSD:EH902035.1,INSD:EH933279.1,INSD:EL099103.1"
FT                   /protein_id="AEE27251.1"
FT                   /translation="MKEDRRLPHKRDAFQFLKTKAAYVIVIVLTYAFGYFSAYHYHQPL
FT                   QQQLPPSTTAVETTKPQVCSIDNFRVTTPCGNLVPPELIRQTVIDRIFNGTSPYIDFPP
FT                   PHAKKFLRPKRIKGWGSYGAVFENLIRRVKPKTIVEVGSFLGASAIHMANLTRRLGLEE
FT                   TQILCVDDFRGWPGFRDRFKDMALVNGDVLLMYQFMQNVVISDFSGSILPVPFSTGSAL
FT                   EKLCEWGVTADLVEIDAGHDFNSAWADINRAVRILRPGGVIFGHDYFTAADNRGVRRAV
FT                   NLFAEINRLKVKTDGQHWVIDSVKVT"
FT   gene            77537..80345
FT                   /locus_tag="AT1G08765"
FT   misc_RNA        join(77537..78089,79097..80345)
FT                   /locus_tag="AT1G08765"
FT                   /note="novel transcribed region; AT1G08765.1"
FT   misc_RNA        join(77727..77892,78008..78089,79097..79340)
FT                   /locus_tag="AT1G08765"
FT                   /note="novel transcribed region; AT1G08765.2"
FT   gene            complement(78927..79037)
FT                   /gene="MIR165a"
FT                   /gene_synonym="MICRORNA 165"
FT                   /gene_synonym="microRNA165A"
FT                   /gene_synonym="MIR165"
FT                   /gene_synonym="MIR165A"
FT                   /gene_synonym="p_MI0000199"
FT                   /locus_tag="AT1G01183"
FT                   /note="Encodes a microRNA that targets several HD-ZIPIII
FT                   family members including PHV, PHB, REV, ATHB-8, and
FT                   ATHB-15. MicroRNAs are regulatory RNAs with a mature length
FT                   of 21-nucleotides that are processed from hairpin
FT                   precursors by Dicer-like enzymes. MicroRNAs can negatively
FT                   regulate gene expression by attenuating translation or by
FT                   directing mRNA cleavage.Mature sequence:
FT                   UCGGACCAGGCUUCAUCCCC"
FT   precursor_RNA   complement(78927..79037)
FT                   /gene="MIR165a"
FT                   /gene_synonym="MICRORNA 165"
FT                   /gene_synonym="microRNA165A"
FT                   /gene_synonym="MIR165"
FT                   /gene_synonym="MIR165A"
FT                   /gene_synonym="p_MI0000199"
FT                   /locus_tag="AT1G01183"
FT                   /product="microRNA ath-MIR165a precursor"
FT   ncRNA           complement(78932..78952)
FT                   /gene="MIR165a"
FT                   /gene_synonym="MICRORNA 165"
FT                   /gene_synonym="microRNA165A"
FT                   /gene_synonym="MIR165"
FT                   /gene_synonym="MIR165A"
FT                   /gene_synonym="p_MI0000199"
FT                   /locus_tag="AT1G01183"
FT                   /product="microRNA ath-miR165a-3p"
FT                   /note="mature miRNA accession:MIMAT0000187"
FT                   /ncRNA_class="miRNA"
FT   ncRNA           complement(79010..79030)
FT                   /gene="MIR165a"
FT                   /gene_synonym="MICRORNA 165"
FT                   /gene_synonym="microRNA165A"
FT                   /gene_synonym="MIR165"
FT                   /gene_synonym="MIR165A"
FT                   /gene_synonym="p_MI0000199"
FT                   /locus_tag="AT1G01183"
FT                   /product="microRNA ath-miR165a-5p"
FT                   /note="mature miRNA accession:MIMAT0031879"
FT                   /ncRNA_class="miRNA"
FT   gene            complement(82984..84946)
FT                   /gene="CYP78A8"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F6F3.25"
FT                   /gene_synonym="family 78"
FT                   /gene_synonym="polypeptide 8"
FT                   /gene_synonym="polypeptide 8''"
FT                   /gene_synonym="subfamily A"
FT                   /locus_tag="AT1G01190"
FT                   /note="member of CYP78A"
FT   mRNA            complement(join(82984..83671,83884..84864))
FT                   /gene="CYP78A8"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F6F3.25"
FT                   /gene_synonym="family 78"
FT                   /gene_synonym="polypeptide 8"
FT                   /gene_synonym="polypeptide 8''"
FT                   /gene_synonym="subfamily A"
FT                   /locus_tag="AT1G01190"
FT                   /product="cytochrome P450, family 78, subfamily A,
FT                   polypeptide 8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL227416.1,INSD:EL025247.1,INSD:EL094995.1,
FT                   INSD:BX836077.1,INSD:EH813832.1"
FT   mRNA            complement(join(83045..83671,83884..84946))
FT                   /gene="CYP78A8"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F6F3.25"
FT                   /gene_synonym="family 78"
FT                   /gene_synonym="polypeptide 8"
FT                   /gene_synonym="polypeptide 8''"
FT                   /gene_synonym="subfamily A"
FT                   /locus_tag="AT1G01190"
FT                   /product="cytochrome P450, family 78, subfamily A,
FT                   polypeptide 8"
FT   CDS_pept        complement(join(83045..83671,83884..84879))
FT                   /codon_start=1
FT                   /gene="CYP78A8"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F6F3.25"
FT                   /gene_synonym="family 78"
FT                   /gene_synonym="polypeptide 8"
FT                   /gene_synonym="polypeptide 8''"
FT                   /gene_synonym="subfamily A"
FT                   /locus_tag="AT1G01190"
FT                   /product="cytochrome P450, family 78, subfamily A,
FT                   polypeptide 8"
FT                   /db_xref="GOA:A0A178WIC4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178WIC4"
FT                   /protein_id="ANM60724.1"
FT                   /translation="MFSLNMRTEIESLWVFALASKFNIYMQQHFASLLVAIAITWFTIT
FT                   IVFWSTPGGPAWGKYFFTRRFISLDYNRKYKNLIPGPRGFPLVGSMSLRSSHVAHQRIA
FT                   SVAEMSNAKRLMAFSLGDTKVVVTCHPAVAKEILNSSVFADRPVDETAYGLMFNRAMGF
FT                   APNGTYWRTLRRLGSNHLFNPKQIKQSEDQRRVIATQMVNAFARNPKSACAVRDLLKTA
FT                   SLCNMMGLVFGREYELESNNNLESECLKGLVEEGYDLLGTLNWTDHLPWLAGLDFQQIR
FT                   FRCSQLVPKVNLLLSRIIHEQRAATGNFLDMLLSLQGSEKLSESDMVAVLWEMIFRGTD
FT                   TVAVLVEWVLARIVMHPKVQLTVHDELDRVVGRSRTVDESDLPSLTYLTAMIKEVLRLH
FT                   PPGPLLSWARLSITDTSVDGYHVPAGTTAMVNMWAIARDPHVWEDPLEFKPERFVAKEG
FT                   EAEFSVFGSDLRLAPFGSGKRVCPGKNLGLTTVSFWVATLLHEFEWLPSVEANPPDLSE
FT                   VLRLSCEMACPLIVNVSSRRKIM"
FT   CDS_pept        complement(join(83045..83671,83884..84864))
FT                   /codon_start=1
FT                   /gene="CYP78A8"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F6F3.25"
FT                   /gene_synonym="family 78"
FT                   /gene_synonym="polypeptide 8"
FT                   /gene_synonym="subfamily A"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="polypeptide 8''"
FT                   /locus_tag="AT1G01190"
FT                   /product="cytochrome P450, family 78, subfamily A,
FT                   polypeptide 8"
FT                   /note="''cytochrome P450, family 78, subfamily A,
FT                   polypeptide 8'' (CYP78A8); FUNCTIONS IN: electron carrier
FT                   activity, monooxygenase activity, iron ion binding, oxygen
FT                   binding, heme binding; INVOLVED IN: oxidation reduction;
FT                   LOCATED IN: endomembrane system; EXPRESSED IN: 6 plant
FT                   structures; EXPRESSED DURING: LP.10 ten leaves visible,
FT                   LP.02 two leaves visible, LP.12 twelve leaves visible;
FT                   CONTAINS InterPro DOMAIN/s: Cytochrome P450
FT                   (InterPro:IPR001128), Cytochrome P450, conserved site
FT                   (InterPro:IPR017972), Cytochrome P450, E-class, group I
FT                   (InterPro:IPR002401); BEST Arabidopsis thaliana protein
FT                   match is: cytochrome P450, family 78, subfamily A,
FT                   polypeptide 6 (TAIR:AT2G46660.1); Has 32104 Blast hits to
FT                   32001 proteins in 1725 species: Archae - 48; Bacteria -
FT                   3617; Metazoa - 11430; Fungi - 6777; Plants - 9112; Viruses
FT                   - 3; Other Eukaryotes - 1117 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01190"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01190.1"
FT                   /db_xref="GOA:F4HS79"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:F4HS79"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL227416.1,INSD:EL025247.1,INSD:EL094995.1,
FT                   INSD:BX836077.1,INSD:EH813832.1"
FT                   /protein_id="AEE27252.1"
FT                   /translation="MRTEIESLWVFALASKFNIYMQQHFASLLVAIAITWFTITIVFWS
FT                   TPGGPAWGKYFFTRRFISLDYNRKYKNLIPGPRGFPLVGSMSLRSSHVAHQRIASVAEM
FT                   SNAKRLMAFSLGDTKVVVTCHPAVAKEILNSSVFADRPVDETAYGLMFNRAMGFAPNGT
FT                   YWRTLRRLGSNHLFNPKQIKQSEDQRRVIATQMVNAFARNPKSACAVRDLLKTASLCNM
FT                   MGLVFGREYELESNNNLESECLKGLVEEGYDLLGTLNWTDHLPWLAGLDFQQIRFRCSQ
FT                   LVPKVNLLLSRIIHEQRAATGNFLDMLLSLQGSEKLSESDMVAVLWEMIFRGTDTVAVL
FT                   VEWVLARIVMHPKVQLTVHDELDRVVGRSRTVDESDLPSLTYLTAMIKEVLRLHPPGPL
FT                   LSWARLSITDTSVDGYHVPAGTTAMVNMWAIARDPHVWEDPLEFKPERFVAKEGEAEFS
FT                   VFGSDLRLAPFGSGKRVCPGKNLGLTTVSFWVATLLHEFEWLPSVEANPPDLSEVLRLS
FT                   CEMACPLIVNVSSRRKIM"
FT   gene            complement(86486..88409)
FT                   /gene="RABA3"
FT                   /gene_synonym="ARABIDOPSIS RAB GTPASE HOMOLOG A3"
FT                   /gene_synonym="ATRAB-A3"
FT                   /gene_synonym="ATRABA3"
FT                   /gene_synonym="F6F3.1"
FT                   /gene_synonym="F6F3_1"
FT                   /gene_synonym="RAB GTPase homolog A3"
FT                   /locus_tag="AT1G01200"
FT   mRNA            complement(join(86486..87162,87880..88409))
FT                   /gene="RABA3"
FT                   /gene_synonym="ARABIDOPSIS RAB GTPASE HOMOLOG A3"
FT                   /gene_synonym="ATRAB-A3"
FT                   /gene_synonym="ATRABA3"
FT                   /gene_synonym="F6F3.1"
FT                   /gene_synonym="F6F3_1"
FT                   /gene_synonym="RAB GTPase homolog A3"
FT                   /locus_tag="AT1G01200"
FT                   /product="RAB GTPase homolog A3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU227043.1,INSD:AU236208.1,INSD:CB253215.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT010979.1,INSD:BT010707.1,INSD:AK228329.1"
FT   CDS_pept        complement(join(86715..87162,87880..88145))
FT                   /codon_start=1
FT                   /gene="RABA3"
FT                   /gene_synonym="ARABIDOPSIS RAB GTPASE HOMOLOG A3"
FT                   /gene_synonym="ATRAB-A3"
FT                   /gene_synonym="ATRABA3"
FT                   /gene_synonym="F6F3.1"
FT                   /gene_synonym="F6F3_1"
FT                   /gene_synonym="RAB GTPase homolog A3"
FT                   /locus_tag="AT1G01200"
FT                   /product="RAB GTPase homolog A3"
FT                   /note="RAB GTPase homolog A3 (RABA3); FUNCTIONS IN: GTP
FT                   binding; INVOLVED IN: protein transport, small GTPase
FT                   mediated signal transduction; LOCATED IN: endosome,
FT                   nucleus, cell plate; EXPRESSED IN: lateral root cap,
FT                   hypocotyl, root, flower, epidermis; EXPRESSED DURING: petal
FT                   differentiation and expansion stage; CONTAINS InterPro
FT                   DOMAIN/s: Ras GTPase (InterPro:IPR001806), Small
FT                   GTP-binding protein (InterPro:IPR005225), Small GTPase
FT                   (InterPro:IPR020851), Ras (InterPro:IPR013753), Ras small
FT                   GTPase, Rab type (InterPro:IPR003579), Rab11-related
FT                   (InterPro:IPR015595); BEST Arabidopsis thaliana protein
FT                   match is: RAB GTPase homolog A4C (TAIR:AT5G47960.1); Has
FT                   27164 Blast hits to 27137 proteins in 734 species: Archae -
FT                   19; Bacteria - 134; Metazoa - 14292; Fungi - 3779; Plants -
FT                   3194; Viruses - 20; Other Eukaryotes - 5726 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01200"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01200.1"
FT                   /db_xref="GOA:Q9LNK1"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNK1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU227043.1,INSD:AU236208.1,INSD:CB253215.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT010979.1,INSD:BT010707.1,INSD:AK228329.1"
FT                   /protein_id="AEE27253.1"
FT                   /translation="MNEEMSGESPENNKHVKKPTMPEKIDYVFKVVVIGDSAVGKTQLL
FT                   SRFTHNEFCYDSKSTIGVEFQTRTITLRGKLVKAQIWDTAGQERYRAVTSAYYRGALGA
FT                   MVVYDITKRLSFDHVARWVEELRAHADDSAVIMLVGNKADLSVGKRAVPTEDAVEFAET
FT                   QRLFFSEVSALSGGNVDEAFFRLLEEIFSRVVVSRKAMESDGGATVKLDGSRIDVISGS
FT                   DLETSNIKEQASCSC"
FT   gene            88622..90502
FT                   /gene_synonym="F6F3.2"
FT                   /gene_synonym="F6F3_2"
FT                   /locus_tag="AT1G01210"
FT   mRNA            join(88622..88730,88954..89081,89173..89263,89405..89745)
FT                   /gene_synonym="F6F3.2"
FT                   /gene_synonym="F6F3_2"
FT                   /locus_tag="AT1G01210"
FT                   /product="DNA-directed RNA polymerase, subunit M, archaeal"
FT   mRNA            join(88883..89081,89173..89263,89405..89579,90162..90502)
FT                   /gene_synonym="F6F3.2"
FT                   /gene_synonym="F6F3_2"
FT                   /locus_tag="AT1G01210"
FT                   /product="DNA-directed RNA polymerase, subunit M, archaeal"
FT   mRNA            join(88890..89081,89173..89263,89405..89745)
FT                   /gene_synonym="F6F3.2"
FT                   /gene_synonym="F6F3_2"
FT                   /locus_tag="AT1G01210"
FT                   /product="DNA-directed RNA polymerase, subunit M, archaeal"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES118081.1,INSD:EG453100.1,INSD:AU238442.1,
FT                   INSD:ES203729.1,INSD:EL236865.1,INSD:EL288268.1,
FT                   INSD:ES075150.1,INSD:ES066624.1,INSD:DR332899.1,
FT                   INSD:EL312407.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK229520.1,INSD:BX817667.1,INSD:BX813659.1,
FT                   INSD:BT008558.1,INSD:BX818201.1,INSD:BT008671.1"
FT   CDS_pept        join(88977..89081,89173..89263,89405..89529)
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.2"
FT                   /gene_synonym="F6F3_2"
FT                   /locus_tag="AT1G01210"
FT                   /product="DNA-directed RNA polymerase, subunit M, archaeal"
FT                   /db_xref="GOA:Q9LNK0"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR034014"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LNK0"
FT                   /protein_id="ANM60312.1"
FT                   /translation="MEFCPTCGNLLRYEGGGNSRFFCSTCPYVAYIQRQVEIKKKQLLV
FT                   KKSIEAVVTKDDIPTAAETEAPCPRCGHDKAYFKSMQIRSADEPESRFYRCLKCEFTWR
FT                   EE"
FT   CDS_pept        join(88977..89081,89173..89263,89405..89529)
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.2"
FT                   /gene_synonym="F6F3_2"
FT                   /locus_tag="AT1G01210"
FT                   /product="DNA-directed RNA polymerase, subunit M, archaeal"
FT                   /db_xref="GOA:Q9LNK0"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR034014"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LNK0"
FT                   /protein_id="ANM60313.1"
FT                   /translation="MEFCPTCGNLLRYEGGGNSRFFCSTCPYVAYIQRQVEIKKKQLLV
FT                   KKSIEAVVTKDDIPTAAETEAPCPRCGHDKAYFKSMQIRSADEPESRFYRCLKCEFTWR
FT                   EE"
FT   CDS_pept        join(88977..89081,89173..89263,89405..89529)
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.2"
FT                   /gene_synonym="F6F3_2"
FT                   /locus_tag="AT1G01210"
FT                   /product="DNA-directed RNA polymerase, subunit M, archaeal"
FT                   /note="DNA-directed RNA polymerase, subunit M, archaeal;
FT                   FUNCTIONS IN: in 6 functions; INVOLVED IN: RNA elongation,
FT                   regulation of transcription, DNA-dependent, transcription,
FT                   regulation of transcription; LOCATED IN: nucleus; CONTAINS
FT                   InterPro DOMAIN/s: Zinc finger, TFIIS-type
FT                   (InterPro:IPR001222), DNA-directed RNA polymerase, M/15kDa
FT                   subunit (InterPro:IPR001529), DNA-directed RNA polymerase,
FT                   subunit M, archaeal (InterPro:IPR006288), DNA-directed RNA
FT                   polymerase M, 15kDa subunit, conserved site
FT                   (InterPro:IPR019761); BEST Arabidopsis thaliana protein
FT                   match is: DNA-directed RNA polymerase, subunit M, archaeal
FT                   (TAIR:AT4G07950.1); Has 1129 Blast hits to 1129 proteins in
FT                   326 species: Archae - 242; Bacteria - 0; Metazoa - 276;
FT                   Fungi - 294; Plants - 112; Viruses - 0; Other Eukaryotes -
FT                   205 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01210"
FT                   /db_xref="GOA:Q9LNK0"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR034014"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LNK0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES118081.1,INSD:EG453100.1,INSD:AU238442.1,
FT                   INSD:ES203729.1,INSD:EL236865.1,INSD:EL288268.1,
FT                   INSD:ES075150.1,INSD:ES066624.1,INSD:DR332899.1,
FT                   INSD:EL312407.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK229520.1,INSD:BX817667.1,INSD:BX813659.1,
FT                   INSD:BT008558.1,INSD:BX818201.1,INSD:BT008671.1"
FT                   /protein_id="AEE27254.1"
FT                   /translation="MEFCPTCGNLLRYEGGGNSRFFCSTCPYVAYIQRQVEIKKKQLLV
FT                   KKSIEAVVTKDDIPTAAETEAPCPRCGHDKAYFKSMQIRSADEPESRFYRCLKCEFTWR
FT                   EE"
FT   gene            complement(90169..90401)
FT                   /locus_tag="AT1G04017"
FT   ncRNA           complement(90169..90401)
FT                   /locus_tag="AT1G04017"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            91342..95681
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /note="Encodes a bifunctional enzyme that has both
FT                   L-fucokinase and GDP-L-fucose pyrophosphorylase activities.
FT                   It catalyzes the two steps of the L-fucose salvage pathway
FT                   for the generation of activated GDP-L-fucose. This pathway
FT                   seems to be of minor importance for cell wall
FT                   polysaccharide biosynthesis compared to the de novo
FT                   GDP-L-fucose biosynthesis pathway in Arabidopsis."
FT   mRNA            join(91342..91633,91743..92933,93045..93171,93271..94281,
FT                   94357..95075,95160..95681)
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT   mRNA            join(91342..91633,91743..92501,92569..92933,93045..93171,
FT                   93271..94281,94357..95075,95160..95681)
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT   mRNA            join(91342..91633,91743..92089,92270..92501,92569..92933,
FT                   93045..93171,93271..94281,94357..95075,95160..95681)
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT   mRNA            join(91342..91633,91743..92070,92270..92501,92569..92933,
FT                   93045..93171,93271..94281,94357..95075,95160..95681)
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV525363.1,INSD:ES049819.1,INSD:EH797926.1,
FT                   INSD:EH817274.1,INSD:EL101234.1,INSD:EL087001.1,
FT                   INSD:EL976350.1,INSD:EH929447.1,INSD:EG444244.1,
FT                   INSD:BP618077.1,INSD:EH941336.1"
FT   gene            complement(91356..91685)
FT                   /locus_tag="AT1G04023"
FT   ncRNA           complement(91356..91685)
FT                   /locus_tag="AT1G04023"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   mRNA            join(91376..91633,91743..92089,92270..92933,93045..93171,
FT                   93271..94281,94357..95075,95160..95676)
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT   mRNA            join(91376..91633,91743..92070,92270..92933,93045..93171,
FT                   93271..94281,94357..95075,95160..95674)
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT   mRNA            join(91642..92070,92270..92501,92569..92933,93045..93171,
FT                   93271..94281,94357..95075,95160..95674)
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT   mRNA            join(91692..92501,92569..92933,93045..93171,93271..94281,
FT                   94357..95075,95160..95681)
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT   CDS_pept        join(91750..92070,92270..92501,92569..92933,93045..93171,
FT                   93271..94281,94357..95075,95160..95552)
FT                   /codon_start=1
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /db_xref="GOA:Q9LNJ9"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012887"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNJ9"
FT                   /protein_id="ANM58557.1"
FT                   /translation="MSKQRKKADLATVLRKSWYHLRLSVRHPTRVPTWDAIVLTAASPE
FT                   QAELYDWQLRRAKRMGRIASSTVTLAVPDPDGKRIGSGAATLNAIYALARHYEKLGFDL
FT                   GPEMEVANGACKWVRFISAKHVLMLHAGGDSKRVPWANPMGKVFLPLPYLAADDPDGPV
FT                   PLLFDHILAIASCARQAFQDQGGLFIMTGDVLPCFDAFKMTLPEDAASIVTVPITLDIA
FT                   SNHGVIVTSKSESLAESYTVSLVNDLLQKPTVEDLVKKDAILHDGRTLLDTGIISARGR
FT                   AWSDLVALGCSCQPMILELIGSKKEMSLYEDLVAAWVPSRHDWLRTRPLGELLVNSLGR
FT                   QKMYSYCTYDLQFLHFGTSSEVLDHLSGDASGIVGRRHLCSIPATTVSDIAASSVILSS
FT                   EIAPGVSIGEDSLIYDSTVSGAVQIGSQSIVVGIHIPSEDLGTPESFRFMLPDRHCLWE
FT                   VPLVGHKGRVIVYCGLHDNPKNSIHKDGTFCGKPLEKVLFDLGIEESDLWSSYVAQDRC
FT                   LWNAKLFPILTYSEMLKLASWLMGLDDSRNKEKIKLWRSSQRVSLEELHGSINFPEMCN
FT                   GSSNHQADLAGGIAKACMNYGMLGRNLSQLCHEILQKESLGLEICKNFLDQCPKFQEQN
FT                   SKILPKSRAYQVEVDLLRACGDEAKAIELEHKVWGAVAEETASAVRYGFREHLLESSGK
FT                   SHSENHISHPDRVFQPRRTKVELPVRVDFVGGWSDTPPWSLERAGYVLNMAITLEGSLP
FT                   IGTIIETTNQMGISIQDDAGNELHIEDPISIKTPFEVNDPFRLVKSALLVTGIVQENFV
FT                   DSTGLAIKTWANVPRGSGLGTSSILAAAVVKGLLQISNGDESNENIARLVLVLEQLMGT
FT                   GGGWQDQIGGLYPGIKFTSSFPGIPMRLQVVPLLASPQLISELEQRLLVVFTGQVRLAH
FT                   QVLHKVVTRYLQRDNLLISSIKRLTELAKSGREALMNCEVDEVGDIMSEAWRLHQELDP
FT                   YCSNEFVDKLFEFSQPYSSGFKLVGAGGGGFSLILAKDAEKAKELRQRLEEHAEFDVKV
FT                   YNWSICI"
FT   CDS_pept        join(91750..92070,92270..92501,92569..92933,93045..93171,
FT                   93271..94281,94357..95075,95160..95552)
FT                   /codon_start=1
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /note="L-fucokinase/GDP-L-fucose pyrophosphorylase (FKGP);
FT                   FUNCTIONS IN: fucose-1-phosphate guanylyltransferase
FT                   activity, fucokinase activity, ATP binding, galactokinase
FT                   activity; INVOLVED IN: GDP-L-fucose salvage; LOCATED IN:
FT                   cytoplasm; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Mevalonate/galactokinase (InterPro:IPR006206), Ribosomal
FT                   protein S5 domain 2-type fold (InterPro:IPR020568), GHMP
FT                   kinase (InterPro:IPR006204), L-fucokinase
FT                   (InterPro:IPR012887), Ribosomal protein S5 domain 2-type
FT                   fold, subgroup (InterPro:IPR014721), GHMP kinase,
FT                   C-terminal (InterPro:IPR013750); Has 1878 Blast hits to
FT                   1819 proteins in 539 species: Archae - 59; Bacteria - 918;
FT                   Metazoa - 155; Fungi - 3; Plants - 87; Viruses - 3; Other
FT                   Eukaryotes - 653 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01220.1"
FT                   /db_xref="GOA:Q9LNJ9"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012887"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNJ9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV525363.1,INSD:ES049819.1,INSD:EH797926.1,
FT                   INSD:EH817274.1,INSD:EL101234.1,INSD:EL087001.1,
FT                   INSD:EL976350.1,INSD:EH929447.1,INSD:EG444244.1,
FT                   INSD:BP618077.1,INSD:EH941336.1"
FT                   /protein_id="AEE27255.1"
FT                   /translation="MSKQRKKADLATVLRKSWYHLRLSVRHPTRVPTWDAIVLTAASPE
FT                   QAELYDWQLRRAKRMGRIASSTVTLAVPDPDGKRIGSGAATLNAIYALARHYEKLGFDL
FT                   GPEMEVANGACKWVRFISAKHVLMLHAGGDSKRVPWANPMGKVFLPLPYLAADDPDGPV
FT                   PLLFDHILAIASCARQAFQDQGGLFIMTGDVLPCFDAFKMTLPEDAASIVTVPITLDIA
FT                   SNHGVIVTSKSESLAESYTVSLVNDLLQKPTVEDLVKKDAILHDGRTLLDTGIISARGR
FT                   AWSDLVALGCSCQPMILELIGSKKEMSLYEDLVAAWVPSRHDWLRTRPLGELLVNSLGR
FT                   QKMYSYCTYDLQFLHFGTSSEVLDHLSGDASGIVGRRHLCSIPATTVSDIAASSVILSS
FT                   EIAPGVSIGEDSLIYDSTVSGAVQIGSQSIVVGIHIPSEDLGTPESFRFMLPDRHCLWE
FT                   VPLVGHKGRVIVYCGLHDNPKNSIHKDGTFCGKPLEKVLFDLGIEESDLWSSYVAQDRC
FT                   LWNAKLFPILTYSEMLKLASWLMGLDDSRNKEKIKLWRSSQRVSLEELHGSINFPEMCN
FT                   GSSNHQADLAGGIAKACMNYGMLGRNLSQLCHEILQKESLGLEICKNFLDQCPKFQEQN
FT                   SKILPKSRAYQVEVDLLRACGDEAKAIELEHKVWGAVAEETASAVRYGFREHLLESSGK
FT                   SHSENHISHPDRVFQPRRTKVELPVRVDFVGGWSDTPPWSLERAGYVLNMAITLEGSLP
FT                   IGTIIETTNQMGISIQDDAGNELHIEDPISIKTPFEVNDPFRLVKSALLVTGIVQENFV
FT                   DSTGLAIKTWANVPRGSGLGTSSILAAAVVKGLLQISNGDESNENIARLVLVLEQLMGT
FT                   GGGWQDQIGGLYPGIKFTSSFPGIPMRLQVVPLLASPQLISELEQRLLVVFTGQVRLAH
FT                   QVLHKVVTRYLQRDNLLISSIKRLTELAKSGREALMNCEVDEVGDIMSEAWRLHQELDP
FT                   YCSNEFVDKLFEFSQPYSSGFKLVGAGGGGFSLILAKDAEKAKELRQRLEEHAEFDVKV
FT                   YNWSICI"
FT   CDS_pept        join(92246..92501,92569..92933,93045..93171,93271..94281,
FT                   94357..95075,95160..95552)
FT                   /codon_start=1
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /db_xref="GOA:A0A1P8API3"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012887"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8API3"
FT                   /protein_id="ANM58554.1"
FT                   /translation="MLYVNNQQMEVANGACKWVRFISAKHVLMLHAGGDSKRVPWANPM
FT                   GKVFLPLPYLAADDPDGPVPLLFDHILAIASCARQAFQDQGGLFIMTGDVLPCFDAFKM
FT                   TLPEDAASIVTVPITLDIASNHGVIVTSKSESLAESYTVSLVNDLLQKPTVEDLVKKDA
FT                   ILHDGRTLLDTGIISARGRAWSDLVALGCSCQPMILELIGSKKEMSLYEDLVAAWVPSR
FT                   HDWLRTRPLGELLVNSLGRQKMYSYCTYDLQFLHFGTSSEVLDHLSGDASGIVGRRHLC
FT                   SIPATTVSDIAASSVILSSEIAPGVSIGEDSLIYDSTVSGAVQIGSQSIVVGIHIPSED
FT                   LGTPESFRFMLPDRHCLWEVPLVGHKGRVIVYCGLHDNPKNSIHKDGTFCGKPLEKVLF
FT                   DLGIEESDLWSSYVAQDRCLWNAKLFPILTYSEMLKLASWLMGLDDSRNKEKIKLWRSS
FT                   QRVSLEELHGSINFPEMCNGSSNHQADLAGGIAKACMNYGMLGRNLSQLCHEILQKESL
FT                   GLEICKNFLDQCPKFQEQNSKILPKSRAYQVEVDLLRACGDEAKAIELEHKVWGAVAEE
FT                   TASAVRYGFREHLLESSGKSHSENHISHPDRVFQPRRTKVELPVRVDFVGGWSDTPPWS
FT                   LERAGYVLNMAITLEGSLPIGTIIETTNQMGISIQDDAGNELHIEDPISIKTPFEVNDP
FT                   FRLVKSALLVTGIVQENFVDSTGLAIKTWANVPRGSGLGTSSILAAAVVKGLLQISNGD
FT                   ESNENIARLVLVLEQLMGTGGGWQDQIGGLYPGIKFTSSFPGIPMRLQVVPLLASPQLI
FT                   SELEQRLLVVFTGQVRLAHQVLHKVVTRYLQRDNLLISSIKRLTELAKSGREALMNCEV
FT                   DEVGDIMSEAWRLHQELDPYCSNEFVDKLFEFSQPYSSGFKLVGAGGGGFSLILAKDAE
FT                   KAKELRQRLEEHAEFDVKVYNWSICI"
FT   CDS_pept        join(92246..92501,92569..92933,93045..93171,93271..94281,
FT                   94357..95075,95160..95552)
FT                   /codon_start=1
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01220"
FT                   /db_xref="GOA:A0A1P8API3"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012887"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8API3"
FT                   /protein_id="ANM58555.1"
FT                   /translation="MLYVNNQQMEVANGACKWVRFISAKHVLMLHAGGDSKRVPWANPM
FT                   GKVFLPLPYLAADDPDGPVPLLFDHILAIASCARQAFQDQGGLFIMTGDVLPCFDAFKM
FT                   TLPEDAASIVTVPITLDIASNHGVIVTSKSESLAESYTVSLVNDLLQKPTVEDLVKKDA
FT                   ILHDGRTLLDTGIISARGRAWSDLVALGCSCQPMILELIGSKKEMSLYEDLVAAWVPSR
FT                   HDWLRTRPLGELLVNSLGRQKMYSYCTYDLQFLHFGTSSEVLDHLSGDASGIVGRRHLC
FT                   SIPATTVSDIAASSVILSSEIAPGVSIGEDSLIYDSTVSGAVQIGSQSIVVGIHIPSED
FT                   LGTPESFRFMLPDRHCLWEVPLVGHKGRVIVYCGLHDNPKNSIHKDGTFCGKPLEKVLF
FT                   DLGIEESDLWSSYVAQDRCLWNAKLFPILTYSEMLKLASWLMGLDDSRNKEKIKLWRSS
FT                   QRVSLEELHGSINFPEMCNGSSNHQADLAGGIAKACMNYGMLGRNLSQLCHEILQKESL
FT                   GLEICKNFLDQCPKFQEQNSKILPKSRAYQVEVDLLRACGDEAKAIELEHKVWGAVAEE
FT                   TASAVRYGFREHLLESSGKSHSENHISHPDRVFQPRRTKVELPVRVDFVGGWSDTPPWS
FT                   LERAGYVLNMAITLEGSLPIGTIIETTNQMGISIQDDAGNELHIEDPISIKTPFEVNDP
FT                   FRLVKSALLVTGIVQENFVDSTGLAIKTWANVPRGSGLGTSSILAAAVVKGLLQISNGD
FT                   ESNENIARLVLVLEQLMGTGGGWQDQIGGLYPGIKFTSSFPGIPMRLQVVPLLASPQLI
FT                   SELEQRLLVVFTGQVRLAHQVLHKVVTRYLQRDNLLISSIKRLTELAKSGREALMNCEV
FT                   DEVGDIMSEAWRLHQELDPYCSNEFVDKLFEFSQPYSSGFKLVGAGGGGFSLILAKDAE
FT                   KAKELRQRLEEHAEFDVKVYNWSICI"
FT   CDS_pept        join(92270..92501,92569..92933,93045..93171,93271..94281,
FT                   94357..95075,95160..95552)
FT                   /codon_start=1
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01220"
FT                   /db_xref="GOA:A0A178W6Y3"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012887"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178W6Y3"
FT                   /protein_id="ANM58560.1"
FT                   /translation="MEVANGACKWVRFISAKHVLMLHAGGDSKRVPWANPMGKVFLPLP
FT                   YLAADDPDGPVPLLFDHILAIASCARQAFQDQGGLFIMTGDVLPCFDAFKMTLPEDAAS
FT                   IVTVPITLDIASNHGVIVTSKSESLAESYTVSLVNDLLQKPTVEDLVKKDAILHDGRTL
FT                   LDTGIISARGRAWSDLVALGCSCQPMILELIGSKKEMSLYEDLVAAWVPSRHDWLRTRP
FT                   LGELLVNSLGRQKMYSYCTYDLQFLHFGTSSEVLDHLSGDASGIVGRRHLCSIPATTVS
FT                   DIAASSVILSSEIAPGVSIGEDSLIYDSTVSGAVQIGSQSIVVGIHIPSEDLGTPESFR
FT                   FMLPDRHCLWEVPLVGHKGRVIVYCGLHDNPKNSIHKDGTFCGKPLEKVLFDLGIEESD
FT                   LWSSYVAQDRCLWNAKLFPILTYSEMLKLASWLMGLDDSRNKEKIKLWRSSQRVSLEEL
FT                   HGSINFPEMCNGSSNHQADLAGGIAKACMNYGMLGRNLSQLCHEILQKESLGLEICKNF
FT                   LDQCPKFQEQNSKILPKSRAYQVEVDLLRACGDEAKAIELEHKVWGAVAEETASAVRYG
FT                   FREHLLESSGKSHSENHISHPDRVFQPRRTKVELPVRVDFVGGWSDTPPWSLERAGYVL
FT                   NMAITLEGSLPIGTIIETTNQMGISIQDDAGNELHIEDPISIKTPFEVNDPFRLVKSAL
FT                   LVTGIVQENFVDSTGLAIKTWANVPRGSGLGTSSILAAAVVKGLLQISNGDESNENIAR
FT                   LVLVLEQLMGTGGGWQDQIGGLYPGIKFTSSFPGIPMRLQVVPLLASPQLISELEQRLL
FT                   VVFTGQVRLAHQVLHKVVTRYLQRDNLLISSIKRLTELAKSGREALMNCEVDEVGDIMS
FT                   EAWRLHQELDPYCSNEFVDKLFEFSQPYSSGFKLVGAGGGGFSLILAKDAEKAKELRQR
FT                   LEEHAEFDVKVYNWSICI"
FT   CDS_pept        join(92583..92933,93045..93171,93271..94281,94357..95075,
FT                   95160..95552)
FT                   /codon_start=1
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01220"
FT                   /db_xref="GOA:A0A1P8APH1"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012887"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8APH1"
FT                   /protein_id="ANM58556.1"
FT                   /translation="MTGDVLPCFDAFKMTLPEDAASIVTVPITLDIASNHGVIVTSKSE
FT                   SLAESYTVSLVNDLLQKPTVEDLVKKDAILHDGRTLLDTGIISARGRAWSDLVALGCSC
FT                   QPMILELIGSKKEMSLYEDLVAAWVPSRHDWLRTRPLGELLVNSLGRQKMYSYCTYDLQ
FT                   FLHFGTSSEVLDHLSGDASGIVGRRHLCSIPATTVSDIAASSVILSSEIAPGVSIGEDS
FT                   LIYDSTVSGAVQIGSQSIVVGIHIPSEDLGTPESFRFMLPDRHCLWEVPLVGHKGRVIV
FT                   YCGLHDNPKNSIHKDGTFCGKPLEKVLFDLGIEESDLWSSYVAQDRCLWNAKLFPILTY
FT                   SEMLKLASWLMGLDDSRNKEKIKLWRSSQRVSLEELHGSINFPEMCNGSSNHQADLAGG
FT                   IAKACMNYGMLGRNLSQLCHEILQKESLGLEICKNFLDQCPKFQEQNSKILPKSRAYQV
FT                   EVDLLRACGDEAKAIELEHKVWGAVAEETASAVRYGFREHLLESSGKSHSENHISHPDR
FT                   VFQPRRTKVELPVRVDFVGGWSDTPPWSLERAGYVLNMAITLEGSLPIGTIIETTNQMG
FT                   ISIQDDAGNELHIEDPISIKTPFEVNDPFRLVKSALLVTGIVQENFVDSTGLAIKTWAN
FT                   VPRGSGLGTSSILAAAVVKGLLQISNGDESNENIARLVLVLEQLMGTGGGWQDQIGGLY
FT                   PGIKFTSSFPGIPMRLQVVPLLASPQLISELEQRLLVVFTGQVRLAHQVLHKVVTRYLQ
FT                   RDNLLISSIKRLTELAKSGREALMNCEVDEVGDIMSEAWRLHQELDPYCSNEFVDKLFE
FT                   FSQPYSSGFKLVGAGGGGFSLILAKDAEKAKELRQRLEEHAEFDVKVYNWSICI"
FT   CDS_pept        join(92583..92933,93045..93171,93271..94281,94357..95075,
FT                   95160..95552)
FT                   /codon_start=1
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /db_xref="GOA:A0A1P8APH1"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012887"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8APH1"
FT                   /protein_id="ANM58558.1"
FT                   /translation="MTGDVLPCFDAFKMTLPEDAASIVTVPITLDIASNHGVIVTSKSE
FT                   SLAESYTVSLVNDLLQKPTVEDLVKKDAILHDGRTLLDTGIISARGRAWSDLVALGCSC
FT                   QPMILELIGSKKEMSLYEDLVAAWVPSRHDWLRTRPLGELLVNSLGRQKMYSYCTYDLQ
FT                   FLHFGTSSEVLDHLSGDASGIVGRRHLCSIPATTVSDIAASSVILSSEIAPGVSIGEDS
FT                   LIYDSTVSGAVQIGSQSIVVGIHIPSEDLGTPESFRFMLPDRHCLWEVPLVGHKGRVIV
FT                   YCGLHDNPKNSIHKDGTFCGKPLEKVLFDLGIEESDLWSSYVAQDRCLWNAKLFPILTY
FT                   SEMLKLASWLMGLDDSRNKEKIKLWRSSQRVSLEELHGSINFPEMCNGSSNHQADLAGG
FT                   IAKACMNYGMLGRNLSQLCHEILQKESLGLEICKNFLDQCPKFQEQNSKILPKSRAYQV
FT                   EVDLLRACGDEAKAIELEHKVWGAVAEETASAVRYGFREHLLESSGKSHSENHISHPDR
FT                   VFQPRRTKVELPVRVDFVGGWSDTPPWSLERAGYVLNMAITLEGSLPIGTIIETTNQMG
FT                   ISIQDDAGNELHIEDPISIKTPFEVNDPFRLVKSALLVTGIVQENFVDSTGLAIKTWAN
FT                   VPRGSGLGTSSILAAAVVKGLLQISNGDESNENIARLVLVLEQLMGTGGGWQDQIGGLY
FT                   PGIKFTSSFPGIPMRLQVVPLLASPQLISELEQRLLVVFTGQVRLAHQVLHKVVTRYLQ
FT                   RDNLLISSIKRLTELAKSGREALMNCEVDEVGDIMSEAWRLHQELDPYCSNEFVDKLFE
FT                   FSQPYSSGFKLVGAGGGGFSLILAKDAEKAKELRQRLEEHAEFDVKVYNWSICI"
FT   CDS_pept        join(92583..92933,93045..93171,93271..94281,94357..95075,
FT                   95160..95552)
FT                   /codon_start=1
FT                   /gene="FKGP"
FT                   /gene_synonym="Arabidopsis thaliana
FT                   L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /gene_synonym="AtFKGP"
FT                   /gene_synonym="F6F3.3"
FT                   /gene_synonym="F6F3_3"
FT                   /gene_synonym="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /locus_tag="AT1G01220"
FT                   /product="L-fucokinase/GDP-L-fucose pyrophosphorylase"
FT                   /db_xref="GOA:A0A1P8APH1"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012887"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8APH1"
FT                   /protein_id="ANM58559.1"
FT                   /translation="MTGDVLPCFDAFKMTLPEDAASIVTVPITLDIASNHGVIVTSKSE
FT                   SLAESYTVSLVNDLLQKPTVEDLVKKDAILHDGRTLLDTGIISARGRAWSDLVALGCSC
FT                   QPMILELIGSKKEMSLYEDLVAAWVPSRHDWLRTRPLGELLVNSLGRQKMYSYCTYDLQ
FT                   FLHFGTSSEVLDHLSGDASGIVGRRHLCSIPATTVSDIAASSVILSSEIAPGVSIGEDS
FT                   LIYDSTVSGAVQIGSQSIVVGIHIPSEDLGTPESFRFMLPDRHCLWEVPLVGHKGRVIV
FT                   YCGLHDNPKNSIHKDGTFCGKPLEKVLFDLGIEESDLWSSYVAQDRCLWNAKLFPILTY
FT                   SEMLKLASWLMGLDDSRNKEKIKLWRSSQRVSLEELHGSINFPEMCNGSSNHQADLAGG
FT                   IAKACMNYGMLGRNLSQLCHEILQKESLGLEICKNFLDQCPKFQEQNSKILPKSRAYQV
FT                   EVDLLRACGDEAKAIELEHKVWGAVAEETASAVRYGFREHLLESSGKSHSENHISHPDR
FT                   VFQPRRTKVELPVRVDFVGGWSDTPPWSLERAGYVLNMAITLEGSLPIGTIIETTNQMG
FT                   ISIQDDAGNELHIEDPISIKTPFEVNDPFRLVKSALLVTGIVQENFVDSTGLAIKTWAN
FT                   VPRGSGLGTSSILAAAVVKGLLQISNGDESNENIARLVLVLEQLMGTGGGWQDQIGGLY
FT                   PGIKFTSSFPGIPMRLQVVPLLASPQLISELEQRLLVVFTGQVRLAHQVLHKVVTRYLQ
FT                   RDNLLISSIKRLTELAKSGREALMNCEVDEVGDIMSEAWRLHQELDPYCSNEFVDKLFE
FT                   FSQPYSSGFKLVGAGGGGFSLILAKDAEKAKELRQRLEEHAEFDVKVYNWSICI"
FT   gene            95935..97407
FT                   /locus_tag="AT1G01225"
FT   mRNA            join(95935..96157,96554..97407)
FT                   /locus_tag="AT1G01225"
FT                   /product="NC domain-containing protein-like protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR310649.1,INSD:DR310650.1,INSD:DR374770.1,
FT                   INSD:BE523378.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY087072.1,INSD:BX818287.1,INSD:BT024776.1"
FT   CDS_pept        join(96064..96157,96554..97242)
FT                   /codon_start=1
FT                   /locus_tag="AT1G01225"
FT                   /product="NC domain-containing protein-like protein"
FT                   /note="NC domain-containing protein-related; CONTAINS
FT                   InterPro DOMAIN/s: NC (InterPro:IPR007053); BEST
FT                   Arabidopsis thaliana protein match is: NC domain-containing
FT                   protein-related (TAIR:AT4G00905.1); Has 173 Blast hits to
FT                   172 proteins in 34 species: Archae - 0; Bacteria - 24;
FT                   Metazoa - 5; Fungi - 0; Plants - 139; Viruses - 0; Other
FT                   Eukaryotes - 5 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01225"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01225.1"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:Q29PY0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR310649.1,INSD:DR310650.1,INSD:DR374770.1,
FT                   INSD:BE523378.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY087072.1,INSD:BX818287.1,INSD:BT024776.1"
FT                   /protein_id="AEE27256.1"
FT                   /translation="MGLLTNKIEREELKPGDHIYTYRAIFAYSHHGIFVGGSKVVHFRP
FT                   EHNPMDSSTSSISSSSSEDICSIFPDCGFRQPDSGVVLSCLDCFLKNGSLYCFEYGVSP
FT                   SVFLTKVRGGTCTTAQSDTTDSVIHRAMYLLQNGFGNYDIFKNNCEDFALYCKTGLLIM
FT                   DKLGVGRSGQASSIVGAPLAALLSSPFKLLIPSPIGVATVTAGMYCMSRYATDIGVRSD
FT                   VIKVSVEDLALNLDVKTIEQGEEEEEDEEEDSDTDYVR"
FT   gene            97412..99240
FT                   /gene_synonym="F6F3.4"
FT                   /gene_synonym="F6F3_4"
FT                   /locus_tag="AT1G01230"
FT   mRNA            join(97412..97805,98457..98605,98908..99240)
FT                   /gene_synonym="F6F3.4"
FT                   /gene_synonym="F6F3_4"
FT                   /locus_tag="AT1G01230"
FT                   /product="ORMDL family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES011220.1,INSD:BP655958.1,INSD:DR338670.1,
FT                   INSD:BP826520.1,INSD:ES045683.1,INSD:DR338665.1,
FT                   INSD:ES172608.1,INSD:BP593738.1,INSD:AV798660.1,
FT                   INSD:EL283989.1,INSD:BP634535.1,INSD:R65182.1,
FT                   INSD:EL123989.1,INSD:T43285.1,INSD:AV827572.1,
FT                   INSD:BP641549.1,INSD:DR338669.1,INSD:BP577962.1,
FT                   INSD:EL156595.1,INSD:AV536130.1,INSD:BP853675.1,
FT                   INSD:BP818781.1,INSD:EL170727.1,INSD:BP796077.1,
FT                   INSD:BP654985.1,INSD:EL140834.1,INSD:EL060233.1,
FT                   INSD:ES020303.1,INSD:BP796090.1,INSD:ES146495.1,
FT                   INSD:EH853447.1,INSD:EL177336.1,INSD:EL126228.1,
FT                   INSD:T44917.1,INSD:ES165618.1,INSD:ES214061.1,
FT                   INSD:DR372182.1,INSD:EL088027.1,INSD:EH935355.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF360237.1,INSD:AY040036.1,INSD:AY085212.1"
FT   CDS_pept        join(97620..97805,98457..98605,98908..99046)
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.4"
FT                   /gene_synonym="F6F3_4"
FT                   /locus_tag="AT1G01230"
FT                   /product="ORMDL family protein"
FT                   /note="ORMDL family protein; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: protein folding;
FT                   LOCATED IN: integral to membrane, endoplasmic reticulum;
FT                   EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15
FT                   growth stages; CONTAINS InterPro DOMAIN/s: ORMDL
FT                   (InterPro:IPR007203); BEST Arabidopsis thaliana protein
FT                   match is: ORMDL family protein (TAIR:AT5G42000.1); Has 538
FT                   Blast hits to 538 proteins in 163 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 276; Fungi - 148; Plants - 90;
FT                   Viruses - 0; Other Eukaryotes - 24 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01230.1"
FT                   /db_xref="GOA:Q9C5I0"
FT                   /db_xref="InterPro:IPR007203"
FT                   /db_xref="UniProtKB/TrEMBL:Q9C5I0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES011220.1,INSD:BP655958.1,INSD:DR338670.1,
FT                   INSD:BP826520.1,INSD:ES045683.1,INSD:DR338665.1,
FT                   INSD:ES172608.1,INSD:BP593738.1,INSD:AV798660.1,
FT                   INSD:EL283989.1,INSD:BP634535.1,INSD:R65182.1,
FT                   INSD:EL123989.1,INSD:T43285.1,INSD:AV827572.1,
FT                   INSD:BP641549.1,INSD:DR338669.1,INSD:BP577962.1,
FT                   INSD:EL156595.1,INSD:AV536130.1,INSD:BP853675.1,
FT                   INSD:BP818781.1,INSD:EL170727.1,INSD:BP796077.1,
FT                   INSD:BP654985.1,INSD:EL140834.1,INSD:EL060233.1,
FT                   INSD:ES020303.1,INSD:BP796090.1,INSD:ES146495.1,
FT                   INSD:EH853447.1,INSD:EL177336.1,INSD:EL126228.1,
FT                   INSD:T44917.1,INSD:ES165618.1,INSD:ES214061.1,
FT                   INSD:DR372182.1,INSD:EL088027.1,INSD:EH935355.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF360237.1,INSD:AY040036.1,INSD:AY085212.1"
FT                   /protein_id="AEE27257.1"
FT                   /translation="MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVS
FT                   GCSPGMAWTVVNLAHFVVTYHSFHWMKGTPFADDQGIYNGLTWWEQMDNGQQLTRNRKF
FT                   LTLVPVVLYLIASHTTDYRHPWLFLNTLAVMVLVVAKFPNMHKVRIFGINGDK"
FT   gene            99865..101987
FT                   /gene_synonym="F633.5"
FT                   /gene_synonym="F633_5"
FT                   /gene_synonym="F6F3.27"
FT                   /locus_tag="AT1G01240"
FT   mRNA            join(99865..100031,100111..100220,100657..101840)
FT                   /gene_synonym="F633.5"
FT                   /gene_synonym="F633_5"
FT                   /gene_synonym="F6F3.27"
FT                   /locus_tag="AT1G01240"
FT                   /product="transmembrane protein"
FT   mRNA            99866..101987
FT                   /gene_synonym="F633.5"
FT                   /gene_synonym="F633_5"
FT                   /gene_synonym="F6F3.27"
FT                   /locus_tag="AT1G01240"
FT                   /product="transmembrane protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR336017.1,INSD:EH880564.1,INSD:DR336020.1,
FT                   INSD:EL264728.1,INSD:AV830581.1,INSD:AV794822.1,
FT                   INSD:BP601327.1,INSD:AV812156.1,INSD:BP667203.1,
FT                   INSD:AV796456.1,INSD:EL223302.1,INSD:DR336018.1,
FT                   INSD:EL328702.1,INSD:BP816181.1,INSD:T42033.1,
FT                   INSD:BX834584.1,INSD:ES195005.1,INSD:EL184195.1,
FT                   INSD:AV786287.1,INSD:EH945474.1,INSD:DR375288.1,
FT                   INSD:ES194812.1,INSD:EL999147.1,INSD:DR336019.1,
FT                   INSD:EL249655.1,INSD:ES209182.1,INSD:AV826419.1,
FT                   INSD:BP780979.1,INSD:EL193974.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY091196.1,INSD:BX815637.1,INSD:AF428444.1,
FT                   INSD:BX818598.1,INSD:AY056171.1,INSD:AY087324.1"
FT   mRNA            join(99866..100220,100657..101987)
FT                   /gene_synonym="F633.5"
FT                   /gene_synonym="F633_5"
FT                   /gene_synonym="F6F3.27"
FT                   /locus_tag="AT1G01240"
FT                   /product="transmembrane protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR336017.1,INSD:EH880564.1,INSD:DR336020.1,
FT                   INSD:EL264728.1,INSD:AV830581.1,INSD:AV794822.1,
FT                   INSD:BP601327.1,INSD:ES140766.1,INSD:AV812156.1,
FT                   INSD:BP667203.1,INSD:AV796456.1,INSD:EL223302.1,
FT                   INSD:DR336018.1,INSD:EL328702.1,INSD:T42033.1,
FT                   INSD:BX834584.1,INSD:ES195005.1,INSD:EL184195.1,
FT                   INSD:AV786287.1,INSD:EH945474.1,INSD:DR375288.1,
FT                   INSD:ES194812.1,INSD:EL999147.1,INSD:DR336019.1,
FT                   INSD:EL249655.1,INSD:ES209182.1,INSD:AV826419.1,
FT                   INSD:BP780979.1,INSD:EL193974.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY091196.1,INSD:AF428444.1,INSD:BX818598.1,
FT                   INSD:AY056171.1,INSD:AY087324.1"
FT   mRNA            join(99866..100031,100657..101987)
FT                   /gene_synonym="F633.5"
FT                   /gene_synonym="F633_5"
FT                   /gene_synonym="F6F3.27"
FT                   /locus_tag="AT1G01240"
FT                   /product="transmembrane protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH880564.1,INSD:EL264728.1,INSD:AV794822.1,
FT                   INSD:BP601327.1,INSD:EL127214.1,INSD:ES140766.1,
FT                   INSD:AV812156.1,INSD:BP667203.1,INSD:AV796456.1,
FT                   INSD:EL223302.1,INSD:EL328702.1,INSD:ES195005.1,
FT                   INSD:BX834584.1,INSD:EL036727.1,INSD:EL184195.1,
FT                   INSD:AV786287.1,INSD:EH945474.1,INSD:DR375288.1,
FT                   INSD:ES194812.1,INSD:EL999147.1,INSD:BX837698.1,
FT                   INSD:EL243431.1,INSD:EL249655.1,INSD:ES209182.1,
FT                   INSD:BP780979.1,INSD:EL193974.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY091196.1"
FT   mRNA            join(99872..100031,100111..101882)
FT                   /gene_synonym="F633.5"
FT                   /gene_synonym="F633_5"
FT                   /gene_synonym="F6F3.27"
FT                   /locus_tag="AT1G01240"
FT                   /product="transmembrane protein"
FT   CDS_pept        100683..101678
FT                   /codon_start=1
FT                   /gene_synonym="F633.5"
FT                   /gene_synonym="F633_5"
FT                   /gene_synonym="F6F3.27"
FT                   /locus_tag="AT1G01240"
FT                   /product="transmembrane protein"
FT                   /db_xref="GOA:Q9LNJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LNJ7"
FT                   /protein_id="ANM58163.1"
FT                   /translation="MGAAEARALWQRTASRCFVVHEDAKMAPRLACCQHQQSSSGNTEK
FT                   NSFSSGSFGDSSDFSCDTKWWLKGSTGFDEEVTNSFLEDTKCKKLHEFVDLIGIREEED
FT                   YSFISKKADATTPWWRSTTDKDELALMVATKSVDHNIQNCDLPPPQKLHKSIHSSSGEK
FT                   GFKTAVKSPWKQGVWKDRFERSLSYNGSTESKNTSPMSSPRSDDLSKGQLLEALRHSQT
FT                   RAREAERAAREACAEKDRVITILLKQASQMLAYKQWLKLLEMEALYLQMKKEEEQEEQV
FT                   KGMNLKKRKQRGEKKKKGETGRYMMAFALGFSLIGAGLLLGWTVGWLLPF"
FT   CDS_pept        100683..101678
FT                   /codon_start=1
FT                   /gene_synonym="F633.5"
FT                   /gene_synonym="F633_5"
FT                   /gene_synonym="F6F3.27"
FT                   /locus_tag="AT1G01240"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01240"
FT                   /db_xref="GOA:Q9LNJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LNJ7"
FT                   /protein_id="ANM58164.1"
FT                   /translation="MGAAEARALWQRTASRCFVVHEDAKMAPRLACCQHQQSSSGNTEK
FT                   NSFSSGSFGDSSDFSCDTKWWLKGSTGFDEEVTNSFLEDTKCKKLHEFVDLIGIREEED
FT                   YSFISKKADATTPWWRSTTDKDELALMVATKSVDHNIQNCDLPPPQKLHKSIHSSSGEK
FT                   GFKTAVKSPWKQGVWKDRFERSLSYNGSTESKNTSPMSSPRSDDLSKGQLLEALRHSQT
FT                   RAREAERAAREACAEKDRVITILLKQASQMLAYKQWLKLLEMEALYLQMKKEEEQEEQV
FT                   KGMNLKKRKQRGEKKKKGETGRYMMAFALGFSLIGAGLLLGWTVGWLLPF"
FT   CDS_pept        100683..101678
FT                   /codon_start=1
FT                   /gene_synonym="F633.5"
FT                   /gene_synonym="F633_5"
FT                   /gene_synonym="F6F3.27"
FT                   /locus_tag="AT1G01240"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; INVOLVED IN: N-terminal protein
FT                   myristoylation; EXPRESSED IN: 17 plant structures;
FT                   EXPRESSED DURING: 11 growth stages; BEST Arabidopsis
FT                   thaliana protein match is: unknown protein
FT                   (TAIR:AT2G46550.1); Has 95 Blast hits to 78 proteins in 16
FT                   species: Archae - 0; Bacteria - 2; Metazoa - 11; Fungi - 0;
FT                   Plants - 80; Viruses - 0; Other Eukaryotes - 2 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q9LNJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LNJ7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR336017.1,INSD:EH880564.1,INSD:DR336020.1,
FT                   INSD:EL264728.1,INSD:AV830581.1,INSD:AV794822.1,
FT                   INSD:BP601327.1,INSD:ES140766.1,INSD:AV812156.1,
FT                   INSD:BP667203.1,INSD:AV796456.1,INSD:EL223302.1,
FT                   INSD:DR336018.1,INSD:EL328702.1,INSD:T42033.1,
FT                   INSD:BX834584.1,INSD:ES195005.1,INSD:EL184195.1,
FT                   INSD:AV786287.1,INSD:EH945474.1,INSD:DR375288.1,
FT                   INSD:ES194812.1,INSD:EL999147.1,INSD:DR336019.1,
FT                   INSD:EL249655.1,INSD:ES209182.1,INSD:AV826419.1,
FT                   INSD:BP780979.1,INSD:EL193974.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY091196.1,INSD:AF428444.1,INSD:BX818598.1,
FT                   INSD:AY056171.1,INSD:AY087324.1"
FT                   /protein_id="AEE27258.1"
FT                   /translation="MGAAEARALWQRTASRCFVVHEDAKMAPRLACCQHQQSSSGNTEK
FT                   NSFSSGSFGDSSDFSCDTKWWLKGSTGFDEEVTNSFLEDTKCKKLHEFVDLIGIREEED
FT                   YSFISKKADATTPWWRSTTDKDELALMVATKSVDHNIQNCDLPPPQKLHKSIHSSSGEK
FT                   GFKTAVKSPWKQGVWKDRFERSLSYNGSTESKNTSPMSSPRSDDLSKGQLLEALRHSQT
FT                   RAREAERAAREACAEKDRVITILLKQASQMLAYKQWLKLLEMEALYLQMKKEEEQEEQV
FT                   KGMNLKKRKQRGEKKKKGETGRYMMAFALGFSLIGAGLLLGWTVGWLLPF"
FT   CDS_pept        100683..101678
FT                   /codon_start=1
FT                   /gene_synonym="F633.5"
FT                   /gene_synonym="F633_5"
FT                   /gene_synonym="F6F3.27"
FT                   /locus_tag="AT1G01240"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT2G46550.1); Has 35333
FT                   Blast hits to 34131 proteins in 2444 species: Archae - 798;
FT                   Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531;
FT                   Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LNJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LNJ7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR336017.1,INSD:EH880564.1,INSD:DR336020.1,
FT                   INSD:EL264728.1,INSD:AV830581.1,INSD:AV794822.1,
FT                   INSD:BP601327.1,INSD:AV812156.1,INSD:BP667203.1,
FT                   INSD:AV796456.1,INSD:EL223302.1,INSD:DR336018.1,
FT                   INSD:EL328702.1,INSD:BP816181.1,INSD:T42033.1,
FT                   INSD:BX834584.1,INSD:ES195005.1,INSD:EL184195.1,
FT                   INSD:AV786287.1,INSD:EH945474.1,INSD:DR375288.1,
FT                   INSD:ES194812.1,INSD:EL999147.1,INSD:DR336019.1,
FT                   INSD:EL249655.1,INSD:ES209182.1,INSD:AV826419.1,
FT                   INSD:BP780979.1,INSD:EL193974.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY091196.1,INSD:BX815637.1,INSD:AF428444.1,
FT                   INSD:BX818598.1,INSD:AY056171.1,INSD:AY087324.1"
FT                   /protein_id="AEE27259.1"
FT                   /translation="MGAAEARALWQRTASRCFVVHEDAKMAPRLACCQHQQSSSGNTEK
FT                   NSFSSGSFGDSSDFSCDTKWWLKGSTGFDEEVTNSFLEDTKCKKLHEFVDLIGIREEED
FT                   YSFISKKADATTPWWRSTTDKDELALMVATKSVDHNIQNCDLPPPQKLHKSIHSSSGEK
FT                   GFKTAVKSPWKQGVWKDRFERSLSYNGSTESKNTSPMSSPRSDDLSKGQLLEALRHSQT
FT                   RAREAERAAREACAEKDRVITILLKQASQMLAYKQWLKLLEMEALYLQMKKEEEQEEQV
FT                   KGMNLKKRKQRGEKKKKGETGRYMMAFALGFSLIGAGLLLGWTVGWLLPF"
FT   CDS_pept        100683..101678
FT                   /codon_start=1
FT                   /gene_synonym="F633.5"
FT                   /gene_synonym="F633_5"
FT                   /gene_synonym="F6F3.27"
FT                   /locus_tag="AT1G01240"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT2G46550.1); Has 35333
FT                   Blast hits to 34131 proteins in 2444 species: Archae - 798;
FT                   Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531;
FT                   Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01240.1"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01240.2"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01240.3"
FT                   /db_xref="GOA:Q9LNJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LNJ7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH880564.1,INSD:EL264728.1,INSD:AV794822.1,
FT                   INSD:BP601327.1,INSD:EL127214.1,INSD:ES140766.1,
FT                   INSD:AV812156.1,INSD:BP667203.1,INSD:AV796456.1,
FT                   INSD:EL223302.1,INSD:EL328702.1,INSD:ES195005.1,
FT                   INSD:BX834584.1,INSD:EL036727.1,INSD:EL184195.1,
FT                   INSD:AV786287.1,INSD:EH945474.1,INSD:DR375288.1,
FT                   INSD:ES194812.1,INSD:EL999147.1,INSD:BX837698.1,
FT                   INSD:EL243431.1,INSD:EL249655.1,INSD:ES209182.1,
FT                   INSD:BP780979.1,INSD:EL193974.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY091196.1"
FT                   /protein_id="AEE27260.1"
FT                   /translation="MGAAEARALWQRTASRCFVVHEDAKMAPRLACCQHQQSSSGNTEK
FT                   NSFSSGSFGDSSDFSCDTKWWLKGSTGFDEEVTNSFLEDTKCKKLHEFVDLIGIREEED
FT                   YSFISKKADATTPWWRSTTDKDELALMVATKSVDHNIQNCDLPPPQKLHKSIHSSSGEK
FT                   GFKTAVKSPWKQGVWKDRFERSLSYNGSTESKNTSPMSSPRSDDLSKGQLLEALRHSQT
FT                   RAREAERAAREACAEKDRVITILLKQASQMLAYKQWLKLLEMEALYLQMKKEEEQEEQV
FT                   KGMNLKKRKQRGEKKKKGETGRYMMAFALGFSLIGAGLLLGWTVGWLLPF"
FT   gene            complement(104440..105330)
FT                   /gene_synonym="F6F3.6"
FT                   /gene_synonym="F6F3_6"
FT                   /locus_tag="AT1G01250"
FT                   /note="encodes a member of the DREB subfamily A-4 of
FT                   ERF/AP2 transcription factor family. The protein contains
FT                   one AP2 domain. There are 17 members in this subfamily
FT                   including TINY."
FT   mRNA            complement(104440..105330)
FT                   /gene_synonym="F6F3.6"
FT                   /gene_synonym="F6F3_6"
FT                   /locus_tag="AT1G01250"
FT                   /product="Integrase-type DNA-binding superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CF773675.1,INSD:DR324378.1,INSD:DR324369.1,
FT                   INSD:DR324373.1,INSD:EL013196.1,INSD:DR324368.1,
FT                   INSD:DR324377.1,INSD:DR324372.1,INSD:DN604750.1,
FT                   INSD:DR373964.1,INSD:DR324366.1,INSD:DR324375.1,
FT                   INSD:DR324371.1,INSD:DR324374.1,INSD:EL262601.1,
FT                   INSD:DR324367.1,INSD:DR324370.1,INSD:DR324376.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT025752.1,INSD:BX818662.1,INSD:AY086507.1"
FT   CDS_pept        complement(104731..105309)
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.6"
FT                   /gene_synonym="F6F3_6"
FT                   /locus_tag="AT1G01250"
FT                   /product="Integrase-type DNA-binding superfamily protein"
FT                   /note="Integrase-type DNA-binding superfamily protein;
FT                   FUNCTIONS IN: DNA binding, sequence-specific DNA binding
FT                   transcription factor activity; INVOLVED IN: regulation of
FT                   transcription, DNA-dependent; LOCATED IN: nucleus,
FT                   chloroplast; EXPRESSED IN: 10 plant structures; EXPRESSED
FT                   DURING: 6 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   DNA-binding, integrase-type (InterPro:IPR016177),
FT                   Pathogenesis-related transcriptional factor/ERF,
FT                   DNA-binding (InterPro:IPR001471); BEST Arabidopsis thaliana
FT                   protein match is: Integrase-type DNA-binding superfamily
FT                   protein (TAIR:AT5G25810.1); Has 5404 Blast hits to 5361
FT                   proteins in 232 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 0; Fungi - 0; Plants - 5399; Viruses - 0; Other
FT                   Eukaryotes - 5 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01250"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01250.1"
FT                   /db_xref="GOA:Q1ECI2"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR036955"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1ECI2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CF773675.1,INSD:DR324378.1,INSD:DR324369.1,
FT                   INSD:DR324373.1,INSD:EL013196.1,INSD:DR324368.1,
FT                   INSD:DR324377.1,INSD:DR324372.1,INSD:DN604750.1,
FT                   INSD:DR373964.1,INSD:DR324366.1,INSD:DR324375.1,
FT                   INSD:DR324371.1,INSD:DR324374.1,INSD:EL262601.1,
FT                   INSD:DR324367.1,INSD:DR324370.1,INSD:DR324376.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT025752.1,INSD:BX818662.1,INSD:AY086507.1"
FT                   /protein_id="AEE27261.1"
FT                   /translation="MSPQRMKLSSPPVTNNEPTATASAVKSCGGGGKETSSSTTRHPVY
FT                   HGVRKRRWGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAFCLKGRKAQLNFPEEI
FT                   EDLPRPSTCTPRDIQVAAAKAANAVKIIKMGDDDVAGIDDGDDFWEGIELPELMMSGGG
FT                   WSPEPFVAGDDATWLVDGDLYQYQFMACL"
FT   gene            108946..111699
FT                   /gene_synonym="F6F3.7"
FT                   /gene_synonym="F6F3_7"
FT                   /gene_synonym="JAM2"
FT                   /gene_synonym="Jasmonate Associated MYC2 LIKE 2"
FT                   /locus_tag="AT1G01260"
FT   mRNA            join(108946..109330,109406..111699)
FT                   /gene_synonym="F6F3.7"
FT                   /gene_synonym="F6F3_7"
FT                   /gene_synonym="JAM2"
FT                   /gene_synonym="Jasmonate Associated MYC2 LIKE 2"
FT                   /locus_tag="AT1G01260"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH886131.1,INSD:DR363974.1,INSD:DR749621.1,
FT                   INSD:ES062135.1,INSD:EL104370.1,INSD:EH852265.1,
FT                   INSD:EL014574.1,INSD:EL226606.1,INSD:AV815114.1,
FT                   INSD:AV813750.1,INSD:DR749620.1,INSD:AV792188.1,
FT                   INSD:T20442.1,INSD:AV805486.1,INSD:EH960896.1,
FT                   INSD:BP624870.1,INSD:BP821186.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT004517.1,INSD:AF251698.1,INSD:AF488559.1"
FT   mRNA            108991..111699
FT                   /gene_synonym="F6F3.7"
FT                   /gene_synonym="F6F3_7"
FT                   /gene_synonym="JAM2"
FT                   /gene_synonym="Jasmonate Associated MYC2 LIKE 2"
FT                   /locus_tag="AT1G01260"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT   mRNA            join(109076..109330,109413..111535)
FT                   /gene_synonym="F6F3.7"
FT                   /gene_synonym="F6F3_7"
FT                   /gene_synonym="JAM2"
FT                   /gene_synonym="Jasmonate Associated MYC2 LIKE 2"
FT                   /locus_tag="AT1G01260"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH886131.1,INSD:DR749621.1,INSD:ES062135.1,
FT                   INSD:EL104370.1,INSD:EH852265.1,INSD:EL014574.1,
FT                   INSD:BP561469.1,INSD:EL226606.1,INSD:BP562496.2,
FT                   INSD:AV815114.1,INSD:AV813750.1,INSD:DR749620.1,
FT                   INSD:AV792188.1,INSD:T20442.1,INSD:AV805486.1,
FT                   INSD:EH960896.1,INSD:BP624870.1,INSD:BP821186.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT004517.1,INSD:AF251698.1,INSD:AY120752.1,
FT                   INSD:AF488559.1,INSD:BX814931.1,INSD:AY079012.1"
FT   CDS_pept        109595..111367
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.7"
FT                   /gene_synonym="F6F3_7"
FT                   /gene_synonym="JAM2"
FT                   /gene_synonym="Jasmonate Associated MYC2 LIKE 2"
FT                   /locus_tag="AT1G01260"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /note="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein; FUNCTIONS IN: DNA binding,
FT                   sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: regulation of transcription; LOCATED
FT                   IN: nucleus; EXPRESSED IN: 24 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Helix-loop-helix DNA-binding domain (InterPro:IPR001092),
FT                   Helix-loop-helix DNA-binding (InterPro:IPR011598); BEST
FT                   Arabidopsis thaliana protein match is: ABA-inducible
FT                   BHLH-type transcription factor (TAIR:AT2G46510.1); Has 3647
FT                   Blast hits to 3273 proteins in 223 species: Archae - 0;
FT                   Bacteria - 2; Metazoa - 174; Fungi - 93; Plants - 3336;
FT                   Viruses - 0; Other Eukaryotes - 42 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LNJ5"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR025610"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNJ5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH886131.1,INSD:DR749621.1,INSD:ES062135.1,
FT                   INSD:EL104370.1,INSD:EH852265.1,INSD:EL014574.1,
FT                   INSD:BP561469.1,INSD:EL226606.1,INSD:BP562496.2,
FT                   INSD:AV815114.1,INSD:AV813750.1,INSD:DR749620.1,
FT                   INSD:AV792188.1,INSD:T20442.1,INSD:AV805486.1,
FT                   INSD:EH960896.1,INSD:BP624870.1,INSD:BP821186.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT004517.1,INSD:AF251698.1,INSD:AY120752.1,
FT                   INSD:AF488559.1,INSD:BX814931.1,INSD:AY079012.1"
FT                   /protein_id="AEE27262.1"
FT                   /translation="MNIGRLVWNEDDKAIVASLLGKRALDYLLSNSVSNANLLMTLGSD
FT                   ENLQNKLSDLVERPNASNFSWNYAIFWQISRSKAGDLVLCWGDGYCREPKEGEKSEIVR
FT                   ILSMGREEETHQTMRKRVLQKLHDLFGGSEEENCALGLDRVTDTEMFLLSSMYFSFPRG
FT                   EGGPGKCFASAKPVWLSDVVNSGSDYCVRSFLAKSAGIQTVVLVPTDLGVVELGSTSCL
FT                   PESEDSILSIRSLFTSSLPPVRAVALPVTVAEKIDDNRTKIFGKDLHNSGFLQHHQHHQ
FT                   QQQQQPPQQQQHRQFREKLTVRKMDDRAPKRLDAYPNNGNRFMFSNPGTNNNTLLSPTW
FT                   VQPENYTRPINVKEVPSTDEFKFLPLQQSSQRLLPPAQMQIDFSAASSRASENNSDGEG
FT                   GGEWADAVGADESGNNRPRKRGRRPANGRAEALNHVEAERQRREKLNQRFYALRSVVPN
FT                   ISKMDKASLLGDAVSYINELHAKLKVMEAERERLGYSSNPPISLDSDINVQTSGEDVTV
FT                   RINCPLESHPASRIFHAFEESKVEVINSNLEVSQDTVLHTFVVKSEELTKEKLISALSR
FT                   EQTNSVQSRTSSGR"
FT   CDS_pept        109595..111367
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.7"
FT                   /gene_synonym="F6F3_7"
FT                   /gene_synonym="JAM2"
FT                   /gene_synonym="Jasmonate Associated MYC2 LIKE 2"
FT                   /locus_tag="AT1G01260"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /note="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein; FUNCTIONS IN: DNA binding,
FT                   sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: regulation of transcription; LOCATED
FT                   IN: nucleus; EXPRESSED IN: 24 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Helix-loop-helix DNA-binding domain (InterPro:IPR001092),
FT                   Helix-loop-helix DNA-binding (InterPro:IPR011598); BEST
FT                   Arabidopsis thaliana protein match is: ABA-inducible
FT                   BHLH-type transcription factor (TAIR:AT2G46510.1); Has 3647
FT                   Blast hits to 3273 proteins in 223 species: Archae - 0;
FT                   Bacteria - 2; Metazoa - 174; Fungi - 93; Plants - 3336;
FT                   Viruses - 0; Other Eukaryotes - 42 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01260"
FT                   /db_xref="GOA:Q9LNJ5"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR025610"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNJ5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH886131.1,INSD:DR363974.1,INSD:DR749621.1,
FT                   INSD:ES062135.1,INSD:EL104370.1,INSD:EH852265.1,
FT                   INSD:EL014574.1,INSD:EL226606.1,INSD:AV815114.1,
FT                   INSD:AV813750.1,INSD:DR749620.1,INSD:AV792188.1,
FT                   INSD:T20442.1,INSD:AV805486.1,INSD:EH960896.1,
FT                   INSD:BP624870.1,INSD:BP821186.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT004517.1,INSD:AF251698.1,INSD:AF488559.1"
FT                   /protein_id="AEE27263.1"
FT                   /translation="MNIGRLVWNEDDKAIVASLLGKRALDYLLSNSVSNANLLMTLGSD
FT                   ENLQNKLSDLVERPNASNFSWNYAIFWQISRSKAGDLVLCWGDGYCREPKEGEKSEIVR
FT                   ILSMGREEETHQTMRKRVLQKLHDLFGGSEEENCALGLDRVTDTEMFLLSSMYFSFPRG
FT                   EGGPGKCFASAKPVWLSDVVNSGSDYCVRSFLAKSAGIQTVVLVPTDLGVVELGSTSCL
FT                   PESEDSILSIRSLFTSSLPPVRAVALPVTVAEKIDDNRTKIFGKDLHNSGFLQHHQHHQ
FT                   QQQQQPPQQQQHRQFREKLTVRKMDDRAPKRLDAYPNNGNRFMFSNPGTNNNTLLSPTW
FT                   VQPENYTRPINVKEVPSTDEFKFLPLQQSSQRLLPPAQMQIDFSAASSRASENNSDGEG
FT                   GGEWADAVGADESGNNRPRKRGRRPANGRAEALNHVEAERQRREKLNQRFYALRSVVPN
FT                   ISKMDKASLLGDAVSYINELHAKLKVMEAERERLGYSSNPPISLDSDINVQTSGEDVTV
FT                   RINCPLESHPASRIFHAFEESKVEVINSNLEVSQDTVLHTFVVKSEELTKEKLISALSR
FT                   EQTNSVQSRTSSGR"
FT   CDS_pept        109595..111367
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.7"
FT                   /gene_synonym="F6F3_7"
FT                   /gene_synonym="JAM2"
FT                   /gene_synonym="Jasmonate Associated MYC2 LIKE 2"
FT                   /locus_tag="AT1G01260"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /note="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein; FUNCTIONS IN: DNA binding,
FT                   sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: regulation of transcription; LOCATED
FT                   IN: nucleus; EXPRESSED IN: 24 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Helix-loop-helix DNA-binding domain (InterPro:IPR001092),
FT                   Helix-loop-helix DNA-binding (InterPro:IPR011598); BEST
FT                   Arabidopsis thaliana protein match is: ABA-inducible
FT                   BHLH-type transcription factor (TAIR:AT2G46510.1)."
FT                   /db_xref="GOA:Q9LNJ5"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR025610"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNJ5"
FT                   /protein_id="AEE27264.1"
FT                   /translation="MNIGRLVWNEDDKAIVASLLGKRALDYLLSNSVSNANLLMTLGSD
FT                   ENLQNKLSDLVERPNASNFSWNYAIFWQISRSKAGDLVLCWGDGYCREPKEGEKSEIVR
FT                   ILSMGREEETHQTMRKRVLQKLHDLFGGSEEENCALGLDRVTDTEMFLLSSMYFSFPRG
FT                   EGGPGKCFASAKPVWLSDVVNSGSDYCVRSFLAKSAGIQTVVLVPTDLGVVELGSTSCL
FT                   PESEDSILSIRSLFTSSLPPVRAVALPVTVAEKIDDNRTKIFGKDLHNSGFLQHHQHHQ
FT                   QQQQQPPQQQQHRQFREKLTVRKMDDRAPKRLDAYPNNGNRFMFSNPGTNNNTLLSPTW
FT                   VQPENYTRPINVKEVPSTDEFKFLPLQQSSQRLLPPAQMQIDFSAASSRASENNSDGEG
FT                   GGEWADAVGADESGNNRPRKRGRRPANGRAEALNHVEAERQRREKLNQRFYALRSVVPN
FT                   ISKMDKASLLGDAVSYINELHAKLKVMEAERERLGYSSNPPISLDSDINVQTSGEDVTV
FT                   RINCPLESHPASRIFHAFEESKVEVINSNLEVSQDTVLHTFVVKSEELTKEKLISALSR
FT                   EQTNSVQSRTSSGR"
FT   gene            complement(111890..111961)
FT                   /gene_synonym="51947.TRNA-GLN-1"
FT                   /locus_tag="AT1G01270"
FT   tRNA            complement(111890..111961)
FT                   /gene_synonym="51947.TRNA-GLN-1"
FT                   /locus_tag="AT1G01270"
FT                   /product="tRNA-Gln"
FT                   /note="pre-tRNA-tRNA-Gln (anticodon: CTG)"
FT   gene            112263..113947
FT                   /gene="CYP703A2"
FT                   /gene_synonym="CYP703"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F6F3.8"
FT                   /gene_synonym="F6F3_8"
FT                   /gene_synonym="family 703"
FT                   /gene_synonym="polypeptide 2"
FT                   /gene_synonym="subfamily A"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="polypeptide 2''"
FT                   /locus_tag="AT1G01280"
FT                   /note="member of CYP703A CYP703A2 is expressed specifically
FT                   in anthers of land plants, catalyzing the in-chain
FT                   hydroxylation at the C-7 position of medium-chain saturated
FT                   fatty acids (lauric acid in-chain hydroxylase) which is
FT                   involved in pollen development (sporopollenin synthesis)."
FT   mRNA            join(112263..113195,113279..113947)
FT                   /gene="CYP703A2"
FT                   /gene_synonym="CYP703"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F6F3.8"
FT                   /gene_synonym="F6F3_8"
FT                   /gene_synonym="family 703"
FT                   /gene_synonym="polypeptide 2"
FT                   /gene_synonym="subfamily A"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="polypeptide 2''"
FT                   /locus_tag="AT1G01280"
FT                   /product="cytochrome P450, family 703, subfamily A,
FT                   polypeptide 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV532990.1,INSD:AV535036.1,INSD:AA720028.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT022023.1,INSD:BX814827.1"
FT   CDS_pept        join(112290..113195,113279..113905)
FT                   /codon_start=1
FT                   /gene="CYP703A2"
FT                   /gene_synonym="CYP703"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F6F3.8"
FT                   /gene_synonym="F6F3_8"
FT                   /gene_synonym="family 703"
FT                   /gene_synonym="polypeptide 2"
FT                   /gene_synonym="subfamily A"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="polypeptide 2''"
FT                   /locus_tag="AT1G01280"
FT                   /product="cytochrome P450, family 703, subfamily A,
FT                   polypeptide 2"
FT                   /note="''cytochrome P450, family 703, subfamily A,
FT                   polypeptide 2'' (CYP703A2); FUNCTIONS IN: oxidoreductase
FT                   activity, acting on paired donors, with incorporation or
FT                   reduction of molecular oxygen, NADH or NADPH as one donor,
FT                   and incorporation of one atom of oxygen, oxygen binding;
FT                   INVOLVED IN: medium-chain fatty acid metabolic process,
FT                   pollen wall assembly, medium-chain fatty acid biosynthetic
FT                   process, sporopollenin biosynthetic process, pollen exine
FT                   formation; LOCATED IN: endomembrane system; EXPRESSED IN: 6
FT                   plant structures; EXPRESSED DURING: petal differentiation
FT                   and expansion stage; CONTAINS InterPro DOMAIN/s: Cytochrome
FT                   P450 (InterPro:IPR001128), Cytochrome P450, conserved site
FT                   (InterPro:IPR017972), Cytochrome P450, E-class, group I
FT                   (InterPro:IPR002401); BEST Arabidopsis thaliana protein
FT                   match is: Cytochrome P450 superfamily protein
FT                   (TAIR:AT5G07990.1); Has 29652 Blast hits to 29399 proteins
FT                   in 1569 species: Archae - 44; Bacteria - 2451; Metazoa -
FT                   11172; Fungi - 6019; Plants - 9091; Viruses - 3; Other
FT                   Eukaryotes - 872 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01280.1"
FT                   /db_xref="GOA:Q9LNJ4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNJ4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV532990.1,INSD:AV535036.1,INSD:AA720028.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT022023.1,INSD:BX814827.1"
FT                   /protein_id="AEE27265.1"
FT                   /translation="MILVLASLFAVLILNVLLWRWLKASACKAQRLPPGPPRLPILGNL
FT                   LQLGPLPHRDLASLCDKYGPLVYLRLGNVDAITTNDPDTIREILLRQDDVFSSRPKTLA
FT                   AVHLAYGCGDVALAPMGPHWKRMRRICMEHLLTTKRLESFTTQRAEEARYLIRDVFKRS
FT                   ETGKPINLKEVLGAFSMNNVTRMLLGKQFFGPGSLVSPKEAQEFLHITHKLFWLLGVIY
FT                   LGDYLPFWRWVDPSGCEKEMRDVEKRVDEFHTKIIDEHRRAKLEDEDKNGDMDFVDVLL
FT                   SLPGENGKAHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEAIKQPRVMRKIQEELDNV
FT                   VGSNRMVDESDLVHLNYLRCVVRETFRMHPAGPFLIPHESVRATTINGYYIPAKTRVFI
FT                   NTHGLGRNTKIWDDVEDFRPERHWPVEGSGRVEISHGPDFKILPFSAGKRKCPGAPLGV
FT                   TMVLMALARLFHCFEWSSPGNIDTVEVYGMTMPKAKPLRAIAKPRLAAHLYT"
FT   gene            114202..116407
FT                   /gene="CNX3"
FT                   /gene_synonym="cofactor of nitrate reductase and xanthine
FT                   dehydrogenase 3"
FT                   /gene_synonym="F6F3.9"
FT                   /gene_synonym="F6F3_9"
FT                   /locus_tag="AT1G01290"
FT                   /note="COFACTOR OF NITRATE REDUCTASE AND XANTHINE
FT                   DEHYDROGENASE 3. Encodes a protein involved in molybdenum
FT                   cofactor biosynthesis. Homologous to E.coli MoaC.
FT                   Expression is low in all tissues examined, except in roots.
FT                   Appears to have targeting signals for chloroplast or
FT                   mitochondria"
FT   mRNA            join(114202..114433,114619..116407)
FT                   /gene="CNX3"
FT                   /gene_synonym="cofactor of nitrate reductase and xanthine
FT                   dehydrogenase 3"
FT                   /gene_synonym="F6F3.9"
FT                   /gene_synonym="F6F3_9"
FT                   /locus_tag="AT1G01290"
FT                   /product="cofactor of nitrate reductase and xanthine
FT                   dehydrogenase 3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX834303.1,INSD:EL294839.1,INSD:ES150329.1,
FT                   INSD:ES116970.1,INSD:EL325829.1,INSD:ES166792.1,
FT                   INSD:ES091105.1,INSD:EG481028.1,INSD:ES035017.1,
FT                   INSD:BX837205.1,INSD:BP670762.1,INSD:EL154211.1,
FT                   INSD:EL029607.1,INSD:ES131775.1,INSD:ES158437.1,
FT                   INSD:ES175954.1,INSD:EL214091.1,INSD:ES105459.1,
FT                   INSD:ES079836.1,INSD:EL999867.1,INSD:ES183855.1,
FT                   INSD:ES158886.1,INSD:EH801972.1,INSD:EL160535.1,
FT                   INSD:EL036177.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT025641.1"
FT   mRNA            join(114202..114433,114619..115339,115961..116407)
FT                   /gene="CNX3"
FT                   /gene_synonym="cofactor of nitrate reductase and xanthine
FT                   dehydrogenase 3"
FT                   /gene_synonym="F6F3.9"
FT                   /gene_synonym="F6F3_9"
FT                   /locus_tag="AT1G01290"
FT                   /product="cofactor of nitrate reductase and xanthine
FT                   dehydrogenase 3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL294839.1,INSD:ES150329.1,INSD:ES116970.1,
FT                   INSD:EL325829.1,INSD:EL075788.1,INSD:EL292211.1,
FT                   INSD:ES166792.1,INSD:ES091105.1,INSD:EG481028.1,
FT                   INSD:ES035017.1,INSD:BX837205.1,INSD:EL154211.1,
FT                   INSD:ES131775.1,INSD:ES158437.1,INSD:ES175954.1,
FT                   INSD:EL214091.1,INSD:ES105459.1,INSD:ES079836.1,
FT                   INSD:ES183855.1,INSD:EH801972.1,INSD:ES158886.1,
FT                   INSD:EL160535.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX817403.1,INSD:BX818416.1,INSD:Z48046.1,
FT                   INSD:BT025641.1"
FT   CDS_pept        join(114299..114433,114619..115296)
FT                   /codon_start=1
FT                   /gene="CNX3"
FT                   /gene_synonym="cofactor of nitrate reductase and xanthine
FT                   dehydrogenase 3"
FT                   /gene_synonym="F6F3.9"
FT                   /gene_synonym="F6F3_9"
FT                   /locus_tag="AT1G01290"
FT                   /product="cofactor of nitrate reductase and xanthine
FT                   dehydrogenase 3"
FT                   /note="cofactor of nitrate reductase and xanthine
FT                   dehydrogenase 3 (CNX3); CONTAINS InterPro DOMAIN/s:
FT                   Molybdopterin cofactor biosynthesis C (MoaC) domain
FT                   (InterPro:IPR002820); Has 5242 Blast hits to 5240 proteins
FT                   in 1916 species: Archae - 213; Bacteria - 3669; Metazoa -
FT                   104; Fungi - 75; Plants - 45; Viruses - 0; Other Eukaryotes
FT                   - 1136 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01290"
FT                   /db_xref="GOA:Q39056"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39056"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL294839.1,INSD:ES150329.1,INSD:ES116970.1,
FT                   INSD:EL325829.1,INSD:EL075788.1,INSD:EL292211.1,
FT                   INSD:ES166792.1,INSD:ES091105.1,INSD:EG481028.1,
FT                   INSD:ES035017.1,INSD:BX837205.1,INSD:EL154211.1,
FT                   INSD:ES131775.1,INSD:ES158437.1,INSD:ES175954.1,
FT                   INSD:EL214091.1,INSD:ES105459.1,INSD:ES079836.1,
FT                   INSD:ES183855.1,INSD:EH801972.1,INSD:ES158886.1,
FT                   INSD:EL160535.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX817403.1,INSD:BX818416.1,INSD:Z48046.1,
FT                   INSD:BT025641.1"
FT                   /protein_id="AEE27266.1"
FT                   /translation="MISTLRRAVFLRRFPAVVSPIKRAFSSRIDDEFDPQIMNINELNQ
FT                   EMQSIFGQEPSPDGPGTMDFSELKSSKIEPLRSKNIDFRQQIEYHKSTHSSKNDSQAIE
FT                   QYAKVASDMSKLTHVGIAGEAQMVDVSSKDNSKRTALACCKVILGKRVFDLVLANQMGK
FT                   GDVLGVAKIAGINGAKQTSSLIPLCHNIALTHVRVDLRLNPEDFSVDIEGEASCTGKTG
FT                   VEMEAMTAVSVAGLTVYDMCKAASKDISITDVRLERKTGGKSGSWSRL"
FT   CDS_pept        join(114299..114433,114619..115296)
FT                   /codon_start=1
FT                   /gene="CNX3"
FT                   /gene_synonym="cofactor of nitrate reductase and xanthine
FT                   dehydrogenase 3"
FT                   /gene_synonym="F6F3.9"
FT                   /gene_synonym="F6F3_9"
FT                   /locus_tag="AT1G01290"
FT                   /product="cofactor of nitrate reductase and xanthine
FT                   dehydrogenase 3"
FT                   /note="cofactor of nitrate reductase and xanthine
FT                   dehydrogenase 3 (CNX3); CONTAINS InterPro DOMAIN/s:
FT                   Molybdopterin cofactor biosynthesis C (MoaC) domain
FT                   (InterPro:IPR002820); Has 5242 Blast hits to 5240 proteins
FT                   in 1916 species: Archae - 213; Bacteria - 3669; Metazoa -
FT                   104; Fungi - 75; Plants - 45; Viruses - 0; Other Eukaryotes
FT                   - 1136 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q39056"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39056"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX834303.1,INSD:EL294839.1,INSD:ES150329.1,
FT                   INSD:ES116970.1,INSD:EL325829.1,INSD:ES166792.1,
FT                   INSD:ES091105.1,INSD:EG481028.1,INSD:ES035017.1,
FT                   INSD:BX837205.1,INSD:BP670762.1,INSD:EL154211.1,
FT                   INSD:EL029607.1,INSD:ES131775.1,INSD:ES158437.1,
FT                   INSD:ES175954.1,INSD:EL214091.1,INSD:ES105459.1,
FT                   INSD:ES079836.1,INSD:EL999867.1,INSD:ES183855.1,
FT                   INSD:ES158886.1,INSD:EH801972.1,INSD:EL160535.1,
FT                   INSD:EL036177.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT025641.1"
FT                   /protein_id="AEE27267.1"
FT                   /translation="MISTLRRAVFLRRFPAVVSPIKRAFSSRIDDEFDPQIMNINELNQ
FT                   EMQSIFGQEPSPDGPGTMDFSELKSSKIEPLRSKNIDFRQQIEYHKSTHSSKNDSQAIE
FT                   QYAKVASDMSKLTHVGIAGEAQMVDVSSKDNSKRTALACCKVILGKRVFDLVLANQMGK
FT                   GDVLGVAKIAGINGAKQTSSLIPLCHNIALTHVRVDLRLNPEDFSVDIEGEASCTGKTG
FT                   VEMEAMTAVSVAGLTVYDMCKAASKDISITDVRLERKTGGKSGSWSRL"
FT   gene            116784..118845
FT                   /gene_synonym="F6F3.10"
FT                   /gene_synonym="F6F3_10"
FT                   /locus_tag="AT1G01300"
FT   mRNA            116784..118845
FT                   /gene_synonym="F6F3.10"
FT                   /gene_synonym="F6F3_10"
FT                   /locus_tag="AT1G01300"
FT                   /product="Eukaryotic aspartyl protease family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR363968.1,INSD:DR335053.1,INSD:EL074360.1,
FT                   INSD:BP824663.1,INSD:BP572074.1,INSD:AV531697.1,
FT                   INSD:AV549699.1,INSD:DR371229.1,INSD:DR335037.1,
FT                   INSD:BE521556.1,INSD:ES118177.1,INSD:DR335063.1,
FT                   INSD:EL992348.1,INSD:DR335067.1,INSD:BX834301.1,
FT                   INSD:ES202330.1,INSD:EL318690.1,INSD:AV442161.1,
FT                   INSD:BE529684.1,INSD:ES209002.1,INSD:Z29193.1,
FT                   INSD:ES168637.1,INSD:BP568436.1,INSD:DR335050.1,
FT                   INSD:DR335065.1,INSD:EL973750.1,INSD:AV830679.1,
FT                   INSD:AV526581.1,INSD:BP594265.1,INSD:BE525026.1,
FT                   INSD:BE528697.1,INSD:EG475676.1,INSD:DR335031.1,
FT                   INSD:ES026213.1,INSD:ES066423.1,INSD:ES113286.1,
FT                   INSD:BE521555.1,INSD:EH805791.1,INSD:AV782527.1,
FT                   INSD:DR335034.1,INSD:AA598131.1,INSD:DR335066.1,
FT                   INSD:EL229536.1,INSD:DR335046.1,INSD:DR335041.1,
FT                   INSD:DR335055.1,INSD:AI992760.1,INSD:EL998560.1,
FT                   INSD:BP820339.1,INSD:DR335049.1,INSD:H36272.1,
FT                   INSD:AA067558.1,INSD:DR335054.1,INSD:DR335047.1,
FT                   INSD:EH903209.1,INSD:AV542905.1,INSD:DR335058.1,
FT                   INSD:EG477197.1,INSD:BX839427.1,INSD:EL252009.1,
FT                   INSD:EH823297.1,INSD:DR335038.1,INSD:DR335035.1,
FT                   INSD:ES026311.1,INSD:BE528010.1,INSD:EH876184.1,
FT                   INSD:ES134450.1,INSD:EH900926.1,INSD:BP827317.1,
FT                   INSD:AV796814.1,INSD:EL198174.1,INSD:DR335045.1,
FT                   INSD:DR335030.1,INSD:EL154172.1,INSD:EH818601.1,
FT                   INSD:ES029915.1,INSD:ES000534.1,INSD:EL091724.1,
FT                   INSD:AV789991.1,INSD:DR335064.1,INSD:BE527443.1,
FT                   INSD:DR335060.1,INSD:DR335028.1,INSD:DR335036.1,
FT                   INSD:DR335029.1,INSD:ES050070.1,INSD:ES214020.1,
FT                   INSD:ES076222.1,INSD:DR335052.1,INSD:EG477199.1,
FT                   INSD:DR335059.1,INSD:EL302051.1,INSD:ES002092.1,
FT                   INSD:BP651409.1,INSD:DR335051.1,INSD:DR335032.1,
FT                   INSD:ES096015.1,INSD:AI239382.1,INSD:DR335044.1,
FT                   INSD:BE525740.1,INSD:AV542356.1,INSD:EH904914.1,
FT                   INSD:BP822846.1,INSD:EH950824.1,INSD:CK120181.1,
FT                   INSD:EL083935.1,INSD:DR355084.1,INSD:DR335048.1,
FT                   INSD:AV548735.1,INSD:EL337029.1,INSD:DR335056.1,
FT                   INSD:BP620824.1,INSD:ES145297.1,INSD:DR335062.1,
FT                   INSD:AV797383.1,INSD:EH795368.1,INSD:EL248212.1,
FT                   INSD:BX834744.1,INSD:EL141620.1,INSD:BP669449.1,
FT                   INSD:ES153059.1,INSD:DR335061.1,INSD:EG475673.1,
FT                   INSD:DR335042.1,INSD:BP599683.1,INSD:BE520517.1,
FT                   INSD:AV441300.1,INSD:DR335040.1,INSD:BP835652.1,
FT                   INSD:DR335039.1,INSD:BP837478.1,INSD:EH969621.1,
FT                   INSD:ES062919.1,INSD:BP607166.1,INSD:ES163143.1,
FT                   INSD:EL031683.1,INSD:DR335043.1,INSD:ES188818.1,
FT                   INSD:EL981909.1,INSD:DR335057.1,INSD:BP586862.1,
FT                   INSD:DR335033.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX816933.1,INSD:BX815554.1,INSD:BX813801.1,
FT                   INSD:AY088528.1,INSD:BT006619.1,INSD:BX818063.1,
FT                   INSD:BX818267.1,INSD:AK230044.1,INSD:BX815326.1,
FT                   INSD:AY128344.1,INSD:BX815795.1"
FT   CDS_pept        117065..118522
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.10"
FT                   /gene_synonym="F6F3_10"
FT                   /locus_tag="AT1G01300"
FT                   /product="Eukaryotic aspartyl protease family protein"
FT                   /note="Eukaryotic aspartyl protease family protein;
FT                   FUNCTIONS IN: aspartic-type endopeptidase activity;
FT                   INVOLVED IN: proteolysis, response to karrikin; LOCATED IN:
FT                   membrane, plant-type cell wall; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Peptidase aspartic (InterPro:IPR021109),
FT                   Peptidase aspartic, catalytic (InterPro:IPR009007),
FT                   Peptidase A1 (InterPro:IPR001461); BEST Arabidopsis
FT                   thaliana protein match is: Eukaryotic aspartyl protease
FT                   family protein (TAIR:AT3G61820.1); Has 3898 Blast hits to
FT                   3871 proteins in 332 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 1165; Fungi - 579; Plants - 1953; Viruses - 0;
FT                   Other Eukaryotes - 201 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01300"
FT                   /db_xref="GOA:Q9LNJ3"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR032799"
FT                   /db_xref="InterPro:IPR032861"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNJ3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR363968.1,INSD:DR335053.1,INSD:EL074360.1,
FT                   INSD:BP824663.1,INSD:BP572074.1,INSD:AV531697.1,
FT                   INSD:AV549699.1,INSD:DR371229.1,INSD:DR335037.1,
FT                   INSD:BE521556.1,INSD:ES118177.1,INSD:DR335063.1,
FT                   INSD:EL992348.1,INSD:DR335067.1,INSD:BX834301.1,
FT                   INSD:ES202330.1,INSD:EL318690.1,INSD:AV442161.1,
FT                   INSD:BE529684.1,INSD:ES209002.1,INSD:Z29193.1,
FT                   INSD:ES168637.1,INSD:BP568436.1,INSD:DR335050.1,
FT                   INSD:DR335065.1,INSD:EL973750.1,INSD:AV830679.1,
FT                   INSD:AV526581.1,INSD:BP594265.1,INSD:BE525026.1,
FT                   INSD:BE528697.1,INSD:EG475676.1,INSD:DR335031.1,
FT                   INSD:ES026213.1,INSD:ES066423.1,INSD:ES113286.1,
FT                   INSD:BE521555.1,INSD:EH805791.1,INSD:AV782527.1,
FT                   INSD:DR335034.1,INSD:AA598131.1,INSD:DR335066.1,
FT                   INSD:EL229536.1,INSD:DR335046.1,INSD:DR335041.1,
FT                   INSD:DR335055.1,INSD:AI992760.1,INSD:EL998560.1,
FT                   INSD:BP820339.1,INSD:DR335049.1,INSD:H36272.1,
FT                   INSD:AA067558.1,INSD:DR335054.1,INSD:DR335047.1,
FT                   INSD:EH903209.1,INSD:AV542905.1,INSD:DR335058.1,
FT                   INSD:EG477197.1,INSD:BX839427.1,INSD:EL252009.1,
FT                   INSD:EH823297.1,INSD:DR335038.1,INSD:DR335035.1,
FT                   INSD:ES026311.1,INSD:BE528010.1,INSD:EH876184.1,
FT                   INSD:ES134450.1,INSD:EH900926.1,INSD:BP827317.1,
FT                   INSD:AV796814.1,INSD:EL198174.1,INSD:DR335045.1,
FT                   INSD:DR335030.1,INSD:EL154172.1,INSD:EH818601.1,
FT                   INSD:ES029915.1,INSD:ES000534.1,INSD:EL091724.1,
FT                   INSD:AV789991.1,INSD:DR335064.1,INSD:BE527443.1,
FT                   INSD:DR335060.1,INSD:DR335028.1,INSD:DR335036.1,
FT                   INSD:DR335029.1,INSD:ES050070.1,INSD:ES214020.1,
FT                   INSD:ES076222.1,INSD:DR335052.1,INSD:EG477199.1,
FT                   INSD:DR335059.1,INSD:EL302051.1,INSD:ES002092.1,
FT                   INSD:BP651409.1,INSD:DR335051.1,INSD:DR335032.1,
FT                   INSD:ES096015.1,INSD:AI239382.1,INSD:DR335044.1,
FT                   INSD:BE525740.1,INSD:AV542356.1,INSD:EH904914.1,
FT                   INSD:BP822846.1,INSD:EH950824.1,INSD:CK120181.1,
FT                   INSD:EL083935.1,INSD:DR355084.1,INSD:DR335048.1,
FT                   INSD:AV548735.1,INSD:EL337029.1,INSD:DR335056.1,
FT                   INSD:BP620824.1,INSD:ES145297.1,INSD:DR335062.1,
FT                   INSD:AV797383.1,INSD:EH795368.1,INSD:EL248212.1,
FT                   INSD:BX834744.1,INSD:EL141620.1,INSD:BP669449.1,
FT                   INSD:ES153059.1,INSD:DR335061.1,INSD:EG475673.1,
FT                   INSD:DR335042.1,INSD:BP599683.1,INSD:BE520517.1,
FT                   INSD:AV441300.1,INSD:DR335040.1,INSD:BP835652.1,
FT                   INSD:DR335039.1,INSD:BP837478.1,INSD:EH969621.1,
FT                   INSD:ES062919.1,INSD:BP607166.1,INSD:ES163143.1,
FT                   INSD:EL031683.1,INSD:DR335043.1,INSD:ES188818.1,
FT                   INSD:EL981909.1,INSD:DR335057.1,INSD:BP586862.1,
FT                   INSD:DR335033.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX816933.1,INSD:BX815554.1,INSD:BX813801.1,
FT                   INSD:AY088528.1,INSD:BT006619.1,INSD:BX818063.1,
FT                   INSD:BX818267.1,INSD:AK230044.1,INSD:BX815326.1,
FT                   INSD:AY128344.1,INSD:BX815795.1"
FT                   /protein_id="AEE27268.1"
FT                   /translation="MVGRRKALLFSLCFFFLSLPSFSSLPSFQTLFPNSHSLPCASPVS
FT                   FQPDSDSESLLESEFESGSDSESSSSITLNLDHIDALSSNKTPDELFSSRLQRDSRRVK
FT                   SIATLAAQIPGRNVTHAPRPGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGS
FT                   DIVWLQCAPCRRCYSQSDPIFDPRKSKTYATIPCSSPHCRRLDSAGCNTRRKTCLYQVS
FT                   YGDGSFTVGDFSTETLTFRRNRVKGVALGCGHDNEGLFVGAAGLLGLGKGKLSFPGQTG
FT                   HRFNQKFSYCLVDRSASSKPSSVVFGNAAVSRIARFTPLLSNPKLDTFYYVGLLGISVG
FT                   GTRVPGVTASLFKLDQIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGAKTLKRAPDFS
FT                   LFDTCFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGTMGGLSII
FT                   GNIQQQGFRVVYDLASSRVGFAPGGCA"
FT   gene            119381..119997
FT                   /locus_tag="AT1G01305"
FT   mRNA            119381..119997
FT                   /locus_tag="AT1G01305"
FT                   /product="hypothetical protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG509783.1,INSD:ES207303.1,INSD:ES193472.1,
FT                   INSD:EL985987.1,INSD:ES097266.1,INSD:ES064108.1,
FT                   INSD:EL968921.1,INSD:ES146194.1,INSD:ES044406.1,
FT                   INSD:EG509773.1,INSD:EG509780.1,INSD:EL985291.1,
FT                   INSD:EL988191.1,INSD:ES154049.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:EF183180.1"
FT   CDS_pept        119429..119854
FT                   /codon_start=1
FT                   /locus_tag="AT1G01305"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: endomembrane system; Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01305.1"
FT                   /db_xref="GOA:Q1G401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1G401"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG509783.1,INSD:ES207303.1,INSD:ES193472.1,
FT                   INSD:EL985987.1,INSD:ES097266.1,INSD:ES064108.1,
FT                   INSD:EL968921.1,INSD:ES146194.1,INSD:ES044406.1,
FT                   INSD:EG509773.1,INSD:EG509780.1,INSD:EL985291.1,
FT                   INSD:EL988191.1,INSD:ES154049.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:EF183180.1"
FT                   /protein_id="AEE27269.1"
FT                   /translation="MGKPRSVSPTIFLLVILLVTAGEKTEAKPWWKKVGDSIGNIAGGI
FT                   RNAVGNYKPVEMGLSLKGGFCVRKLLSLNTNVFSEWCIALNDPRAPMYMKIENIPSGVS
FT                   IESILKKPIDLIKNHYPNFLKVWNFNQKIKRKPRRAL"
FT   gene            120154..121130
FT                   /gene_synonym="F6F3.11"
FT                   /gene_synonym="F6F3_11"
FT                   /locus_tag="AT1G01310"
FT   mRNA            120154..121130
FT                   /gene_synonym="F6F3.11"
FT                   /gene_synonym="F6F3_11"
FT                   /locus_tag="AT1G01310"
FT                   /product="CAP (Cysteine-rich secretory proteins, Antigen 5,
FT                   and Pathogenesis-related 1 protein) superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AA650904.1,INSD:EL292563.1,INSD:BP839299.1,
FT                   INSD:EH936107.1,INSD:BP835423.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX814530.1,INSD:BT014786.1,INSD:BT015693.1"
FT   CDS_pept        120221..120946
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.11"
FT                   /gene_synonym="F6F3_11"
FT                   /locus_tag="AT1G01310"
FT                   /product="CAP (Cysteine-rich secretory proteins, Antigen 5,
FT                   and Pathogenesis-related 1 protein) superfamily protein"
FT                   /note="CAP (Cysteine-rich secretory proteins, Antigen 5,
FT                   and Pathogenesis-related 1 protein) superfamily protein;
FT                   FUNCTIONS IN: molecular_function unknown; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: extracellular
FT                   region; EXPRESSED IN: 6 plant structures; EXPRESSED DURING:
FT                   L mature pollen stage, M germinated pollen stage, 4
FT                   anthesis, petal differentiation and expansion stage;
FT                   CONTAINS InterPro DOMAIN/s: Allergen V5/Tpx-1 related,
FT                   conserved site (InterPro:IPR018244), Allergen V5/Tpx-1
FT                   related (InterPro:IPR001283), Ves allergen
FT                   (InterPro:IPR002413), SCP-like extracellular
FT                   (InterPro:IPR014044); BEST Arabidopsis thaliana protein
FT                   match is: CAP (Cysteine-rich secretory proteins, Antigen 5,
FT                   and Pathogenesis-related 1 protein) superfamily protein
FT                   (TAIR:AT3G09590.1); Has 2987 Blast hits to 2892 proteins in
FT                   368 species: Archae - 0; Bacteria - 64; Metazoa - 1591;
FT                   Fungi - 333; Plants - 892; Viruses - 0; Other Eukaryotes -
FT                   107 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01310"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01310.1"
FT                   /db_xref="GOA:Q6ID87"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR002413"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="InterPro:IPR034111"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ID87"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AA650904.1,INSD:EL292563.1,INSD:BP839299.1,
FT                   INSD:EH936107.1,INSD:BP835423.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX814530.1,INSD:BT014786.1,INSD:BT015693.1"
FT                   /protein_id="AEE27270.1"
FT                   /translation="MELRKRKIRAPLHIFVGITFFLLQLWSGTAQINHEDSSTKPSVKN
FT                   SPSATSTRLLLSPPSFTGNRFSFRFRWRRIRRRNRVNRASREFLIAHNLVRARVGEPPF
FT                   QWDGRLAAYARTWANQRVGDCRLVHSNGPYGENIFWAGKNNWSPRDIVNVWADEDKFYD
FT                   VKGNTCEPQHMCGHYTQIVWRDSTKVGCASVDCSNGGVYAICVYNPPGNYEGENPFGSY
FT                   DDQIGLARDDPPAVIGGMA"
FT   gene            complement(121067..130577)
FT                   /gene_synonym="F6F3.12"
FT                   /gene_synonym="F6F3_12"
FT                   /locus_tag="AT1G01320"
FT   mRNA            complement(join(121067..121406,121493..123495,
FT                   123579..123669,123785..123897,123992..124123,
FT                   124211..124394,124499..124632,124714..124818,
FT                   124921..125022,125134..125226,125329..125655,
FT                   125742..125843,125936..125998,126076..126589,
FT                   126686..126840,126935..127453,127532..127573,
FT                   127651..127782,127868..127935,128028..128312,
FT                   128479..128551,128968..129060,129853..129914,
FT                   130039..130149,130372..130577))
FT                   /gene_synonym="F6F3.12"
FT                   /gene_synonym="F6F3_12"
FT                   /locus_tag="AT1G01320"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT   mRNA            complement(join(121067..121406,121493..123501,
FT                   123579..123669,123785..123897,123992..124123,
FT                   124211..124394,124499..124632,124714..124818,
FT                   124921..125022,125134..125226,125329..125655,
FT                   125742..125843,125936..125998,126076..126589,
FT                   126686..126840,126935..127453,127532..127573,
FT                   127651..127782,127868..127935,128028..128312,
FT                   128479..128551,128968..129060,129853..129914,
FT                   130039..130149,130372..130573))
FT                   /gene_synonym="F6F3.12"
FT                   /gene_synonym="F6F3_12"
FT                   /locus_tag="AT1G01320"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT   mRNA            complement(join(121124..121406,121493..123501,
FT                   123579..123669,123785..123897,123992..124123,
FT                   124211..124394,124499..124632,124714..124818,
FT                   124921..125046,125134..125226,125329..125655,
FT                   125742..125843,125936..125998,126076..126589,
FT                   126686..126840,126935..127453,127532..127573,
FT                   127651..127782,127868..127935,128028..128312,
FT                   128479..128551,128968..129060,129853..129914,
FT                   130039..130149,130372..130570))
FT                   /gene_synonym="F6F3.12"
FT                   /gene_synonym="F6F3_12"
FT                   /locus_tag="AT1G01320"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL151017.1,INSD:EH813969.1,INSD:EH882762.1,
FT                   INSD:AV523603.1,INSD:EH989499.1,INSD:EL052197.1,
FT                   INSD:BP839299.1,INSD:EL295504.1,INSD:AV522861.1,
FT                   INSD:AV523342.1,INSD:EL203825.1,INSD:BP835423.1,
FT                   INSD:EL274308.1,INSD:BP642899.1,INSD:EH955492.1,
FT                   INSD:AV831583.1,INSD:AV529314.1,INSD:EL283640.1,
FT                   INSD:EH936107.1,INSD:BP828358.1,INSD:AV816789.1,
FT                   INSD:EL282586.1,INSD:EH960077.1,INSD:EL054360.1,
FT                   INSD:AA650904.1,INSD:EL065833.1,INSD:EL150708.1,
FT                   INSD:EL249576.1,INSD:EL064264.1,INSD:EH874932.1,
FT                   INSD:EL287770.1,INSD:EL236743.1,INSD:EL156301.1,
FT                   INSD:ES028670.1,INSD:EH979570.1,INSD:EH932154.1,
FT                   INSD:EL292563.1,INSD:EL059722.1,INSD:EL022685.1,
FT                   INSD:EH856930.1,INSD:EL146295.1,INSD:EL261435.1,
FT                   INSD:EH830800.1,INSD:AV564051.1,INSD:AI999610.1,
FT                   INSD:EL172278.1,INSD:EL264965.1,INSD:EL192048.1,
FT                   INSD:AV523836.1,INSD:DR369067.1,INSD:EH797523.1,
FT                   INSD:EL220841.1,INSD:EH988479.1,INSD:EL054137.1,
FT                   INSD:EH804433.1,INSD:CB258338.1,INSD:ES047824.1,
FT                   INSD:AV529590.1,INSD:EH848879.1,INSD:EL107652.1,
FT                   INSD:EG516336.1,INSD:EL075495.1,INSD:EL135667.1,
FT                   INSD:EH914884.1,INSD:EH878352.1,INSD:EL203251.1,
FT                   INSD:BG459430.1,INSD:EL068573.1,INSD:CD532579.1,
FT                   INSD:EG439175.1,INSD:EL091725.1,INSD:CB260512.1,
FT                   INSD:AV529001.1,INSD:R30319.1,INSD:EL083980.1,
FT                   INSD:AV529355.1,INSD:EH805167.1,INSD:AV528397.1,
FT                   INSD:EL242796.1,INSD:EL330304.1,INSD:EL130916.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY080760.1,INSD:AK221066.1"
FT   CDS_pept        complement(join(121582..123495,123579..123669,
FT                   123785..123897,123992..124123,124211..124394,
FT                   124499..124632,124714..124818,124921..125022,
FT                   125134..125226,125329..125655,125742..125843,
FT                   125936..125998,126076..126589,126686..126840,
FT                   126935..127453,127532..127573,127651..127782,
FT                   127868..127935,128028..128312,128479..128551,
FT                   128968..129060,129853..129914,130039..130099))
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.12"
FT                   /gene_synonym="F6F3_12"
FT                   /locus_tag="AT1G01320"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /note="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein; FUNCTIONS IN: binding; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Tetratricopeptide-like helical
FT                   (InterPro:IPR011990), Tetratricopeptide repeat-containing
FT                   (InterPro:IPR013026), Tetratricopeptide repeat
FT                   (InterPro:IPR019734); BEST Arabidopsis thaliana protein
FT                   match is: Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein (TAIR:AT4G28080.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01320"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01320.2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025697"
FT                   /db_xref="InterPro:IPR028275"
FT                   /db_xref="InterPro:IPR033646"
FT                   /db_xref="UniProtKB/TrEMBL:F4HS98"
FT                   /protein_id="AEE27272.1"
FT                   /translation="MAPKNNRGKTKGDKKKKEEKVLPVIVDVIVNLPDETEAILKGIST
FT                   DRIIDVRRLLSVNFDTCHVTNYSLSHEIRGSRLKDTVDVSALKPCVLTLTEEDYNEGTA
FT                   VAHVRRLLDIVACTTCFGPSPEKSDSVKSAQVKGGGKNSKQSDTSPPPSPASKDTVVDE
FT                   AGETSHSFPKLGSFYEFFSLAHLTPPLQYIRLATKRETEDIAKEDHLLSIDVKLCNGKL
FT                   VHIEGCRKGFYSIGKQRIICHNLVDLLRQISRAFDNAYSDLLKAFSERNKFGNLPYGFR
FT                   ANTWLIPPTAAQSPAAFPPLPVEDERWGGDGGGQGRDGSYDLVPWSNEFAFIASMPCKT
FT                   AEERQVRDRKVFLLHNLFVDVATFRAIKAVQKVMAEPVLAEEDSEVLYSETVRDLTVTV
FT                   TRDTSNASSKVDTKIDGIQATGLDKKKLMERNLLKGLTADENTAAHDVATLGTISLKYC
FT                   GYIAVVKLEKESEELSPPSQIVDLLEQPEGGANALNINSLRFLLHKSSPEQNKKTPQQH
FT                   DDELTSSREFVSKMLEESIAKLEGEEIDRDSIMRWELGACWIQHLQDQKNTEKDKKQTG
FT                   EKSKNELKVEGLGKPLKSLNSSKKKTDVSSPKTPQTALSSQVDAVSSEADTAASLQSDA
FT                   EKNAQENVLILKNLLSDAAFTRLKESDTGLHHKSLQELVDLAQNYYTEVAIPKLVADFG
FT                   SLELSPVDGRTLTDFMHTRGLRMRSLGYVVKLSDKLSHVQSLCVHEMIVRALKHILQAV
FT                   ISAVATDTDKIAIKVAAALNMMLGIPENVAATPHNPWNVHPLIFRWLEKFLKKRYDYDL
FT                   NAFSYKDLRKFAILRGLCHKVGIELIPRDFDMDSPAPFRKTDVVSLVPVHKQAACSSAD
FT                   GRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDF
FT                   NQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLT
FT                   CGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAI
FT                   ALSLMEAYHLSVQHEQTTLRILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTP
FT                   KPDASIASKGHLSVSDLLDYINPSHNAKGKESVAAKRKNYILKEKSKQSNVSEHLVEIP
FT                   REKQKEMSEEDTEETGSEEGKSSEENHETILAPVEEPPSPPVIEDATMDNSNPITSSDV
FT                   STEPQHPDGSEDGWQPVQRPRSAGSYGRRMKQRRASIGKVYTYQKKNVEADIDNPLFQN
FT                   ATQQNDKYYILKKRTASYSSYADHHSPGLTTQGTKFGRKIVKTLAYRVKSTQPSSGNAK
FT                   TAGETSEEDGLKTDASSVEPPTLSSTVQSEAYHTKNSVVSLGKSPSYKEVALAPPGSIA
FT                   KYQVWVPQAEVSDKQEDDEMEKKTEQGTSMELTRDEQMITGLEEEVKKEISADPESNIT
FT                   QGEEEIKVELQPSEGVLGGSHINENDESGGGIQVEEQVEVELINDGVTDMIHSTREQQV
FT                   IDQLAADSEDLKAKLSISTTDSGDASRGLLPNKKLSASAAPFNPSSPPSIIRPTPIGMN
FT                   IGPSWPVNMTLHHGPPPPYPSPPTTPNLMQPMSFVYPPPYSQSVPTSTYPVTSGPFHPN
FT                   QFPWQLNVSDFVPRTVWPGCHPVEFPPPHMITEPIAATVLEPTVILPTDIDTSGVEETK
FT                   EGTQDVAVADEVMDSVNHVNNAVARSETENGNRKSEEGEKTFSILLRGRRNRKQTLRMP
FT                   ISLLNRPYDSQPFKLGYSRVIRDSEAPKSVA"
FT   CDS_pept        complement(join(121582..123501,123579..123669,
FT                   123785..123897,123992..124123,124211..124394,
FT                   124499..124632,124714..124818,124921..125022,
FT                   125134..125226,125329..125655,125742..125843,
FT                   125936..125998,126076..126589,126686..126840,
FT                   126935..127453,127532..127573,127651..127782,
FT                   127868..127935,128028..128312,128479..128551,
FT                   128968..129060,129853..129914,130039..130099))
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.12"
FT                   /gene_synonym="F6F3_12"
FT                   /locus_tag="AT1G01320"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01320"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025697"
FT                   /db_xref="InterPro:IPR028275"
FT                   /db_xref="InterPro:IPR033646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AR50"
FT                   /protein_id="ANM59104.1"
FT                   /translation="MAPKNNRGKTKGDKKKKEEKVLPVIVDVIVNLPDETEAILKGIST
FT                   DRIIDVRRLLSVNFDTCHVTNYSLSHEIRGSRLKDTVDVSALKPCVLTLTEEDYNEGTA
FT                   VAHVRRLLDIVACTTCFGPSPEKSDSVKSAQVKGGGKNSKQSDTSPPPSPASKDTVVDE
FT                   AGETSHSFPKLGSFYEFFSLAHLTPPLQYIRLATKRETEDIAKEDHLLSIDVKLCNGKL
FT                   VHIEGCRKGFYSIGKQRIICHNLVDLLRQISRAFDNAYSDLLKAFSERNKFGNLPYGFR
FT                   ANTWLIPPTAAQSPAAFPPLPVEDERWGGDGGGQGRDGSYDLVPWSNEFAFIASMPCKT
FT                   AEERQVRDRKVFLLHNLFVDVATFRAIKAVQKVMAEPVLAEEDSEVLYSETVRDLTVTV
FT                   TRDTSNASSKVDTKIDGIQATGLDKKKLMERNLLKGLTADENTAAHDVATLGTISLKYC
FT                   GYIAVVKLEKESEELSPPSQIVDLLEQPEGGANALNINSLRFLLHKSSPEQNKKTPQQH
FT                   DDELTSSREFVSKMLEESIAKLEGEEIDRDSIMRWELGACWIQHLQDQKNTEKDKKQTG
FT                   EKSKNELKVEGLGKPLKSLNSSKKKTDVSSPKTPQTALSSQVDAVSSEADTAASLQSDA
FT                   EKNAQENVLILKNLLSDAAFTRLKESDTGLHHKSLQELVDLAQNYYTEVAIPKLVADFG
FT                   SLELSPVDGRTLTDFMHTRGLRMRSLGYVVKLSDKLSHVQSLCVHEMIVRALKHILQAV
FT                   ISAVATDTDKIAIKVAAALNMMLGIPENVAATPHNPWNVHPLIFRWLEKFLKKRYDYDL
FT                   NAFSYKDLRKFAILRGLCHKVGIELIPRDFDMDSPAPFRKTDVVSLVPVHKQAACSSAD
FT                   GRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDF
FT                   NQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLT
FT                   CGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAI
FT                   ALSLMEAYHLSVQHEQTTLRILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTP
FT                   KPDASIASKGHLSVSDLLDYINPSHNAKGKESVAAKRKNYILKLKEKSKQSNVSEHLVE
FT                   IPREKQKEMSEEDTEETGSEEGKSSEENHETILAPVEEPPSPPVIEDATMDNSNPITSS
FT                   DVSTEPQHPDGSEDGWQPVQRPRSAGSYGRRMKQRRASIGKVYTYQKKNVEADIDNPLF
FT                   QNATQQNDKYYILKKRTASYSSYADHHSPGLTTQGTKFGRKIVKTLAYRVKSTQPSSGN
FT                   AKTAGETSEEDGLKTDASSVEPPTLSSTVQSEAYHTKNSVVSLGKSPSYKEVALAPPGS
FT                   IAKYQVWVPQAEVSDKQEDDEMEKKTEQGTSMELTRDEQMITGLEEEVKKEISADPESN
FT                   ITQGEEEIKVELQPSEGVLGGSHINENDESGGGIQVEEQVEVELINDGVTDMIHSTREQ
FT                   QVIDQLAADSEDLKAKLSISTTDSGDASRGLLPNKKLSASAAPFNPSSPPSIIRPTPIG
FT                   MNIGPSWPVNMTLHHGPPPPYPSPPTTPNLMQPMSFVYPPPYSQSVPTSTYPVTSGPFH
FT                   PNQFPWQLNVSDFVPRTVWPGCHPVEFPPPHMITEPIAATVLEPTVILPTDIDTSGVEE
FT                   TKEGTQDVAVADEVMDSVNHVNNAVARSETENGNRKSEEGEKTFSILLRGRRNRKQTLR
FT                   MPISLLNRPYDSQPFKLGYSRVIRDSEAPKSVA"
FT   CDS_pept        complement(join(121582..123501,123579..123669,
FT                   123785..123897,123992..124123,124211..124394,
FT                   124499..124632,124714..124818,124921..125046,
FT                   125134..125226,125329..125655,125742..125843,
FT                   125936..125998,126076..126589,126686..126840,
FT                   126935..127453,127532..127573,127651..127782,
FT                   127868..127935,128028..128312,128479..128551,
FT                   128968..129060,129853..129914,130039..130099))
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.12"
FT                   /gene_synonym="F6F3_12"
FT                   /locus_tag="AT1G01320"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /note="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein; FUNCTIONS IN: binding; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Tetratricopeptide-like helical
FT                   (InterPro:IPR011990), Tetratricopeptide repeat-containing
FT                   (InterPro:IPR013026), Tetratricopeptide repeat
FT                   (InterPro:IPR019734); BEST Arabidopsis thaliana protein
FT                   match is: Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein (TAIR:AT4G28080.1); Has 12123 Blast hits to 4846
FT                   proteins in 494 species: Archae - 106; Bacteria - 3214;
FT                   Metazoa - 4973; Fungi - 1823; Plants - 555; Viruses - 79;
FT                   Other Eukaryotes - 1373 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01320"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01320.1"
FT                   /db_xref="GOA:F4HS99"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025697"
FT                   /db_xref="InterPro:IPR028275"
FT                   /db_xref="InterPro:IPR033646"
FT                   /db_xref="UniProtKB/TrEMBL:F4HS99"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL151017.1,INSD:EH813969.1,INSD:EH882762.1,
FT                   INSD:AV523603.1,INSD:EH989499.1,INSD:EL052197.1,
FT                   INSD:BP839299.1,INSD:EL295504.1,INSD:AV522861.1,
FT                   INSD:AV523342.1,INSD:EL203825.1,INSD:BP835423.1,
FT                   INSD:EL274308.1,INSD:BP642899.1,INSD:EH955492.1,
FT                   INSD:AV831583.1,INSD:AV529314.1,INSD:EL283640.1,
FT                   INSD:EH936107.1,INSD:BP828358.1,INSD:AV816789.1,
FT                   INSD:EL282586.1,INSD:EH960077.1,INSD:EL054360.1,
FT                   INSD:AA650904.1,INSD:EL065833.1,INSD:EL150708.1,
FT                   INSD:EL249576.1,INSD:EL064264.1,INSD:EH874932.1,
FT                   INSD:EL287770.1,INSD:EL236743.1,INSD:EL156301.1,
FT                   INSD:ES028670.1,INSD:EH979570.1,INSD:EH932154.1,
FT                   INSD:EL292563.1,INSD:EL059722.1,INSD:EL022685.1,
FT                   INSD:EH856930.1,INSD:EL146295.1,INSD:EL261435.1,
FT                   INSD:EH830800.1,INSD:AV564051.1,INSD:AI999610.1,
FT                   INSD:EL172278.1,INSD:EL264965.1,INSD:EL192048.1,
FT                   INSD:AV523836.1,INSD:DR369067.1,INSD:EH797523.1,
FT                   INSD:EL220841.1,INSD:EH988479.1,INSD:EL054137.1,
FT                   INSD:EH804433.1,INSD:CB258338.1,INSD:ES047824.1,
FT                   INSD:AV529590.1,INSD:EH848879.1,INSD:EL107652.1,
FT                   INSD:EG516336.1,INSD:EL075495.1,INSD:EL135667.1,
FT                   INSD:EH914884.1,INSD:EH878352.1,INSD:EL203251.1,
FT                   INSD:BG459430.1,INSD:EL068573.1,INSD:CD532579.1,
FT                   INSD:EG439175.1,INSD:EL091725.1,INSD:CB260512.1,
FT                   INSD:AV529001.1,INSD:R30319.1,INSD:EL083980.1,
FT                   INSD:AV529355.1,INSD:EH805167.1,INSD:AV528397.1,
FT                   INSD:EL242796.1,INSD:EL330304.1,INSD:EL130916.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY080760.1,INSD:AK221066.1"
FT                   /protein_id="AEE27271.1"
FT                   /translation="MAPKNNRGKTKGDKKKKEEKVLPVIVDVIVNLPDETEAILKGIST
FT                   DRIIDVRRLLSVNFDTCHVTNYSLSHEIRGSRLKDTVDVSALKPCVLTLTEEDYNEGTA
FT                   VAHVRRLLDIVACTTCFGPSPEKSDSVKSAQVKGGGKNSKQSDTSPPPSPASKDTVVDE
FT                   AGETSHSFPKLGSFYEFFSLAHLTPPLQYIRLATKRETEDIAKEDHLLSIDVKLCNGKL
FT                   VHIEGCRKGFYSIGKQRIICHNLVDLLRQISRAFDNAYSDLLKAFSERNKFGNLPYGFR
FT                   ANTWLIPPTAAQSPAAFPPLPVEDERWGGDGGGQGRDGSYDLVPWSNEFAFIASMPCKT
FT                   AEERQVRDRKVFLLHNLFVDVATFRAIKAVQKVMAEPVLAEEDSEVLYSETVRDLTVTV
FT                   TRDTSNASSKVDTKIDGIQATGLDKKKLMERNLLKGLTADENTAAHDVATLGTISLKYC
FT                   GYIAVVKLEKESEELSPPSQIVDLLEQPEGGANALNINSLRFLLHKSSPEQNKKTPQQH
FT                   DDELTSSREFVSKMLEESIAKLEGEEIDRDSIMRWELGACWIQHLQDQKNTEKDKKQTG
FT                   EKSKNELKVEGLGKPLKSLNSSKKKTDVSSPKTPQTALSSQVDAVSSEADTAASLQSDA
FT                   EKNAQENVLILKNLLSDAAFTRLKESDTGLHHKSLQELVDLAQNYYTEVAIPKLVADFG
FT                   SLELSPVDGRTLTDFMHTRGLRMRSLGYVVKLSDKLSHVQSLCVHEMIVRALKHILQAV
FT                   ISAVATDTDKIAIKVAAALNMMLGIPENVAATPHNPWNVHPLIFRWLEKFLKKRYDYDL
FT                   NAFSYKDLRKFAILRGLCHKVGIELIPRDFDMDSPAPFRKTDVVSLVPVHKTFYFKSMQ
FT                   QAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAV
FT                   VLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKR
FT                   ALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTA
FT                   ASYHAIAIALSLMEAYHLSVQHEQTTLRILRAKLGPDDLRTQDAAAWLEYFESKAFEQQ
FT                   EAARNGTPKPDASIASKGHLSVSDLLDYINPSHNAKGKESVAAKRKNYILKLKEKSKQS
FT                   NVSEHLVEIPREKQKEMSEEDTEETGSEEGKSSEENHETILAPVEEPPSPPVIEDATMD
FT                   NSNPITSSDVSTEPQHPDGSEDGWQPVQRPRSAGSYGRRMKQRRASIGKVYTYQKKNVE
FT                   ADIDNPLFQNATQQNDKYYILKKRTASYSSYADHHSPGLTTQGTKFGRKIVKTLAYRVK
FT                   STQPSSGNAKTAGETSEEDGLKTDASSVEPPTLSSTVQSEAYHTKNSVVSLGKSPSYKE
FT                   VALAPPGSIAKYQVWVPQAEVSDKQEDDEMEKKTEQGTSMELTRDEQMITGLEEEVKKE
FT                   ISADPESNITQGEEEIKVELQPSEGVLGGSHINENDESGGGIQVEEQVEVELINDGVTD
FT                   MIHSTREQQVIDQLAADSEDLKAKLSISTTDSGDASRGLLPNKKLSASAAPFNPSSPPS
FT                   IIRPTPIGMNIGPSWPVNMTLHHGPPPPYPSPPTTPNLMQPMSFVYPPPYSQSVPTSTY
FT                   PVTSGPFHPNQFPWQLNVSDFVPRTVWPGCHPVEFPPPHMITEPIAATVLEPTVILPTD
FT                   IDTSGVEETKEGTQDVAVADEVMDSVNHVNNAVARSETENGNRKSEEGEKTFSILLRGR
FT                   RNRKQTLRMPISLLNRPYDSQPFKLGYSRVIRDSEAPKSVA"
FT   gene            130736..130858
FT                   /locus_tag="AT1G01335"
FT   mRNA            130736..130858
FT                   /locus_tag="AT1G01335"
FT                   /product="auxin-responsive endogenous peptide protein"
FT   CDS_pept        130736..130858
FT                   /codon_start=1
FT                   /locus_tag="AT1G01335"
FT                   /product="auxin-responsive endogenous peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01335"
FT                   /db_xref="GOA:P0DKH9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DKH9"
FT                   /protein_id="ANM60886.1"
FT                   /translation="MGLSDCLIYRLVVRCFLDYSICAPFYFYHKFMLSASEPVF"
FT   gene            complement(132270..135924)
FT                   /gene="CNGC10"
FT                   /gene_synonym="ACBK1"
FT                   /gene_synonym="ATCNGC10"
FT                   /gene_synonym="cyclic nucleotide gated channel 10"
FT                   /gene_synonym="F6F3.13"
FT                   /gene_synonym="F6F3_13"
FT                   /locus_tag="AT1G01340"
FT                   /note="member of Cyclic nucleotide gated channel family"
FT   mRNA            complement(join(132270..132744,132824..133218,
FT                   133303..133539,133641..133752,133911..134206,
FT                   134289..134501,134582..135104,135188..135269,
FT                   135708..135924))
FT                   /gene="CNGC10"
FT                   /gene_synonym="ACBK1"
FT                   /gene_synonym="ATCNGC10"
FT                   /gene_synonym="cyclic nucleotide gated channel 10"
FT                   /gene_synonym="F6F3.13"
FT                   /gene_synonym="F6F3_13"
FT                   /locus_tag="AT1G01340"
FT                   /product="cyclic nucleotide gated channel 10"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL105473.1,INSD:EL055533.1,INSD:EL235784.1,
FT                   INSD:EL072738.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AF272002.3"
FT   mRNA            complement(join(132328..132744,132824..133218,
FT                   133303..133539,133641..133752,133911..134206,
FT                   134289..134501,134582..135322))
FT                   /gene="CNGC10"
FT                   /gene_synonym="ACBK1"
FT                   /gene_synonym="ATCNGC10"
FT                   /gene_synonym="cyclic nucleotide gated channel 10"
FT                   /gene_synonym="F6F3.13"
FT                   /gene_synonym="F6F3_13"
FT                   /locus_tag="AT1G01340"
FT                   /product="cyclic nucleotide gated channel 10"
FT   CDS_pept        complement(join(132414..132744,132824..133218,
FT                   133303..133539,133641..133752,133911..134206,
FT                   134289..134501,134582..135104,135188..135216))
FT                   /codon_start=1
FT                   /gene="CNGC10"
FT                   /gene_synonym="ACBK1"
FT                   /gene_synonym="ATCNGC10"
FT                   /gene_synonym="cyclic nucleotide gated channel 10"
FT                   /gene_synonym="F6F3.13"
FT                   /gene_synonym="F6F3_13"
FT                   /locus_tag="AT1G01340"
FT                   /product="cyclic nucleotide gated channel 10"
FT                   /note="cyclic nucleotide gated channel 10 (CNGC10);
FT                   FUNCTIONS IN: ion channel activity, cyclic nucleotide
FT                   binding, calmodulin binding; INVOLVED IN: ion transport,
FT                   transmembrane transport; LOCATED IN: membrane; EXPRESSED
FT                   IN: 14 plant structures; EXPRESSED DURING: 10 growth
FT                   stages; CONTAINS InterPro DOMAIN/s: Cyclic
FT                   nucleotide-binding (InterPro:IPR000595), Cyclic
FT                   nucleotide-binding-like (InterPro:IPR018490), Ion transport
FT                   (InterPro:IPR005821), RmlC-like jelly roll fold
FT                   (InterPro:IPR014710), IQ calmodulin-binding region
FT                   (InterPro:IPR000048); BEST Arabidopsis thaliana protein
FT                   match is: cyclic nucleotide-gated channel 13
FT                   (TAIR:AT4G01010.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01340"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01340.2"
FT                   /db_xref="GOA:Q9LNJ0"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNJ0"
FT                   /protein_id="AEE27274.1"
FT                   /translation="MAFSHDNRVRFKDEGKPLSSEYGYGRKARPSLDRVFKNVKWGFKK
FT                   PLSFPSHKDPDHKETSSVTRKNIINPQDSFLQNWNKIFLFACVVALAIDPLFFYIPIVD
FT                   SARHCLTLDSKLEIAASLLRTLIDAFYIIHIVFQFRTAYIAPSSRVFGRGELVDDAKAI
FT                   ALKYLSSYFIIDLLSILPLPQIVVLAVIPSVNQPVSLLTKDYLKFSIIAQYVPRILRMY
FT                   PLYTEVTRTSGIVTETAWAGAAWNLSLYMLASHVFGALWYLISVEREDRCWQEACEKTK
FT                   GCNMKFLYCENDRNVSNNFLTTSCPFLDPGDITNSTIFNFGIFTDALKSGVVESHDFWK
FT                   KFFYCFWWGLRNLSALGQNLQTSKFVGEIIFAISICISGLVLFALLIGNMQKYLESTTV
FT                   REEEMRVRKRDAEQWMSHRMLPEDLRKRIRRYEQYRWQETRGVEEETLLRNLPKDLRRD
FT                   IKRHLCLDLLKKVPLFEIMDEQLLDAVCDRLRPVLYTENSYVIREGDPVGEMLFVMRGR
FT                   LVSATTNGGRSGFFNAVNLKASDFCGEDLLPWALDPQSSSHFPISTRTVQALTEVEAFA
FT                   LTAEDLKSVASQFRRLHSKQLQHTFRFYSVQWRTWSVSFIQAAWRRYCRRKLAKSLRDE
FT                   EDRLREALASQDKEHNAATVSSSLSLGGALYASRFASNALHNLRHNISNLPPRYTLPLL
FT                   PQKPTEPDFTANHTTDP"
FT   CDS_pept        complement(join(132414..132744,132824..133218,
FT                   133303..133539,133641..133752,133911..134206,
FT                   134289..134501,134582..135118))
FT                   /codon_start=1
FT                   /gene="CNGC10"
FT                   /gene_synonym="ACBK1"
FT                   /gene_synonym="ATCNGC10"
FT                   /gene_synonym="cyclic nucleotide gated channel 10"
FT                   /gene_synonym="F6F3.13"
FT                   /gene_synonym="F6F3_13"
FT                   /locus_tag="AT1G01340"
FT                   /product="cyclic nucleotide gated channel 10"
FT                   /note="cyclic nucleotide gated channel 10 (CNGC10);
FT                   FUNCTIONS IN: ion channel activity, cyclic nucleotide
FT                   binding, calmodulin binding; INVOLVED IN: ion transport,
FT                   transmembrane transport; LOCATED IN: membrane; EXPRESSED
FT                   IN: 14 plant structures; EXPRESSED DURING: 10 growth
FT                   stages; CONTAINS InterPro DOMAIN/s: Cyclic
FT                   nucleotide-binding (InterPro:IPR000595), Ion transport
FT                   (InterPro:IPR005821), Cyclic nucleotide-binding-like
FT                   (InterPro:IPR018490), RmlC-like jelly roll fold
FT                   (InterPro:IPR014710), IQ calmodulin-binding region
FT                   (InterPro:IPR000048); BEST Arabidopsis thaliana protein
FT                   match is: cyclic nucleotide-gated channel 13
FT                   (TAIR:AT4G01010.1); Has 3364 Blast hits to 3209 proteins in
FT                   253 species: Archae - 0; Bacteria - 35; Metazoa - 1554;
FT                   Fungi - 48; Plants - 1027; Viruses - 0; Other Eukaryotes -
FT                   700 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01340"
FT                   /db_xref="GOA:Q9LNJ0"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNJ0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL105473.1,INSD:EL055533.1,INSD:EL235784.1,
FT                   INSD:EL072738.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AF272002.3"
FT                   /protein_id="AEE27273.1"
FT                   /translation="MILFRFKDEGKPLSSEYGYGRKARPSLDRVFKNVKWGFKKPLSFP
FT                   SHKDPDHKETSSVTRKNIINPQDSFLQNWNKIFLFACVVALAIDPLFFYIPIVDSARHC
FT                   LTLDSKLEIAASLLRTLIDAFYIIHIVFQFRTAYIAPSSRVFGRGELVDDAKAIALKYL
FT                   SSYFIIDLLSILPLPQIVVLAVIPSVNQPVSLLTKDYLKFSIIAQYVPRILRMYPLYTE
FT                   VTRTSGIVTETAWAGAAWNLSLYMLASHVFGALWYLISVEREDRCWQEACEKTKGCNMK
FT                   FLYCENDRNVSNNFLTTSCPFLDPGDITNSTIFNFGIFTDALKSGVVESHDFWKKFFYC
FT                   FWWGLRNLSALGQNLQTSKFVGEIIFAISICISGLVLFALLIGNMQKYLESTTVREEEM
FT                   RVRKRDAEQWMSHRMLPEDLRKRIRRYEQYRWQETRGVEEETLLRNLPKDLRRDIKRHL
FT                   CLDLLKKVPLFEIMDEQLLDAVCDRLRPVLYTENSYVIREGDPVGEMLFVMRGRLVSAT
FT                   TNGGRSGFFNAVNLKASDFCGEDLLPWALDPQSSSHFPISTRTVQALTEVEAFALTAED
FT                   LKSVASQFRRLHSKQLQHTFRFYSVQWRTWSVSFIQAAWRRYCRRKLAKSLRDEEDRLR
FT                   EALASQDKEHNAATVSSSLSLGGALYASRFASNALHNLRHNISNLPPRYTLPLLPQKPT
FT                   EPDFTANHTTDP"
FT   gene            136090..138162
FT                   /gene_synonym="F6F3.14"
FT                   /gene_synonym="F6F3.15"
FT                   /gene_synonym="F6F3_14"
FT                   /gene_synonym="F6F3_15"
FT                   /locus_tag="AT1G01350"
FT   mRNA            join(136090..136234,136667..136816,136935..137758,
FT                   137848..138162)
FT                   /gene_synonym="F6F3.14"
FT                   /gene_synonym="F6F3.15"
FT                   /gene_synonym="F6F3_14"
FT                   /gene_synonym="F6F3_15"
FT                   /locus_tag="AT1G01350"
FT                   /product="Zinc finger (CCCH-type/C3HC4-type RING finger)
FT                   family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP637089.1,INSD:ES041235.1,INSD:EH937116.1,
FT                   INSD:DR379980.1,INSD:ES127789.1,INSD:AV524848.1,
FT                   INSD:BP638172.1,INSD:AU239237.1,INSD:BP834635.1,
FT                   INSD:BP811922.1,INSD:BP577944.1,INSD:BP596341.1,
FT                   INSD:BP570868.1,INSD:EL970299.1,INSD:BP834398.1,
FT                   INSD:EH977536.1,INSD:DR353000.1,INSD:BP825937.1,
FT                   INSD:ES190865.1,INSD:ES023733.1,INSD:BP840835.1,
FT                   INSD:BP568213.1,INSD:BP576565.1,INSD:AI997822.1,
FT                   INSD:BP844665.1,INSD:AV539694.1,INSD:BP828451.1,
FT                   INSD:ES093734.1,INSD:BP583835.1,INSD:BP819662.1,
FT                   INSD:ES085657.1,INSD:ES025456.1,INSD:EH992074.1,
FT                   INSD:DR352999.1,INSD:BP811937.1,INSD:BP583813.1,
FT                   INSD:ES031102.1,INSD:ES025911.1,INSD:EL264359.1,
FT                   INSD:EH822279.1,INSD:AU226158.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX814333.1,INSD:AK118376.1,INSD:BX817015.1"
FT   CDS_pept        join(136732..136816,136935..137758,137848..137970)
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.14"
FT                   /gene_synonym="F6F3.15"
FT                   /gene_synonym="F6F3_14"
FT                   /gene_synonym="F6F3_15"
FT                   /locus_tag="AT1G01350"
FT                   /product="Zinc finger (CCCH-type/C3HC4-type RING finger)
FT                   family protein"
FT                   /note="Zinc finger (CCCH-type/C3HC4-type RING finger)
FT                   family protein; FUNCTIONS IN: zinc ion binding, nucleic
FT                   acid binding; CONTAINS InterPro DOMAIN/s: Zinc finger,
FT                   CCCH-type (InterPro:IPR000571), Zinc finger, RING-type,
FT                   conserved site (InterPro:IPR017907), Zinc finger, RING-type
FT                   (InterPro:IPR001841); BEST Arabidopsis thaliana protein
FT                   match is: Zinc finger (CCCH-type/C3HC4-type RING finger)
FT                   family protein (TAIR:AT5G06420.2); Has 30201 Blast hits to
FT                   17322 proteins in 780 species: Archae - 12; Bacteria -
FT                   1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses
FT                   - 0; Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8GX84"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039971"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GX84"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP637089.1,INSD:ES041235.1,INSD:EH937116.1,
FT                   INSD:DR379980.1,INSD:ES127789.1,INSD:AV524848.1,
FT                   INSD:BP638172.1,INSD:AU239237.1,INSD:BP834635.1,
FT                   INSD:BP811922.1,INSD:BP577944.1,INSD:BP596341.1,
FT                   INSD:BP570868.1,INSD:EL970299.1,INSD:BP834398.1,
FT                   INSD:EH977536.1,INSD:DR353000.1,INSD:BP825937.1,
FT                   INSD:ES190865.1,INSD:ES023733.1,INSD:BP840835.1,
FT                   INSD:BP568213.1,INSD:BP576565.1,INSD:AI997822.1,
FT                   INSD:BP844665.1,INSD:AV539694.1,INSD:BP828451.1,
FT                   INSD:ES093734.1,INSD:BP583835.1,INSD:BP819662.1,
FT                   INSD:ES085657.1,INSD:ES025456.1,INSD:EH992074.1,
FT                   INSD:DR352999.1,INSD:BP811937.1,INSD:BP583813.1,
FT                   INSD:ES031102.1,INSD:ES025911.1,INSD:EL264359.1,
FT                   INSD:EH822279.1,INSD:AU226158.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX814333.1,INSD:AK118376.1,INSD:BX817015.1"
FT                   /protein_id="AEE27275.1"
FT                   /translation="MSDSGEPKPSQQEEPLPQPAAQETQSQQVCTFFKKPTKSKNIRKR
FT                   TIDADEEDGDSKSESSILQNLKKVAKPDSKLYFSSGPSKSSTTTSGAPERSVFHYDSSK
FT                   EIQVQNDSGATATLETETDFNQDARAIRERVLKKADEALKGNKKKASDEKLYKGIHGYT
FT                   DHKAGFRREQTISSEKAGGSHGPLRASAHIRVSARFDYQPDICKDYKETGYCGYGDSCK
FT                   FLHDRGDYKPGWQIEKEWEEAEKVRKRNKAMGVEDEDDEADKDSDEDENALPFACFICR
FT                   EPFVDPVVTKCKHYFCEHCALKHHTKNKKCFVCNQPTMGIFNAAHEIKKRMAEERSKAE
FT                   QGL"
FT   gene            138489..139680
FT                   /locus_tag="AT1G01355"
FT   mRNA            join(138489..138778,138875..138914,138989..139114,
FT                   139203..139345,139488..139671)
FT                   /locus_tag="AT1G01355"
FT                   /product="Putative endonuclease or glycosyl hydrolase"
FT   mRNA            join(138513..138541,138597..138778,138863..139114,
FT                   139203..139345,139488..139680)
FT                   /locus_tag="AT1G01355"
FT                   /product="Putative endonuclease or glycosyl hydrolase"
FT   mRNA            join(138513..138541,138597..138778,138875..139114,
FT                   139203..139345,139488..139651)
FT                   /locus_tag="AT1G01355"
FT                   /product="Putative endonuclease or glycosyl hydrolase"
FT   CDS_pept        join(138513..138541,138597..138778,138863..139114,
FT                   139203..139345,139488..139568)
FT                   /codon_start=1
FT                   /locus_tag="AT1G01355"
FT                   /product="Putative endonuclease or glycosyl hydrolase"
FT                   /note="Putative endonuclease or glycosyl hydrolase;
FT                   FUNCTIONS IN: zinc ion binding; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: intracellular;
FT                   CONTAINS InterPro DOMAIN/s: Zinc finger, C2H2-type
FT                   (InterPro:IPR007087); BEST Arabidopsis thaliana protein
FT                   match is: Putative endonuclease or glycosyl hydrolase
FT                   (TAIR:AT5G35640.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01355"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01355.1"
FT                   /db_xref="GOA:F4HSA3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR024768"
FT                   /db_xref="UniProtKB/TrEMBL:F4HSA3"
FT                   /protein_id="AEE27276.1"
FT                   /translation="MRKAKAVACGCPVPADVDVRRVGPCIKRALEKLGYSGPLTITAVG
FT                   ILTDVPHDFLRQVHSSGIALHHVPTVSETALSGIGWAVVKWTWYNQPPANLMLISYEHI
FT                   YLTTLDMLGRIGYNTVRSILPDDPQQAASSASPSTGSFLWESLLASLPAADDMDSGAPQ
FT                   EDKCGEMGEPALLCEQCRFTVQGFENFSTHLKSEEHAHESQYYRNEDDETDGDDYVRDS
FT                   EDDEEE"
FT   CDS_pept        join(138513..138541,138597..138778,138875..139114,
FT                   139203..139345,139488..139568)
FT                   /codon_start=1
FT                   /locus_tag="AT1G01355"
FT                   /product="Putative endonuclease or glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01355"
FT                   /db_xref="GOA:A0A1P8AVW5"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR024768"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AVW5"
FT                   /protein_id="ANM60747.1"
FT                   /translation="MRKAKAVACGCPVPADVDVRRVGPCIKRALEKLGYSGPLTITAVG
FT                   ILTDVPHDFLRQVHSSGIALHHVPTALSGIGWAVVKWTWYNQPPANLMLISYEHIYLTT
FT                   LDMLGRIGYNTVRSILPDDPQQAASSASPSTGSFLWESLLASLPAADDMDSGAPQEDKC
FT                   GEMGEPALLCEQCRFTVQGFENFSTHLKSEEHAHESQYYRNEDDETDGDDYVRDSEDDE
FT                   EE"
FT   CDS_pept        join(138722..138778,138875..138914,138989..139114,
FT                   139203..139345,139488..139568)
FT                   /codon_start=1
FT                   /locus_tag="AT1G01355"
FT                   /product="Putative endonuclease or glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01355"
FT                   /db_xref="GOA:A0A1P8AVR8"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR024768"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AVR8"
FT                   /protein_id="ANM60746.1"
FT                   /translation="MTSSDKSIPLESLFITFPPLSQGLGGLWLSGPGRIGYNTVRSILP
FT                   DDPQQAASSASPSTGSFLWESLLASLPAADDMDSGAPQEDKCGEMGEPALLCEQCRFTV
FT                   QGFENFSTHLKSEEHAHESQYYRNEDDETDGDDYVRDSEDDEEE"
FT   gene            141870..143261
FT                   /gene="RCAR1"
FT                   /gene_synonym="F6F3.16"
FT                   /gene_synonym="F6F3_16"
FT                   /gene_synonym="PYL9"
FT                   /gene_synonym="PYRABACTIN RESISTANCE 1-LIKE 9"
FT                   /gene_synonym="regulatory component of ABA receptor 1"
FT                   /locus_tag="AT1G01360"
FT                   /note="Encodes RCAR1 (regulatory components of ABA
FT                   receptor). Interacts with and regulates the type 2C protein
FT                   phosphatases (PP2Cs) ABI1 and ABI2. Functions as abscisic
FT                   acid sensor."
FT   mRNA            join(141870..142281,142424..142639,142711..143261)
FT                   /gene="RCAR1"
FT                   /gene_synonym="F6F3.16"
FT                   /gene_synonym="F6F3_16"
FT                   /gene_synonym="PYL9"
FT                   /gene_synonym="PYRABACTIN RESISTANCE 1-LIKE 9"
FT                   /gene_synonym="regulatory component of ABA receptor 1"
FT                   /locus_tag="AT1G01360"
FT                   /product="regulatory component of ABA receptor 1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV545168.1,INSD:EL092949.1,INSD:CK121713.1,
FT                   INSD:EG527854.1,INSD:DR370649.1,INSD:BP778078.1,
FT                   INSD:ES135898.1,INSD:AU235559.1,INSD:DR212138.1,
FT                   INSD:BP582210.1,INSD:EH904661.1,INSD:EL013981.1,
FT                   INSD:DR372756.1,INSD:BP843684.1,INSD:ES017792.1,
FT                   INSD:EH850283.1,INSD:AU226286.1,INSD:EL191043.1,
FT                   INSD:ES067534.1,INSD:BP663206.1,INSD:ES023684.1,
FT                   INSD:AV553852.1,INSD:AI997945.1,INSD:ES089518.1,
FT                   INSD:DR300117.1,INSD:ES173563.1,INSD:DR300118.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY087967.1,INSD:AK227623.1,INSD:BT006399.1,
FT                   INSD:BX817886.1"
FT   CDS_pept        join(142138..142281,142424..142639,142711..142914)
FT                   /codon_start=1
FT                   /gene="RCAR1"
FT                   /gene_synonym="F6F3.16"
FT                   /gene_synonym="F6F3_16"
FT                   /gene_synonym="PYL9"
FT                   /gene_synonym="PYRABACTIN RESISTANCE 1-LIKE 9"
FT                   /gene_synonym="regulatory component of ABA receptor 1"
FT                   /locus_tag="AT1G01360"
FT                   /product="regulatory component of ABA receptor 1"
FT                   /note="regulatory component of ABA receptor 1 (RCAR1);
FT                   CONTAINS InterPro DOMAIN/s: Polyketide cyclase/dehydrase
FT                   (InterPro:IPR019587); BEST Arabidopsis thaliana protein
FT                   match is: PYR1-like 7 (TAIR:AT4G01026.1); Has 395 Blast
FT                   hits to 395 proteins in 28 species: Archae - 0; Bacteria -
FT                   3; Metazoa - 0; Fungi - 0; Plants - 392; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q84MC7"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="PDB:3OQU"
FT                   /db_xref="PDB:3W9R"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84MC7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV545168.1,INSD:EL092949.1,INSD:CK121713.1,
FT                   INSD:EG527854.1,INSD:DR370649.1,INSD:BP778078.1,
FT                   INSD:ES135898.1,INSD:AU235559.1,INSD:DR212138.1,
FT                   INSD:BP582210.1,INSD:EH904661.1,INSD:EL013981.1,
FT                   INSD:DR372756.1,INSD:BP843684.1,INSD:ES017792.1,
FT                   INSD:EH850283.1,INSD:AU226286.1,INSD:EL191043.1,
FT                   INSD:ES067534.1,INSD:BP663206.1,INSD:ES023684.1,
FT                   INSD:AV553852.1,INSD:AI997945.1,INSD:ES089518.1,
FT                   INSD:DR300117.1,INSD:ES173563.1,INSD:DR300118.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY087967.1,INSD:AK227623.1,INSD:BT006399.1,
FT                   INSD:BX817886.1"
FT                   /protein_id="AEE27277.1"
FT                   /translation="MMDGVEGGTAMYGGLETVQYVRTHHQHLCRENQCTSALVKHIKAP
FT                   LHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIGSLREVNVKSGLPATTSTERLELLDDE
FT                   EHILGIKIIGGDHRLKNYSSILTVHPEIIEGRAGTMVIESFVVDVPQGNTKDETCYFVE
FT                   ALIRCNLKSLADVSERLASQDITQ"
FT   gene            143489..146479
FT                   /gene="HTR12"
FT                   /gene_synonym="CENH3"
FT                   /gene_synonym="CENTROMERIC HISTONE H3"
FT                   /gene_synonym="F6F3.17"
FT                   /gene_synonym="F6F3_17"
FT                   /locus_tag="AT1G01370"
FT                   /note="Encodes a centromere-identifying protein histone H3
FT                   variant. Localized at centromeres in both mitotic and
FT                   meiotic cells."
FT   mRNA            join(143489..143676,143764..143824,143934..143977,
FT                   144064..144109,144193..144227,144315..144351,
FT                   144447..144559,144927..145004,145132..145207,
FT                   145345..145435,146164..146479)
FT                   /gene="HTR12"
FT                   /gene_synonym="CENH3"
FT                   /gene_synonym="CENTROMERIC HISTONE H3"
FT                   /gene_synonym="F6F3.17"
FT                   /gene_synonym="F6F3_17"
FT                   /locus_tag="AT1G01370"
FT                   /product="Histone superfamily protein"
FT   mRNA            join(143489..143824,143934..143977,144064..144109,
FT                   144193..144227,144315..144351,144447..144559,
FT                   144927..145004,145132..145207,145345..146042)
FT                   /gene="HTR12"
FT                   /gene_synonym="CENH3"
FT                   /gene_synonym="CENTROMERIC HISTONE H3"
FT                   /gene_synonym="F6F3.17"
FT                   /gene_synonym="F6F3_17"
FT                   /locus_tag="AT1G01370"
FT                   /product="Histone superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR253123.1,INSD:ES027780.1,INSD:DR381035.1,
FT                   INSD:ES055344.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT024771.1,INSD:AB081500.1,INSD:AK175840.1,
FT                   INSD:AF465800.1"
FT   mRNA            join(143489..143676,143764..143824,143934..143977,
FT                   144064..144109,144193..144227,144315..144351,
FT                   144447..144559,144927..145004,145132..145207,
FT                   145345..146042)
FT                   /gene="HTR12"
FT                   /gene_synonym="CENH3"
FT                   /gene_synonym="CENTROMERIC HISTONE H3"
FT                   /gene_synonym="F6F3.17"
FT                   /gene_synonym="F6F3_17"
FT                   /locus_tag="AT1G01370"
FT                   /product="Histone superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES027780.1,INSD:DR214906.1,INSD:DR381035.1,
FT                   INSD:DR214905.1,INSD:ES055344.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT024771.1,INSD:AB081500.1,INSD:AY086361.1,
FT                   INSD:AF465800.1"
FT   mRNA            join(143522..143676,143761..143824,143934..143977,
FT                   144064..144109,144193..144227,144315..144351,
FT                   144447..144559,144927..145004,145132..145207,
FT                   145345..145676)
FT                   /gene="HTR12"
FT                   /gene_synonym="CENH3"
FT                   /gene_synonym="CENTROMERIC HISTONE H3"
FT                   /gene_synonym="F6F3.17"
FT                   /gene_synonym="F6F3_17"
FT                   /locus_tag="AT1G01370"
FT                   /product="Histone superfamily protein"
FT   CDS_pept        join(143773..143824,143934..143977,144064..144109,
FT                   144193..144227,144315..144351,144447..144559,
FT                   144927..145004,145132..145207,145345..145400)
FT                   /codon_start=1
FT                   /gene="HTR12"
FT                   /gene_synonym="CENH3"
FT                   /gene_synonym="CENTROMERIC HISTONE H3"
FT                   /gene_synonym="F6F3.17"
FT                   /gene_synonym="F6F3_17"
FT                   /locus_tag="AT1G01370"
FT                   /product="Histone superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01370"
FT                   /db_xref="GOA:Q8RVQ9"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RVQ9"
FT                   /protein_id="ANM60590.1"
FT                   /translation="MARTKHRVTRSQPRNQTDAAGASSSQAAGPTTTPTRRGGEGGDNT
FT                   QQTNPTTSPATGTRRGAKRSRQAMPRGSQKKSYRYRPGTVALKEIRHFQKQTNLLIPAA
FT                   SFIREVRSITHMLAPPQINRWTAEALVALQEAAEDYLVGLFSDSMLCAIHARRVTLMRK
FT                   DFELARRLGGKGRPW"
FT   CDS_pept        join(143773..143824,143934..143977,144064..144109,
FT                   144193..144227,144315..144351,144447..144559,
FT                   144927..145004,145132..145207,145345..145400)
FT                   /codon_start=1
FT                   /gene="HTR12"
FT                   /gene_synonym="CENH3"
FT                   /gene_synonym="CENTROMERIC HISTONE H3"
FT                   /gene_synonym="F6F3.17"
FT                   /gene_synonym="F6F3_17"
FT                   /locus_tag="AT1G01370"
FT                   /product="Histone superfamily protein"
FT                   /db_xref="GOA:Q8RVQ9"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RVQ9"
FT                   /protein_id="ANM60591.1"
FT                   /translation="MARTKHRVTRSQPRNQTDAAGASSSQAAGPTTTPTRRGGEGGDNT
FT                   QQTNPTTSPATGTRRGAKRSRQAMPRGSQKKSYRYRPGTVALKEIRHFQKQTNLLIPAA
FT                   SFIREVRSITHMLAPPQINRWTAEALVALQEAAEDYLVGLFSDSMLCAIHARRVTLMRK
FT                   DFELARRLGGKGRPW"
FT   CDS_pept        join(143773..143824,143934..143977,144064..144109,
FT                   144193..144227,144315..144351,144447..144559,
FT                   144927..145004,145132..145207,145345..145400)
FT                   /codon_start=1
FT                   /gene="HTR12"
FT                   /gene_synonym="CENH3"
FT                   /gene_synonym="CENTROMERIC HISTONE H3"
FT                   /gene_synonym="F6F3.17"
FT                   /gene_synonym="F6F3_17"
FT                   /locus_tag="AT1G01370"
FT                   /product="Histone superfamily protein"
FT                   /note="HTR12; FUNCTIONS IN: DNA binding; INVOLVED IN:
FT                   double fertilization forming a zygote and endosperm;
FT                   LOCATED IN: chromosome, centromeric region, nucleus;
FT                   EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 8
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Histone H3
FT                   (InterPro:IPR000164), Histone-fold (InterPro:IPR009072),
FT                   Histone core (InterPro:IPR007125); BEST Arabidopsis
FT                   thaliana protein match is: male-gamete-specific histone H3
FT                   (TAIR:AT1G19890.1); Has 14361 Blast hits to 14354 proteins
FT                   in 7190 species: Archae - 0; Bacteria - 0; Metazoa - 10494;
FT                   Fungi - 2020; Plants - 1256; Viruses - 0; Other Eukaryotes
FT                   - 591 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8RVQ9"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RVQ9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES027780.1,INSD:DR214906.1,INSD:DR381035.1,
FT                   INSD:DR214905.1,INSD:ES055344.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT024771.1,INSD:AB081500.1,INSD:AY086361.1,
FT                   INSD:AF465800.1"
FT                   /protein_id="AEE27278.1"
FT                   /translation="MARTKHRVTRSQPRNQTDAAGASSSQAAGPTTTPTRRGGEGGDNT
FT                   QQTNPTTSPATGTRRGAKRSRQAMPRGSQKKSYRYRPGTVALKEIRHFQKQTNLLIPAA
FT                   SFIREVRSITHMLAPPQINRWTAEALVALQEAAEDYLVGLFSDSMLCAIHARRVTLMRK
FT                   DFELARRLGGKGRPW"
FT   CDS_pept        join(143773..143824,143934..143977,144064..144109,
FT                   144193..144227,144315..144351,144447..144559,
FT                   144927..145004,145132..145207,145345..145400)
FT                   /codon_start=1
FT                   /gene="HTR12"
FT                   /gene_synonym="CENH3"
FT                   /gene_synonym="CENTROMERIC HISTONE H3"
FT                   /gene_synonym="F6F3.17"
FT                   /gene_synonym="F6F3_17"
FT                   /locus_tag="AT1G01370"
FT                   /product="Histone superfamily protein"
FT                   /note="HTR12; FUNCTIONS IN: DNA binding; INVOLVED IN:
FT                   double fertilization forming a zygote and endosperm;
FT                   LOCATED IN: chromosome, centromeric region, nucleus;
FT                   EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 8
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Histone H3
FT                   (InterPro:IPR000164), Histone-fold (InterPro:IPR009072),
FT                   Histone core (InterPro:IPR007125); BEST Arabidopsis
FT                   thaliana protein match is: male-gamete-specific histone H3
FT                   (TAIR:AT1G19890.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8RVQ9"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RVQ9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR253123.1,INSD:ES027780.1,INSD:DR381035.1,
FT                   INSD:ES055344.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT024771.1,INSD:AB081500.1,INSD:AK175840.1,
FT                   INSD:AF465800.1"
FT                   /protein_id="AEE27279.1"
FT                   /translation="MARTKHRVTRSQPRNQTDAAGASSSQAAGPTTTPTRRGGEGGDNT
FT                   QQTNPTTSPATGTRRGAKRSRQAMPRGSQKKSYRYRPGTVALKEIRHFQKQTNLLIPAA
FT                   SFIREVRSITHMLAPPQINRWTAEALVALQEAAEDYLVGLFSDSMLCAIHARRVTLMRK
FT                   DFELARRLGGKGRPW"
FT   gene            147043..148014
FT                   /gene="ETC1"
FT                   /gene_synonym="ENHANCER OF TRY AND CPC 1"
FT                   /gene_synonym="F6F3.18"
FT                   /gene_synonym="F6F3_18"
FT                   /locus_tag="AT1G01380"
FT                   /note="ETC1 is involved in trichome and root hair
FT                   patterning in Arabidopsis."
FT   mRNA            join(147043..147333,147452..148014)
FT                   /gene="ETC1"
FT                   /gene_synonym="ENHANCER OF TRY AND CPC 1"
FT                   /gene_synonym="F6F3.18"
FT                   /gene_synonym="F6F3_18"
FT                   /locus_tag="AT1G01380"
FT                   /product="Homeodomain-like superfamily protein"
FT   mRNA            join(147043..147333,147452..147539,147644..148014)
FT                   /gene="ETC1"
FT                   /gene_synonym="ENHANCER OF TRY AND CPC 1"
FT                   /gene_synonym="F6F3.18"
FT                   /gene_synonym="F6F3_18"
FT                   /locus_tag="AT1G01380"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DN604644.1,INSD:DR290142.1,INSD:DR372046.1,
FT                   INSD:AA597320.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY519518.1"
FT   mRNA            join(147153..147333,147452..147528,147644..147942)
FT                   /gene="ETC1"
FT                   /gene_synonym="ENHANCER OF TRY AND CPC 1"
FT                   /gene_synonym="F6F3.18"
FT                   /gene_synonym="F6F3_18"
FT                   /locus_tag="AT1G01380"
FT                   /product="Homeodomain-like superfamily protein"
FT   CDS_pept        join(147267..147333,147452..147539,147644..147740)
FT                   /codon_start=1
FT                   /gene="ETC1"
FT                   /gene_synonym="ENHANCER OF TRY AND CPC 1"
FT                   /gene_synonym="F6F3.18"
FT                   /gene_synonym="F6F3_18"
FT                   /locus_tag="AT1G01380"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /note="ENHANCER OF TRY AND CPC 1 (ETC1); FUNCTIONS IN: DNA
FT                   binding, sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: regulation of transcription,
FT                   DNA-dependent, regulation of transcription; EXPRESSED IN:
FT                   shoot apex, hypocotyl, root; CONTAINS InterPro DOMAIN/s:
FT                   SANT, DNA-binding (InterPro:IPR001005), Homeodomain-like
FT                   (InterPro:IPR009057), Myb, DNA-binding
FT                   (InterPro:IPR014778), Homeodomain-related
FT                   (InterPro:IPR012287), Myb transcription factor
FT                   (InterPro:IPR015495); BEST Arabidopsis thaliana protein
FT                   match is: CAPRICE-like MYB3 (TAIR:AT4G01060.1); Has 2220
FT                   Blast hits to 2220 proteins in 165 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 2207;
FT                   Viruses - 0; Other Eukaryotes - 13 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01380.1"
FT                   /db_xref="GOA:Q9LNI5"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNI5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DN604644.1,INSD:DR290142.1,INSD:DR372046.1,
FT                   INSD:AA597320.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY519518.1"
FT                   /protein_id="AEE27280.1"
FT                   /translation="MNTQRKSKHLKTNPTIVASSSEEVSSLEWEEIAMAQEEEDLICRM
FT                   YKLVGERWDLIAGRIPGRTAEEIERFWVMKNHRRSQLR"
FT   CDS_pept        join(147267..147333,147452..147528,147644..147694)
FT                   /codon_start=1
FT                   /gene="ETC1"
FT                   /gene_synonym="ENHANCER OF TRY AND CPC 1"
FT                   /gene_synonym="F6F3.18"
FT                   /gene_synonym="F6F3_18"
FT                   /locus_tag="AT1G01380"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01380"
FT                   /db_xref="GOA:A0A1P8AQ06"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AQ06"
FT                   /protein_id="ANM58733.1"
FT                   /translation="MNTQRKSKHLKTNPTIVASSSEEVSSLEWEEIAMAQEEEDLICRM
FT                   YKLVGFNSWEDSRKNSRRD"
FT   CDS_pept        join(147267..147333,147452..147567)
FT                   /codon_start=1
FT                   /gene="ETC1"
FT                   /gene_synonym="ENHANCER OF TRY AND CPC 1"
FT                   /gene_synonym="F6F3.18"
FT                   /gene_synonym="F6F3_18"
FT                   /locus_tag="AT1G01380"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01380"
FT                   /db_xref="GOA:A0A1P8AQ13"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AQ13"
FT                   /protein_id="ANM58732.1"
FT                   /translation="MNTQRKSKHLKTNPTIVASSSEEVSSLEWEEIAMAQEEEDLICRM
FT                   YKLVGERFFMFSLIP"
FT   gene            complement(148013..149848)
FT                   /gene_synonym="F6F3.19"
FT                   /gene_synonym="F6F3_19"
FT                   /locus_tag="AT1G01390"
FT   mRNA            complement(148013..149848)
FT                   /gene_synonym="F6F3.19"
FT                   /gene_synonym="F6F3_19"
FT                   /locus_tag="AT1G01390"
FT                   /product="UDP-Glycosyltransferase superfamily protein"
FT   mRNA            complement(148018..149806)
FT                   /gene_synonym="F6F3.19"
FT                   /gene_synonym="F6F3_19"
FT                   /locus_tag="AT1G01390"
FT                   /product="UDP-Glycosyltransferase superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BU635233.1,INSD:AV826496.1,INSD:EL123028.1,
FT                   INSD:AV795197.1,INSD:EL108983.1,INSD:EL043376.1,
FT                   INSD:EL245591.1,INSD:EH840430.1,INSD:BP611817.1,
FT                   INSD:EH986423.1,INSD:EL247626.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062668.1,INSD:BT002579.1"
FT   CDS_pept        complement(148319..149812)
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.19"
FT                   /gene_synonym="F6F3_19"
FT                   /locus_tag="AT1G01390"
FT                   /product="UDP-Glycosyltransferase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01390"
FT                   /db_xref="GOA:A0A1P8AV09"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR035595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AV09"
FT                   /protein_id="ANM60489.1"
FT                   /translation="MSIDIFQEIRIKKILLLMAEANTPHIAIMPSPGMGHLIPFVELAK
FT                   RLVQHDCFTVTMIISGETSPSKAQRSVLNSLPSSIASVFLPPADLSDVPSTARIETRAM
FT                   LTMTRSNPALRELFGSLSTKKSLPAVLVVDMFGADAFDVAVDFHVSPYIFYASNANVLS
FT                   FFLHLPKLDKTVSCEFRYLTEPLKIPGCVPITGKDFLDTVQDRNDDAYKLLLHNTKRYK
FT                   EAKGILVNSFVDLESNAIKALQEPAPDKPTVYPIGPLVNTSSSNVNLEDKFGCLSWLDN
FT                   QPFGSVLYISFGSGGTLTCEQFNELAIGLAESGKRFIWVIRSPSEIVSSSYFNPHSETD
FT                   PFSFLPIGFLDRTKEKGLVVPSWAPQVQILAHPSTCGFLTHCGWNSTLESIVNGVPLIA
FT                   WPLFAEQKMNTLLLVEDVGAALRIHAGEDGIVRREEVVRVVKALMEGEEGKAIGNKVKE
FT                   LKEGVVRVLGDDGLSSKSFGEVLLKWKTHQRDINQETSH"
FT   CDS_pept        complement(148319..149761)
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.19"
FT                   /gene_synonym="F6F3_19"
FT                   /locus_tag="AT1G01390"
FT                   /product="UDP-Glycosyltransferase superfamily protein"
FT                   /note="UDP-Glycosyltransferase superfamily protein;
FT                   FUNCTIONS IN: UDP-glycosyltransferase activity, transferase
FT                   activity, transferring glycosyl groups; INVOLVED IN:
FT                   metabolic process; EXPRESSED IN: 7 plant structures;
FT                   EXPRESSED DURING: 9 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: UDP-glucuronosyl/UDP-glucosyltransferase
FT                   (InterPro:IPR002213); BEST Arabidopsis thaliana protein
FT                   match is: UDP-glucosyl transferase 72B3 (TAIR:AT1G01420.1);
FT                   Has 7970 Blast hits to 7908 proteins in 429 species: Archae
FT                   - 0; Bacteria - 359; Metazoa - 2438; Fungi - 37; Plants -
FT                   5024; Viruses - 48; Other Eukaryotes - 64 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01390.1"
FT                   /db_xref="GOA:Q8W4C2"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR035595"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8W4C2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BU635233.1,INSD:AV826496.1,INSD:EL123028.1,
FT                   INSD:AV795197.1,INSD:EL108983.1,INSD:EL043376.1,
FT                   INSD:EL245591.1,INSD:EH840430.1,INSD:BP611817.1,
FT                   INSD:EH986423.1,INSD:EL247626.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062668.1,INSD:BT002579.1"
FT                   /protein_id="AEE27281.1"
FT                   /translation="MAEANTPHIAIMPSPGMGHLIPFVELAKRLVQHDCFTVTMIISGE
FT                   TSPSKAQRSVLNSLPSSIASVFLPPADLSDVPSTARIETRAMLTMTRSNPALRELFGSL
FT                   STKKSLPAVLVVDMFGADAFDVAVDFHVSPYIFYASNANVLSFFLHLPKLDKTVSCEFR
FT                   YLTEPLKIPGCVPITGKDFLDTVQDRNDDAYKLLLHNTKRYKEAKGILVNSFVDLESNA
FT                   IKALQEPAPDKPTVYPIGPLVNTSSSNVNLEDKFGCLSWLDNQPFGSVLYISFGSGGTL
FT                   TCEQFNELAIGLAESGKRFIWVIRSPSEIVSSSYFNPHSETDPFSFLPIGFLDRTKEKG
FT                   LVVPSWAPQVQILAHPSTCGFLTHCGWNSTLESIVNGVPLIAWPLFAEQKMNTLLLVED
FT                   VGAALRIHAGEDGIVRREEVVRVVKALMEGEEGKAIGNKVKELKEGVVRVLGDDGLSSK
FT                   SFGEVLLKWKTHQRDINQETSH"
FT   gene            complement(150689..152210)
FT                   /gene_synonym="F6F3.20"
FT                   /gene_synonym="F6F3_20"
FT                   /locus_tag="AT1G01400"
FT   mRNA            complement(join(150689..151298,151393..151731,
FT                   151932..152002,152086..152210))
FT                   /gene_synonym="F6F3.20"
FT                   /gene_synonym="F6F3_20"
FT                   /locus_tag="AT1G01400"
FT                   /product="hypothetical protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG471975.1,INSD:EG471980.1,INSD:EG471983.1,
FT                   INSD:EG471990.1,INSD:EG471985.1,INSD:EG419393.1,
FT                   INSD:EG419395.1,INSD:EG419656.1,INSD:EG471977.1,
FT                   INSD:EG471989.1,INSD:EG471978.1,INSD:EG471986.1,
FT                   INSD:EG471974.1,INSD:EG471991.1,INSD:EG471979.1,
FT                   INSD:EG471982.1,INSD:EG471988.1,INSD:EG471981.1,
FT                   INSD:EG471984.1,INSD:EG419389.1,INSD:EG471972.1,
FT                   INSD:EG471971.1,INSD:EG471992.1,INSD:EG471973.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY735499.1"
FT   CDS_pept        complement(join(151158..151298,151393..151731,
FT                   151932..152002,152086..152149))
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.20"
FT                   /gene_synonym="F6F3_20"
FT                   /locus_tag="AT1G01400"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; Has 21 Blast hits to 21 proteins in
FT                   8 species: Archae - 0; Bacteria - 2; Metazoa - 2; Fungi -
FT                   1; Plants - 13; Viruses - 0; Other Eukaryotes - 3 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01400.1"
FT                   /db_xref="GOA:Q9LNI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LNI3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG471975.1,INSD:EG471980.1,INSD:EG471983.1,
FT                   INSD:EG471990.1,INSD:EG471985.1,INSD:EG419393.1,
FT                   INSD:EG419395.1,INSD:EG419656.1,INSD:EG471977.1,
FT                   INSD:EG471989.1,INSD:EG471978.1,INSD:EG471986.1,
FT                   INSD:EG471974.1,INSD:EG471991.1,INSD:EG471979.1,
FT                   INSD:EG471982.1,INSD:EG471988.1,INSD:EG471981.1,
FT                   INSD:EG471984.1,INSD:EG419389.1,INSD:EG471972.1,
FT                   INSD:EG471971.1,INSD:EG471992.1,INSD:EG471973.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY735499.1"
FT                   /protein_id="AEE27282.1"
FT                   /translation="MEREEPIARNEVDHETPTKPDESASASSPRRSEETLNQSTQINQT
FT                   GPRSVLHLQSQESHLSNSTTTHASSPSVNVTPKPDLSSFSNTTATQEPSPSAGLQIRTI
FT                   EKDRSPGSAFPRHKRLPVFDEVCSGAVFPWYGPQEPDLPSSSGIGTMSANSHDDRRAYE
FT                   LAYPLPSRDIQSKKELRNAHLKTPTATLTNTTTTTIHGSRT"
FT   gene            153113..154198
FT                   /gene="PUM22"
FT                   /gene_synonym="APUM22"
FT                   /gene_synonym="F6F3.21"
FT                   /gene_synonym="F6F3_21"
FT                   /gene_synonym="pumilio 22"
FT                   /locus_tag="AT1G01410"
FT                   /note="Encodes a member of the Arabidopsis Pumilio (APUM)
FT                   proteins containing PUF domain (eight repeats of
FT                   approximately 36 amino acids each). PUF proteins regulate
FT                   both mRNA stability and translation through
FT                   sequence-specific binding to the 3' UTR of target mRNA
FT                   transcripts."
FT   mRNA            153113..154198
FT                   /gene="PUM22"
FT                   /gene_synonym="APUM22"
FT                   /gene_synonym="F6F3.21"
FT                   /gene_synonym="F6F3_21"
FT                   /gene_synonym="pumilio 22"
FT                   /locus_tag="AT1G01410"
FT                   /product="pumilio 22"
FT   CDS_pept        153113..154198
FT                   /codon_start=1
FT                   /gene="PUM22"
FT                   /gene_synonym="APUM22"
FT                   /gene_synonym="F6F3.21"
FT                   /gene_synonym="F6F3_21"
FT                   /gene_synonym="pumilio 22"
FT                   /locus_tag="AT1G01410"
FT                   /product="pumilio 22"
FT                   /note="pumilio 22 (PUM22); FUNCTIONS IN: RNA binding,
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s:
FT                   Pumilio RNA-binding repeat (InterPro:IPR001313),
FT                   Armadillo-like helical (InterPro:IPR011989), Armadillo-type
FT                   fold (InterPro:IPR016024); BEST Arabidopsis thaliana
FT                   protein match is: ARM repeat superfamily protein
FT                   (TAIR:AT5G64490.1); Has 304 Blast hits to 271 proteins in
FT                   75 species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi -
FT                   65; Plants - 186; Viruses - 0; Other Eukaryotes - 52
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01410"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01410.1"
FT                   /db_xref="GOA:Q9LNI2"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNI2"
FT                   /protein_id="AEE27283.1"
FT                   /translation="MTHERGYDLASQVLNICNVHHKKLFCHITYRHLLVLSSDDNGCVI
FT                   LKKVITIADDFLKDEFLDLIAQHAHSLSMHDLGISLIQHVLELDFTKKTTQDDKRLHEL
FT                   MAEFDEVLSTSVTADVDKLHKLASKLMLDSDLFFEFVITRRGSLMIQIILGKSEEVDQV
FT                   ILAGVKQRFIDVTTNFYGYRIMIQTIKVFKKRGDLKVYDQILRLIGVHALYLTKDPDMG
FT                   NKTFQHAINLHHQDCTTFIACGLQSHYIELSFLKHGSKIVEMLIDDRISMVPLVLLMME
FT                   IVKCDEDTLVRLATDEYGNNILKKFLALAKEHKEDFFGDLVDKLNPLLDSLRGTLGENI
FT                   VAIIDSETEMVKDRIVSQGNN"
FT   gene            complement(154367..156178)
FT                   /gene="UGT72B3"
FT                   /gene_synonym="F6F3.22"
FT                   /gene_synonym="F6F3_22"
FT                   /gene_synonym="UDP-glucosyl transferase 72B3"
FT                   /locus_tag="AT1G01420"
FT   mRNA            complement(154367..156178)
FT                   /gene="UGT72B3"
FT                   /gene_synonym="F6F3.22"
FT                   /gene_synonym="F6F3_22"
FT                   /gene_synonym="UDP-glucosyl transferase 72B3"
FT                   /locus_tag="AT1G01420"
FT                   /product="UDP-glucosyl transferase 72B3"
FT   mRNA            complement(154492..156011)
FT                   /gene="UGT72B3"
FT                   /gene_synonym="F6F3.22"
FT                   /gene_synonym="F6F3_22"
FT                   /gene_synonym="UDP-glucosyl transferase 72B3"
FT                   /locus_tag="AT1G01420"
FT                   /product="UDP-glucosyl transferase 72B3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES010113.1,INSD:BP845279.1,INSD:BP665395.1,
FT                   INSD:EL306393.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT030469.1,INSD:AK175504.1,INSD:BT011808.1"
FT   CDS_pept        complement(154566..156020)
FT                   /codon_start=1
FT                   /gene="UGT72B3"
FT                   /gene_synonym="F6F3.22"
FT                   /gene_synonym="F6F3_22"
FT                   /gene_synonym="UDP-glucosyl transferase 72B3"
FT                   /locus_tag="AT1G01420"
FT                   /product="UDP-glucosyl transferase 72B3"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01420"
FT                   /db_xref="GOA:A0A1P8AUD8"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR035595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AUD8"
FT                   /protein_id="ANM60250.1"
FT                   /translation="MQKMADGNTPHVAIIPSPGIGHLIPLVELAKRLLDNHGFTVTFII
FT                   PGDSPPSKAQRSVLNSLPSSIASVFLPPADLSDVPSTARIETRISLTVTRSNPALRELF
FT                   GSLSAEKRLPAVLVVDLFGTDAFDVAAEFHVSPYIFYASNANVLTFLLHLPKLDETVSC
FT                   EFRELTEPVIIPGCVPITGKDFVDPCQDRKDESYKWLLHNVKRFKEAEGILVNSFVDLE
FT                   PNTIKIVQEPAPDKPPVYLIGPLVNSGSHDADVNDEYKCLNWLDNQPFGSVLYVSFGSG
FT                   GTLTFEQFIELALGLAESGKRFLWVIRSPSGIASSSYFNPQSRNDPFSFLPQGFLDRTK
FT                   EKGLVVGSWAPQAQILTHTSIGGFLTHCGWNSSLESIVNGVPLIAWPLYAEQKMNALLL
FT                   VDVGAALRARLGEDGVVGREEVARVVKGLIEGEEGNAVRKKMKELKEGSVRVLRDDGFS
FT                   TKSLNEVSLKWKAHQRKIDQEQESFL"
FT   CDS_pept        complement(154566..156011)
FT                   /codon_start=1
FT                   /gene="UGT72B3"
FT                   /gene_synonym="F6F3.22"
FT                   /gene_synonym="F6F3_22"
FT                   /gene_synonym="UDP-glucosyl transferase 72B3"
FT                   /locus_tag="AT1G01420"
FT                   /product="UDP-glucosyl transferase 72B3"
FT                   /note="UDP-glucosyl transferase 72B3 (UGT72B3); FUNCTIONS
FT                   IN: quercetin 3-O-glucosyltransferase activity,
FT                   UDP-glycosyltransferase activity, transferase activity,
FT                   transferring glycosyl groups; INVOLVED IN: metabolic
FT                   process; LOCATED IN: cellular_component unknown; EXPRESSED
FT                   IN: 11 plant structures; EXPRESSED DURING: LP.04 four
FT                   leaves visible, petal differentiation and expansion stage;
FT                   CONTAINS InterPro DOMAIN/s:
FT                   UDP-glucuronosyl/UDP-glucosyltransferase
FT                   (InterPro:IPR002213); BEST Arabidopsis thaliana protein
FT                   match is: UDP-Glycosyltransferase superfamily protein
FT                   (TAIR:AT1G01390.1); Has 7961 Blast hits to 7896 proteins in
FT                   480 species: Archae - 0; Bacteria - 474; Metazoa - 2294;
FT                   Fungi - 32; Plants - 5027; Viruses - 70; Other Eukaryotes -
FT                   64 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01420"
FT                   /db_xref="GOA:Q9LNI1"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR035595"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LNI1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES010113.1,INSD:BP845279.1,INSD:BP665395.1,
FT                   INSD:EL306393.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT030469.1,INSD:AK175504.1,INSD:BT011808.1"
FT                   /protein_id="AEE27284.1"
FT                   /translation="MADGNTPHVAIIPSPGIGHLIPLVELAKRLLDNHGFTVTFIIPGD
FT                   SPPSKAQRSVLNSLPSSIASVFLPPADLSDVPSTARIETRISLTVTRSNPALRELFGSL
FT                   SAEKRLPAVLVVDLFGTDAFDVAAEFHVSPYIFYASNANVLTFLLHLPKLDETVSCEFR
FT                   ELTEPVIIPGCVPITGKDFVDPCQDRKDESYKWLLHNVKRFKEAEGILVNSFVDLEPNT
FT                   IKIVQEPAPDKPPVYLIGPLVNSGSHDADVNDEYKCLNWLDNQPFGSVLYVSFGSGGTL
FT                   TFEQFIELALGLAESGKRFLWVIRSPSGIASSSYFNPQSRNDPFSFLPQGFLDRTKEKG
FT                   LVVGSWAPQAQILTHTSIGGFLTHCGWNSSLESIVNGVPLIAWPLYAEQKMNALLLVDV
FT                   GAALRARLGEDGVVGREEVARVVKGLIEGEEGNAVRKKMKELKEGSVRVLRDDGFSTKS
FT                   LNEVSLKWKAHQRKIDQEQESFL"
FT   gene            complement(156477..158823)
FT                   /gene="TBL25"
FT                   /gene_synonym="F6F3.23"
FT                   /gene_synonym="F6F3_23"
FT                   /gene_synonym="TRICHOME BIREFRINGENCE-LIKE 25"
FT                   /locus_tag="AT1G01430"
FT                   /note="Encodes a member of the TBL (TRICHOME
FT                   BIREFRINGENCE-LIKE) gene family containing a plant-specific
FT                   DUF231 (domain of unknown function) domain. TBL gene family
FT                   has 46 members, two of which (TBR/AT5G06700 and
FT                   TBL3/AT5G01360) have been shown to be involved in the
FT                   synthesis and deposition of secondary wall cellulose,
FT                   presumably by influencing the esterification state of
FT                   pectic polymers. A nomenclature for this gene family has
FT                   been proposed (Volker Bischoff & Wolf Scheible, 2010,
FT                   personal communication)."
FT   mRNA            complement(join(156477..157756,157829..158112,
FT                   158254..158823))
FT                   /gene="TBL25"
FT                   /gene_synonym="F6F3.23"
FT                   /gene_synonym="F6F3_23"
FT                   /gene_synonym="TRICHOME BIREFRINGENCE-LIKE 25"
FT                   /locus_tag="AT1G01430"
FT                   /product="TRICHOME BIREFRINGENCE-LIKE 25"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH978587.1,INSD:EH903165.1,INSD:EH802667.1,
FT                   INSD:EH886608.1,INSD:EH986236.1,INSD:EH873356.1,
FT                   INSD:EH804479.1,INSD:EL324451.1,INSD:EH852536.1,
FT                   INSD:R90627.1,INSD:EH855873.1,INSD:EL097086.1,
FT                   INSD:EL016091.1,INSD:EH897218.1,INSD:AU236905.1,
FT                   INSD:EL298723.1,INSD:EH880556.1,INSD:EL253060.1,
FT                   INSD:ES081681.1,INSD:EH799706.1,INSD:EL048876.1,
FT                   INSD:AU227909.1,INSD:AV530954.1,INSD:EL011191.1,
FT                   INSD:EL267719.1,INSD:EH950239.1,INSD:ES146284.1,
FT                   INSD:EL256036.1,INSD:EH965747.1,INSD:EH802569.1,
FT                   INSD:EH865428.1,INSD:EL204913.1,INSD:EH816820.1,
FT                   INSD:AV536925.1,INSD:EL100264.1,INSD:EL202779.1,
FT                   INSD:EH828508.1,INSD:DR356464.1,INSD:EL298885.1,
FT                   INSD:AI995110.1,INSD:EH835411.1,INSD:EL065284.1,
FT                   INSD:ES130017.1,INSD:AV565538.1,INSD:EH958339.1,
FT                   INSD:EH817110.1,INSD:EL279662.1,INSD:ES128514.1,
FT                   INSD:AA395564.1,INSD:CB074546.1,INSD:EH812716.1,
FT                   INSD:EH982827.1,INSD:EL158669.1,INSD:AV565299.1,
FT                   INSD:EH979362.1,INSD:EH976994.1,INSD:EL083587.1,
FT                   INSD:BP616052.1,INSD:EH809116.1,INSD:EL146468.1,
FT                   INSD:EH899541.1,INSD:BX839752.1,INSD:R90644.1,
FT                   INSD:AV536271.1,INSD:EH844896.1,INSD:EL126998.1,
FT                   INSD:EH940771.1,INSD:EL079545.1,INSD:EH846108.1,
FT                   INSD:EL130824.1,INSD:EH985870.1,INSD:EL029743.1,
FT                   INSD:EL170514.1,INSD:EL102563.1,INSD:EL288455.1,
FT                   INSD:EL089413.1,INSD:H76231.1,INSD:EL003001.1,
FT                   INSD:EL114691.1,INSD:EH870478.1,INSD:ES139404.1,
FT                   INSD:EH856716.1,INSD:EL203511.1,INSD:EL109207.1,
FT                   INSD:N38106.1,INSD:EL267555.1,INSD:EH850211.1,
FT                   INSD:EL338409.1,INSD:EL149726.1,INSD:BP850619.1,
FT                   INSD:EL335770.1,INSD:EL035422.1,INSD:EL166801.1,
FT                   INSD:EH950497.1,INSD:EH983446.1,INSD:EL320608.1,
FT                   INSD:EL215486.1,INSD:EL145979.1,INSD:EL050234.1,
FT                   INSD:EL217003.1,INSD:EL101055.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT004301.1,INSD:BX816990.1,INSD:BX815518.1,
FT                   INSD:BT005623.1"
FT   CDS_pept        complement(join(156953..157756,157829..158112,
FT                   158254..158536))
FT                   /codon_start=1
FT                   /gene="TBL25"
FT                   /gene_synonym="F6F3.23"
FT                   /gene_synonym="F6F3_23"
FT                   /gene_synonym="TRICHOME BIREFRINGENCE-LIKE 25"
FT                   /locus_tag="AT1G01430"
FT                   /product="TRICHOME BIREFRINGENCE-LIKE 25"
FT                   /note="TRICHOME BIREFRINGENCE-LIKE 25 (TBL25); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF231,
FT                   plant (InterPro:IPR004253); BEST Arabidopsis thaliana
FT                   protein match is: TRICHOME BIREFRINGENCE-LIKE 26
FT                   (TAIR:AT4G01080.1); Has 1353 Blast hits to 1335 proteins in
FT                   35 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   6; Plants - 1340; Viruses - 0; Other Eukaryotes - 7
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01430"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01430.1"
FT                   /db_xref="GOA:Q84JH9"
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="InterPro:IPR029985"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84JH9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH978587.1,INSD:EH903165.1,INSD:EH802667.1,
FT                   INSD:EH886608.1,INSD:EH986236.1,INSD:EH873356.1,
FT                   INSD:EH804479.1,INSD:EL324451.1,INSD:EH852536.1,
FT                   INSD:R90627.1,INSD:EH855873.1,INSD:EL097086.1,
FT                   INSD:EL016091.1,INSD:EH897218.1,INSD:AU236905.1,
FT                   INSD:EL298723.1,INSD:EH880556.1,INSD:EL253060.1,
FT                   INSD:ES081681.1,INSD:EH799706.1,INSD:EL048876.1,
FT                   INSD:AU227909.1,INSD:AV530954.1,INSD:EL011191.1,
FT                   INSD:EL267719.1,INSD:EH950239.1,INSD:ES146284.1,
FT                   INSD:EL256036.1,INSD:EH965747.1,INSD:EH802569.1,
FT                   INSD:EH865428.1,INSD:EL204913.1,INSD:EH816820.1,
FT                   INSD:AV536925.1,INSD:EL100264.1,INSD:EL202779.1,
FT                   INSD:EH828508.1,INSD:DR356464.1,INSD:EL298885.1,
FT                   INSD:AI995110.1,INSD:EH835411.1,INSD:EL065284.1,
FT                   INSD:ES130017.1,INSD:AV565538.1,INSD:EH958339.1,
FT                   INSD:EH817110.1,INSD:EL279662.1,INSD:ES128514.1,
FT                   INSD:AA395564.1,INSD:CB074546.1,INSD:EH812716.1,
FT                   INSD:EH982827.1,INSD:EL158669.1,INSD:AV565299.1,
FT                   INSD:EH979362.1,INSD:EH976994.1,INSD:EL083587.1,
FT                   INSD:BP616052.1,INSD:EH809116.1,INSD:EL146468.1,
FT                   INSD:EH899541.1,INSD:BX839752.1,INSD:R90644.1,
FT                   INSD:AV536271.1,INSD:EH844896.1,INSD:EL126998.1,
FT                   INSD:EH940771.1,INSD:EL079545.1,INSD:EH846108.1,
FT                   INSD:EL130824.1,INSD:EH985870.1,INSD:EL029743.1,
FT                   INSD:EL170514.1,INSD:EL102563.1,INSD:EL288455.1,
FT                   INSD:EL089413.1,INSD:H76231.1,INSD:EL003001.1,
FT                   INSD:EL114691.1,INSD:EH870478.1,INSD:ES139404.1,
FT                   INSD:EH856716.1,INSD:EL203511.1,INSD:EL109207.1,
FT                   INSD:N38106.1,INSD:EL267555.1,INSD:EH850211.1,
FT                   INSD:EL338409.1,INSD:EL149726.1,INSD:BP850619.1,
FT                   INSD:EL335770.1,INSD:EL035422.1,INSD:EL166801.1,
FT                   INSD:EH950497.1,INSD:EH983446.1,INSD:EL320608.1,
FT                   INSD:EL215486.1,INSD:EL145979.1,INSD:EL050234.1,
FT                   INSD:EL217003.1,INSD:EL101055.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT004301.1,INSD:BX816990.1,INSD:BX815518.1,
FT                   INSD:BT005623.1"
FT                   /protein_id="AEE27285.1"
FT                   /translation="MDSLRLISKSIKIEGTPFGSSHQRNQIFLKSVAFFLLIGLAYRFL
FT                   ITNSTVSPVPTVRSSPESLPPDPSGLTAITQTSASVDSPANITTIASQNVSTKCDIFIG
FT                   NWVPDPSGPIYTNVSCRHIQDYQNCLKNGRPDVNYLRWRWQPRDCDLPRFNPEQFLDNM
FT                   RNKWLAFIGDSISRNHVQSLLCILSQVEEVEDIFHDKEYKSRIWRFPSYNFTLSVIWSP
FT                   FLVKAETFENGVPFSDIRVHLDKLDQKWTDQYINFDYVVISGGKWFLKTTIFHENNTVT
FT                   GCHYCQGKNNMTELGYLYSYRKVLHLVLDFVAEPNHKAQVLFRTTTPDHFENGEWDSGG
FT                   FCNRTMPFTEGSEGEMKSEDVSMRDIELEEFYKTTTTQQEGSNSNIVLLDTTSMSLLRP
FT                   DGHPGPYRYPNPFAGLKNKELNQVQNDCLHWCLPGPIDSWNDLMVEVMLNRERQRRE"
FT   gene            complement(159628..162953)
FT                   /gene_synonym="F6F3.24"
FT                   /gene_synonym="F6F3_24"
FT                   /locus_tag="AT1G01440"
FT   mRNA            complement(join(159628..159992,160079..160302,
FT                   160418..160478,160568..162280,162487..162953))
FT                   /gene_synonym="F6F3.24"
FT                   /gene_synonym="F6F3_24"
FT                   /locus_tag="AT1G01440"
FT                   /product="hypothetical protein (DUF3133)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL114090.1,INSD:DR364210.1,INSD:EL143259.1,
FT                   INSD:EH915792.1,INSD:EL008688.1,INSD:DR383577.1,
FT                   INSD:ES010491.1,INSD:EL054910.1,INSD:ES062605.1,
FT                   INSD:EL301702.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT010599.1"
FT   CDS_pept        complement(join(159935..159992,160079..160302,
FT                   160418..160478,160568..162219))
FT                   /codon_start=1
FT                   /gene_synonym="F6F3.24"
FT                   /gene_synonym="F6F3_24"
FT                   /locus_tag="AT1G01440"
FT                   /product="hypothetical protein (DUF3133)"
FT                   /note="Protein of unknown function (DUF3133); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF3133
FT                   (InterPro:IPR021480); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF3133)
FT                   (TAIR:AT4G01090.1); Has 702 Blast hits to 662 proteins in
FT                   107 species: Archae - 0; Bacteria - 15; Metazoa - 235;
FT                   Fungi - 59; Plants - 328; Viruses - 0; Other Eukaryotes -
FT                   65 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01440.1"
FT                   /db_xref="GOA:Q6NQ63"
FT                   /db_xref="InterPro:IPR021480"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NQ63"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL114090.1,INSD:DR364210.1,INSD:EL143259.1,
FT                   INSD:EH915792.1,INSD:EL008688.1,INSD:DR383577.1,
FT                   INSD:ES010491.1,INSD:EL054910.1,INSD:ES062605.1,
FT                   INSD:EL301702.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT010599.1"
FT                   /protein_id="AEE27286.1"
FT                   /translation="MRTSGDVYGADTGSSRSDEDRGFKEDLNESATSPMRNRLDDSNSR
FT                   PGSQRFVKSSRKEEETDSDSSSSKNTTTRNNPIQYTDKQQAELLRKLDSIKDHLLRGGG
FT                   NNATVVDQPPMGFHAHHGPPPSYYNPYPEPFPYGMYPTASNQPHVPAYRDPYGFPVHRI
FT                   PQNFYQGPSHYPNQMPPRPPYPQGQYVDIGSDILESQLQDPRFFPGTPSRYGDVPFSPA
FT                   LHHGEKVGPFSPHGGVHTRWPSEIDSEMGGAFARGYVQQAVSDTDSRRCHPLAGGAPFI
FT                   ACHSCFELLYVPKKKLLGQERQQKMQCGACSEVITFRVVDKKLVFSSSALGETTNRVSV
FT                   EVEDRSSPIPVVDDYPLNDEEPRIHQETKIVHAVSPSDHSNDEDRSSISSEPRKQVVKS
FT                   VRSRAQGAKVPPPPPPEKSNLLELFEYSNVNRAAITYGMAQLGYYKQESYTKQDSLKSE
FT                   SVATETDVSYNEYYTNTEESEDSRISKASKEGRRPRNRKQSSEHSFAEVTNNISSNDQN
FT                   NEQLEVWVNGYLIPEDLVISAEKQAGPVQAGKYWYDYRAGFWGVMGNPCLGIIPPFIEE
FT                   FSRPMPDNCGAGNTSVFVNGRELHERDLELLSSRGLPRGKNRSYIIDIAGRVLDGDSGE
FT                   ELKSLGRLAPTVDKVKHGFGMRVPRSLVS"
FT   gene            163278..166353
FT                   /locus_tag="AT1G01448"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT1G01450; Potential natural antisense gene, locus overlaps
FT                   with AT1G01450"
FT   ncRNA           join(163278..163516,163934..164103,164225..164686,
FT                   164771..165380,165449..166353)
FT                   /locus_tag="AT1G01448"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   ncRNA           join(163278..163516,163934..164103,164225..164686,
FT                   164771..165380,165449..165656,165769..166353)
FT                   /locus_tag="AT1G01448"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   ncRNA           join(163302..163516,163934..164103,164225..164686,
FT                   164771..165380,165449..165656,165983..166307)
FT                   /locus_tag="AT1G01448"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(164105..165517)
FT                   /gene_synonym="F22L4.1"
FT                   /gene_synonym="F22L4_1"
FT                   /locus_tag="AT1G01450"
FT   mRNA            complement(164105..165517)
FT                   /gene_synonym="F22L4.1"
FT                   /gene_synonym="F22L4_1"
FT                   /locus_tag="AT1G01450"
FT                   /product="Protein kinase superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES159578.1,INSD:ES024481.1,INSD:EH835114.1,
FT                   INSD:BX834656.1"
FT   CDS_pept        complement(164105..165517)
FT                   /codon_start=1
FT                   /gene_synonym="F22L4.1"
FT                   /gene_synonym="F22L4_1"
FT                   /locus_tag="AT1G01450"
FT                   /product="Protein kinase superfamily protein"
FT                   /note="Protein kinase superfamily protein; FUNCTIONS IN:
FT                   protein serine/threonine/tyrosine kinase activity, kinase
FT                   activity; INVOLVED IN: protein amino acid phosphorylation;
FT                   LOCATED IN: cellular_component unknown; EXPRESSED IN:
FT                   pollen tube; CONTAINS InterPro DOMAIN/s: Protein kinase,
FT                   catalytic domain (InterPro:IPR000719),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Tyrosine-protein kinase, catalytic
FT                   domain (InterPro:IPR020635),
FT                   Serine-threonine/tyrosine-protein kinase
FT                   (InterPro:IPR001245), Protein kinase-like domain
FT                   (InterPro:IPR011009); BEST Arabidopsis thaliana protein
FT                   match is: Protein kinase family protein (TAIR:AT1G64300.2);
FT                   Has 73829 Blast hits to 73194 proteins in 2427 species:
FT                   Archae - 72; Bacteria - 7086; Metazoa - 29204; Fungi -
FT                   5761; Plants - 19826; Viruses - 200; Other Eukaryotes -
FT                   11680 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01450"
FT                   /db_xref="GOA:F4HSB4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:F4HSB4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES159578.1,INSD:ES024481.1,INSD:EH835114.1,
FT                   INSD:BX834656.1"
FT                   /protein_id="AEE27287.1"
FT                   /translation="MADFLLKHLGDGNESPKLFPSSLLDNTKDYQVKKRLGNGSQYKEI
FT                   TWLGESFALRHFFGDIDALLPQITPLLSLSHPNIVYYLCGFTDEEKKECFLVMELMRKT
FT                   LGMHIKEVCGPRKKNTLSLPVAVDLMLQIALGMEYLHSKRIYHGELNPSNILVKPRSNQ
FT                   SGDGYLLGKIFGFGLNSVKGFSSKSASLTSQNENFPFIWYSPEVLEEQEQSGTAGSLKY
FT                   SDKSDVYSFGMVSFELLTGKVPFEDSHLQGDKMSRNIRAGERPLFPFNSPKFITNLTKR
FT                   CWHADPNQRPTFSSISRILRYIKRFLALNPECYSSSQQDPSIAPTVDYCEIETKLLQKL
FT                   SWESTELTKVSQVPFQMFAYRVVERAKTCEKDNLREPSESGSEWASCSEDEGGAGSDEQ
FT                   LSYAKERRLSCSSNDVGMSKKQVSNLLKRASSLKPIQKPGEIIISQYIYIYIGSLTNMN
FT                   LVTCTNFFVLCH"
FT   gene            complement(166589..168088)
FT                   /locus_tag="AT1G01453"
FT   mRNA            complement(join(166589..166871,167014..168088))
FT                   /locus_tag="AT1G01453"
FT                   /product="late embryogenesis abundant hydroxyproline-rich
FT                   glycoprotein family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG502604.1,INSD:EG453117.1,INSD:EG456449.1,
FT                   INSD:EG485288.1,INSD:EG453124.1,INSD:EG456446.1,
FT                   INSD:EG456458.1,INSD:EG454409.1,INSD:EG436373.1,
FT                   INSD:EG502587.1,INSD:EG502570.1,INSD:EG485287.1,
FT                   INSD:EG502568.1,INSD:EG456448.1,INSD:EG453120.1,
FT                   INSD:EG502603.1,INSD:EG502615.1,INSD:EG502580.1,
FT                   INSD:EG502596.1,INSD:EG453116.1,INSD:EG456454.1,
FT                   INSD:EG502574.1,INSD:EG502577.1,INSD:EG502569.1,
FT                   INSD:EG502576.1,INSD:EG454407.1,INSD:EG502539.1,
FT                   INSD:EG456455.1,INSD:EG456445.1,INSD:EG456450.1,
FT                   INSD:EG502601.1,INSD:EG456444.1,INSD:EG454362.1,
FT                   INSD:EG502581.1,INSD:EG502578.1,INSD:EG502567.1,
FT                   INSD:EG502579.1,INSD:EG502602.1,INSD:EG456453.1,
FT                   INSD:EG454405.1,INSD:EG502582.1,INSD:EG453123.1,
FT                   INSD:EG456447.1,INSD:EG502588.1,INSD:EG502600.1,
FT                   INSD:EG502595.1,INSD:EG456464.1,INSD:EG456462.1,
FT                   INSD:EG453114.1,INSD:EG456451.1,INSD:EG456461.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:EF183207.1"
FT   mRNA            complement(166618..167842)
FT                   /locus_tag="AT1G01453"
FT                   /product="late embryogenesis abundant hydroxyproline-rich
FT                   glycoprotein family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG453117.1,INSD:EG485288.1,INSD:EG453120.1,
FT                   INSD:EG453124.1,INSD:EG502581.1,INSD:EG454362.1,
FT                   INSD:EG456460.1,INSD:EG453116.1,INSD:EG454405.1,
FT                   INSD:EG456462.1,INSD:EG456464.1,INSD:EG454407.1,
FT                   INSD:EG456459.1,INSD:EG453114.1,INSD:EG502582.1,
FT                   INSD:EG453123.1,INSD:EG454409.1,INSD:EG436373.1,
FT                   INSD:EG485287.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:EF183208.1"
FT   CDS_pept        complement(join(166853..166871,167014..167798))
FT                   /codon_start=1
FT                   /locus_tag="AT1G01453"
FT                   /product="late embryogenesis abundant hydroxyproline-rich
FT                   glycoprotein family protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; BEST Arabidopsis thaliana
FT                   protein match is: unknown protein (TAIR:AT4G01110.1); Has
FT                   30201 Blast hits to 17322 proteins in 780 species: Archae -
FT                   12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants
FT                   - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01453"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01453.1"
FT                   /db_xref="GOA:B3H6G3"
FT                   /db_xref="UniProtKB/TrEMBL:B3H6G3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG502604.1,INSD:EG453117.1,INSD:EG456449.1,
FT                   INSD:EG485288.1,INSD:EG453124.1,INSD:EG456446.1,
FT                   INSD:EG456458.1,INSD:EG454409.1,INSD:EG436373.1,
FT                   INSD:EG502587.1,INSD:EG502570.1,INSD:EG485287.1,
FT                   INSD:EG502568.1,INSD:EG456448.1,INSD:EG453120.1,
FT                   INSD:EG502603.1,INSD:EG502615.1,INSD:EG502580.1,
FT                   INSD:EG502596.1,INSD:EG453116.1,INSD:EG456454.1,
FT                   INSD:EG502574.1,INSD:EG502577.1,INSD:EG502569.1,
FT                   INSD:EG502576.1,INSD:EG454407.1,INSD:EG502539.1,
FT                   INSD:EG456455.1,INSD:EG456445.1,INSD:EG456450.1,
FT                   INSD:EG502601.1,INSD:EG456444.1,INSD:EG454362.1,
FT                   INSD:EG502581.1,INSD:EG502578.1,INSD:EG502567.1,
FT                   INSD:EG502579.1,INSD:EG502602.1,INSD:EG456453.1,
FT                   INSD:EG454405.1,INSD:EG502582.1,INSD:EG453123.1,
FT                   INSD:EG456447.1,INSD:EG502588.1,INSD:EG502600.1,
FT                   INSD:EG502595.1,INSD:EG456464.1,INSD:EG456462.1,
FT                   INSD:EG453114.1,INSD:EG456451.1,INSD:EG456461.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:EF183207.1"
FT                   /protein_id="AEE27288.1"
FT                   /translation="MDQKRPTIAGDEEMAAEKPLQPALQKPPGFRDQQNQPSAPPSGTA
FT                   TLPRRRPRPIHPADKKRRCSFCRVFCCCVCILFAVILLLILIAVAVFFLWYSPKLPVVR
FT                   LASFKISNFNFSDGKSDDGWSFLSADTTSVLDFRNPNGKLTFYYGDTDVAVILGEKDFE
FT                   TNLESTKVKGFIEKPGNRTAVIVPTTVRKRQVDDPTAKRLQVELKSKKLLVTVTAKTKV
FT                   GLAVGSRKIVTVGVSLRCGGVILQTLDSKMAQCTIKMLKWIKLRS"
FT   CDS_pept        complement(166929..167798)
FT                   /codon_start=1
FT                   /locus_tag="AT1G01453"
FT                   /product="late embryogenesis abundant hydroxyproline-rich
FT                   glycoprotein family protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; BEST Arabidopsis thaliana
FT                   protein match is: unknown protein (TAIR:AT4G01110.1); Has
FT                   30201 Blast hits to 17322 proteins in 780 species: Archae -
FT                   12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants
FT                   - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01453"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01453.2"
FT                   /db_xref="GOA:F4HSB6"
FT                   /db_xref="UniProtKB/TrEMBL:F4HSB6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG453117.1,INSD:EG485288.1,INSD:EG453120.1,
FT                   INSD:EG453124.1,INSD:EG502581.1,INSD:EG454362.1,
FT                   INSD:EG456460.1,INSD:EG453116.1,INSD:EG454405.1,
FT                   INSD:EG456462.1,INSD:EG456464.1,INSD:EG454407.1,
FT                   INSD:EG456459.1,INSD:EG453114.1,INSD:EG502582.1,
FT                   INSD:EG453123.1,INSD:EG454409.1,INSD:EG436373.1,
FT                   INSD:EG485287.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:EF183208.1"
FT                   /protein_id="AEE27289.1"
FT                   /translation="MDQKRPTIAGDEEMAAEKPLQPALQKPPGFRDQQNQPSAPPSGTA
FT                   TLPRRRPRPIHPADKKRRCSFCRVFCCCVCILFAVILLLILIAVAVFFLWYSPKLPVVR
FT                   LASFKISNFNFSDGKSDDGWSFLSADTTSVLDFRNPNGKLTFYYGDTDVAVILGEKDFE
FT                   TNLESTKVKGFIEKPGNRTAVIVPTTVRKRQVDDPTAKRLQVELKSKKLLVTVTAKTKV
FT                   GLAVGSRKIVTVGVSLRCGGVILQTLDSKMAQCTIKMLKWYVETTWSKLDDLVDSKLNK
FT                   SYYKKVFI"
FT   gene            168559..171386
FT                   /gene="PIPK11"
FT                   /gene_synonym="ATPIPK11"
FT                   /gene_synonym="F22L4.2"
FT                   /gene_synonym="F22L4_2"
FT                   /locus_tag="AT1G01460"
FT                   /note="Type I phosphatidylinositol-4-phosphate 5-kinase,
FT                   subfamily A."
FT   mRNA            join(168559..168801,169037..169257,169347..169509,
FT                   169600..169710,169806..169993,170071..170162,
FT                   170266..170313,170412..170507,170622..170760,
FT                   170851..171386)
FT                   /gene="PIPK11"
FT                   /gene_synonym="ATPIPK11"
FT                   /gene_synonym="F22L4.2"
FT                   /gene_synonym="F22L4_2"
FT                   /locus_tag="AT1G01460"
FT                   /product="Phosphatidylinositol-4-phosphate 5-kinase, core"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT028973.1,INSD:BX814758.1,INSD:DQ056443.1"
FT   CDS_pept        join(169115..169257,169347..169509,169600..169710,
FT                   169806..169993,170071..170162,170266..170313,
FT                   170412..170507,170622..170760,170851..171154)
FT                   /codon_start=1
FT                   /gene="PIPK11"
FT                   /gene_synonym="ATPIPK11"
FT                   /gene_synonym="F22L4.2"
FT                   /gene_synonym="F22L4_2"
FT                   /locus_tag="AT1G01460"
FT                   /product="Phosphatidylinositol-4-phosphate 5-kinase, core"
FT                   /note="PIPK11; FUNCTIONS IN:
FT                   1-phosphatidylinositol-4-phosphate 5-kinase activity,
FT                   phosphatidylinositol phosphate kinase activity; INVOLVED
FT                   IN: phosphatidylinositol metabolic process; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: sperm cell,
FT                   sepal, male gametophyte, flower, pollen tube; EXPRESSED
FT                   DURING: L mature pollen stage, M germinated pollen stage, 4
FT                   anthesis; CONTAINS InterPro DOMAIN/s:
FT                   Phosphatidylinositol-4-phosphate 5-kinase, core, subgroup
FT                   (InterPro:IPR016034), Phosphatidylinositol-4-phosphate
FT                   5-kinase, core (InterPro:IPR002498); BEST Arabidopsis
FT                   thaliana protein match is: phosphatidylinositol phosphate
FT                   kinase 10 (TAIR:AT4G01190.1); Has 2109 Blast hits to 1621
FT                   proteins in 223 species: Archae - 0; Bacteria - 2; Metazoa
FT                   - 980; Fungi - 317; Plants - 416; Viruses - 0; Other
FT                   Eukaryotes - 394 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LMN1"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LMN1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT028973.1,INSD:BX814758.1,INSD:DQ056443.1"
FT                   /protein_id="AEE27290.1"
FT                   /translation="MFTREITAKDVKATEKNRIRYSSKHIKHLPPGTITEFEWKDYCPL
FT                   GFRLIQELEDINHDEYMKSICNDETLRKLSTSKVGNMFLLSKDDRFLIKILRKSEIKVI
FT                   LEMLPGYFRHIHKYRSTLLSKNYGAHSVKPIGGVKTYFVVMSNILQSDVFMNKVYDLKG
FT                   SSQGRTNKKIKVRDKTILKDIDLDFCFYVDSLARHRLIKQTKLDCELLEDEGIMDYSLM
FT                   LGLQVKGSCHGSIDELIPVYDSFTSRGSVDSNSSKFMKTASNSPDRSSSTMYSCTPSRN
FT                   SVDSENSVNIQSVASISPSPAQTNASDSPYESLVSKTNLTNIFQNSSSTNFGMKIPGRA
FT                   RRVGRGESGSVVGKQSREGGEEWYDVILYLGIIDIFQDYGVRKRLEHCYKSIQHSSKTI
FT                   SAVHPKMYSSRFQDFVSQIFLPDEDPSH"
FT   gene            complement(171525..172948)
FT                   /gene="LEA14"
FT                   /gene_synonym="F22L4.3"
FT                   /gene_synonym="F22L4_3"
FT                   /gene_synonym="LATE EMBRYOGENESIS ABUNDANT 14"
FT                   /gene_synonym="LEA1"
FT                   /gene_synonym="LIGHT STRESS-REGULATED 3"
FT                   /gene_synonym="LSR3"
FT                   /locus_tag="AT1G01470"
FT                   /note="Encodes late-embryogenesis abundant protein whose
FT                   mRNA levels are induced in response to wounding and light
FT                   stress. Might be involved in protection against
FT                   dessication."
FT   mRNA            complement(join(171525..172544,172621..172948))
FT                   /gene="LEA14"
FT                   /gene_synonym="F22L4.3"
FT                   /gene_synonym="F22L4_3"
FT                   /gene_synonym="LATE EMBRYOGENESIS ABUNDANT 14"
FT                   /gene_synonym="LEA1"
FT                   /gene_synonym="LIGHT STRESS-REGULATED 3"
FT                   /gene_synonym="LSR3"
FT                   /locus_tag="AT1G01470"
FT                   /product="Late embryogenesis abundant protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP624808.1,INSD:CD530986.1,INSD:BP848865.1,
FT                   INSD:AV819336.1,INSD:CD530395.1,INSD:EG501645.1,
FT                   INSD:EG489860.1,INSD:AV823250.2,INSD:EH975104.1,
FT                   INSD:DR375791.1,INSD:BP847963.1,INSD:BP808268.1,
FT                   INSD:Z37259.1,INSD:EL321058.1,INSD:EG501633.1,
FT                   INSD:H76171.1,INSD:CD530356.1,INSD:EG436108.1,
FT                   INSD:EL132144.1,INSD:EL130667.1,INSD:EG456489.1,
FT                   INSD:EG510415.1,INSD:BP581374.1,INSD:EG504418.1,
FT                   INSD:EL246469.1,INSD:AV787755.1,INSD:DR260609.1,
FT                   INSD:BP843702.1,INSD:EG508236.1,INSD:EG501650.1,
FT                   INSD:EH864334.1,INSD:EL281860.1,INSD:R30106.1,
FT                   INSD:EL272470.1,INSD:BP616567.1,INSD:EG501649.1,
FT                   INSD:BP650777.1,INSD:CD530999.1,INSD:EL224185.1,
FT                   INSD:EH916820.1,INSD:EL038394.1,INSD:EH909449.1,
FT                   INSD:EG478604.1,INSD:CB261215.1,INSD:EH971597.1,
FT                   INSD:DR260607.1,INSD:DR260606.1,INSD:DR260603.1,
FT                   INSD:CD531490.1,INSD:BP796430.1,INSD:EL192430.1,
FT                   INSD:CD531286.1,INSD:EH846632.1,INSD:EH836830.1,
FT                   INSD:EL121966.1,INSD:BP852279.1,INSD:EL259749.1,
FT                   INSD:EL315283.1,INSD:EG475792.1,INSD:AV784184.1,
FT                   INSD:AV782620.1,INSD:CD531790.1,INSD:DR260612.1,
FT                   INSD:AI994095.1,INSD:EG510416.1,INSD:EH957689.1,
FT                   INSD:EH943227.1,INSD:EH991848.1,INSD:EH992479.1,
FT                   INSD:EL069114.1,INSD:CD531544.1,INSD:EG501648.1,
FT                   INSD:EG508217.1,INSD:EG508244.1,INSD:EG508235.1,
FT                   INSD:EG478569.1,INSD:EH808871.1,INSD:EH918412.1,
FT                   INSD:BP868754.1,INSD:BP635498.1,INSD:EL314449.1,
FT                   INSD:EL143047.1,INSD:EH866397.1,INSD:EG501644.1,
FT                   INSD:DR260613.1,INSD:Z37258.1,INSD:EH846433.1,
FT                   INSD:EH843252.1,INSD:DR260605.1,INSD:EH925821.1,
FT                   INSD:EG501264.1,INSD:CD534634.1,INSD:DR260604.1,
FT                   INSD:EL039924.1,INSD:EL074206.1,INSD:DR260611.1,
FT                   INSD:EH866172.1,INSD:DR260602.1,INSD:BP850993.1,
FT                   INSD:EG504421.1,INSD:EG478568.1,INSD:CB260225.1,
FT                   INSD:EH797394.1,INSD:EG528399.1,INSD:EG489859.1,
FT                   INSD:BP613163.1,INSD:EH816289.1,INSD:AV790439.1,
FT                   INSD:EG474773.1,INSD:EH868574.1,INSD:EL264597.1,
FT                   INSD:DR260608.1,INSD:EL122717.1,INSD:BP632046.1,
FT                   INSD:EL202066.1,INSD:AV537107.1,INSD:BP612920.1,
FT                   INSD:DR260610.1,INSD:EL047465.1,INSD:EH798581.1,
FT                   INSD:EG501651.1,INSD:EG479300.1,INSD:BP609668.1,
FT                   INSD:EL267781.1,INSD:EL338600.1,INSD:BP632705.1,
FT                   INSD:BP635782.1,INSD:EG478603.1,INSD:EH799019.1,
FT                   INSD:EG432774.1,INSD:CD532558.1,INSD:EG508218.1,
FT                   INSD:BP620699.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX841965.1,INSD:AY074855.1,INSD:BX818671.1,
FT                   INSD:BT015111.1"
FT   CDS_pept        complement(join(172295..172544,172621..172826))
FT                   /codon_start=1
FT                   /gene="LEA14"
FT                   /gene_synonym="F22L4.3"
FT                   /gene_synonym="F22L4_3"
FT                   /gene_synonym="LATE EMBRYOGENESIS ABUNDANT 14"
FT                   /gene_synonym="LIGHT STRESS-REGULATED 3"
FT                   /gene_synonym="LSR3"
FT                   /gene_synonym="LEA1"
FT                   /locus_tag="AT1G01470"
FT                   /product="Late embryogenesis abundant protein"
FT                   /note="LATE EMBRYOGENESIS ABUNDANT 14 (LEA14); CONTAINS
FT                   InterPro DOMAIN/s: Water stress and hypersensitive response
FT                   domain (InterPro:IPR013990), Late embryogenesis abundant
FT                   protein, group 2 (InterPro:IPR004864); BEST Arabidopsis
FT                   thaliana protein match is: Late embryogenesis abundant
FT                   protein (TAIR:AT2G46140.1); Has 340 Blast hits to 340
FT                   proteins in 93 species: Archae - 0; Bacteria - 10; Metazoa
FT                   - 0; Fungi - 0; Plants - 329; Viruses - 0; Other Eukaryotes
FT                   - 1 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01470"
FT                   /db_xref="GOA:O03983"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="PDB:1XO8"
FT                   /db_xref="UniProtKB/Swiss-Prot:O03983"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP624808.1,INSD:CD530986.1,INSD:BP848865.1,
FT                   INSD:AV819336.1,INSD:CD530395.1,INSD:EG501645.1,
FT                   INSD:EG489860.1,INSD:AV823250.2,INSD:EH975104.1,
FT                   INSD:DR375791.1,INSD:BP847963.1,INSD:BP808268.1,
FT                   INSD:Z37259.1,INSD:EL321058.1,INSD:EG501633.1,
FT                   INSD:H76171.1,INSD:CD530356.1,INSD:EG436108.1,
FT                   INSD:EL132144.1,INSD:EL130667.1,INSD:EG456489.1,
FT                   INSD:EG510415.1,INSD:BP581374.1,INSD:EG504418.1,
FT                   INSD:EL246469.1,INSD:AV787755.1,INSD:DR260609.1,
FT                   INSD:BP843702.1,INSD:EG508236.1,INSD:EG501650.1,
FT                   INSD:EH864334.1,INSD:EL281860.1,INSD:R30106.1,
FT                   INSD:EL272470.1,INSD:BP616567.1,INSD:EG501649.1,
FT                   INSD:BP650777.1,INSD:CD530999.1,INSD:EL224185.1,
FT                   INSD:EH916820.1,INSD:EL038394.1,INSD:EH909449.1,
FT                   INSD:EG478604.1,INSD:CB261215.1,INSD:EH971597.1,
FT                   INSD:DR260607.1,INSD:DR260606.1,INSD:DR260603.1,
FT                   INSD:CD531490.1,INSD:BP796430.1,INSD:EL192430.1,
FT                   INSD:CD531286.1,INSD:EH846632.1,INSD:EH836830.1,
FT                   INSD:EL121966.1,INSD:BP852279.1,INSD:EL259749.1,
FT                   INSD:EL315283.1,INSD:EG475792.1,INSD:AV784184.1,
FT                   INSD:AV782620.1,INSD:CD531790.1,INSD:DR260612.1,
FT                   INSD:AI994095.1,INSD:EG510416.1,INSD:EH957689.1,
FT                   INSD:EH943227.1,INSD:EH991848.1,INSD:EH992479.1,
FT                   INSD:EL069114.1,INSD:CD531544.1,INSD:EG501648.1,
FT                   INSD:EG508217.1,INSD:EG508244.1,INSD:EG508235.1,
FT                   INSD:EG478569.1,INSD:EH808871.1,INSD:EH918412.1,
FT                   INSD:BP868754.1,INSD:BP635498.1,INSD:EL314449.1,
FT                   INSD:EL143047.1,INSD:EH866397.1,INSD:EG501644.1,
FT                   INSD:DR260613.1,INSD:Z37258.1,INSD:EH846433.1,
FT                   INSD:EH843252.1,INSD:DR260605.1,INSD:EH925821.1,
FT                   INSD:EG501264.1,INSD:CD534634.1,INSD:DR260604.1,
FT                   INSD:EL039924.1,INSD:EL074206.1,INSD:DR260611.1,
FT                   INSD:EH866172.1,INSD:DR260602.1,INSD:BP850993.1,
FT                   INSD:EG504421.1,INSD:EG478568.1,INSD:CB260225.1,
FT                   INSD:EH797394.1,INSD:EG528399.1,INSD:EG489859.1,
FT                   INSD:BP613163.1,INSD:EH816289.1,INSD:AV790439.1,
FT                   INSD:EG474773.1,INSD:EH868574.1,INSD:EL264597.1,
FT                   INSD:DR260608.1,INSD:EL122717.1,INSD:BP632046.1,
FT                   INSD:EL202066.1,INSD:AV537107.1,INSD:BP612920.1,
FT                   INSD:DR260610.1,INSD:EL047465.1,INSD:EH798581.1,
FT                   INSD:EG501651.1,INSD:EG479300.1,INSD:BP609668.1,
FT                   INSD:EL267781.1,INSD:EL338600.1,INSD:BP632705.1,
FT                   INSD:BP635782.1,INSD:EG478603.1,INSD:EH799019.1,
FT                   INSD:EG432774.1,INSD:CD532558.1,INSD:EG508218.1,
FT                   INSD:BP620699.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX841965.1,INSD:AY074855.1,INSD:BX818671.1,
FT                   INSD:BT015111.1"
FT                   /protein_id="AEE27291.1"
FT                   /translation="MASLLDKAKDFVADKLTAIPKPEGSVTDVDLKDVNRDSVEYLAKV
FT                   SVTNPYSHSIPICEISFTFHSAGREIGKGKIPDPGSLKAKDMTALDIPVVVPYSILFNL
FT                   ARDVGVDWDIDYELQIGLTIDLPVVGEFTIPISSKGEIKLPTFKDFF"
FT   gene            175706..178406
FT                   /gene="ACS2"
FT                   /gene_synonym="1-amino-cyclopropane-1-carboxylate synthase
FT                   2"
FT                   /gene_synonym="1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE"
FT                   /gene_synonym="AT-ACC2"
FT                   /gene_synonym="EC 4.4.1.14"
FT                   /gene_synonym="F22L4.4"
FT                   /gene_synonym="F22L4_4"
FT                   /gene_synonym="S-ADENOSYL-L-METHIONINE
FT                   METHYLTHIOADENOSINE-LYASE"
FT                   /locus_tag="AT1G01480"
FT                   /note="a member of the 1-aminocyclopropane-1-carboxylate
FT                   (ACC) synthase (S-adenosyl-L-methionine
FT                   methylthioadenosine-lyase, EC 4.4.1.14) gene family,
FT                   isolated from a flower-specific cDNA library."
FT   mRNA            join(175706..176032,176207..176338,176592..176752,
FT                   177025..178406)
FT                   /gene="ACS2"
FT                   /gene_synonym="1-amino-cyclopropane-1-carboxylate synthase
FT                   2"
FT                   /gene_synonym="1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE"
FT                   /gene_synonym="AT-ACC2"
FT                   /gene_synonym="EC 4.4.1.14"
FT                   /gene_synonym="F22L4.4"
FT                   /gene_synonym="F22L4_4"
FT                   /gene_synonym="S-ADENOSYL-L-METHIONINE
FT                   METHYLTHIOADENOSINE-LYASE"
FT                   /locus_tag="AT1G01480"
FT                   /product="1-amino-cyclopropane-1-carboxylate synthase 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL320586.1,INSD:EG528116.1,INSD:BE038138.1,
FT                   INSD:EG490665.1,INSD:EG432329.1,INSD:EG432340.1,
FT                   INSD:BE530452.1,INSD:BP659127.1,INSD:AV787991.1,
FT                   INSD:EG528115.1,INSD:BP655684.1,INSD:CB252093.1,
FT                   INSD:CD529827.1,INSD:EG490664.1,INSD:AV563225.1,
FT                   INSD:BP648177.1,INSD:AW004327.1,INSD:EL170366.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:M95595.1,INSD:AY143877.1,INSD:BX814896.1,
FT                   INSD:AF334719.1"
FT   CDS_pept        join(175862..176032,176207..176338,176592..176752,
FT                   177025..178051)
FT                   /codon_start=1
FT                   /gene="ACS2"
FT                   /gene_synonym="1-amino-cyclopropane-1-carboxylate synthase
FT                   2"
FT                   /gene_synonym="1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE"
FT                   /gene_synonym="AT-ACC2"
FT                   /gene_synonym="EC 4.4.1.14"
FT                   /gene_synonym="F22L4.4"
FT                   /gene_synonym="F22L4_4"
FT                   /gene_synonym="S-ADENOSYL-L-METHIONINE
FT                   METHYLTHIOADENOSINE-LYASE"
FT                   /locus_tag="AT1G01480"
FT                   /product="1-amino-cyclopropane-1-carboxylate synthase 2"
FT                   /note="1-amino-cyclopropane-1-carboxylate synthase 2
FT                   (ACS2); CONTAINS InterPro DOMAIN/s:
FT                   1-aminocyclopropane-1-carboxylate synthase
FT                   (InterPro:IPR001176), Aminotransferase, class I/classII
FT                   (InterPro:IPR004839), Pyridoxal phosphate-dependent
FT                   transferase, major domain (InterPro:IPR015424),
FT                   Aminotransferases, class-I, pyridoxal-phosphate-binding
FT                   site (InterPro:IPR004838), Pyridoxal phosphate-dependent
FT                   transferase, major region, subdomain 2
FT                   (InterPro:IPR015422), Pyridoxal phosphate-dependent
FT                   transferase, major region, subdomain 1
FT                   (InterPro:IPR015421); BEST Arabidopsis thaliana protein
FT                   match is: ACC synthase 1 (TAIR:AT3G61510.1); Has 30194
FT                   Blast hits to 30192 proteins in 2936 species: Archae - 881;
FT                   Bacteria - 20730; Metazoa - 650; Fungi - 807; Plants -
FT                   1338; Viruses - 0; Other Eukaryotes - 5788 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q06402"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06402"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL320586.1,INSD:EG528116.1,INSD:BE038138.1,
FT                   INSD:EG490665.1,INSD:EG432329.1,INSD:EG432340.1,
FT                   INSD:BE530452.1,INSD:BP659127.1,INSD:AV787991.1,
FT                   INSD:EG528115.1,INSD:BP655684.1,INSD:CB252093.1,
FT                   INSD:CD529827.1,INSD:EG490664.1,INSD:AV563225.1,
FT                   INSD:BP648177.1,INSD:AW004327.1,INSD:EL170366.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:M95595.1,INSD:AY143877.1,INSD:BX814896.1,
FT                   INSD:AF334719.1"
FT                   /protein_id="AEE27293.1"
FT                   /translation="MGLPGKNKGAVLSKIATNNQHGENSEYFDGWKAYDKDPFHLSRNP
FT                   HGIIQMGLAENQLCLDLIKDWVKENPEASICTLEGIHQFSDIANFQDYHGLKKFRQAIA
FT                   HFMGKARGGRVTFDPERVVMSGGATGANETIMFCLADPGDVFLIPSPYYAAFDRDLRWR
FT                   TGVEIIPVPCSSSDNFKLTVDAAEWAYKKAQESNKKVKGLILTNPSNPLGTMLDKDTLT
FT                   NLVRFVTRKNIHLVVDEIYAATVFAGGDFVSVAEVVNDVDISEVNVDLIHIVYSLSKDM
FT                   GLPGFRVGIVYSFNDSVVSCARKMSSFGLVSSQTQLMLASMLSDDQFVDNFLMESSRRL
FT                   GIRHKVFTTGIKKADIACLTSNAGLFAWMDLRHLLRDRNSFESEIELWHIIIDRVKLNV
FT                   SPGSSFRCTEPGWFRICFANMDDDTLHVALGRIQDFVSKNKNKIVEKASENDQVIQNKS
FT                   AKKLKWTQTNLRLSFRRLYEDGLSSPGIMSPHSPLLRA"
FT   mRNA            join(176141..176338,176592..176752,177025..178400)
FT                   /gene="ACS2"
FT                   /gene_synonym="1-amino-cyclopropane-1-carboxylate synthase
FT                   2"
FT                   /gene_synonym="1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE"
FT                   /gene_synonym="AT-ACC2"
FT                   /gene_synonym="EC 4.4.1.14"
FT                   /gene_synonym="F22L4.4"
FT                   /gene_synonym="F22L4_4"
FT                   /gene_synonym="S-ADENOSYL-L-METHIONINE
FT                   METHYLTHIOADENOSINE-LYASE"
FT                   /locus_tag="AT1G01480"
FT                   /product="1-amino-cyclopropane-1-carboxylate synthase 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL320586.1,INSD:BE038138.1,INSD:EG432329.1,
FT                   INSD:EG432340.1,INSD:BE530452.1,INSD:BP659127.1,
FT                   INSD:AV787991.1,INSD:AV824827.1,INSD:BP655684.1,
FT                   INSD:CD529827.1,INSD:AV563225.1,INSD:BP648177.1,
FT                   INSD:EL170366.1,INSD:AW004327.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY143877.1,INSD:AY052207.1"
FT   CDS_pept        join(176607..176752,177025..178051)
FT                   /codon_start=1
FT                   /gene="ACS2"
FT                   /gene_synonym="1-amino-cyclopropane-1-carboxylate synthase
FT                   2"
FT                   /gene_synonym="1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE"
FT                   /gene_synonym="AT-ACC2"
FT                   /gene_synonym="EC 4.4.1.14"
FT                   /gene_synonym="F22L4.4"
FT                   /gene_synonym="F22L4_4"
FT                   /gene_synonym="S-ADENOSYL-L-METHIONINE
FT                   METHYLTHIOADENOSINE-LYASE"
FT                   /locus_tag="AT1G01480"
FT                   /product="1-amino-cyclopropane-1-carboxylate synthase 2"
FT                   /note="1-amino-cyclopropane-1-carboxylate synthase 2
FT                   (ACS2); CONTAINS InterPro DOMAIN/s:
FT                   1-aminocyclopropane-1-carboxylate synthase
FT                   (InterPro:IPR001176), Pyridoxal phosphate-dependent
FT                   transferase, major domain (InterPro:IPR015424),
FT                   Aminotransferase, class I/classII (InterPro:IPR004839),
FT                   Aminotransferases, class-I, pyridoxal-phosphate-binding
FT                   site (InterPro:IPR004838), Pyridoxal phosphate-dependent
FT                   transferase, major region, subdomain 1
FT                   (InterPro:IPR015421), Pyridoxal phosphate-dependent
FT                   transferase, major region, subdomain 2
FT                   (InterPro:IPR015422); BEST Arabidopsis thaliana protein
FT                   match is: ACC synthase 1 (TAIR:AT3G61510.1); Has 28365
FT                   Blast hits to 28364 proteins in 2923 species: Archae - 821;
FT                   Bacteria - 19365; Metazoa - 634; Fungi - 793; Plants -
FT                   1286; Viruses - 0; Other Eukaryotes - 5466 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01480"
FT                   /db_xref="GOA:Q06402"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06402"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL320586.1,INSD:BE038138.1,INSD:EG432329.1,
FT                   INSD:EG432340.1,INSD:BE530452.1,INSD:BP659127.1,
FT                   INSD:AV787991.1,INSD:AV824827.1,INSD:BP655684.1,
FT                   INSD:CD529827.1,INSD:AV563225.1,INSD:BP648177.1,
FT                   INSD:EL170366.1,INSD:AW004327.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY143877.1,INSD:AY052207.1"
FT                   /protein_id="AEE27294.1"
FT                   /translation="MGKARGGRVTFDPERVVMSGGATGANETIMFCLADPGDVFLIPSP
FT                   YYAAFDRDLRWRTGVEIIPVPCSSSDNFKLTVDAAEWAYKKAQESNKKVKGLILTNPSN
FT                   PLGTMLDKDTLTNLVRFVTRKNIHLVVDEIYAATVFAGGDFVSVAEVVNDVDISEVNVD
FT                   LIHIVYSLSKDMGLPGFRVGIVYSFNDSVVSCARKMSSFGLVSSQTQLMLASMLSDDQF
FT                   VDNFLMESSRRLGIRHKVFTTGIKKADIACLTSNAGLFAWMDLRHLLRDRNSFESEIEL
FT                   WHIIIDRVKLNVSPGSSFRCTEPGWFRICFANMDDDTLHVALGRIQDFVSKNKNKIVEK
FT                   ASENDQVIQNKSAKKLKWTQTNLRLSFRRLYEDGLSSPGIMSPHSPLLRA"
FT   gene            complement(180017..182749)
FT                   /gene_synonym="F22L4.5"
FT                   /gene_synonym="F22L4_5"
FT                   /locus_tag="AT1G01490"
FT   mRNA            complement(join(180017..180852,181347..182135,
FT                   182253..182534))
FT                   /gene_synonym="F22L4.5"
FT                   /gene_synonym="F22L4_5"
FT                   /locus_tag="AT1G01490"
FT                   /product="Heavy metal transport/detoxification superfamily
FT                   protein"
FT   mRNA            complement(join(180018..180852,181347..181422,
FT                   181594..182135,182253..182497))
FT                   /gene_synonym="F22L4.5"
FT                   /gene_synonym="F22L4_5"
FT                   /locus_tag="AT1G01490"
FT                   /product="Heavy metal transport/detoxification superfamily
FT                   protein"
FT   mRNA            complement(join(180056..180852,181347..181422,
FT                   182061..182135,182253..182749))
FT                   /gene_synonym="F22L4.5"
FT                   /gene_synonym="F22L4_5"
FT                   /locus_tag="AT1G01490"
FT                   /product="Heavy metal transport/detoxification superfamily
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL005002.1,INSD:T13955.1,INSD:BP603370.1,
FT                   INSD:EH915489.1,INSD:EL272441.1,INSD:BP805901.1,
FT                   INSD:EH848811.1,INSD:DR375233.1,INSD:EG503065.1,
FT                   INSD:EG506310.1,INSD:EH983666.1,INSD:EH844395.1,
FT                   INSD:EG458415.1,INSD:EG503076.1,INSD:EL102999.1,
FT                   INSD:BP804321.1,INSD:DR192957.1,INSD:BP853820.1,
FT                   INSD:EH830751.1,INSD:DR192958.1,INSD:EG450174.1,
FT                   INSD:AV522013.1,INSD:EG504330.1,INSD:EL211972.1,
FT                   INSD:EL087984.1,INSD:EL101822.1,INSD:EH958207.1,
FT                   INSD:BP622853.1,INSD:EL294794.1,INSD:EG458416.1,
FT                   INSD:EG450180.1,INSD:EG450179.1,INSD:EH942930.1,
FT                   INSD:BP655832.1,INSD:EL040196.1,INSD:EL047479.1,
FT                   INSD:EH940782.1,INSD:BP630265.1,INSD:AI993148.1,
FT                   INSD:EH925573.1,INSD:BP829755.1,INSD:BP808281.1,
FT                   INSD:EL056657.1,INSD:EH909483.1,INSD:AV825123.1,
FT                   INSD:BP660068.1,INSD:EL130792.1,INSD:ES006703.1,
FT                   INSD:EL164595.1,INSD:T44360.1,INSD:EL244174.1,
FT                   INSD:BP644636.1,INSD:EH847808.1,INSD:EL035297.1,
FT                   INSD:EL105534.1,INSD:BP621356.1,INSD:EL230398.1,
FT                   INSD:AV790044.1,INSD:CD529641.1,INSD:EG450168.1,
FT                   INSD:EG506302.1,INSD:EH976381.1,INSD:EG440393.1,
FT                   INSD:BP622851.1,INSD:BP634423.1,INSD:ES194289.1,
FT                   INSD:EG425715.1,INSD:EH870930.1,INSD:EL065141.1,
FT                   INSD:EG504327.1,INSD:EH858374.1,INSD:EL105319.1,
FT                   INSD:T44306.1,INSD:EH925566.1,INSD:EG450176.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY063805.1,INSD:BX815252.1"
FT   mRNA            complement(join(180056..180852,181347..181422,
FT                   182061..182749))
FT                   /gene_synonym="F22L4.5"
FT                   /gene_synonym="F22L4_5"
FT                   /locus_tag="AT1G01490"
FT                   /product="Heavy metal transport/detoxification superfamily
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL005002.1,INSD:BP603370.1,INSD:EH915489.1,
FT                   INSD:EH848811.1,INSD:DR375233.1,INSD:EG503065.1,
FT                   INSD:EH983666.1,INSD:EH844395.1,INSD:EG458415.1,
FT                   INSD:EL075061.1,INSD:EG503076.1,INSD:EL102999.1,
FT                   INSD:BP804321.1,INSD:DR192957.1,INSD:DR192958.1,
FT                   INSD:EG450174.1,INSD:AV522013.1,INSD:EL087984.1,
FT                   INSD:EH958207.1,INSD:BP622853.1,INSD:EL294794.1,
FT                   INSD:EG458416.1,INSD:EG450180.1,INSD:EH942930.1,
FT                   INSD:EG450179.1,INSD:BP655832.1,INSD:EL040196.1,
FT                   INSD:EL047479.1,INSD:BP630265.1,INSD:AI993148.1,
FT                   INSD:EH925573.1,INSD:EL056657.1,INSD:EH909483.1,
FT                   INSD:BP660068.1,INSD:EL130792.1,INSD:ES006703.1,
FT                   INSD:EL164595.1,INSD:EL244174.1,INSD:T44360.1,
FT                   INSD:BP644636.1,INSD:EH847808.1,INSD:EL035297.1,
FT                   INSD:EL105534.1,INSD:BP621356.1,INSD:AV790044.1,
FT                   INSD:CB255080.1,INSD:CD529641.1,INSD:EG450168.1,
FT                   INSD:EH976381.1,INSD:EG440393.1,INSD:BP622851.1,
FT                   INSD:BP634423.1,INSD:EG425715.1,INSD:ES194289.1,
FT                   INSD:EH870930.1,INSD:EL065141.1,INSD:EH858374.1,
FT                   INSD:EL105319.1,INSD:EG450176.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX815252.1"
FT   CDS_pept        complement(join(180401..180852,181347..181422,
FT                   182061..182066))
FT                   /codon_start=1
FT                   /gene_synonym="F22L4.5"
FT                   /gene_synonym="F22L4_5"
FT                   /locus_tag="AT1G01490"
FT                   /product="Heavy metal transport/detoxification superfamily
FT                   protein"
FT                   /note="Heavy metal transport/detoxification superfamily
FT                   protein; FUNCTIONS IN: metal ion binding; INVOLVED IN:
FT                   metal ion transport; LOCATED IN: cellular_component
FT                   unknown; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Heavy
FT                   metal transport/detoxification protein
FT                   (InterPro:IPR006121); BEST Arabidopsis thaliana protein
FT                   match is: Heavy metal transport/detoxification superfamily
FT                   protein (TAIR:AT1G63950.1); Has 7083 Blast hits to 3987
FT                   proteins in 399 species: Archae - 47; Bacteria - 875;
FT                   Metazoa - 1731; Fungi - 337; Plants - 1157; Viruses - 96;
FT                   Other Eukaryotes - 2840 (source: NCBI BLink)."
FT                   /db_xref="GOA:O03982"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/Swiss-Prot:O03982"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL005002.1,INSD:T13955.1,INSD:BP603370.1,
FT                   INSD:EH915489.1,INSD:EL272441.1,INSD:BP805901.1,
FT                   INSD:EH848811.1,INSD:DR375233.1,INSD:EG503065.1,
FT                   INSD:EG506310.1,INSD:EH983666.1,INSD:EH844395.1,
FT                   INSD:EG458415.1,INSD:EG503076.1,INSD:EL102999.1,
FT                   INSD:BP804321.1,INSD:DR192957.1,INSD:BP853820.1,
FT                   INSD:EH830751.1,INSD:DR192958.1,INSD:EG450174.1,
FT                   INSD:AV522013.1,INSD:EG504330.1,INSD:EL211972.1,
FT                   INSD:EL087984.1,INSD:EL101822.1,INSD:EH958207.1,
FT                   INSD:BP622853.1,INSD:EL294794.1,INSD:EG458416.1,
FT                   INSD:EG450180.1,INSD:EG450179.1,INSD:EH942930.1,
FT                   INSD:BP655832.1,INSD:EL040196.1,INSD:EL047479.1,
FT                   INSD:EH940782.1,INSD:BP630265.1,INSD:AI993148.1,
FT                   INSD:EH925573.1,INSD:BP829755.1,INSD:BP808281.1,
FT                   INSD:EL056657.1,INSD:EH909483.1,INSD:AV825123.1,
FT                   INSD:BP660068.1,INSD:EL130792.1,INSD:ES006703.1,
FT                   INSD:EL164595.1,INSD:T44360.1,INSD:EL244174.1,
FT                   INSD:BP644636.1,INSD:EH847808.1,INSD:EL035297.1,
FT                   INSD:EL105534.1,INSD:BP621356.1,INSD:EL230398.1,
FT                   INSD:AV790044.1,INSD:CD529641.1,INSD:EG450168.1,
FT                   INSD:EG506302.1,INSD:EH976381.1,INSD:EG440393.1,
FT                   INSD:BP622851.1,INSD:BP634423.1,INSD:ES194289.1,
FT                   INSD:EG425715.1,INSD:EH870930.1,INSD:EL065141.1,
FT                   INSD:EG504327.1,INSD:EH858374.1,INSD:EL105319.1,
FT                   INSD:T44306.1,INSD:EH925566.1,INSD:EG450176.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY063805.1,INSD:BX815252.1"
FT                   /protein_id="AEE27295.1"
FT                   /translation="MKKIVLKLDLHDDRAKQKALKTVSTLPGIDSIAMDMKEKKLTVIG
FT                   TVDPVNVVSKLRKYWPMTDIVLVGPAKEPEKEKKEEPKKEGGGEPPKKEGEAPKEEGKK
FT                   EGEAPKKEEEKKEGGDKKEGEKKDQPQAQPQPVVPPPDHVLELVKAYKAYNPHLTTYYY
FT                   AQSIEENPNACVIC"
FT   CDS_pept        complement(join(180401..180852,181347..181422,
FT                   182061..182066))
FT                   /codon_start=1
FT                   /gene_synonym="F22L4.5"
FT                   /gene_synonym="F22L4_5"
FT                   /locus_tag="AT1G01490"
FT                   /product="Heavy metal transport/detoxification superfamily
FT                   protein"
FT                   /note="Heavy metal transport/detoxification superfamily
FT                   protein; FUNCTIONS IN: metal ion binding; INVOLVED IN:
FT                   metal ion transport; LOCATED IN: cellular_component
FT                   unknown; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Heavy
FT                   metal transport/detoxification protein
FT                   (InterPro:IPR006121); BEST Arabidopsis thaliana protein
FT                   match is: Heavy metal transport/detoxification superfamily
FT                   protein (TAIR:AT1G63950.1); Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="GOA:O03982"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/Swiss-Prot:O03982"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL005002.1,INSD:BP603370.1,INSD:EH915489.1,
FT                   INSD:EH848811.1,INSD:DR375233.1,INSD:EG503065.1,
FT                   INSD:EH983666.1,INSD:EH844395.1,INSD:EG458415.1,
FT                   INSD:EL075061.1,INSD:EG503076.1,INSD:EL102999.1,
FT                   INSD:BP804321.1,INSD:DR192957.1,INSD:DR192958.1,
FT                   INSD:EG450174.1,INSD:AV522013.1,INSD:EL087984.1,
FT                   INSD:EH958207.1,INSD:BP622853.1,INSD:EL294794.1,
FT                   INSD:EG458416.1,INSD:EG450180.1,INSD:EH942930.1,
FT                   INSD:EG450179.1,INSD:BP655832.1,INSD:EL040196.1,
FT                   INSD:EL047479.1,INSD:BP630265.1,INSD:AI993148.1,
FT                   INSD:EH925573.1,INSD:EL056657.1,INSD:EH909483.1,
FT                   INSD:BP660068.1,INSD:EL130792.1,INSD:ES006703.1,
FT                   INSD:EL164595.1,INSD:EL244174.1,INSD:T44360.1,
FT                   INSD:BP644636.1,INSD:EH847808.1,INSD:EL035297.1,
FT                   INSD:EL105534.1,INSD:BP621356.1,INSD:AV790044.1,
FT                   INSD:CB255080.1,INSD:CD529641.1,INSD:EG450168.1,
FT                   INSD:EH976381.1,INSD:EG440393.1,INSD:BP622851.1,
FT                   INSD:BP634423.1,INSD:EG425715.1,INSD:ES194289.1,
FT                   INSD:EH870930.1,INSD:EL065141.1,INSD:EH858374.1,
FT                   INSD:EL105319.1,INSD:EG450176.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX815252.1"
FT                   /protein_id="AEE27296.1"
FT                   /translation="MKKIVLKLDLHDDRAKQKALKTVSTLPGIDSIAMDMKEKKLTVIG
FT                   TVDPVNVVSKLRKYWPMTDIVLVGPAKEPEKEKKEEPKKEGGGEPPKKEGEAPKEEGKK
FT                   EGEAPKKEEEKKEGGDKKEGEKKDQPQAQPQPVVPPPDHVLELVKAYKAYNPHLTTYYY
FT                   AQSIEENPNACVIC"
FT   CDS_pept        complement(join(180401..180852,181347..181422,
FT                   181594..181680))
FT                   /codon_start=1
FT                   /gene_synonym="F22L4.5"
FT                   /gene_synonym="F22L4_5"
FT                   /locus_tag="AT1G01490"
FT                   /product="Heavy metal transport/detoxification superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01490"
FT                   /db_xref="GOA:A0A1P8AS52"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AS52"
FT                   /protein_id="ANM59483.1"
FT                   /translation="MMSMPLLLQNSVSLLYMFTQIHMHVTLCVKIVLKLDLHDDRAKQK
FT                   ALKTVSTLPGIDSIAMDMKEKKLTVIGTVDPVNVVSKLRKYWPMTDIVLVGPAKEPEKE
FT                   KKEEPKKEGGGEPPKKEGEAPKEEGKKEGEAPKKEEEKKEGGDKKEGEKKDQPQAQPQP
FT                   VVPPPDHVLELVKAYKAYNPHLTTYYYAQSIEENPNACVIC"
FT   CDS_pept        complement(180401..180835)
FT                   /codon_start=1
FT                   /gene_synonym="F22L4.5"
FT                   /gene_synonym="F22L4_5"
FT                   /locus_tag="AT1G01490"
FT                   /product="Heavy metal transport/detoxification superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AS50"
FT                   /protein_id="ANM59482.1"
FT                   /translation="MDMKEKKLTVIGTVDPVNVVSKLRKYWPMTDIVLVGPAKEPEKEK
FT                   KEEPKKEGGGEPPKKEGEAPKEEGKKEGEAPKKEEEKKEGGDKKEGEKKDQPQAQPQPV
FT                   VPPPDHVLELVKAYKAYNPHLTTYYYAQSIEENPNACVIC"
FT   gene            185033..187135
FT                   /gene_synonym="F22L4.17"
FT                   /gene_synonym="F22L4_17"
FT                   /locus_tag="AT1G01500"
FT   mRNA            join(185033..186009,186340..187135)
FT                   /gene_synonym="F22L4.17"
FT                   /gene_synonym="F22L4_17"
FT                   /locus_tag="AT1G01500"
FT                   /product="Erythronate-4-phosphate dehydrogenase family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR250060.1,INSD:EH827092.1,INSD:AV814424.1,
FT                   INSD:DR370930.1,INSD:DR250062.1,INSD:AV538205.1,
FT                   INSD:DR250065.1,INSD:DR250061.1,INSD:AV521864.1,
FT                   INSD:EL149293.1,INSD:DR250066.1,INSD:AV831028.1,
FT                   INSD:EL287157.1,INSD:EH951839.1,INSD:BE526856.1,
FT                   INSD:EH858155.1,INSD:DR250063.1,INSD:DR250064.1,
FT                   INSD:EG456024.1,INSD:DR250059.1,INSD:EL176498.1,
FT                   INSD:EH847027.1,INSD:EL285745.1,INSD:DR250067.1,
FT                   INSD:CA781495.1,INSD:EL229433.1,INSD:EL335960.1,
FT                   INSD:EL217346.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX816623.1,INSD:AK227140.1,INSD:BT002511.1,
FT                   INSD:BT008724.1,INSD:Y10087.1,INSD:BX817237.1,
FT                   INSD:BX813518.1,INSD:BX815094.1,INSD:BX817628.1,
FT                   INSD:BX815178.1,INSD:AY088357.1,INSD:BX816231.1,
FT                   INSD:BX816042.1"
FT   CDS_pept        join(185260..186009,186340..186573)
FT                   /codon_start=1
FT                   /gene_synonym="F22L4.17"
FT                   /gene_synonym="F22L4_17"
FT                   /locus_tag="AT1G01500"
FT                   /product="Erythronate-4-phosphate dehydrogenase family
FT                   protein"
FT                   /note="Erythronate-4-phosphate dehydrogenase family
FT                   protein; BEST Arabidopsis thaliana protein match is:
FT                   Erythronate-4-phosphate dehydrogenase family protein
FT                   (TAIR:AT1G19400.2); Has 143 Blast hits to 143 proteins in
FT                   19 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 143; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q8GUH2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GUH2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR250060.1,INSD:EH827092.1,INSD:AV814424.1,
FT                   INSD:DR370930.1,INSD:DR250062.1,INSD:AV538205.1,
FT                   INSD:DR250065.1,INSD:DR250061.1,INSD:AV521864.1,
FT                   INSD:EL149293.1,INSD:DR250066.1,INSD:AV831028.1,
FT                   INSD:EL287157.1,INSD:EH951839.1,INSD:BE526856.1,
FT                   INSD:EH858155.1,INSD:DR250063.1,INSD:DR250064.1,
FT                   INSD:EG456024.1,INSD:DR250059.1,INSD:EL176498.1,
FT                   INSD:EH847027.1,INSD:EL285745.1,INSD:DR250067.1,
FT                   INSD:CA781495.1,INSD:EL229433.1,INSD:EL335960.1,
FT                   INSD:EL217346.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX816623.1,INSD:AK227140.1,INSD:BT002511.1,
FT                   INSD:BT008724.1,INSD:Y10087.1,INSD:BX817237.1,
FT                   INSD:BX813518.1,INSD:BX815094.1,INSD:BX817628.1,
FT                   INSD:BX815178.1,INSD:AY088357.1,INSD:BX816231.1,
FT                   INSD:BX816042.1"
FT                   /protein_id="AEE27297.1"
FT                   /translation="MISKDHLHHLDPLGTTKSYHMNTSTVSPPSPASSISLSQSAWLEV
FT                   RLFYVRIAPCVVENVPDFLTLRHPRRETGASLEVNGVRVPSSQTASLKLRRDRVDRESS
FT                   EVTYVSTETVRVTGCVDFEVYDNEDMVLCGNLDRIEGAWNNGTVSDPKTGWGMDCYIAM
FT                   GNGHVSGPSASVFFQPKFGVSSPSVEVYIAGCCGGVPVILTKTIQASPRRKVARHVTLD
FT                   AIPEDEEVGKEQDIGTIGDELARQSKVQMMESEVDEYDDSDMKMAQRYYPEGMYVDEDG
FT                   QLSWFNAGVRVGVGIGLGMCLGVGIGVGLLMRSYQATTSNLRRRFL"
FT   gene            187145..190472
FT                   /gene="AN"
FT                   /gene_synonym="ANGUSTIFOLIA"
FT                   /gene_synonym="DETORQUEO"
FT                   /gene_synonym="DOQ"
FT                   /gene_synonym="F22L4.6"
FT                   /gene_synonym="F22L4_6"
FT                   /locus_tag="AT1G01510"
FT                   /note="Encodes a homolog of human CtBP. Mutant has longer
FT                   and thicker leaves than wild type. Involved in controlling
FT                   polar cell expansion in the leaf width direction."
FT   mRNA            join(187145..187822,188011..188176,188284..188414,
FT                   188529..189320,189417..189464,189562..189675,
FT                   189765..190472)
FT                   /gene="AN"
FT                   /gene_synonym="ANGUSTIFOLIA"
FT                   /gene_synonym="DETORQUEO"
FT                   /gene_synonym="DOQ"
FT                   /gene_synonym="F22L4.6"
FT                   /gene_synonym="F22L4_6"
FT                   /locus_tag="AT1G01510"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH814661.1,INSD:ES172146.1,INSD:CF774056.1,
FT                   INSD:ES068539.1,INSD:AV799066.1,INSD:EG468829.1,
FT                   INSD:ES207784.1,INSD:BP665891.1,INSD:BP789359.1,
FT                   INSD:ES030338.1,INSD:EH812442.1,INSD:EL985953.1,
FT                   INSD:CB253293.1,INSD:EL298271.1,INSD:EL097457.1,
FT                   INSD:BP862611.1,INSD:BP854502.1,INSD:EL286304.1,
FT                   INSD:EH862161.1,INSD:AV548200.1,INSD:BP809692.1,
FT                   INSD:EL989784.1,INSD:EH877145.1,INSD:ES103103.1,
FT                   INSD:EH868522.1,INSD:Z48386.1,INSD:ES120248.1,
FT                   INSD:ES108599.1,INSD:ES027927.1,INSD:ES065046.1,
FT                   INSD:EG475343.1,INSD:EL058605.1,INSD:BP839029.1,
FT                   INSD:EL316145.1,INSD:EL179697.1,INSD:Z48385.1,
FT                   INSD:EG475241.1,INSD:EH985639.1,INSD:ES014081.1,
FT                   INSD:CB253714.1,INSD:EG475341.1,INSD:ES147313.1,
FT                   INSD:BP813530.1,INSD:EL276158.1,INSD:EL232632.1,
FT                   INSD:EG468818.1,INSD:EH845594.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY059829.1,INSD:BT000155.1,INSD:AB032060.1"
FT   CDS_pept        join(187235..187822,188011..188176,188284..188414,
FT                   188529..189320,189417..189464,189562..189675,
FT                   189765..189836)
FT                   /codon_start=1
FT                   /gene="AN"
FT                   /gene_synonym="ANGUSTIFOLIA"
FT                   /gene_synonym="F22L4.6"
FT                   /gene_synonym="F22L4_6"
FT                   /gene_synonym="DETORQUEO"
FT                   /gene_synonym="DOQ"
FT                   /locus_tag="AT1G01510"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /note="ANGUSTIFOLIA (AN); CONTAINS InterPro DOMAIN/s:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
FT                   (InterPro:IPR006140), NAD(P)-binding domain
FT                   (InterPro:IPR016040); BEST Arabidopsis thaliana protein
FT                   match is: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein (TAIR:AT1G12550.1); Has 20556 Blast hits to
FT                   20427 proteins in 2617 species: Archae - 372; Bacteria -
FT                   13694; Metazoa - 624; Fungi - 929; Plants - 529; Viruses -
FT                   5; Other Eukaryotes - 4403 (source: NCBI BLink)."
FT                   /db_xref="GOA:O23702"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23702"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH814661.1,INSD:ES172146.1,INSD:CF774056.1,
FT                   INSD:ES068539.1,INSD:AV799066.1,INSD:EG468829.1,
FT                   INSD:ES207784.1,INSD:BP665891.1,INSD:BP789359.1,
FT                   INSD:ES030338.1,INSD:EH812442.1,INSD:EL985953.1,
FT                   INSD:CB253293.1,INSD:EL298271.1,INSD:EL097457.1,
FT                   INSD:BP862611.1,INSD:BP854502.1,INSD:EL286304.1,
FT                   INSD:EH862161.1,INSD:AV548200.1,INSD:BP809692.1,
FT                   INSD:EL989784.1,INSD:EH877145.1,INSD:ES103103.1,
FT                   INSD:EH868522.1,INSD:Z48386.1,INSD:ES120248.1,
FT                   INSD:ES108599.1,INSD:ES027927.1,INSD:ES065046.1,
FT                   INSD:EG475343.1,INSD:EL058605.1,INSD:BP839029.1,
FT                   INSD:EL316145.1,INSD:EL179697.1,INSD:Z48385.1,
FT                   INSD:EG475241.1,INSD:EH985639.1,INSD:ES014081.1,
FT                   INSD:CB253714.1,INSD:EG475341.1,INSD:ES147313.1,
FT                   INSD:BP813530.1,INSD:EL276158.1,INSD:EL232632.1,
FT                   INSD:EG468818.1,INSD:EH845594.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY059829.1,INSD:BT000155.1,INSD:AB032060.1"
FT                   /protein_id="AEE27298.1"
FT                   /translation="MSKIRSSATMPHRDQPSPASPHVVTLNCIEDCALEQDSLAGVAGV
FT                   EYVPLSRIADGKIESATAVLLHSLAYLPRAAQRRLRPHQLILCLGSADRAVDSTLAADL
FT                   GLRLVHVDTSRAEEIADTVMALILGLLRRTHLLSRHALSASGWLGSLQPLCRGMRRCRG
FT                   MVLGIVGRSVSARYLASRSLAFKMSVLYFDVPEGDEERIRPSRFPRAARRMDTLNDLLA
FT                   ASDVISLHCALTNDTVQILNAECLQHIKPGAFLVNTGSCQLLDDCAVKQLLIDGTIAGC
FT                   ALDGAEGPQWMEAWVKEMPNVLILPRSADYSEEVWMEIREKAISILHSFFLDGVIPSNT
FT                   VSDEEVEESEASEEEEQSPSKHEKLAIVESTSRQQGESTLTSTEIVRREASELKESLSP
FT                   GQQHVSQNTAVKPEGRRSRSGKKAKKRHSQQKYMQKTDGSSGLNEESTSRRDDIAMSDT
FT                   EEVLSSSSRCASPEDSRSRKTPLEVMQESSPNQLVMSSKKFIGKSSELLKDGYVVALYA
FT                   KDLSGLHVSRQRTKNGGWFLDTLSNVSKRDPAAQFIIAYRNKDTVGLRSFAAGGKLLQI
FT                   NRRMEFVFASHSFDVWESWSLEGSLDECRLVNCRNSSAVLDVRVEILAMVGDDGITRWI
FT                   D"
FT   gene            190408..192436
FT                   /gene="ASG4"
FT                   /gene_synonym="ALTERED SEED GERMINATION 4"
FT                   /gene_synonym="F22L4.18"
FT                   /gene_synonym="F22L4_18"
FT                   /locus_tag="AT1G01520"
FT   mRNA            join(190408..190828,190941..190998,191138..191258,
FT                   191341..191475,191579..191692,191780..192436)
FT                   /gene="ASG4"
FT                   /gene_synonym="ALTERED SEED GERMINATION 4"
FT                   /gene_synonym="F22L4.18"
FT                   /gene_synonym="F22L4_18"
FT                   /locus_tag="AT1G01520"
FT                   /product="Homeodomain-like superfamily protein"
FT   mRNA            join(190408..190828,190941..190998,191138..191258,
FT                   191341..191475,191579..191692,191780..192026,
FT                   192107..192436)
FT                   /gene="ASG4"
FT                   /gene_synonym="ALTERED SEED GERMINATION 4"
FT                   /gene_synonym="F22L4.18"
FT                   /gene_synonym="F22L4_18"
FT                   /locus_tag="AT1G01520"
FT                   /product="Homeodomain-like superfamily protein"
FT   mRNA            join(190408..190828,190941..190998,191138..191258,
FT                   191341..191475,191579..191692,191780..191889,
FT                   191967..192436)
FT                   /gene="ASG4"
FT                   /gene_synonym="ALTERED SEED GERMINATION 4"
FT                   /gene_synonym="F22L4.18"
FT                   /gene_synonym="F22L4_18"
FT                   /locus_tag="AT1G01520"
FT                   /product="Homeodomain-like superfamily protein"
FT   mRNA            join(190408..190828,190941..190998,191138..191258,
FT                   191341..191475,191579..191692,191780..191889,
FT                   191967..192026,192107..192436)
FT                   /gene="ASG4"
FT                   /gene_synonym="ALTERED SEED GERMINATION 4"
FT                   /gene_synonym="F22L4.18"
FT                   /gene_synonym="F22L4_18"
FT                   /locus_tag="AT1G01520"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /inference="similar to RNA sequence, EST:INSD:DN604655.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY519508.1,INSD:AJ937211.1,INSD:BT029347.1"
FT   mRNA            join(190478..190828,190941..190998,191138..191475,
FT                   191579..191692,191780..191889,191967..192026,
FT                   192107..192436)
FT                   /gene="ASG4"
FT                   /gene_synonym="ALTERED SEED GERMINATION 4"
FT                   /gene_synonym="F22L4.18"
FT                   /gene_synonym="F22L4_18"
FT                   /locus_tag="AT1G01520"
FT                   /product="Homeodomain-like superfamily protein"
FT   CDS_pept        join(190596..190828,190941..190998,191138..191258,
FT                   191341..191475,191579..191692,191780..191889,
FT                   191967..192026,192107..192139)
FT                   /codon_start=1
FT                   /gene="ASG4"
FT                   /gene_synonym="F22L4.18"
FT                   /gene_synonym="F22L4_18"
FT                   /gene_synonym="ALTERED SEED GERMINATION 4"
FT                   /locus_tag="AT1G01520"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /note="Homeodomain-like superfamily protein; CONTAINS
FT                   InterPro DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005),
FT                   Homeodomain-like (InterPro:IPR009057), Myb, DNA-binding
FT                   (InterPro:IPR014778), Myb-like DNA-binding domain, SHAQKYF
FT                   class (InterPro:IPR006447), HTH transcriptional regulator,
FT                   Myb-type, DNA-binding (InterPro:IPR017930); BEST
FT                   Arabidopsis thaliana protein match is: Homeodomain-like
FT                   superfamily protein (TAIR:AT4G01280.1); Has 1311 Blast hits
FT                   to 1300 proteins in 113 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 59; Fungi - 0; Plants - 1067; Viruses - 0; Other
FT                   Eukaryotes - 185 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01520"
FT                   /db_xref="GOA:Q6R0H0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6R0H0"
FT                   /inference="similar to RNA sequence, EST:INSD:DN604655.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY519508.1,INSD:AJ937211.1,INSD:BT029347.1"
FT                   /protein_id="AEE27299.1"
FT                   /translation="MVTVNPSQAHCLPMKMSLPGFNTLPHTATTIPVSIRSNRTMSFFE
FT                   DPTKKVRKPYTITKSRENWTEQEHDKFLEALHLFDRDWKKIKAFVGSKTVIQIRSHAQK
FT                   YFLKVQKNGTKEHLPPPRPKRKANHPYPQKAPKFTLSSSNALFQHDYLYNTNSHPVIST
FT                   TRKHGLVHCDVSIPSSVIKEEFGVSENCCSTSSSRDKQRTRIVTETNDQESCGKPHRVA
FT                   PNFAEVYNFIGSVFDPKTTGHVKRLKEMDPINLETVLLLMKNLSVNLTSPEFDEQRKLI
FT                   SSYNAS"
FT   CDS_pept        join(190596..190828,190941..190998,191138..191258,
FT                   191341..191475,191579..191692,191780..191889,
FT                   191967..192059)
FT                   /codon_start=1
FT                   /gene="ASG4"
FT                   /gene_synonym="ALTERED SEED GERMINATION 4"
FT                   /gene_synonym="F22L4.18"
FT                   /gene_synonym="F22L4_18"
FT                   /locus_tag="AT1G01520"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /db_xref="GOA:A0A178W835"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178W835"
FT                   /protein_id="ANM57768.1"
FT                   /translation="MVTVNPSQAHCLPMKMSLPGFNTLPHTATTIPVSIRSNRTMSFFE
FT                   DPTKKVRKPYTITKSRENWTEQEHDKFLEALHLFDRDWKKIKAFVGSKTVIQIRSHAQK
FT                   YFLKVQKNGTKEHLPPPRPKRKANHPYPQKAPKFTLSSSNALFQHDYLYNTNSHPVIST
FT                   TRKHGLVHCDVSIPSSVIKEEFGVSENCCSTSSSRDKQRTRIVTETNDQESCGKPHRVA
FT                   PNFAEVYNFIGSVFDPKTTGHVKRLKEMDPINLETVLLLMKNLSVNLTSPEFDEQVRAS
FT                   RLFVTF"
FT   CDS_pept        join(190596..190828,190941..190998,191138..191258,
FT                   191341..191475,191579..191692,191780..191895)
FT                   /codon_start=1
FT                   /gene="ASG4"
FT                   /gene_synonym="ALTERED SEED GERMINATION 4"
FT                   /gene_synonym="F22L4.18"
FT                   /gene_synonym="F22L4_18"
FT                   /locus_tag="AT1G01520"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01520"
FT                   /db_xref="GOA:A0A1P8AMB7"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AMB7"
FT                   /protein_id="ANM57765.1"
FT                   /translation="MVTVNPSQAHCLPMKMSLPGFNTLPHTATTIPVSIRSNRTMSFFE
FT                   DPTKKVRKPYTITKSRENWTEQEHDKFLEALHLFDRDWKKIKAFVGSKTVIQIRSHAQK
FT                   YFLKVQKNGTKEHLPPPRPKRKANHPYPQKAPKFTLSSSNALFQHDYLYNTNSHPVIST
FT                   TRKHGLVHCDVSIPSSVIKEEFGVSENCCSTSSSRDKQRTRIVTETNDQESCGKPHRVA
FT                   PNFAEVYNFIGSVFDPKTTGHVKRLKEMDPINLETV"
FT   CDS_pept        join(190596..190828,190941..190998,191138..191258,
FT                   191341..191475,191579..191692,191780..191895)
FT                   /codon_start=1
FT                   /gene="ASG4"
FT                   /gene_synonym="ALTERED SEED GERMINATION 4"
FT                   /gene_synonym="F22L4.18"
FT                   /gene_synonym="F22L4_18"
FT                   /locus_tag="AT1G01520"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /db_xref="GOA:A0A1P8AMB7"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AMB7"
FT                   /protein_id="ANM57767.1"
FT                   /translation="MVTVNPSQAHCLPMKMSLPGFNTLPHTATTIPVSIRSNRTMSFFE
FT                   DPTKKVRKPYTITKSRENWTEQEHDKFLEALHLFDRDWKKIKAFVGSKTVIQIRSHAQK
FT                   YFLKVQKNGTKEHLPPPRPKRKANHPYPQKAPKFTLSSSNALFQHDYLYNTNSHPVIST
FT                   TRKHGLVHCDVSIPSSVIKEEFGVSENCCSTSSSRDKQRTRIVTETNDQESCGKPHRVA
FT                   PNFAEVYNFIGSVFDPKTTGHVKRLKEMDPINLETV"
FT   CDS_pept        join(191181..191475,191579..191692,191780..191889,
FT                   191967..192026,192107..192139)
FT                   /codon_start=1
FT                   /gene="ASG4"
FT                   /gene_synonym="ALTERED SEED GERMINATION 4"
FT                   /gene_synonym="F22L4.18"
FT                   /gene_synonym="F22L4_18"
FT                   /locus_tag="AT1G01520"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01520"
FT                   /db_xref="GOA:A0A1P8AM82"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AM82"
FT                   /protein_id="ANM57766.1"
FT                   /translation="MGLKNISHLLDQRGKPITHIHKKLLNVATLNLLSFYFRFCYFISF
FT                   SHGYVFDAVTLSSSNALFQHDYLYNTNSHPVISTTRKHGLVHCDVSIPSSVIKEEFGVS
FT                   ENCCSTSSSRDKQRTRIVTETNDQESCGKPHRVAPNFAEVYNFIGSVFDPKTTGHVKRL
FT                   KEMDPINLETVLLLMKNLSVNLTSPEFDEQRKLISSYNAS"
FT   gene            complement(192634..193670)
FT                   /gene="AGL28"
FT                   /gene_synonym="AGAMOUS-like 28"
FT                   /gene_synonym="F22L4.7"
FT                   /gene_synonym="F22L4_7"
FT                   /locus_tag="AT1G01530"
FT   mRNA            complement(join(192634..193071,193351..193670))
FT                   /gene="AGL28"
FT                   /gene_synonym="AGAMOUS-like 28"
FT                   /gene_synonym="F22L4.7"
FT                   /gene_synonym="F22L4_7"
FT                   /locus_tag="AT1G01530"
FT                   /product="AGAMOUS-like 28"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR370581.1,INSD:CB253179.1,INSD:DR751418.1,
FT                   INSD:DR292196.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ446218.1,INSD:AY141231.1,INSD:DQ652819.1"
FT   CDS_pept        complement(join(192640..193071,193351..193662))
FT                   /codon_start=1
FT                   /gene="AGL28"
FT                   /gene_synonym="AGAMOUS-like 28"
FT                   /gene_synonym="F22L4.7"
FT                   /gene_synonym="F22L4_7"
FT                   /locus_tag="AT1G01530"
FT                   /product="AGAMOUS-like 28"
FT                   /note="AGAMOUS-like 28 (AGL28); FUNCTIONS IN: DNA binding,
FT                   sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: regulation of transcription,
FT                   DNA-dependent; LOCATED IN: nucleus; EXPRESSED IN: central
FT                   cell, embryo, endosperm; CONTAINS InterPro DOMAIN/s:
FT                   Transcription factor, MADS-box (InterPro:IPR002100); BEST
FT                   Arabidopsis thaliana protein match is: AGAMOUS-like 23
FT                   (TAIR:AT1G65360.1); Has 6009 Blast hits to 6009 proteins in
FT                   738 species: Archae - 0; Bacteria - 0; Metazoa - 628; Fungi
FT                   - 306; Plants - 4996; Viruses - 0; Other Eukaryotes - 79
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01530"
FT                   /db_xref="GOA:Q9LMM8"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="InterPro:IPR033896"
FT                   /db_xref="InterPro:IPR036879"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LMM8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR370581.1,INSD:CB253179.1,INSD:DR751418.1,
FT                   INSD:DR292196.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ446218.1,INSD:AY141231.1,INSD:DQ652819.1"
FT                   /protein_id="AEE27300.1"
FT                   /translation="MARKNLGRRKIELVKMTNESNLQVTFSKRRSGLFKKGSELCTLCD
FT                   AEIAIIVFSPSGKAYSFGHPNVNKLLDHSLGRVIRHNNTNFAESRTKLRIQMLNESLTE
FT                   VMAEKEKEQETKQSIVQNERENKDAEKWWRNSPTELNLAQSTSMKCDLEALKKEVDEKV
FT                   AQLHHRNLNFYVGSSSNVAAPAAVSGGNISTNHGFFDQNGNSTSAPTLPFGFNVMNRTP
FT                   AGYNSYQLQNQEVKQVHPQYWARYY"
FT   gene            195645..198787
FT                   /gene_synonym="F22L4.8"
FT                   /gene_synonym="F22L4_8"
FT                   /locus_tag="AT1G01540"
FT   mRNA            join(195645..196542,197115..197219,197300..197422,
FT                   197501..197671,197775..197904,197974..198183,
FT                   198267..198787)
FT                   /gene_synonym="F22L4.8"
FT                   /gene_synonym="F22L4_8"
FT                   /locus_tag="AT1G01540"
FT                   /product="Protein kinase superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL063258.1,INSD:CB260076.1,INSD:EL066847.1,
FT                   INSD:EL308603.1,INSD:BP860417.1,INSD:EG503195.1,
FT                   INSD:ES118123.1,INSD:Z17558.1,INSD:BP856879.1,
FT                   INSD:BP590402.1,INSD:EG456431.1,INSD:EH832695.1,
FT                   INSD:BP576547.1,INSD:EG486678.1,INSD:DR358279.1,
FT                   INSD:EL105900.1,INSD:EL242478.1,INSD:AV797748.1,
FT                   INSD:AA712856.1,INSD:DR358278.1,INSD:EH896160.1,
FT                   INSD:AV557557.1,INSD:EH905136.1,INSD:EG456432.1,
FT                   INSD:EL068223.1,INSD:EL022952.1,INSD:ES062359.1,
FT                   INSD:BP849665.1,INSD:BP612742.1,INSD:AV827288.1,
FT                   INSD:ES211081.1,INSD:N97089.1,INSD:AV807514.1,
FT                   INSD:EH833066.1,INSD:ES113029.1,INSD:BP788775.1,
FT                   INSD:EH945062.1,INSD:BP809750.1,INSD:BP835505.1,
FT                   INSD:EL062519.1,INSD:BP847487.1,INSD:BP564759.1,
FT                   INSD:BP847059.1,INSD:AV800623.1,INSD:EL131574.1,
FT                   INSD:AV794507.1,INSD:Z26473.1,INSD:BP864640.1,
FT                   INSD:EG486677.1,INSD:EL281077.1,INSD:BP660777.1,
FT                   INSD:EL196904.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF332429.1,INSD:BX816564.1,INSD:BX815874.1,
FT                   INSD:AK220743.1,INSD:AF367265.1,INSD:AY093964.1"
FT   mRNA            join(195812..196542,197115..197219,197300..197422,
FT                   197501..197671,197775..198183,198267..198635)
FT                   /gene_synonym="F22L4.8"
FT                   /gene_synonym="F22L4_8"
FT                   /locus_tag="AT1G01540"
FT                   /product="Protein kinase superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL063258.1,INSD:Z26772.1,INSD:CB260076.1,
FT                   INSD:AI996016.1,INSD:EL308603.1,INSD:EL066847.1,
FT                   INSD:BP860417.1,INSD:EG503195.1,INSD:ES118123.1,
FT                   INSD:BP856879.1,INSD:BP590402.1,INSD:EG456431.1,
FT                   INSD:EH832695.1,INSD:BP576547.1,INSD:EG486678.1,
FT                   INSD:DR358279.1,INSD:EL242478.1,INSD:AV797748.1,
FT                   INSD:AA712856.1,INSD:EH896160.1,INSD:DR358278.1,
FT                   INSD:AV557557.1,INSD:EG456432.1,INSD:EH905136.1,
FT                   INSD:EL068223.1,INSD:ES062359.1,INSD:BP612742.1,
FT                   INSD:BP849665.1,INSD:AV827288.1,INSD:ES211081.1,
FT                   INSD:AV807514.1,INSD:ES113029.1,INSD:EH833066.1,
FT                   INSD:BP788775.1,INSD:EH945062.1,INSD:BP809750.1,
FT                   INSD:EL062519.1,INSD:BP847487.1,INSD:BP564759.1,
FT                   INSD:BP847059.1,INSD:AV800623.1,INSD:EL131574.1,
FT                   INSD:AV794507.1,INSD:Z26473.1,INSD:BP864640.1,
FT                   INSD:EL281077.1,INSD:BP660777.1,INSD:BE039500.1,
FT                   INSD:EL196904.1"
FT   CDS_pept        join(195980..196542,197115..197219,197300..197422,
FT                   197501..197671,197775..197904,197974..198183,
FT                   198267..198383)
FT                   /codon_start=1
FT                   /gene_synonym="F22L4.8"
FT                   /gene_synonym="F22L4_8"
FT                   /locus_tag="AT1G01540"
FT                   /product="Protein kinase superfamily protein"
FT                   /note="Protein kinase superfamily protein; FUNCTIONS IN:
FT                   protein serine/threonine kinase activity, protein kinase
FT                   activity, kinase activity, ATP binding; INVOLVED IN:
FT                   protein amino acid phosphorylation; LOCATED IN: plasma
FT                   membrane; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Protein kinase, ATP binding site (InterPro:IPR017441),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), Protein kinase, catalytic
FT                   domain (InterPro:IPR000719), Tyrosine-protein kinase,
FT                   catalytic domain (InterPro:IPR020635); BEST Arabidopsis
FT                   thaliana protein match is: Protein kinase superfamily
FT                   protein (TAIR:AT4G01330.1); Has 118949 Blast hits to 117566
FT                   proteins in 4483 species: Archae - 118; Bacteria - 14365;
FT                   Metazoa - 43793; Fungi - 9783; Plants - 32976; Viruses -
FT                   455; Other Eukaryotes - 17459 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q3EDL4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3EDL4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL063258.1,INSD:CB260076.1,INSD:EL066847.1,
FT                   INSD:EL308603.1,INSD:BP860417.1,INSD:EG503195.1,
FT                   INSD:ES118123.1,INSD:Z17558.1,INSD:BP856879.1,
FT                   INSD:BP590402.1,INSD:EG456431.1,INSD:EH832695.1,
FT                   INSD:BP576547.1,INSD:EG486678.1,INSD:DR358279.1,
FT                   INSD:EL105900.1,INSD:EL242478.1,INSD:AV797748.1,
FT                   INSD:AA712856.1,INSD:DR358278.1,INSD:EH896160.1,
FT                   INSD:AV557557.1,INSD:EH905136.1,INSD:EG456432.1,
FT                   INSD:EL068223.1,INSD:EL022952.1,INSD:ES062359.1,
FT                   INSD:BP849665.1,INSD:BP612742.1,INSD:AV827288.1,
FT                   INSD:ES211081.1,INSD:N97089.1,INSD:AV807514.1,
FT                   INSD:EH833066.1,INSD:ES113029.1,INSD:BP788775.1,
FT                   INSD:EH945062.1,INSD:BP809750.1,INSD:BP835505.1,
FT                   INSD:EL062519.1,INSD:BP847487.1,INSD:BP564759.1,
FT                   INSD:BP847059.1,INSD:AV800623.1,INSD:EL131574.1,
FT                   INSD:AV794507.1,INSD:Z26473.1,INSD:BP864640.1,
FT                   INSD:EG486677.1,INSD:EL281077.1,INSD:BP660777.1,
FT                   INSD:EL196904.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF332429.1,INSD:BX816564.1,INSD:BX815874.1,
FT                   INSD:AK220743.1,INSD:AF367265.1,INSD:AY093964.1"
FT                   /protein_id="AEE27302.1"
FT                   /translation="MSVYDAAFLNTELSKPTSIFGLRLWVVIGILLGSLIVIALFLLSL
FT                   CLTSRRKNRKPRADFASAAIATPPISKEIKEIVPAQNQSVPAEIQVDIGKIEHRVVFSD
FT                   RVSSGESRGTASASETASYSGSGNCGPEVSHLGWGRWYTLRELEAATNGLCEENVIGEG
FT                   GYGIVYRGILTDGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCVEGAY
FT                   RMLVYDFVDNGNLEQWIHGDVGDVSPLTWDIRMNIILGMAKGLAYLHEGLEPKVVHRDI
FT                   KSSNILLDRQWNAKVSDFGLAKLLGSESSYVTTRVMGTFGYVAPEYACTGMLNEKSDIY
FT                   SFGILIMEIITGRNPVDYSRPQGETNLVDWLKSMVGNRRSEEVVDPKIPEPPSSKALKR
FT                   VLLVALRCVDPDANKRPKMGHIIHMLEAEDLLYRDERRTTRDHGSRERQETAVVAAGSE
FT                   SGESGSRHHQQKQR"
FT   CDS_pept        join(195980..196542,197115..197219,197300..197422,
FT                   197501..197671,197775..197973)
FT                   /codon_start=1
FT                   /gene_synonym="F22L4.8"
FT                   /gene_synonym="F22L4_8"
FT                   /locus_tag="AT1G01540"
FT                   /product="Protein kinase superfamily protein"
FT                   /note="Protein kinase superfamily protein; FUNCTIONS IN:
FT                   protein serine/threonine kinase activity, protein kinase
FT                   activity, kinase activity, ATP binding; INVOLVED IN:
FT                   protein amino acid phosphorylation; LOCATED IN: plasma
FT                   membrane; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Protein kinase, ATP binding site (InterPro:IPR017441),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Serine/threonine-protein
FT                   kinase, active site (InterPro:IPR008271), Protein
FT                   kinase-like domain (InterPro:IPR011009), Protein kinase,
FT                   catalytic domain (InterPro:IPR000719), Tyrosine-protein
FT                   kinase, catalytic domain (InterPro:IPR020635); BEST
FT                   Arabidopsis thaliana protein match is: Protein kinase
FT                   superfamily protein (TAIR:AT4G01330.2); Has 117942 Blast
FT                   hits to 116606 proteins in 4399 species: Archae - 110;
FT                   Bacteria - 14062; Metazoa - 43660; Fungi - 9737; Plants -
FT                   32599; Viruses - 442; Other Eukaryotes - 17332 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01540"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01540.1"
FT                   /db_xref="GOA:F4HSC9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:F4HSC9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL063258.1,INSD:Z26772.1,INSD:CB260076.1,
FT                   INSD:AI996016.1,INSD:EL308603.1,INSD:EL066847.1,
FT                   INSD:BP860417.1,INSD:EG503195.1,INSD:ES118123.1,
FT                   INSD:BP856879.1,INSD:BP590402.1,INSD:EG456431.1,
FT                   INSD:EH832695.1,INSD:BP576547.1,INSD:EG486678.1,
FT                   INSD:DR358279.1,INSD:EL242478.1,INSD:AV797748.1,
FT                   INSD:AA712856.1,INSD:EH896160.1,INSD:DR358278.1,
FT                   INSD:AV557557.1,INSD:EG456432.1,INSD:EH905136.1,
FT                   INSD:EL068223.1,INSD:ES062359.1,INSD:BP612742.1,
FT                   INSD:BP849665.1,INSD:AV827288.1,INSD:ES211081.1,
FT                   INSD:AV807514.1,INSD:ES113029.1,INSD:EH833066.1,
FT                   INSD:BP788775.1,INSD:EH945062.1,INSD:BP809750.1,
FT                   INSD:EL062519.1,INSD:BP847487.1,INSD:BP564759.1,
FT                   INSD:BP847059.1,INSD:AV800623.1,INSD:EL131574.1,
FT                   INSD:AV794507.1,INSD:Z26473.1,INSD:BP864640.1,
FT                   INSD:EL281077.1,INSD:BP660777.1,INSD:BE039500.1,
FT                   INSD:EL196904.1"
FT                   /protein_id="AEE27301.1"
FT                   /translation="MSVYDAAFLNTELSKPTSIFGLRLWVVIGILLGSLIVIALFLLSL
FT                   CLTSRRKNRKPRADFASAAIATPPISKEIKEIVPAQNQSVPAEIQVDIGKIEHRVVFSD
FT                   RVSSGESRGTASASETASYSGSGNCGPEVSHLGWGRWYTLRELEAATNGLCEENVIGEG
FT                   GYGIVYRGILTDGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHKNLVRLLGYCVEGAY
FT                   RMLVYDFVDNGNLEQWIHGDVGDVSPLTWDIRMNIILGMAKGLAYLHEGLEPKVVHRDI
FT                   KSSNILLDRQWNAKVSDFGLAKLLGSESSYVTTRVMGTFGYVAPEYACTGMLNEKSDIY
FT                   SFGILIMEIITGRNPVDYSRPQGEVFDKHIQSSLCFCKWSYYVSWL"
FT   gene            199527..201775
FT                   /gene="BPS1"
FT                   /gene_synonym="BYPASS 1"
FT                   /gene_synonym="F22L4.9"
FT                   /gene_synonym="F22L4_9"
FT                   /locus_tag="AT1G01550"
FT                   /note="Encodes a protein with no functionally characterized
FT                   domains that to prevent the synthesis of a novel substance
FT                   that moves from the root to the shoot, where it modifies
FT                   shoot growth by interfering with auxin signaling. Synthesis
FT                   and delivery of this substance requires neither phloem nor
FT                   endodermis."
FT   mRNA            join(199527..199763,199890..199959,200511..201775)
FT                   /gene="BPS1"
FT                   /gene_synonym="BYPASS 1"
FT                   /gene_synonym="F22L4.9"
FT                   /gene_synonym="F22L4_9"
FT                   /locus_tag="AT1G01550"
FT                   /product="BPS1-like protein (DUF793)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH965158.1,INSD:CD529780.1,INSD:EH890117.1,
FT                   INSD:EL022850.1,INSD:BP789082.1,INSD:ES196268.1,
FT                   INSD:H36161.1,INSD:BP666861.1,INSD:EL230510.1,
FT                   INSD:AI100650.1,INSD:BP777906.1,INSD:EH796654.1,
FT                   INSD:BP799174.1,INSD:EL338658.1,INSD:DR205992.1,
FT                   INSD:AV812619.1,INSD:EL980319.1,INSD:EL199927.1,
FT                   INSD:CD532203.1,INSD:BP639179.1,INSD:DR205986.1,
FT                   INSD:BP617463.1,INSD:EH906086.1,INSD:BP587538.1,
FT                   INSD:DR205989.1,INSD:EL977409.1,INSD:EL253613.1,
FT                   INSD:AV799468.1,INSD:EH835087.1,INSD:EL174544.1,
FT                   INSD:ES188298.1,INSD:ES194779.1,INSD:EL970497.1,
FT                   INSD:ES205375.1,INSD:ES120781.1,INSD:DR205991.1,
FT                   INSD:EL016337.1,INSD:DR206006.1,INSD:BP597439.1,
FT                   INSD:EL198286.1,INSD:CD531880.1,INSD:ES191077.1,
FT                   INSD:BP567636.1,INSD:DR205982.1,INSD:EL083149.1,
FT                   INSD:BP812517.1,INSD:BP777706.1,INSD:EL038337.1,
FT                   INSD:EH808111.1,INSD:ES185982.1,INSD:EH852316.1,
FT                   INSD:EH833808.1,INSD:EL203714.1,INSD:BP626751.1,
FT                   INSD:EL076310.1,INSD:EH912458.1,INSD:EL048996.1,
FT                   INSD:BP791397.1,INSD:EL281775.1,INSD:EL979711.1,
FT                   INSD:BP779714.1,INSD:EL975387.1,INSD:AV783727.1,
FT                   INSD:DR206009.1,INSD:BP619221.1,INSD:EH845610.1,
FT                   INSD:ES186917.1,INSD:EL969978.1,INSD:DR205998.1,
FT                   INSD:EL117312.1,INSD:EH816787.1,INSD:EH810495.1,
FT                   INSD:EL994244.1,INSD:EL223982.1,INSD:EH992577.1,
FT                   INSD:AV811115.1,INSD:BP784434.1,INSD:CF653030.1,
FT                   INSD:EL050272.1,INSD:EL050118.1,INSD:AV786034.1,
FT                   INSD:BP580871.1,INSD:AV808985.1,INSD:EL058435.1,
FT                   INSD:EL058817.1,INSD:DR212538.1,INSD:AV820555.1,
FT                   INSD:AV804363.1,INSD:AV442302.1,INSD:ES045583.1,
FT                   INSD:BE526106.1,INSD:DR205996.1,INSD:AV796139.1,
FT                   INSD:DR206002.1,INSD:EH795604.1,INSD:EL004584.1,
FT                   INSD:BP669693.1,INSD:EL240083.1,INSD:AV519217.1,
FT                   INSD:ES202230.1,INSD:BP571559.1,INSD:BP646785.1,
FT                   INSD:EH946132.1,INSD:ES064092.1,INSD:BP656582.1,
FT                   INSD:AV566860.1,INSD:DR205984.1,INSD:ES042994.1,
FT                   INSD:ES102493.1,INSD:AV822863.1,INSD:BP648095.1,
FT                   INSD:EL201974.1,INSD:CB254151.1,INSD:EL166956.1,
FT                   INSD:EL121746.1,INSD:EL977269.1,INSD:EH821075.1,
FT                   INSD:DR206008.1,INSD:DR206000.1,INSD:BP815238.1,
FT                   INSD:AV440904.1,INSD:BP814290.1,INSD:EH989363.1,
FT                   INSD:EH931173.1,INSD:ES148495.1,INSD:ES100319.1,
FT                   INSD:ES053264.1,INSD:EH865397.1,INSD:CD532221.1,
FT                   INSD:DR206010.1,INSD:BP832543.1,INSD:EH962693.1,
FT                   INSD:BP653211.1,INSD:BP863516.1,INSD:AV809223.1,
FT                   INSD:AV803859.1,INSD:EL008624.1,INSD:BP577951.1,
FT                   INSD:AV820354.1,INSD:CB074541.1,INSD:AV818878.1,
FT                   INSD:EH856605.1,INSD:BP618633.1,INSD:EG523502.1,
FT                   INSD:CD532187.1,INSD:DR205983.1,INSD:BP597895.1,
FT                   INSD:BP836560.1,INSD:EL186852.1,INSD:EH928857.1,
FT                   INSD:BP567739.1,INSD:EH948821.1,INSD:EL979189.1,
FT                   INSD:CD531112.1,INSD:EH943500.1,INSD:DR206001.1,
FT                   INSD:ES195458.1,INSD:EL984245.1,INSD:EH909394.1,
FT                   INSD:EL968248.1,INSD:EL979648.1,INSD:EL971487.1,
FT                   INSD:EL232187.1,INSD:EH820006.1,INSD:AV802042.1,
FT                   INSD:EL196749.1,INSD:EG523501.1,INSD:EL036014.1,
FT                   INSD:EH819308.1,INSD:ES152698.1,INSD:EH929393.1,
FT                   INSD:T43647.1,INSD:ES013346.1,INSD:EL030676.1,
FT                   INSD:DR205993.1,INSD:EL047542.1,INSD:BE523139.1,
FT                   INSD:EL223241.1,INSD:BP839219.1,INSD:EL109383.1,
FT                   INSD:ES168032.1,INSD:EL074592.1,INSD:AV804719.1,
FT                   INSD:EL314797.1,INSD:EH913317.1,INSD:DR205980.1,
FT                   INSD:BP617900.1,INSD:EL111649.1,INSD:EL088379.1,
FT                   INSD:EL969103.1,INSD:ES135482.1,INSD:BP612918.1,
FT                   INSD:DR212539.1,INSD:EL254567.1,INSD:EL972034.1,
FT                   INSD:DR206004.1,INSD:DR205997.1,INSD:ES056681.1,
FT                   INSD:EL970868.1,INSD:AV786428.1,INSD:DR205985.1,
FT                   INSD:ES106770.1,INSD:BP607243.1,INSD:EL974709.1,
FT                   INSD:ES031557.1,INSD:EL980201.1,INSD:BP799515.1,
FT                   INSD:BP623169.1,INSD:CK118585.1,INSD:EH898083.1,
FT                   INSD:AV824408.1,INSD:BP647227.1,INSD:EL172011.1,
FT                   INSD:AV794288.1,INSD:AV522055.1,INSD:EL290797.1,
FT                   INSD:AV800740.1,INSD:BP595107.1,INSD:EL176496.1,
FT                   INSD:AV793305.1,INSD:BP802612.1,INSD:ES029454.1,
FT                   INSD:BP616597.1,INSD:BP791290.1,INSD:DR205994.1,
FT                   INSD:AV535727.1,INSD:ES177364.1,INSD:EL973935.1,
FT                   INSD:DR206003.1,INSD:EL096772.1,INSD:DR205988.1,
FT                   INSD:EH828723.1,INSD:ES173714.1,INSD:EL972296.1,
FT                   INSD:EH970356.1,INSD:DR206012.1,INSD:EL149556.1,
FT                   INSD:BP803813.1,INSD:EL968901.1,INSD:BP589644.1,
FT                   INSD:EL969168.1,INSD:CD531278.1,INSD:DR206005.1,
FT                   INSD:EL113861.1,INSD:DR205987.1,INSD:BP856776.1,
FT                   INSD:DR205995.1,INSD:EL025206.1,INSD:EH815005.1,
FT                   INSD:EL967344.1,INSD:ES128802.1,INSD:T22185.1,
FT                   INSD:DR205999.1,INSD:AV818333.1,INSD:BP566909.1,
FT                   INSD:EL162663.1,INSD:EH824964.1,INSD:EH931659.1,
FT                   INSD:BP621246.1,INSD:AV818103.1,INSD:AI996538.1,
FT                   INSD:Z37624.1,INSD:DR205990.1,INSD:EL976135.1,
FT                   INSD:AV794056.1,INSD:DR206011.1,INSD:BP561566.2,
FT                   INSD:EL306377.1,INSD:DR206007.1,INSD:AV798131.1,
FT                   INSD:DR205981.1,INSD:EL064587.1,INSD:DR375721.1,
FT                   INSD:BP801444.1,INSD:DR206013.1,INSD:EH819018.1,
FT                   INSD:DR206014.1,INSD:ES215901.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF349532.1,INSD:AY063906.1,INSD:AY059805.1,
FT                   INSD:BT000041.1,INSD:AF083676.1,INSD:BX815515.1,
FT                   INSD:AY091197.1"
FT   mRNA            join(199630..199959,200511..201775)
FT                   /gene="BPS1"
FT                   /gene_synonym="BYPASS 1"
FT                   /gene_synonym="F22L4.9"
FT                   /gene_synonym="F22L4_9"
FT                   /locus_tag="AT1G01550"
FT                   /product="BPS1-like protein (DUF793)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH965158.1,INSD:CD529780.1,INSD:EH890117.1,
FT                   INSD:EL022850.1,INSD:BP789082.1,INSD:ES196268.1,
FT                   INSD:BP666861.1,INSD:AI100650.1,INSD:BP777906.1,
FT                   INSD:EH796654.1,INSD:EL338658.1,INSD:AV812619.1,
FT                   INSD:CB253177.1,INSD:EL980319.1,INSD:EL199927.1,
FT                   INSD:CD532203.1,INSD:BP639179.1,INSD:BP617463.1,
FT                   INSD:BP587538.1,INSD:EL977409.1,INSD:EL253613.1,
FT                   INSD:AV799468.1,INSD:EH835087.1,INSD:EL174544.1,
FT                   INSD:ES188298.1,INSD:ES194779.1,INSD:EL970497.1,
FT                   INSD:ES205375.1,INSD:ES120781.1,INSD:EL016337.1,
FT                   INSD:BP597439.1,INSD:EL198286.1,INSD:CD531880.1,
FT                   INSD:ES191077.1,INSD:BP567636.1,INSD:DR368633.1,
FT                   INSD:EL083149.1,INSD:DR368639.1,INSD:BP777706.1,
FT                   INSD:EH808111.1,INSD:EL038337.1,INSD:EL140685.1,
FT                   INSD:ES185982.1,INSD:EL979942.1,INSD:EH852316.1,
FT                   INSD:DR368640.1,INSD:EH833808.1,INSD:EL203714.1,
FT                   INSD:BP626751.1,INSD:EH912458.1,INSD:EL048996.1,
FT                   INSD:BP791397.1,INSD:EL281775.1,INSD:EL979711.1,
FT                   INSD:BP779714.1,INSD:EL975387.1,INSD:AV783727.1,
FT                   INSD:EH845610.1,INSD:BP619221.1,INSD:ES186917.1,
FT                   INSD:EL969978.1,INSD:EL117312.1,INSD:EH816787.1,
FT                   INSD:EH810495.1,INSD:EL994244.1,INSD:EL223982.1,
FT                   INSD:EH992577.1,INSD:AV811115.1,INSD:BP784434.1,
FT                   INSD:CF653030.1,INSD:EL050272.1,INSD:EL050118.1,
FT                   INSD:AV786034.1,INSD:BP580871.1,INSD:AV808985.1,
FT                   INSD:EL058435.1,INSD:EL986345.1,INSD:EL058817.1,
FT                   INSD:DR212538.1,INSD:AV820555.1,INSD:AV804363.1,
FT                   INSD:ES045583.1,INSD:AV796139.1,INSD:EH795604.1,
FT                   INSD:EL004584.1,INSD:BP669693.1,INSD:EL240083.1,
FT                   INSD:DR368636.1,INSD:DR368632.1,INSD:AV519217.1,
FT                   INSD:ES202230.1,INSD:BP571559.1,INSD:BP646785.1,
FT                   INSD:ES064092.1,INSD:BP656582.1,INSD:AV566860.1,
FT                   INSD:DR205984.1,INSD:ES042994.1,INSD:BP648095.1,
FT                   INSD:EL201974.1,INSD:CB254151.1,INSD:EL166956.1,
FT                   INSD:EL121746.1,INSD:EL977269.1,INSD:EH821075.1,
FT                   INSD:AV440904.1,INSD:EH989363.1,INSD:ES148495.1,
FT                   INSD:EH931173.1,INSD:ES100319.1,INSD:ES053264.1,
FT                   INSD:BP813415.1,INSD:EH865397.1,INSD:CD532221.1,
FT                   INSD:EH962693.1,INSD:BP653211.1,INSD:AV809223.1,
FT                   INSD:AV803859.1,INSD:EL008624.1,INSD:BP577951.1,
FT                   INSD:AV820354.1,INSD:EH893189.1,INSD:CB074541.1,
FT                   INSD:AV818878.1,INSD:EH856605.1,INSD:BP618633.1,
FT                   INSD:CD532187.1,INSD:DR368635.1,INSD:AV440197.1,
FT                   INSD:BP597895.1,INSD:EL186852.1,INSD:CB254255.1,
FT                   INSD:EH928857.1,INSD:BP567739.1,INSD:EH948821.1,
FT                   INSD:EL979189.1,INSD:CD531112.1,INSD:EH943500.1,
FT                   INSD:BP814361.1,INSD:ES195458.1,INSD:BP839270.1,
FT                   INSD:BP837763.1,INSD:EL984245.1,INSD:EH909394.1,
FT                   INSD:EL968248.1,INSD:EL979648.1,INSD:CB253014.1,
FT                   INSD:EL971487.1,INSD:EL232187.1,INSD:EH820006.1,
FT                   INSD:AV802042.1,INSD:EL196749.1,INSD:EG523501.1,
FT                   INSD:ES152698.1,INSD:EH819308.1,INSD:EL036014.1,
FT                   INSD:EH929393.1,INSD:T43647.1,INSD:ES013346.1,
FT                   INSD:EL030676.1,INSD:EL047542.1,INSD:EL223241.1,
FT                   INSD:EL109383.1,INSD:ES168032.1,INSD:EL074592.1,
FT                   INSD:AV804719.1,INSD:EL314797.1,INSD:EH913317.1,
FT                   INSD:EL111649.1,INSD:BP617900.1,INSD:EL088379.1,
FT                   INSD:EL969103.1,INSD:ES135482.1,INSD:BP612918.1,
FT                   INSD:BP825677.1,INSD:DR212539.1,INSD:EL254567.1,
FT                   INSD:EL972034.1,INSD:ES056681.1,INSD:EL970868.1,
FT                   INSD:AV786428.1,INSD:ES106770.1,INSD:BP607243.1,
FT                   INSD:EL974709.1,INSD:ES031557.1,INSD:EL980201.1,
FT                   INSD:BP623169.1,INSD:DR368634.1,INSD:CK118585.1,
FT                   INSD:EH898083.1,INSD:DR368638.1,INSD:BP647227.1,
FT                   INSD:EL172011.1,INSD:AV794288.1,INSD:AV522055.1,
FT                   INSD:EL290797.1,INSD:AV800740.1,INSD:EL176496.1,
FT                   INSD:AV793305.1,INSD:BP595107.1,INSD:ES029454.1,
FT                   INSD:BP616597.1,INSD:BP791290.1,INSD:AV535727.1,
FT                   INSD:ES177364.1,INSD:EL973935.1,INSD:EL096772.1,
FT                   INSD:EH828723.1,INSD:ES173714.1,INSD:EL972296.1,
FT                   INSD:EH970356.1,INSD:EL149556.1,INSD:EL968901.1,
FT                   INSD:BP589644.1,INSD:EL969168.1,INSD:EL113861.1,
FT                   INSD:EL978726.1,INSD:DR368637.1,INSD:EL025206.1,
FT                   INSD:EH815005.1,INSD:EL967344.1,INSD:ES128802.1,
FT                   INSD:T22185.1,INSD:AV818333.1,INSD:BP566909.1,
FT                   INSD:EL162663.1,INSD:EH824964.1,INSD:BP621246.1,
FT                   INSD:AV818103.1,INSD:AI996538.1,INSD:Z37624.1,
FT                   INSD:EL976135.1,INSD:AV794056.1,INSD:EL306377.1,
FT                   INSD:AV798131.1,INSD:EL064587.1,INSD:DR375721.1,
FT                   INSD:EH819018.1,INSD:ES215901.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF349532.1,INSD:BT000041.1,INSD:AF083676.1,
FT                   INSD:AY091197.1"
FT   CDS_pept        200526..201575
FT                   /codon_start=1
FT                   /gene="BPS1"
FT                   /gene_synonym="BYPASS 1"
FT                   /gene_synonym="F22L4.9"
FT                   /gene_synonym="F22L4_9"
FT                   /locus_tag="AT1G01550"
FT                   /product="BPS1-like protein (DUF793)"
FT                   /note="BYPASS 1 (BPS1); FUNCTIONS IN: molecular_function
FT                   unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 24
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Protein BYPASS related
FT                   (InterPro:IPR008511); BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT2G46080.1); Has 170 Blast
FT                   hits to 170 proteins in 24 species: Archae - 0; Bacteria -
FT                   0; Metazoa - 7; Fungi - 0; Plants - 160; Viruses - 0; Other
FT                   Eukaryotes - 3 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LMM6"
FT                   /db_xref="InterPro:IPR008511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LMM6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH965158.1,INSD:CD529780.1,INSD:EH890117.1,
FT                   INSD:EL022850.1,INSD:BP789082.1,INSD:ES196268.1,
FT                   INSD:H36161.1,INSD:BP666861.1,INSD:EL230510.1,
FT                   INSD:AI100650.1,INSD:BP777906.1,INSD:EH796654.1,
FT                   INSD:BP799174.1,INSD:EL338658.1,INSD:DR205992.1,
FT                   INSD:AV812619.1,INSD:EL980319.1,INSD:EL199927.1,
FT                   INSD:CD532203.1,INSD:BP639179.1,INSD:DR205986.1,
FT                   INSD:BP617463.1,INSD:EH906086.1,INSD:BP587538.1,
FT                   INSD:DR205989.1,INSD:EL977409.1,INSD:EL253613.1,
FT                   INSD:AV799468.1,INSD:EH835087.1,INSD:EL174544.1,
FT                   INSD:ES188298.1,INSD:ES194779.1,INSD:EL970497.1,
FT                   INSD:ES205375.1,INSD:ES120781.1,INSD:DR205991.1,
FT                   INSD:EL016337.1,INSD:DR206006.1,INSD:BP597439.1,
FT                   INSD:EL198286.1,INSD:CD531880.1,INSD:ES191077.1,
FT                   INSD:BP567636.1,INSD:DR205982.1,INSD:EL083149.1,
FT                   INSD:BP812517.1,INSD:BP777706.1,INSD:EL038337.1,
FT                   INSD:EH808111.1,INSD:ES185982.1,INSD:EH852316.1,
FT                   INSD:EH833808.1,INSD:EL203714.1,INSD:BP626751.1,
FT                   INSD:EL076310.1,INSD:EH912458.1,INSD:EL048996.1,
FT                   INSD:BP791397.1,INSD:EL281775.1,INSD:EL979711.1,
FT                   INSD:BP779714.1,INSD:EL975387.1,INSD:AV783727.1,
FT                   INSD:DR206009.1,INSD:BP619221.1,INSD:EH845610.1,
FT                   INSD:ES186917.1,INSD:EL969978.1,INSD:DR205998.1,
FT                   INSD:EL117312.1,INSD:EH816787.1,INSD:EH810495.1,
FT                   INSD:EL994244.1,INSD:EL223982.1,INSD:EH992577.1,
FT                   INSD:AV811115.1,INSD:BP784434.1,INSD:CF653030.1,
FT                   INSD:EL050272.1,INSD:EL050118.1,INSD:AV786034.1,
FT                   INSD:BP580871.1,INSD:AV808985.1,INSD:EL058435.1,
FT                   INSD:EL058817.1,INSD:DR212538.1,INSD:AV820555.1,
FT                   INSD:AV804363.1,INSD:AV442302.1,INSD:ES045583.1,
FT                   INSD:BE526106.1,INSD:DR205996.1,INSD:AV796139.1,
FT                   INSD:DR206002.1,INSD:EH795604.1,INSD:EL004584.1,
FT                   INSD:BP669693.1,INSD:EL240083.1,INSD:AV519217.1,
FT                   INSD:ES202230.1,INSD:BP571559.1,INSD:BP646785.1,
FT                   INSD:EH946132.1,INSD:ES064092.1,INSD:BP656582.1,
FT                   INSD:AV566860.1,INSD:DR205984.1,INSD:ES042994.1,
FT                   INSD:ES102493.1,INSD:AV822863.1,INSD:BP648095.1,
FT                   INSD:EL201974.1,INSD:CB254151.1,INSD:EL166956.1,
FT                   INSD:EL121746.1,INSD:EL977269.1,INSD:EH821075.1,
FT                   INSD:DR206008.1,INSD:DR206000.1,INSD:BP815238.1,
FT                   INSD:AV440904.1,INSD:BP814290.1,INSD:EH989363.1,
FT                   INSD:EH931173.1,INSD:ES148495.1,INSD:ES100319.1,
FT                   INSD:ES053264.1,INSD:EH865397.1,INSD:CD532221.1,
FT                   INSD:DR206010.1,INSD:BP832543.1,INSD:EH962693.1,
FT                   INSD:BP653211.1,INSD:BP863516.1,INSD:AV809223.1,
FT                   INSD:AV803859.1,INSD:EL008624.1,INSD:BP577951.1,
FT                   INSD:AV820354.1,INSD:CB074541.1,INSD:AV818878.1,
FT                   INSD:EH856605.1,INSD:BP618633.1,INSD:EG523502.1,
FT                   INSD:CD532187.1,INSD:DR205983.1,INSD:BP597895.1,
FT                   INSD:BP836560.1,INSD:EL186852.1,INSD:EH928857.1,
FT                   INSD:BP567739.1,INSD:EH948821.1,INSD:EL979189.1,
FT                   INSD:CD531112.1,INSD:EH943500.1,INSD:DR206001.1,
FT                   INSD:ES195458.1,INSD:EL984245.1,INSD:EH909394.1,
FT                   INSD:EL968248.1,INSD:EL979648.1,INSD:EL971487.1,
FT                   INSD:EL232187.1,INSD:EH820006.1,INSD:AV802042.1,
FT                   INSD:EL196749.1,INSD:EG523501.1,INSD:EL036014.1,
FT                   INSD:EH819308.1,INSD:ES152698.1,INSD:EH929393.1,
FT                   INSD:T43647.1,INSD:ES013346.1,INSD:EL030676.1,
FT                   INSD:DR205993.1,INSD:EL047542.1,INSD:BE523139.1,
FT                   INSD:EL223241.1,INSD:BP839219.1,INSD:EL109383.1,
FT                   INSD:ES168032.1,INSD:EL074592.1,INSD:AV804719.1,
FT                   INSD:EL314797.1,INSD:EH913317.1,INSD:DR205980.1,
FT                   INSD:BP617900.1,INSD:EL111649.1,INSD:EL088379.1,
FT                   INSD:EL969103.1,INSD:ES135482.1,INSD:BP612918.1,
FT                   INSD:DR212539.1,INSD:EL254567.1,INSD:EL972034.1,
FT                   INSD:DR206004.1,INSD:DR205997.1,INSD:ES056681.1,
FT                   INSD:EL970868.1,INSD:AV786428.1,INSD:DR205985.1,
FT                   INSD:ES106770.1,INSD:BP607243.1,INSD:EL974709.1,
FT                   INSD:ES031557.1,INSD:EL980201.1,INSD:BP799515.1,
FT                   INSD:BP623169.1,INSD:CK118585.1,INSD:EH898083.1,
FT                   INSD:AV824408.1,INSD:BP647227.1,INSD:EL172011.1,
FT                   INSD:AV794288.1,INSD:AV522055.1,INSD:EL290797.1,
FT                   INSD:AV800740.1,INSD:BP595107.1,INSD:EL176496.1,
FT                   INSD:AV793305.1,INSD:BP802612.1,INSD:ES029454.1,
FT                   INSD:BP616597.1,INSD:BP791290.1,INSD:DR205994.1,
FT                   INSD:AV535727.1,INSD:ES177364.1,INSD:EL973935.1,
FT                   INSD:DR206003.1,INSD:EL096772.1,INSD:DR205988.1,
FT                   INSD:EH828723.1,INSD:ES173714.1,INSD:EL972296.1,
FT                   INSD:EH970356.1,INSD:DR206012.1,INSD:EL149556.1,
FT                   INSD:BP803813.1,INSD:EL968901.1,INSD:BP589644.1,
FT                   INSD:EL969168.1,INSD:CD531278.1,INSD:DR206005.1,
FT                   INSD:EL113861.1,INSD:DR205987.1,INSD:BP856776.1,
FT                   INSD:DR205995.1,INSD:EL025206.1,INSD:EH815005.1,
FT                   INSD:EL967344.1,INSD:ES128802.1,INSD:T22185.1,
FT                   INSD:DR205999.1,INSD:AV818333.1,INSD:BP566909.1,
FT                   INSD:EL162663.1,INSD:EH824964.1,INSD:EH931659.1,
FT                   INSD:BP621246.1,INSD:AV818103.1,INSD:AI996538.1,
FT                   INSD:Z37624.1,INSD:DR205990.1,INSD:EL976135.1,
FT                   INSD:AV794056.1,INSD:DR206011.1,INSD:BP561566.2,
FT                   INSD:EL306377.1,INSD:DR206007.1,INSD:AV798131.1,
FT                   INSD:DR205981.1,INSD:EL064587.1,INSD:DR375721.1,
FT                   INSD:BP801444.1,INSD:DR206013.1,INSD:EH819018.1,
FT                   INSD:DR206014.1,INSD:ES215901.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF349532.1,INSD:AY063906.1,INSD:AY059805.1,
FT                   INSD:BT000041.1,INSD:AF083676.1,INSD:BX815515.1,
FT                   INSD:AY091197.1"
FT                   /protein_id="AEE27303.1"
FT                   /translation="MARPQDPPRGFFPFGNPFKNLSSKNSVLSSKLLPLLNNFETNLAS
FT                   SISKLVPKEKSDILTVSWMKQAMESLCETHNGIKTLITDLELPVSDWEDKWVDVYLDIS
FT                   VKLLDLCNAFSSELTRLNQGHLLLQFALHNLEANSPQNLSKAQSSLDSWKQHIVSKNPR
FT                   IENCRAILSSLVQTLNLPKVKNSAKGKVLMRALYGVKVKTLYISGVFAAAFSGSSQNLM
FT                   YLTVSNELPWAQSFMEVQNTMNAEIKNIFLSDGLTVLKELEAVASGVKKLYPAIQQGSI
FT                   DPISLQPLKDSVTELSNGIDLVSKEVDCFFKILLSGRDTLLENLRSMGASTLQATSPKK
FT                   AAGKNYRGF"
FT   CDS_pept        200526..201575
FT                   /codon_start=1
FT                   /gene="BPS1"
FT                   /gene_synonym="BYPASS 1"
FT                   /gene_synonym="F22L4.9"
FT                   /gene_synonym="F22L4_9"
FT                   /locus_tag="AT1G01550"
FT                   /product="BPS1-like protein (DUF793)"
FT                   /note="BYPASS 1 (BPS1); FUNCTIONS IN: molecular_function
FT                   unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 24
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Protein BYPASS related
FT                   (InterPro:IPR008511); BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT2G46080.1); Has 35333
FT                   Blast hits to 34131 proteins in 2444 species: Archae - 798;
FT                   Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531;
FT                   Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01550.1"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01550.2"
FT                   /db_xref="GOA:Q9LMM6"
FT                   /db_xref="InterPro:IPR008511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LMM6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH965158.1,INSD:CD529780.1,INSD:EH890117.1,
FT                   INSD:EL022850.1,INSD:BP789082.1,INSD:ES196268.1,
FT                   INSD:BP666861.1,INSD:AI100650.1,INSD:BP777906.1,
FT                   INSD:EH796654.1,INSD:EL338658.1,INSD:AV812619.1,
FT                   INSD:CB253177.1,INSD:EL980319.1,INSD:EL199927.1,
FT                   INSD:CD532203.1,INSD:BP639179.1,INSD:BP617463.1,
FT                   INSD:BP587538.1,INSD:EL977409.1,INSD:EL253613.1,
FT                   INSD:AV799468.1,INSD:EH835087.1,INSD:EL174544.1,
FT                   INSD:ES188298.1,INSD:ES194779.1,INSD:EL970497.1,
FT                   INSD:ES205375.1,INSD:ES120781.1,INSD:EL016337.1,
FT                   INSD:BP597439.1,INSD:EL198286.1,INSD:CD531880.1,
FT                   INSD:ES191077.1,INSD:BP567636.1,INSD:DR368633.1,
FT                   INSD:EL083149.1,INSD:DR368639.1,INSD:BP777706.1,
FT                   INSD:EH808111.1,INSD:EL038337.1,INSD:EL140685.1,
FT                   INSD:ES185982.1,INSD:EL979942.1,INSD:EH852316.1,
FT                   INSD:DR368640.1,INSD:EH833808.1,INSD:EL203714.1,
FT                   INSD:BP626751.1,INSD:EH912458.1,INSD:EL048996.1,
FT                   INSD:BP791397.1,INSD:EL281775.1,INSD:EL979711.1,
FT                   INSD:BP779714.1,INSD:EL975387.1,INSD:AV783727.1,
FT                   INSD:EH845610.1,INSD:BP619221.1,INSD:ES186917.1,
FT                   INSD:EL969978.1,INSD:EL117312.1,INSD:EH816787.1,
FT                   INSD:EH810495.1,INSD:EL994244.1,INSD:EL223982.1,
FT                   INSD:EH992577.1,INSD:AV811115.1,INSD:BP784434.1,
FT                   INSD:CF653030.1,INSD:EL050272.1,INSD:EL050118.1,
FT                   INSD:AV786034.1,INSD:BP580871.1,INSD:AV808985.1,
FT                   INSD:EL058435.1,INSD:EL986345.1,INSD:EL058817.1,
FT                   INSD:DR212538.1,INSD:AV820555.1,INSD:AV804363.1,
FT                   INSD:ES045583.1,INSD:AV796139.1,INSD:EH795604.1,
FT                   INSD:EL004584.1,INSD:BP669693.1,INSD:EL240083.1,
FT                   INSD:DR368636.1,INSD:DR368632.1,INSD:AV519217.1,
FT                   INSD:ES202230.1,INSD:BP571559.1,INSD:BP646785.1,
FT                   INSD:ES064092.1,INSD:BP656582.1,INSD:AV566860.1,
FT                   INSD:DR205984.1,INSD:ES042994.1,INSD:BP648095.1,
FT                   INSD:EL201974.1,INSD:CB254151.1,INSD:EL166956.1,
FT                   INSD:EL121746.1,INSD:EL977269.1,INSD:EH821075.1,
FT                   INSD:AV440904.1,INSD:EH989363.1,INSD:ES148495.1,
FT                   INSD:EH931173.1,INSD:ES100319.1,INSD:ES053264.1,
FT                   INSD:BP813415.1,INSD:EH865397.1,INSD:CD532221.1,
FT                   INSD:EH962693.1,INSD:BP653211.1,INSD:AV809223.1,
FT                   INSD:AV803859.1,INSD:EL008624.1,INSD:BP577951.1,
FT                   INSD:AV820354.1,INSD:EH893189.1,INSD:CB074541.1,
FT                   INSD:AV818878.1,INSD:EH856605.1,INSD:BP618633.1,
FT                   INSD:CD532187.1,INSD:DR368635.1,INSD:AV440197.1,
FT                   INSD:BP597895.1,INSD:EL186852.1,INSD:CB254255.1,
FT                   INSD:EH928857.1,INSD:BP567739.1,INSD:EH948821.1,
FT                   INSD:EL979189.1,INSD:CD531112.1,INSD:EH943500.1,
FT                   INSD:BP814361.1,INSD:ES195458.1,INSD:BP839270.1,
FT                   INSD:BP837763.1,INSD:EL984245.1,INSD:EH909394.1,
FT                   INSD:EL968248.1,INSD:EL979648.1,INSD:CB253014.1,
FT                   INSD:EL971487.1,INSD:EL232187.1,INSD:EH820006.1,
FT                   INSD:AV802042.1,INSD:EL196749.1,INSD:EG523501.1,
FT                   INSD:ES152698.1,INSD:EH819308.1,INSD:EL036014.1,
FT                   INSD:EH929393.1,INSD:T43647.1,INSD:ES013346.1,
FT                   INSD:EL030676.1,INSD:EL047542.1,INSD:EL223241.1,
FT                   INSD:EL109383.1,INSD:ES168032.1,INSD:EL074592.1,
FT                   INSD:AV804719.1,INSD:EL314797.1,INSD:EH913317.1,
FT                   INSD:EL111649.1,INSD:BP617900.1,INSD:EL088379.1,
FT                   INSD:EL969103.1,INSD:ES135482.1,INSD:BP612918.1,
FT                   INSD:BP825677.1,INSD:DR212539.1,INSD:EL254567.1,
FT                   INSD:EL972034.1,INSD:ES056681.1,INSD:EL970868.1,
FT                   INSD:AV786428.1,INSD:ES106770.1,INSD:BP607243.1,
FT                   INSD:EL974709.1,INSD:ES031557.1,INSD:EL980201.1,
FT                   INSD:BP623169.1,INSD:DR368634.1,INSD:CK118585.1,
FT                   INSD:EH898083.1,INSD:DR368638.1,INSD:BP647227.1,
FT                   INSD:EL172011.1,INSD:AV794288.1,INSD:AV522055.1,
FT                   INSD:EL290797.1,INSD:AV800740.1,INSD:EL176496.1,
FT                   INSD:AV793305.1,INSD:BP595107.1,INSD:ES029454.1,
FT                   INSD:BP616597.1,INSD:BP791290.1,INSD:AV535727.1,
FT                   INSD:ES177364.1,INSD:EL973935.1,INSD:EL096772.1,
FT                   INSD:EH828723.1,INSD:ES173714.1,INSD:EL972296.1,
FT                   INSD:EH970356.1,INSD:EL149556.1,INSD:EL968901.1,
FT                   INSD:BP589644.1,INSD:EL969168.1,INSD:EL113861.1,
FT                   INSD:EL978726.1,INSD:DR368637.1,INSD:EL025206.1,
FT                   INSD:EH815005.1,INSD:EL967344.1,INSD:ES128802.1,
FT                   INSD:T22185.1,INSD:AV818333.1,INSD:BP566909.1,
FT                   INSD:EL162663.1,INSD:EH824964.1,INSD:BP621246.1,
FT                   INSD:AV818103.1,INSD:AI996538.1,INSD:Z37624.1,
FT                   INSD:EL976135.1,INSD:AV794056.1,INSD:EL306377.1,
FT                   INSD:AV798131.1,INSD:EL064587.1,INSD:DR375721.1,
FT                   INSD:EH819018.1,INSD:ES215901.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF349532.1,INSD:BT000041.1,INSD:AF083676.1,
FT                   INSD:AY091197.1"
FT                   /protein_id="AEE27304.1"
FT                   /translation="MARPQDPPRGFFPFGNPFKNLSSKNSVLSSKLLPLLNNFETNLAS
FT                   SISKLVPKEKSDILTVSWMKQAMESLCETHNGIKTLITDLELPVSDWEDKWVDVYLDIS
FT                   VKLLDLCNAFSSELTRLNQGHLLLQFALHNLEANSPQNLSKAQSSLDSWKQHIVSKNPR
FT                   IENCRAILSSLVQTLNLPKVKNSAKGKVLMRALYGVKVKTLYISGVFAAAFSGSSQNLM
FT                   YLTVSNELPWAQSFMEVQNTMNAEIKNIFLSDGLTVLKELEAVASGVKKLYPAIQQGSI
FT                   DPISLQPLKDSVTELSNGIDLVSKEVDCFFKILLSGRDTLLENLRSMGASTLQATSPKK
FT                   AAGKNYRGF"
FT   gene            202103..204440
FT                   /gene="MPK11"
FT                   /gene_synonym="ATMPK11"
FT                   /gene_synonym="F22L4.10"
FT                   /gene_synonym="F22L4_10"
FT                   /gene_synonym="MAP kinase 11"
FT                   /locus_tag="AT1G01560"
FT                   /note="member of MAP Kinase"
FT   mRNA            join(202103..202508,202782..202911,202991..203128,
FT                   203267..203599,203760..204388)
FT                   /gene="MPK11"
FT                   /gene_synonym="ATMPK11"
FT                   /gene_synonym="F22L4.10"
FT                   /gene_synonym="F22L4_10"
FT                   /gene_synonym="MAP kinase 11"
FT                   /locus_tag="AT1G01560"
FT                   /product="MAP kinase 11"
FT   mRNA            join(202111..202508,202782..202911,202991..203128,
FT                   203267..203599,203760..203943,204029..204440)
FT                   /gene="MPK11"
FT                   /gene_synonym="ATMPK11"
FT                   /gene_synonym="F22L4.10"
FT                   /gene_synonym="F22L4_10"
FT                   /gene_synonym="MAP kinase 11"
FT                   /locus_tag="AT1G01560"
FT                   /product="MAP kinase 11"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG486148.1,INSD:CB255438.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX815051.1"
FT   mRNA            join(202136..202508,202782..202911,202991..203128,
FT                   203267..204335)
FT                   /gene="MPK11"
FT                   /gene_synonym="ATMPK11"
FT                   /gene_synonym="F22L4.10"
FT                   /gene_synonym="F22L4_10"
FT                   /gene_synonym="MAP kinase 11"
FT                   /locus_tag="AT1G01560"
FT                   /product="MAP kinase 11"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG486148.1,INSD:CB255438.1"
FT   mRNA            join(202136..202508,202782..202911,202991..203128,
FT                   203267..203943,204029..204335)
FT                   /gene="MPK11"
FT                   /gene_synonym="ATMPK11"
FT                   /gene_synonym="F22L4.10"
FT                   /gene_synonym="F22L4_10"
FT                   /gene_synonym="MAP kinase 11"
FT                   /locus_tag="AT1G01560"
FT                   /product="MAP kinase 11"
FT   CDS_pept        join(202345..202508,202782..202911,202991..203128,
FT                   203267..203599,203760..203943,204029..204189)
FT                   /codon_start=1
FT                   /gene="MPK11"
FT                   /gene_synonym="ATMPK11"
FT                   /gene_synonym="F22L4.10"
FT                   /gene_synonym="F22L4_10"
FT                   /gene_synonym="MAP kinase 11"
FT                   /locus_tag="AT1G01560"
FT                   /product="MAP kinase 11"
FT                   /note="MAP kinase 11 (MPK11); FUNCTIONS IN: MAP kinase
FT                   activity, kinase activity; INVOLVED IN: signal
FT                   transduction, response to abscisic acid stimulus; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), JNK MAP kinase
FT                   (InterPro:IPR008351), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Serine/threonine-protein
FT                   kinase, active site (InterPro:IPR008271), Protein
FT                   kinase-like domain (InterPro:IPR011009), MAP kinase,
FT                   conserved site (InterPro:IPR003527), Protein kinase,
FT                   catalytic domain (InterPro:IPR000719), Tyrosine-protein
FT                   kinase, catalytic domain (InterPro:IPR020635); BEST
FT                   Arabidopsis thaliana protein match is: MAP kinase 4
FT                   (TAIR:AT4G01370.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01560.2"
FT                   /db_xref="GOA:Q9LMM5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LMM5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG486148.1,INSD:CB255438.1"
FT                   /protein_id="AEE27306.1"
FT                   /translation="MSIEKPFFGDDSNRGVSINGGRYVQYNVYGNLFEVSKKYVPPLRP
FT                   IGRGASGIVCAAWNSETGEEVAIKKIGNAFGNIIDAKRTLREIKLLKHMDHDNVIAIID
FT                   IIRPPQPDNFNDVHIVYELMDTDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYVHSANVL
FT                   HRDLKPSNLLLNANCDLKIGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAI
FT                   DIWSVGCILGEIMTREPLFPGRDYVQQLRLITELIGSPDDSSLGFLRSDNARRYVRQLP
FT                   QYPRQNFAARFPNMSVNAVDLLQKMLVFDPNRRITVDEALCHPYLAPLHEYNEEPVCVR
FT                   PFHFDFEQPSLTEENIKELIYRESVKFNP"
FT   CDS_pept        join(202345..202508,202782..202911,202991..203128,
FT                   203267..203599,203760..204035)
FT                   /codon_start=1
FT                   /gene="MPK11"
FT                   /gene_synonym="ATMPK11"
FT                   /gene_synonym="F22L4.10"
FT                   /gene_synonym="F22L4_10"
FT                   /gene_synonym="MAP kinase 11"
FT                   /locus_tag="AT1G01560"
FT                   /product="MAP kinase 11"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01560"
FT                   /db_xref="GOA:A0A1P8ASZ4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8ASZ4"
FT                   /protein_id="ANM59778.1"
FT                   /translation="MSIEKPFFGDDSNRGVSINGGRYVQYNVYGNLFEVSKKYVPPLRP
FT                   IGRGASGIVCAAWNSETGEEVAIKKIGNAFGNIIDAKRTLREIKLLKHMDHDNVIAIID
FT                   IIRPPQPDNFNDVHIVYELMDTDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYVHSANVL
FT                   HRDLKPSNLLLNANCDLKIGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAI
FT                   DIWSVGCILGEIMTREPLFPGRDYVQQLRLITELIGSPDDSSLGFLRSDNARRYVRQLP
FT                   QYPRQNFAARFPNMSVNAVDLLQKMLVFDPNRRITGKADENLYMLHSLLIFSFYNTFEL
FT                   VLSCSR"
FT   CDS_pept        join(202345..202508,202782..202911,202991..203128,
FT                   203267..203662)
FT                   /codon_start=1
FT                   /gene="MPK11"
FT                   /gene_synonym="ATMPK11"
FT                   /gene_synonym="F22L4.10"
FT                   /gene_synonym="F22L4_10"
FT                   /gene_synonym="MAP kinase 11"
FT                   /locus_tag="AT1G01560"
FT                   /product="MAP kinase 11"
FT                   /db_xref="GOA:Q9LMM5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LMM5"
FT                   /protein_id="ANM59779.1"
FT                   /translation="MSIEKPFFGDDSNRGVSINGGRYVQYNVYGNLFEVSKKYVPPLRP
FT                   IGRGASGIVCAAWNSETGEEVAIKKIGNAFGNIIDAKRTLREIKLLKHMDHDNVIAIID
FT                   IIRPPQPDNFNDVHIVYELMDTDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYVHSANVL
FT                   HRDLKPSNLLLNANCDLKIGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAI
FT                   DIWSVGCILGEIMTREPLFPGRDYVQQLRLITEVNFSLFHLTILFRFNLKKEH"
FT   CDS_pept        join(202345..202508,202782..202911,202991..203128,
FT                   203267..203662)
FT                   /codon_start=1
FT                   /gene="MPK11"
FT                   /gene_synonym="ATMPK11"
FT                   /gene_synonym="F22L4.10"
FT                   /gene_synonym="F22L4_10"
FT                   /gene_synonym="MAP kinase 11"
FT                   /locus_tag="AT1G01560"
FT                   /product="MAP kinase 11"
FT                   /note="MAP kinase 11 (MPK11); FUNCTIONS IN: MAP kinase
FT                   activity, kinase activity; INVOLVED IN: signal
FT                   transduction, response to abscisic acid stimulus; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), Serine/threonine-protein
FT                   kinase-like domain (InterPro:IPR017442),
FT                   Serine/threonine-protein kinase, active site
FT                   (InterPro:IPR008271), Protein kinase-like domain
FT                   (InterPro:IPR011009), MAP kinase, conserved site
FT                   (InterPro:IPR003527), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Tyrosine-protein kinase, catalytic
FT                   domain (InterPro:IPR020635); BEST Arabidopsis thaliana
FT                   protein match is: MAP kinase 4 (TAIR:AT4G01370.1); Has
FT                   120594 Blast hits to 119420 proteins in 4621 species:
FT                   Archae - 98; Bacteria - 12299; Metazoa - 46324; Fungi -
FT                   12052; Plants - 29649; Viruses - 464; Other Eukaryotes -
FT                   19708 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01560"
FT                   /db_xref="GOA:Q9LMM5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LMM5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG486148.1,INSD:CB255438.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX815051.1"
FT                   /protein_id="AEE27305.1"
FT                   /translation="MSIEKPFFGDDSNRGVSINGGRYVQYNVYGNLFEVSKKYVPPLRP
FT                   IGRGASGIVCAAWNSETGEEVAIKKIGNAFGNIIDAKRTLREIKLLKHMDHDNVIAIID
FT                   IIRPPQPDNFNDVHIVYELMDTDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYVHSANVL
FT                   HRDLKPSNLLLNANCDLKIGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAI
FT                   DIWSVGCILGEIMTREPLFPGRDYVQQLRLITEVNFSLFHLTILFRFNLKKEH"
FT   gene            204935..207642
FT                   /gene_synonym="F22L4.11"
FT                   /gene_synonym="F22L4_11"
FT                   /locus_tag="AT1G01570"
FT   mRNA            join(204935..205949,206692..207243,207325..207642)
FT                   /gene_synonym="F22L4.11"
FT                   /gene_synonym="F22L4_11"
FT                   /locus_tag="AT1G01570"
FT                   /product="transferring glycosyl group transferase (DUF604)"
FT   CDS_pept        join(205083..205949,206692..207243,207325..207435)
FT                   /codon_start=1
FT                   /gene_synonym="F22L4.11"
FT                   /gene_synonym="F22L4_11"
FT                   /locus_tag="AT1G01570"
FT                   /product="transferring glycosyl group transferase (DUF604)"
FT                   /db_xref="GOA:Q9LMM4"
FT                   /db_xref="InterPro:IPR006740"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LMM4"
FT                   /protein_id="ANM59743.1"
FT                   /translation="MGDDKKDQKQLSSYLKAKNFSCDSHFSFYWLMSRLIFLILAILFS
FT                   LQFVFYPLNFISSSSQPLIKFSVSPVVSGSGSVHEPDQTELKHVVFGIAASAKFWKHRK
FT                   DYVKLWWKPNGEMNGVVWLDQHINQNDNVSKTLPPIRISSDTSRFQYRYPKGLRSAIRI
FT                   TRIVSETVRLLNGTELEKNVRWIVMGDDDTVFFPENLVKVLRKYDHNQFYYIGSSSESH
FT                   IQNLKFSYGMAYGGGGFAISYPLAKALEKMQDRCIQRYSELYGSDDRIHACMSELGVPL
FT                   TKEVGFHQIDLYGKLLGLLSAHPLAPLVSIHHLDLVDPVFPNMGRVNAMRRFMVPAKLD
FT                   SPSLAQQSICYDADHRWTVSVSWGYTVQIIRGVLSAREMVIPTRTFIDWYKQADERSYA
FT                   FNTRPIAKSACQRPRVYYLSNALPDLALRRTASEYVRWYDMWEPECDWDMSDPSEFERV
FT                   IVYKKPDPDRWNKHRAPRRDCCRVLPTTKNGTMVIDVGACKDDEFAEFLVK"
FT   mRNA            join(205176..205949,206692..207243,207325..207435)
FT                   /gene_synonym="F22L4.11"
FT                   /gene_synonym="F22L4_11"
FT                   /locus_tag="AT1G01570"
FT                   /product="transferring glycosyl group transferase (DUF604)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES162570.1,INSD:ES068027.1,INSD:ES195893.1,
FT                   INSD:EH938224.1,INSD:ES100382.1"
FT   CDS_pept        join(205176..205949,206692..207243,207325..207435)
FT                   /codon_start=1
FT                   /gene_synonym="F22L4.11"
FT                   /gene_synonym="F22L4_11"
FT                   /locus_tag="AT1G01570"
FT                   /product="transferring glycosyl group transferase (DUF604)"
FT                   /note="FUNCTIONS IN: transferase activity, transferring
FT                   glycosyl groups; INVOLVED IN: biological_process unknown;
FT                   LOCATED IN: endomembrane system; EXPRESSED IN: 15 plant
FT                   structures; EXPRESSED DURING: 7 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF604
FT                   (InterPro:IPR006740); BEST Arabidopsis thaliana protein
FT                   match is: fringe-related protein (TAIR:AT4G00300.1); Has
FT                   558 Blast hits to 547 proteins in 95 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 99; Fungi - 169; Plants - 281;
FT                   Viruses - 0; Other Eukaryotes - 9 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01570"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01570.1"
FT                   /db_xref="GOA:F4HU33"
FT                   /db_xref="InterPro:IPR006740"
FT                   /db_xref="UniProtKB/TrEMBL:F4HU33"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES162570.1,INSD:ES068027.1,INSD:ES195893.1,
FT                   INSD:EH938224.1,INSD:ES100382.1"
FT                   /protein_id="AEE27307.1"
FT                   /translation="MSRLIFLILAILFSLQFVFYPLNFISSSSQPLIKFSVSPVVSGSG
FT                   SVHEPDQTELKHVVFGIAASAKFWKHRKDYVKLWWKPNGEMNGVVWLDQHINQNDNVSK
FT                   TLPPIRISSDTSRFQYRYPKGLRSAIRITRIVSETVRLLNGTELEKNVRWIVMGDDDTV
FT                   FFPENLVKVLRKYDHNQFYYIGSSSESHIQNLKFSYGMAYGGGGFAISYPLAKALEKMQ
FT                   DRCIQRYSELYGSDDRIHACMSELGVPLTKEVGFHQIDLYGKLLGLLSAHPLAPLVSIH
FT                   HLDLVDPVFPNMGRVNAMRRFMVPAKLDSPSLAQQSICYDADHRWTVSVSWGYTVQIIR
FT                   GVLSAREMVIPTRTFIDWYKQADERSYAFNTRPIAKSACQRPRVYYLSNALPDLALRRT
FT                   ASEYVRWYDMWEPECDWDMSDPSEFERVIVYKKPDPDRWNKHRAPRRDCCRVLPTTKNG
FT                   TMVIDVGACKDDEFAEFLVK"
FT   gene            208995..213082
FT                   /gene="FRO2"
FT                   /gene_synonym="ATFRO2"
FT                   /gene_synonym="F22L4.12"
FT                   /gene_synonym="F22L4_12"
FT                   /gene_synonym="FERRIC CHELATE REDUCTASE DEFECTIVE 1"
FT                   /gene_synonym="ferric reduction oxidase 2"
FT                   /gene_synonym="FERRIC REDUCTION OXIDASE 2"
FT                   /gene_synonym="FRD1"
FT                   /locus_tag="AT1G01580"
FT                   /note="Encodes the low-iron-inducible ferric chelate
FT                   reductase responsible for reduction of iron at the root
FT                   surface. It is likely to be the major Fe(III) chelate
FT                   reductase in Arabidopsis iron metabolism. Coordinately
FT                   regulated with IRT1, the major transporter responsible for
FT                   high-affinity iron uptake from the soil, at both
FT                   transcriptional and posttranscriptional levels. Steady
FT                   state mRNA levels are regulated by several metals. Its
FT                   transcription is regulated by FIT1."
FT   mRNA            join(208995..209608,209764..209866,209950..210144,
FT                   210385..210619,211052..211379,211474..211717,
FT                   211855..212573,212671..213082)
FT                   /gene="FRO2"
FT                   /gene_synonym="ATFRO2"
FT                   /gene_synonym="F22L4.12"
FT                   /gene_synonym="F22L4_12"
FT                   /gene_synonym="FERRIC CHELATE REDUCTASE DEFECTIVE 1"
FT                   /gene_synonym="ferric reduction oxidase 2"
FT                   /gene_synonym="FERRIC REDUCTION OXIDASE 2"
FT                   /gene_synonym="FRD1"
FT                   /locus_tag="AT1G01580"
FT                   /product="ferric reduction oxidase 2"
FT   CDS_pept        join(209161..209608,209764..209866,209950..210144,
FT                   210385..210619,211052..211379,211474..211717,
FT                   211855..212573,212671..212810)
FT                   /codon_start=1
FT                   /gene="FRO2"
FT                   /gene_synonym="ATFRO2"
FT                   /gene_synonym="F22L4.12"
FT                   /gene_synonym="F22L4_12"
FT                   /gene_synonym="FERRIC CHELATE REDUCTASE DEFECTIVE 1"
FT                   /gene_synonym="ferric reduction oxidase 2"
FT                   /gene_synonym="FERRIC REDUCTION OXIDASE 2"
FT                   /gene_synonym="FRD1"
FT                   /locus_tag="AT1G01580"
FT                   /product="ferric reduction oxidase 2"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01580"
FT                   /db_xref="GOA:A0A1P8AVL6"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AVL6"
FT                   /protein_id="ANM60699.1"
FT                   /translation="MKENKKQDPWGRVTCMEHATSLLHPIPTQNSLFIYTLSLPLLPSK
FT                   QANSILLTKAIVPILISLASERERDRNPERKERMEIEKSNNGGSNPSAGEEFKDMIKGV
FT                   TKFLMMVIFLGTIMLWIMMPTLTYRTKWLPHLRIKFGTSTYFGATGTTLFMYMFPMMVV
FT                   ACLGCVYLHFKNRKSPHHIDRETKGGVWSKLRKPMLVKGPLGIVSVTEITFLAMFVALL
FT                   LWCFITYLRNSFATITPKSAAAHDESLWQAKLESAALRLGLIGNICLAFLFLPVARGSS
FT                   LLPAMGLTSESSIKYHIWLGHMVMALFTVHGLCYIIYWASMHEISQMIMWDTKGVSNLA
FT                   GEIALAAGLVMWATTYPKIRRRFFEVFFYTHYLYIVFMLFFVLHVGISFSFIALPGFYI
FT                   FLVDRFLRFLQSRENVRLLAARILPSDTMELTFSKNSKLVYSPTSIMFVNIPSISKLQW
FT                   HPFTITSSSKLEPEKLSIVIKKEGKWSTKLHQRLSSSDQIDRLAVSVEGPYGPASADFL
FT                   RHEALVMVCGGSGITPFISVIRDLIATSQKETCKIPKITLICAFKKSSEISMLDLVLPL
FT                   SGLETELSSDINIKIEAFITRDNDAGDEAKAGKIKTLWFKPSLSDQSISSILGPNSWLW
FT                   LGAILASSFLIFMIIIGIITRYYIYPIDHNTNKIYSLTSKTIIYILVISVSIMATCSAA
FT                   MLWNKKKYGKVESKQVQNVDRPSPTSSPTSSWGYNSLREIESTPQESLVQRTNLHFGER
FT                   PNLKKLLLDVEGSSVGVLVCGPKKMRQKVAEICSSGLAENLHFESISFSW"
FT   mRNA            join(209208..209608,209764..209866,209950..210144,
FT                   210385..210619,211052..211379,211474..211717,
FT                   211855..212573,212671..213080)
FT                   /gene="FRO2"
FT                   /gene_synonym="ATFRO2"
FT                   /gene_synonym="F22L4.12"
FT                   /gene_synonym="F22L4_12"
FT                   /gene_synonym="FERRIC CHELATE REDUCTASE DEFECTIVE 1"
FT                   /gene_synonym="ferric reduction oxidase 2"
FT                   /gene_synonym="FERRIC REDUCTION OXIDASE 2"
FT                   /gene_synonym="FRD1"
FT                   /locus_tag="AT1G01580"
FT                   /product="ferric reduction oxidase 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX837790.1,INSD:BX834666.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY302057.1"
FT   CDS_pept        join(209395..209608,209764..209866,209950..210144,
FT                   210385..210619,211052..211379,211474..211717,
FT                   211855..212573,212671..212810)
FT                   /codon_start=1
FT                   /gene="FRO2"
FT                   /gene_synonym="ATFRO2"
FT                   /gene_synonym="F22L4.12"
FT                   /gene_synonym="F22L4_12"
FT                   /gene_synonym="FERRIC CHELATE REDUCTASE DEFECTIVE 1"
FT                   /gene_synonym="ferric reduction oxidase 2"
FT                   /gene_synonym="FERRIC REDUCTION OXIDASE 2"
FT                   /gene_synonym="FRD1"
FT                   /locus_tag="AT1G01580"
FT                   /product="ferric reduction oxidase 2"
FT                   /note="ferric reduction oxidase 2 (FRO2); CONTAINS InterPro
FT                   DOMAIN/s: Ferredoxin reductase-type FAD-binding domain
FT                   (InterPro:IPR017927), Ferric reductase, NAD binding
FT                   (InterPro:IPR013121), FAD-binding 8 (InterPro:IPR013112),
FT                   Riboflavin synthase-like beta-barrel (InterPro:IPR017938),
FT                   Ferric reductase-like transmembrane component, N-terminal
FT                   (InterPro:IPR013130); BEST Arabidopsis thaliana protein
FT                   match is: ferric reduction oxidase 1 (TAIR:AT1G01590.1);
FT                   Has 2711 Blast hits to 2707 proteins in 388 species: Archae
FT                   - 5; Bacteria - 307; Metazoa - 560; Fungi - 1180; Plants -
FT                   483; Viruses - 0; Other Eukaryotes - 176 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:P92949"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:P92949"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX837790.1,INSD:BX834666.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY302057.1"
FT                   /protein_id="AEE27308.1"
FT                   /translation="MEIEKSNNGGSNPSAGEEFKDMIKGVTKFLMMVIFLGTIMLWIMM
FT                   PTLTYRTKWLPHLRIKFGTSTYFGATGTTLFMYMFPMMVVACLGCVYLHFKNRKSPHHI
FT                   DRETKGGVWSKLRKPMLVKGPLGIVSVTEITFLAMFVALLLWCFITYLRNSFATITPKS
FT                   AAAHDESLWQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAMGLTSESSIKYHIWL
FT                   GHMVMALFTVHGLCYIIYWASMHEISQMIMWDTKGVSNLAGEIALAAGLVMWATTYPKI
FT                   RRRFFEVFFYTHYLYIVFMLFFVLHVGISFSFIALPGFYIFLVDRFLRFLQSRENVRLL
FT                   AARILPSDTMELTFSKNSKLVYSPTSIMFVNIPSISKLQWHPFTITSSSKLEPEKLSIV
FT                   IKKEGKWSTKLHQRLSSSDQIDRLAVSVEGPYGPASADFLRHEALVMVCGGSGITPFIS
FT                   VIRDLIATSQKETCKIPKITLICAFKKSSEISMLDLVLPLSGLETELSSDINIKIEAFI
FT                   TRDNDAGDEAKAGKIKTLWFKPSLSDQSISSILGPNSWLWLGAILASSFLIFMIIIGII
FT                   TRYYIYPIDHNTNKIYSLTSKTIIYILVISVSIMATCSAAMLWNKKKYGKVESKQVQNV
FT                   DRPSPTSSPTSSWGYNSLREIESTPQESLVQRTNLHFGERPNLKKLLLDVEGSSVGVLV
FT                   CGPKKMRQKVAEICSSGLAENLHFESISFSW"
FT   gene            214150..217734
FT                   /gene="FRO1"
FT                   /gene_synonym="ATFRO1"
FT                   /gene_synonym="F22L4.13"
FT                   /gene_synonym="F22L4_13"
FT                   /gene_synonym="ferric reduction oxidase 1"
FT                   /gene_synonym="FERRIC REDUCTION OXIDASE 1"
FT                   /locus_tag="AT1G01590"
FT                   /note="Encodes a ferric-chelate reductase that is expressed
FT                   at extremely low levels in Fe deficiency-induced
FT                   seedlings."
FT   mRNA            join(214150..214406,214480..214582,214697..214897,
FT                   215317..215554,215633..215960,216044..216293,
FT                   216414..217090,217165..217734)
FT                   /gene="FRO1"
FT                   /gene_synonym="ATFRO1"
FT                   /gene_synonym="F22L4.13"
FT                   /gene_synonym="F22L4_13"
FT                   /gene_synonym="ferric reduction oxidase 1"
FT                   /gene_synonym="FERRIC REDUCTION OXIDASE 1"
FT                   /locus_tag="AT1G01590"
FT                   /product="ferric reduction oxidase 1"
FT   CDS_pept        join(214229..214406,214480..214582,214697..214897,
FT                   215317..215554,215633..215960,216044..216293,
FT                   216414..217090,217165..217304)
FT                   /codon_start=1
FT                   /gene="FRO1"
FT                   /gene_synonym="ATFRO1"
FT                   /gene_synonym="F22L4.13"
FT                   /gene_synonym="F22L4_13"
FT                   /gene_synonym="ferric reduction oxidase 1"
FT                   /gene_synonym="FERRIC REDUCTION OXIDASE 1"
FT                   /locus_tag="AT1G01590"
FT                   /product="ferric reduction oxidase 1"
FT                   /note="ferric reduction oxidase 1 (FRO1); FUNCTIONS IN:
FT                   ferric-chelate reductase activity; INVOLVED IN: oxidation
FT                   reduction; LOCATED IN: integral to membrane, membrane;
FT                   CONTAINS InterPro DOMAIN/s: Ferredoxin reductase-type
FT                   FAD-binding domain (InterPro:IPR017927), Ferric reductase,
FT                   NAD binding (InterPro:IPR013121), FAD-binding 8
FT                   (InterPro:IPR013112), Riboflavin synthase-like beta-barrel
FT                   (InterPro:IPR017938), Ferric reductase-like transmembrane
FT                   component, N-terminal (InterPro:IPR013130); BEST
FT                   Arabidopsis thaliana protein match is: ferric reduction
FT                   oxidase 3 (TAIR:AT1G23020.2); Has 2645 Blast hits to 2634
FT                   proteins in 373 species: Archae - 2; Bacteria - 275;
FT                   Metazoa - 567; Fungi - 1143; Plants - 485; Viruses - 0;
FT                   Other Eukaryotes - 173 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LMM2"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LMM2"
FT                   /protein_id="AEE27309.1"
FT                   /translation="MGVGEMNKEVIDKVIKFLMMVILMGTIVIWIMMPTSTYKEIWLTS
FT                   MRAKLGKSIYYGRPGVNLLVYMFPMILLAFLGCIYLHLKKSTTVNQFNSGVEKKRAKFG
FT                   ALRRPMLVNGPLGIVTVTEVMFLTMFMALLLWSLANYMYRTFVNVTSESAATDGNNLWQ
FT                   ARLDLIAVRIGIVGNICLAFLFYPVARGSSLLAAVGLTSESSIKYHIWLGHLVMIIFTS
FT                   HGLCYFIYWISKNQLVSKMLEWDRTAVSNLAGEIALVAGLMMWVTTYPKIRRRLFEVFF
FT                   YSHYLYIVFMLFFVFHVGISHALIPLPGFYIFLVDRFLRFLQSRNNVKLVSARVLPCDT
FT                   VELNFSKNPMLMYSPTSTMFVNIPSISKLQWHPFTIISSSKLEPETLSVMIKSQGKWST
FT                   KLYDMLSSSSSDQINRLAVSVEGPYGPSSTDFLRHESLVMVSGGSGITPFISIVRDLFY
FT                   MSSTHKCKIPKMTLICAFKNSSDLSMLDLILPTSGLTTDMASFVDIQIKAFVTREEKTS
FT                   VKESTHNRNIIKTRHFKPNVSDQPISPILGPNSWLCLAAILSSSFMIFIVIIAIITRYH
FT                   IHPIDQNSEKYTWAYKSLIYLVSISITVVTTSTAAMLWNKKKYYAKNDQYVDNLSPVII
FT                   ESSPQQLISQSTDIHYGERPNLNKLLVGLKGSSVGILVCGPKKMRQKVAKICSFGSAEN
FT                   LHFESISFSW"
FT   gene            218834..221286
FT                   /gene="CYP86A4"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F22L4.14"
FT                   /gene_synonym="F22L4_14"
FT                   /gene_synonym="family 86"
FT                   /gene_synonym="polypeptide 4"
FT                   /gene_synonym="polypeptide 4''"
FT                   /gene_synonym="subfamily A"
FT                   /locus_tag="AT1G01600"
FT                   /note="Encodes a member of the CYP86A subfamily of
FT                   cytochrome p450 genes. Expressed significantly at highest
FT                   level in mature stems and flowers."
FT   mRNA            join(218834..219621,219752..221286)
FT                   /gene="CYP86A4"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F22L4.14"
FT                   /gene_synonym="F22L4_14"
FT                   /gene_synonym="family 86"
FT                   /gene_synonym="polypeptide 4"
FT                   /gene_synonym="polypeptide 4''"
FT                   /gene_synonym="subfamily A"
FT                   /locus_tag="AT1G01600"
FT                   /product="cytochrome P450, family 86, subfamily A,
FT                   polypeptide 4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR365298.1,INSD:AV559963.1,INSD:AV534510.1,
FT                   INSD:DR365295.1,INSD:DR365300.1,INSD:BP656624.1,
FT                   INSD:BP650429.1,INSD:EL121987.1,INSD:AV557999.1,
FT                   INSD:AU229397.1,INSD:DR365297.1,INSD:AV557187.1,
FT                   INSD:DR365296.1,INSD:CK120271.1,INSD:BP589034.1,
FT                   INSD:BP822199.1,INSD:EL198923.1,INSD:DR259579.1,
FT                   INSD:BP831948.1,INSD:DR356620.1,INSD:BP615210.1,
FT                   INSD:EL080676.1,INSD:CK120064.1,INSD:DR365294.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK117400.1"
FT   CDS_pept        join(219200..219621,219752..220994)
FT                   /codon_start=1
FT                   /gene="CYP86A4"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F22L4.14"
FT                   /gene_synonym="F22L4_14"
FT                   /gene_synonym="family 86"
FT                   /gene_synonym="polypeptide 4"
FT                   /gene_synonym="subfamily A"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="polypeptide 4''"
FT                   /locus_tag="AT1G01600"
FT                   /product="cytochrome P450, family 86, subfamily A,
FT                   polypeptide 4"
FT                   /note="''cytochrome P450, family 86, subfamily A,
FT                   polypeptide 4'' (CYP86A4); CONTAINS InterPro DOMAIN/s:
FT                   Cytochrome P450 (InterPro:IPR001128), Cytochrome P450,
FT                   conserved site (InterPro:IPR017972), Cytochrome P450,
FT                   E-class, group I (InterPro:IPR002401); BEST Arabidopsis
FT                   thaliana protein match is: cytochrome P450, family 86,
FT                   subfamily A, polypeptide 2 (TAIR:AT4G00360.1); Has 27858
FT                   Blast hits to 27767 proteins in 1485 species: Archae - 44;
FT                   Bacteria - 2493; Metazoa - 10417; Fungi - 6140; Plants -
FT                   7807; Viruses - 3; Other Eukaryotes - 954 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9LMM1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LMM1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR365298.1,INSD:AV559963.1,INSD:AV534510.1,
FT                   INSD:DR365295.1,INSD:DR365300.1,INSD:BP656624.1,
FT                   INSD:BP650429.1,INSD:EL121987.1,INSD:AV557999.1,
FT                   INSD:AU229397.1,INSD:DR365297.1,INSD:AV557187.1,
FT                   INSD:DR365296.1,INSD:CK120271.1,INSD:BP589034.1,
FT                   INSD:BP822199.1,INSD:EL198923.1,INSD:DR259579.1,
FT                   INSD:BP831948.1,INSD:DR356620.1,INSD:BP615210.1,
FT                   INSD:EL080676.1,INSD:CK120064.1,INSD:DR365294.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK117400.1"
FT                   /protein_id="AEE27310.1"
FT                   /translation="MEISNAMLLVAIVTGYWLWFKRISRWLKGPRVWPLLGSLPGLIEQ
FT                   RDRMHEWITENLRACGGTYQTCIFAVPFLAKKQGLVTVTCDPKNLEHMLKTRFDNYPKG
FT                   PTWQSVFHDLLGQGIFNSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRGIKLRFCPIL
FT                   ATAQDNAEPVDLQDLILRLTFDNICGLAFGKDTRTCAPGLPENGFASAFDRATEASLQR
FT                   FIIPKFMWKLKKWLGLGLEVSLSRSLGEIDEYLAAVINTRKQELMSQQESGTHQRHDDL
FT                   LSRFMMKKTESYSDTFLQHVALNFILAGRDTSSVALSWFFWLITMHPTVEDKIVREICS
FT                   VLIETRGTDDVASWTEEPLGFDEIDRLVYLKAAISETLRLYPSVPEDSKHVENDDVLPD
FT                   GTFVPAGSSVTYSIYAAGRMKSTWGEDCLEFNPERWISPIDGKFINHDQYRFVAFNAGP
FT                   RICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKVEQKMSLTLFMKNGLLVNLYKRDLQG
FT                   IIKSLVVKKSDGVSNGQCNGVIGEGVAVYLNTGVAVV"
FT   gene            complement(221642..224351)
FT                   /gene="GPAT4"
FT                   /gene_synonym="ATGPAT4"
FT                   /gene_synonym="F22L4.15"
FT                   /gene_synonym="F22L4_15"
FT                   /gene_synonym="glycerol-3-phosphate acyltransferase 4"
FT                   /gene_synonym="GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE 4"
FT                   /gene_synonym="GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 4"
FT                   /locus_tag="AT1G01610"
FT                   /note="bifunctional sn-glycerol-3-phosphate
FT                   2-O-acyltransferase/phosphatase. Involved in cutin assembly
FT                   and is functionally redundant with GPAT8."
FT   mRNA            complement(join(221642..222359,222622..223096,
FT                   223551..223866,223945..224351))
FT                   /gene="GPAT4"
FT                   /gene_synonym="ATGPAT4"
FT                   /gene_synonym="F22L4.15"
FT                   /gene_synonym="F22L4_15"
FT                   /gene_synonym="glycerol-3-phosphate acyltransferase 4"
FT                   /gene_synonym="GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE 4"
FT                   /gene_synonym="GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 4"
FT                   /locus_tag="AT1G01610"
FT                   /product="glycerol-3-phosphate acyltransferase 4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV829965.1,INSD:AV802361.1,INSD:BP651636.1,
FT                   INSD:EL050731.1,INSD:BP820841.1,INSD:BP646939.1,
FT                   INSD:AV531246.1,INSD:EL986041.1,INSD:EH829830.1,
FT                   INSD:EH951990.1,INSD:AV539874.1,INSD:EL975365.1,
FT                   INSD:DR268952.1,INSD:EH907105.1,INSD:DR268956.1,
FT                   INSD:EL967704.1,INSD:ES151796.1,INSD:AV809390.1,
FT                   INSD:AV539305.1,INSD:ES158643.1,INSD:DR268953.1,
FT                   INSD:AV532928.1,INSD:DR372940.1,INSD:DR268946.1,
FT                   INSD:DR268957.1,INSD:BP645416.1,INSD:BP654662.1,
FT                   INSD:BP817997.1,INSD:ES126346.1,INSD:ES137316.1,
FT                   INSD:DR268949.1,INSD:BP646404.1,INSD:BP595307.1,
FT                   INSD:BP822157.1,INSD:AV809813.1,INSD:AV814339.1,
FT                   INSD:AV551721.1,INSD:EL970308.1,INSD:DR268950.1,
FT                   INSD:BP780291.1,INSD:BP852606.1,INSD:BP639656.1,
FT                   INSD:EL980226.1,INSD:EH870145.1,INSD:BP657804.1,
FT                   INSD:EL040974.1,INSD:EH905125.1,INSD:EL977227.1,
FT                   INSD:AV548342.1,INSD:DR268959.1,INSD:DR268948.1,
FT                   INSD:ES184703.1,INSD:ES186090.1,INSD:BX839614.1,
FT                   INSD:EL184855.1,INSD:AV440381.1,INSD:BP826113.1,
FT                   INSD:EL972755.1,INSD:EH886132.1,INSD:ES087604.1,
FT                   INSD:DR268954.1,INSD:BP858448.1,INSD:ES088212.1,
FT                   INSD:BP826030.1,INSD:EH838030.1,INSD:EL977005.1,
FT                   INSD:AV792457.1,INSD:DR268955.1,INSD:DR268945.1,
FT                   INSD:ES121226.1,INSD:DR268951.1,INSD:AV534685.1,
FT                   INSD:BP651340.1,INSD:DR268958.1,INSD:AV547707.1,
FT                   INSD:ES149898.1,INSD:ES161871.1,INSD:BP796056.1,
FT                   INSD:DR268947.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY093294.1,INSD:BX815583.1,INSD:BX816674.1,
FT                   INSD:BX815945.1,INSD:AY062466.1,INSD:BX816650.1"
FT   CDS_pept        complement(join(221950..222359,222622..223096,
FT                   223551..223866,223945..224255))
FT                   /codon_start=1
FT                   /gene="GPAT4"
FT                   /gene_synonym="ATGPAT4"
FT                   /gene_synonym="F22L4.15"
FT                   /gene_synonym="F22L4_15"
FT                   /gene_synonym="glycerol-3-phosphate acyltransferase 4"
FT                   /gene_synonym="GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE 4"
FT                   /gene_synonym="GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 4"
FT                   /locus_tag="AT1G01610"
FT                   /product="glycerol-3-phosphate acyltransferase 4"
FT                   /note="glycerol-3-phosphate acyltransferase 4 (GPAT4);
FT                   FUNCTIONS IN: 1-acylglycerol-3-phosphate O-acyltransferase
FT                   activity, acyltransferase activity; INVOLVED IN: metabolic
FT                   process, cutin biosynthetic process; EXPRESSED IN: 25 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Phospholipid/glycerol acyltransferase
FT                   (InterPro:IPR002123); BEST Arabidopsis thaliana protein
FT                   match is: glycerol-3-phosphate acyltransferase 8
FT                   (TAIR:AT4G00400.1); Has 410 Blast hits to 396 proteins in
FT                   34 species: Archae - 0; Bacteria - 20; Metazoa - 10; Fungi
FT                   - 0; Plants - 373; Viruses - 0; Other Eukaryotes - 7
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01610.1"
FT                   /db_xref="GOA:Q9LMM0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LMM0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV829965.1,INSD:AV802361.1,INSD:BP651636.1,
FT                   INSD:EL050731.1,INSD:BP820841.1,INSD:BP646939.1,
FT                   INSD:AV531246.1,INSD:EL986041.1,INSD:EH829830.1,
FT                   INSD:EH951990.1,INSD:AV539874.1,INSD:EL975365.1,
FT                   INSD:DR268952.1,INSD:EH907105.1,INSD:DR268956.1,
FT                   INSD:EL967704.1,INSD:ES151796.1,INSD:AV809390.1,
FT                   INSD:AV539305.1,INSD:ES158643.1,INSD:DR268953.1,
FT                   INSD:AV532928.1,INSD:DR372940.1,INSD:DR268946.1,
FT                   INSD:DR268957.1,INSD:BP645416.1,INSD:BP654662.1,
FT                   INSD:BP817997.1,INSD:ES126346.1,INSD:ES137316.1,
FT                   INSD:DR268949.1,INSD:BP646404.1,INSD:BP595307.1,
FT                   INSD:BP822157.1,INSD:AV809813.1,INSD:AV814339.1,
FT                   INSD:AV551721.1,INSD:EL970308.1,INSD:DR268950.1,
FT                   INSD:BP780291.1,INSD:BP852606.1,INSD:BP639656.1,
FT                   INSD:EL980226.1,INSD:EH870145.1,INSD:BP657804.1,
FT                   INSD:EL040974.1,INSD:EH905125.1,INSD:EL977227.1,
FT                   INSD:AV548342.1,INSD:DR268959.1,INSD:DR268948.1,
FT                   INSD:ES184703.1,INSD:ES186090.1,INSD:BX839614.1,
FT                   INSD:EL184855.1,INSD:AV440381.1,INSD:BP826113.1,
FT                   INSD:EL972755.1,INSD:EH886132.1,INSD:ES087604.1,
FT                   INSD:DR268954.1,INSD:BP858448.1,INSD:ES088212.1,
FT                   INSD:BP826030.1,INSD:EH838030.1,INSD:EL977005.1,
FT                   INSD:AV792457.1,INSD:DR268955.1,INSD:DR268945.1,
FT                   INSD:ES121226.1,INSD:DR268951.1,INSD:AV534685.1,
FT                   INSD:BP651340.1,INSD:DR268958.1,INSD:AV547707.1,
FT                   INSD:ES149898.1,INSD:ES161871.1,INSD:BP796056.1,
FT                   INSD:DR268947.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY093294.1,INSD:BX815583.1,INSD:BX816674.1,
FT                   INSD:BX815945.1,INSD:AY062466.1,INSD:BX816650.1"
FT                   /protein_id="AEE27311.1"
FT                   /translation="MSPAKKSRSFPPISECKSREYDSIAADLDGTLLLSRSSFPYFMLV
FT                   AIEAGSLFRGLILLLSLPIVIIAYLFVSESLGIQILIFISFAGIKIKNIELVSRAVLTR
FT                   FYAADVRKDSFEVFDKCKKRKVVVTANPIVMVEPFVKDYLGGDKVLGTEIEVNPKTMKA
FT                   TGFVKKPGVLVGDLKRLAILKEFGDDSPDLGLGDRTSDHDFMSICKEGYMVHETKSATT
FT                   VPIESLKNRIIFHDGRLVQRPTPLNALIIYLWLPFGFMLSVFRVYFNLPLPERFVRYTY
FT                   EILGIHLTIRGHRPPPPSPGKPGNLYVLNHRTALDPIIIAIALGRKITCVTYSVSRLSL
FT                   MLSPIPAVALTRDRVADAARMRQLLEKGDLVICPEGTTCREPYLLRFSALFAELSDRIV
FT                   PVAMNCKQGMFNGTTVRGVKFWDPYFFFMNPRPSYEATFLDRLPEEMTVNGGGKTPFEV
FT                   ANYVQKVIGGVLGFECTELTRKDKYLLLGGNDGKVESINKTKSME"
FT   gene            complement(225665..227543)
FT                   /gene="PIP1C"
FT                   /gene_synonym="F22L4.16"
FT                   /gene_synonym="F22L4_16"
FT                   /gene_synonym="PIP1;3"
FT                   /gene_synonym="PLASMA MEMBRANE INTRINSIC PROTEIN 1;3"
FT                   /gene_synonym="plasma membrane intrinsic protein 1C"
FT                   /gene_synonym="TMP-B"
FT                   /locus_tag="AT1G01620"
FT                   /note="a member of the plasma membrane intrinsic protein
FT                   subfamily PIP1. localizes to the plasma membrane and
FT                   exhibits water transport activity in Xenopus oocyte.
FT                   expressed ubiquitously and protein level decreases slightly
FT                   during leaf development."
FT   mRNA            complement(join(225665..226081,226171..226311,
FT                   226396..226691,226849..227543))
FT                   /gene="PIP1C"
FT                   /gene_synonym="F22L4.16"
FT                   /gene_synonym="F22L4_16"
FT                   /gene_synonym="PIP1;3"
FT                   /gene_synonym="PLASMA MEMBRANE INTRINSIC PROTEIN 1;3"
FT                   /gene_synonym="plasma membrane intrinsic protein 1C"
FT                   /gene_synonym="TMP-B"
FT                   /locus_tag="AT1G01620"
FT                   /product="plasma membrane intrinsic protein 1C"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL022688.1,INSD:AV542815.1,INSD:ES031969.1,
FT                   INSD:EH942613.1,INSD:ES207935.1,INSD:BP597207.1,
FT                   INSD:EL156430.1,INSD:EL141779.1,INSD:EL152952.1,
FT                   INSD:EH894675.1,INSD:BP660511.1,INSD:BP599962.1,
FT                   INSD:BP615624.1,INSD:BP662923.1,INSD:EL146246.1,
FT                   INSD:EL037866.1,INSD:EL047245.1,INSD:EL151198.1,
FT                   INSD:BP607020.1,INSD:EH818061.1,INSD:AV558713.1,
FT                   INSD:EL206835.1,INSD:EH875654.1,INSD:EL280264.1,
FT                   INSD:BP642384.1,INSD:N96473.1,INSD:EL253795.1,
FT                   INSD:BP607250.1,INSD:EL332827.1,INSD:EH906376.1,
FT                   INSD:EL102531.1,INSD:EH919112.1,INSD:BP617883.1,
FT                   INSD:EL968106.1,INSD:AV803253.1,INSD:EL238139.1,
FT                   INSD:BP615999.1,INSD:EL971516.1,INSD:BP607216.1,
FT                   INSD:EL135508.1,INSD:BP598613.1,INSD:EL123077.1,
FT                   INSD:EL280084.1,INSD:EL126844.1,INSD:EL101396.1,
FT                   INSD:BP572988.1,INSD:EL067661.1,INSD:EL058438.1,
FT                   INSD:BP628643.1,INSD:EL317711.1,INSD:EL091814.1,
FT                   INSD:BP601615.1,INSD:EL221931.1,INSD:BP579413.1,
FT                   INSD:EH989311.1,INSD:ES168314.1,INSD:EL105431.1,
FT                   INSD:EL191322.1,INSD:EH922982.1,INSD:BP621199.1,
FT                   INSD:BP609852.1,INSD:AV541515.1,INSD:BP609593.1,
FT                   INSD:BP600948.1,INSD:EH935904.1,INSD:EH991737.1,
FT                   INSD:BP606165.1,INSD:EG490315.1,INSD:BP601141.1,
FT                   INSD:BP620143.1,INSD:EL245640.1,INSD:EL028965.1,
FT                   INSD:BP608161.1,INSD:BP574341.1,INSD:EL968755.1,
FT                   INSD:BP597940.1,INSD:BP663595.1,INSD:EH847560.1,
FT                   INSD:EL309129.1,INSD:BP585800.1,INSD:AV521978.1,
FT                   INSD:AV556313.1,INSD:BP609622.1,INSD:BP575144.1,
FT                   INSD:BP640275.1,INSD:AV796506.1,INSD:BP586650.1,
FT                   INSD:BP620206.1,INSD:BP672031.1,INSD:AV790800.1,
FT                   INSD:EL267027.1,INSD:EH867799.1,INSD:ES020055.1,
FT                   INSD:BP564514.1,INSD:BP599383.1,INSD:EH861080.1,
FT                   INSD:AV788097.1,INSD:AV560181.1,INSD:AV544872.1,
FT                   INSD:EL302787.1,INSD:EL969882.1,INSD:ES200421.1,
FT                   INSD:AV557985.1,INSD:EL112692.1,INSD:BP609223.1,
FT                   INSD:BP600467.1,INSD:BP617698.1,INSD:BP581123.1,
FT                   INSD:EL061034.1,INSD:EH986621.1,INSD:EH915497.1,
FT                   INSD:BP595560.1,INSD:EH975830.1,INSD:EH941478.1,
FT                   INSD:BP640614.1,INSD:BP632185.1,INSD:BP610508.1,
FT                   INSD:BP618899.1,INSD:AV541769.1,INSD:EH933941.1,
FT                   INSD:EL064787.1,INSD:BP602795.1,INSD:EH956897.1,
FT                   INSD:BP608067.1,INSD:EL126681.1,INSD:AV521949.1,
FT                   INSD:EL010986.1,INSD:DR378172.1,INSD:AV538082.1,
FT                   INSD:EH873527.1,INSD:EL203754.1,INSD:EH836123.1,
FT                   INSD:AV556308.1,INSD:EL166642.1,INSD:BP601457.1,
FT                   INSD:EL034613.1,INSD:EH976899.1,INSD:AV796455.1,
FT                   INSD:EL263649.1,INSD:BP593405.1,INSD:ES183603.1,
FT                   INSD:DR376656.1,INSD:BP658214.1,INSD:BP605405.1,
FT                   INSD:BP612396.1,INSD:EL114746.1,INSD:BP821512.2,
FT                   INSD:EL117147.1,INSD:EL252849.1,INSD:EL269843.1,
FT                   INSD:BP637473.1,INSD:EH903039.1,INSD:ES159215.1,
FT                   INSD:BP603077.1,INSD:BP632017.1,INSD:EL263596.1,
FT                   INSD:BP585340.1,INSD:EL152975.1,INSD:EL262092.1,
FT                   INSD:BP617987.1,INSD:EL209718.1,INSD:BP584824.1,
FT                   INSD:BP661283.1,INSD:EL257230.1,INSD:BP573876.1,
FT                   INSD:EL333154.1,INSD:ES043162.1,INSD:BP617974.1,
FT                   INSD:BP620523.1,INSD:EL310388.1,INSD:EL135552.1,
FT                   INSD:EL007200.1,INSD:BP606031.1,INSD:BP616376.1,
FT                   INSD:EL280920.1,INSD:EL328303.1,INSD:EL297042.1,
FT                   INSD:BP618662.1,INSD:EL090817.1,INSD:ES021756.1,
FT                   INSD:AV819069.1,INSD:BP601676.1,INSD:BP615052.1,
FT                   INSD:BP620768.1,INSD:BP610038.1,INSD:BP601471.1,
FT                   INSD:EL096078.1,INSD:BP671915.1,INSD:ES203197.1,
FT                   INSD:EL252499.1,INSD:EL281193.1,INSD:BP660201.1,
FT                   INSD:EL328270.1,INSD:ES215392.1,INSD:EH850730.1,
FT                   INSD:EH969529.1,INSD:BP658683.1,INSD:BP603342.1,
FT                   INSD:BP616609.1,INSD:BP599906.1,INSD:EH936321.1,
FT                   INSD:BP631941.1,INSD:EL045100.1,INSD:AV532776.1,
FT                   INSD:EL267737.1,INSD:EL314079.1,INSD:AV520330.1,
FT                   INSD:EL064799.1,INSD:BP615499.1,INSD:EH925848.1,
FT                   INSD:EL108199.1,INSD:BP594764.1,INSD:EL022005.1,
FT                   INSD:EL226325.1,INSD:ES205971.1,INSD:ES025560.1,
FT                   INSD:BP600686.1,INSD:ES059667.1,INSD:BP610419.1,
FT                   INSD:AV566751.1,INSD:EH849615.1,INSD:BP600336.1,
FT                   INSD:EL033432.1,INSD:EL007806.1,INSD:EH986449.1,
FT                   INSD:BP617090.1,INSD:BP601369.1,INSD:EH933270.1,
FT                   INSD:EL217592.1,INSD:AV526413.1,INSD:ES189413.1,
FT                   INSD:EH831811.1,INSD:EH954149.1,INSD:AV556029.1,
FT                   INSD:EL040440.1,INSD:EH990388.1,INSD:AV522087.1,
FT                   INSD:EL186559.1,INSD:ES166867.1,INSD:AV812365.1,
FT                   INSD:BP609775.1,INSD:BP607879.1,INSD:BP602402.1,
FT                   INSD:EL018974.1,INSD:EL037612.1,INSD:EL254153.1,
FT                   INSD:BP617832.1,INSD:H36675.1,INSD:BP616661.1,
FT                   INSD:AV539678.1,INSD:BP600348.1,INSD:AV544554.1,
FT                   INSD:BP610673.1,INSD:AV796157.1,INSD:BP585667.1,
FT                   INSD:EH971902.1,INSD:AV817675.1,INSD:ES208303.1,
FT                   INSD:DR251722.1,INSD:EH981507.1,INSD:EH830897.1,
FT                   INSD:BP600835.1,INSD:EL140481.1,INSD:EH859661.1,
FT                   INSD:EL303502.1,INSD:BP619310.1,INSD:BP608721.1,
FT                   INSD:EL090660.1,INSD:EL301726.1,INSD:EL157599.1,
FT                   INSD:EL024055.1,INSD:EH857179.1,INSD:EH917539.1,
FT                   INSD:ES047848.1,INSD:BP617434.1,INSD:BP610391.1,
FT                   INSD:ES049661.1,INSD:BP791904.1,INSD:BP613839.1,
FT                   INSD:BP642510.1,INSD:BP618660.1,INSD:EL105463.1,
FT                   INSD:T13789.1,INSD:BP621816.1,INSD:BP609540.1,
FT                   INSD:BP636829.1,INSD:BP598533.1,INSD:BP600235.1,
FT                   INSD:BP638647.1,INSD:EL062518.1,INSD:EL170961.1,
FT                   INSD:EL228112.1,INSD:BP631825.1,INSD:EH881399.1,
FT                   INSD:BP601368.1,INSD:EH824473.1,INSD:EH869655.1,
FT                   INSD:EL250719.1,INSD:ES209496.1,INSD:BP649830.1,
FT                   INSD:EL067847.1,INSD:BP603295.1,INSD:EL223999.1,
FT                   INSD:EL185472.1,INSD:BP565317.1,INSD:EL226029.1,
FT                   INSD:EL245252.1,INSD:EL279653.1,INSD:BP604147.1,
FT                   INSD:AV540559.1,INSD:EL172337.1,INSD:EL317904.1,
FT                   INSD:EH874407.1,INSD:EH807399.1,INSD:BP610435.1,
FT                   INSD:BP654232.1,INSD:EH844945.1,INSD:EH861873.1,
FT                   INSD:DR251738.1,INSD:BP623477.1,INSD:EH980712.1,
FT                   INSD:EH975396.1,INSD:AV538089.1,INSD:BP638736.1,
FT                   INSD:EG426143.1,INSD:BP584351.1,INSD:CF773819.1,
FT                   INSD:BP639011.1,INSD:BP631996.1,INSD:EL124004.1,
FT                   INSD:BP611297.1,INSD:EH831664.1,INSD:EL132105.1,
FT                   INSD:EL049466.1,INSD:BP613885.1,INSD:EH917807.1,
FT                   INSD:EH977811.1,INSD:BP611882.1,INSD:EH814184.1,
FT                   INSD:ES090493.1,INSD:EH952215.1,INSD:EL011510.1,
FT                   INSD:BP612648.1,INSD:BP608460.1,INSD:DR251707.1,
FT                   INSD:EL034952.1,INSD:EL261156.1,INSD:EL974354.1,
FT                   INSD:BP594367.1,INSD:BP615800.1,INSD:EL308165.1,
FT                   INSD:BP575779.1,INSD:BP640158.1,INSD:ES002126.1,
FT                   INSD:BP611240.1,INSD:BP608709.1,INSD:BP614571.1,
FT                   INSD:EL233175.1,INSD:EH878252.1,INSD:BP605540.1,
FT                   INSD:EL313927.1,INSD:EL145484.1,INSD:ES014657.1,
FT                   INSD:EH920790.1,INSD:EL083416.1,INSD:ES029323.1,
FT                   INSD:EL990130.1,INSD:EH809488.1,INSD:AV564244.1,
FT                   INSD:EH886354.1,INSD:BP604642.1,INSD:BP602117.1,
FT                   INSD:EH831009.1,INSD:BP604929.1,INSD:EH851913.1,
FT                   INSD:EL193216.1,INSD:EL303290.1,INSD:BP630471.1,
FT                   INSD:EL051892.1,INSD:AV532639.1,INSD:EH951007.1,
FT                   INSD:BP603494.1,INSD:EH964652.1,INSD:BP595662.1,
FT                   INSD:EL029861.1,INSD:BP602024.1,INSD:EH989338.1,
FT                   INSD:EL043847.1,INSD:AA720159.1,INSD:EL237854.1,
FT                   INSD:EL016915.1,INSD:EL230677.1,INSD:EL316820.1,
FT                   INSD:BP647157.1,INSD:BP596565.1,INSD:AV567710.1,
FT                   INSD:CB263037.1,INSD:AV562794.1,INSD:BP608894.1,
FT                   INSD:EL004286.1,INSD:EH838998.1,INSD:BP608359.1,
FT                   INSD:EH896395.1,INSD:BP606551.1,INSD:ES171939.1,
FT                   INSD:AV541043.1,INSD:EL131993.1,INSD:BP608045.1,
FT                   INSD:BP618645.1,INSD:EH874635.1,INSD:EL311814.1,
FT                   INSD:BP783133.1,INSD:BP586384.1,INSD:BP564071.1,
FT                   INSD:ES199879.1,INSD:AV520256.1,INSD:BP593584.1,
FT                   INSD:EL220902.1,INSD:BP645633.1,INSD:EL088675.1,
FT                   INSD:BP598220.1,INSD:ES184713.1,INSD:EL970032.1,
FT                   INSD:AV819562.1,INSD:AV565153.1,INSD:BP571372.1,
FT                   INSD:BP614911.1,INSD:BP609563.1,INSD:EH913956.1,
FT                   INSD:BP608146.1,INSD:BP644447.1,INSD:EH920728.1,
FT                   INSD:EL281044.1,INSD:BP667295.1,INSD:BP610836.1,
FT                   INSD:AV532599.1,INSD:ES189993.1,INSD:BP600945.1,
FT                   INSD:EL219859.1,INSD:BP618024.1,INSD:EH929904.1,
FT                   INSD:BP618957.1,INSD:EL263178.1,INSD:EH877180.1,
FT                   INSD:CF772965.1,INSD:BP610990.1,INSD:EL028797.1,
FT                   INSD:EL138931.1,INSD:ES183296.1,INSD:BP609127.1,
FT                   INSD:EL032605.1,INSD:EH901567.1,INSD:BP622651.1,
FT                   INSD:EH863775.1,INSD:DR251704.1,INSD:AI993641.1,
FT                   INSD:EH865644.1,INSD:BP621341.1,INSD:BP606069.1,
FT                   INSD:EL093473.1,INSD:AV559765.1,INSD:EL235307.1,
FT                   INSD:EH938792.1,INSD:BP619482.1,INSD:EH918684.1,
FT                   INSD:ES211422.1,INSD:EL289196.1,INSD:EL325677.1,
FT                   INSD:BP605013.1,INSD:BP601370.1,INSD:EH873264.1,
FT                   INSD:AV560457.1,INSD:ES107103.1,INSD:ES116489.1,
FT                   INSD:ES125584.1,INSD:N65208.1,INSD:EH835745.1,
FT                   INSD:BP599291.1,INSD:BP616084.1,INSD:EH802275.1,
FT                   INSD:EL197465.1,INSD:BP585134.1,INSD:EL203315.1,
FT                   INSD:EH931010.1,INSD:BP617708.1,INSD:EL049701.1,
FT                   INSD:EH807734.1,INSD:BP598904.1,INSD:BP633638.1,
FT                   INSD:BP609293.1,INSD:EH928920.1,INSD:EH936852.1,
FT                   INSD:BP606120.1,INSD:EL324225.1,INSD:EL970104.1,
FT                   INSD:BP618806.1,INSD:EL297186.1,INSD:EL066812.1,
FT                   INSD:EH853207.1,INSD:EH894078.1,INSD:BP568845.1,
FT                   INSD:BP653919.1,INSD:BP632954.1,INSD:BP604590.1,
FT                   INSD:BP600633.1,INSD:EL161033.1,INSD:BP620287.1,
FT                   INSD:ES107208.1,INSD:AV520025.1,INSD:BP628559.1,
FT                   INSD:BP598805.1,INSD:EL187521.1,INSD:EH816005.1,
FT                   INSD:EH921090.1,INSD:BP613945.1,INSD:BP619833.1,
FT                   INSD:BP579241.1,INSD:AV788373.1,INSD:EL099147.1,
FT                   INSD:N65332.1,INSD:BP619521.1,INSD:EL240488.1,
FT                   INSD:EH918693.1,INSD:DR251745.1,INSD:EL022672.1,
FT                   INSD:BP588074.1,INSD:ES052246.1,INSD:BP617853.1,
FT                   INSD:EL972052.1,INSD:EL011338.1,INSD:EL302533.1,
FT                   INSD:EH893628.1,INSD:Z34252.1,INSD:BP649957.1,
FT                   INSD:EL252327.1,INSD:AV786481.1,INSD:EH826951.1,
FT                   INSD:AV815685.1,INSD:ES091419.1,INSD:BP618045.1,
FT                   INSD:BP623686.1,INSD:EH883694.1,INSD:EL307750.1,
FT                   INSD:EL057289.1,INSD:EH881679.1,INSD:BP622193.1,
FT                   INSD:BP615535.1,INSD:EL206306.1,INSD:BP668761.1,
FT                   INSD:EH981204.1,INSD:BP664324.1,INSD:AV562369.1,
FT                   INSD:EL061044.1,INSD:EH977582.1,INSD:AV534648.1,
FT                   INSD:EH963952.1,INSD:EL338047.1,INSD:EL043387.1,
FT                   INSD:EL058035.1,INSD:BP614292.1,INSD:AV786497.1,
FT                   INSD:EL146481.1,INSD:EH963215.1,INSD:EL218814.1"
FT   mRNA            complement(join(225665..226081,226171..226311,
FT                   226396..226691,226849..227049,227079..227302))
FT                   /gene="PIP1C"
FT                   /gene_synonym="F22L4.16"
FT                   /gene_synonym="F22L4_16"
FT                   /gene_synonym="PIP1;3"
FT                   /gene_synonym="PLASMA MEMBRANE INTRINSIC PROTEIN 1;3"
FT                   /gene_synonym="plasma membrane intrinsic protein 1C"
FT                   /gene_synonym="TMP-B"
FT                   /locus_tag="AT1G01620"
FT                   /product="plasma membrane intrinsic protein 1C"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL022688.1,INSD:AV526574.1,INSD:EH942613.1,
FT                   INSD:DR251720.1,INSD:H36992.1,INSD:BP597207.1,
FT                   INSD:DR251737.1,INSD:EL152952.1,INSD:EH894675.1,
FT                   INSD:BP660511.1,INSD:BP599962.1,INSD:BP615624.1,
FT                   INSD:CF652750.1,INSD:EL146246.1,INSD:BP662923.1,
FT                   INSD:EL037866.1,INSD:EL047245.1,INSD:EL151198.1,
FT                   INSD:BP808083.1,INSD:EL028351.1,INSD:BP607020.1,
FT                   INSD:EL206835.1,INSD:EH875654.1,INSD:EL280264.1,
FT                   INSD:BP642384.1,INSD:EL253795.1,INSD:DR251751.1,
FT                   INSD:BP607250.1,INSD:EL332827.1,INSD:AV803253.1,
FT                   INSD:EL968106.1,INSD:BP617883.1,INSD:BP615999.1,
FT                   INSD:EL971516.1,INSD:BP607216.1,INSD:EL280084.1,
FT                   INSD:EL126844.1,INSD:EL058438.1,INSD:EL221931.1,
FT                   INSD:BP579413.1,INSD:EH989311.1,INSD:EL105431.1,
FT                   INSD:BP621199.1,INSD:BP609593.1,INSD:EH991737.1,
FT                   INSD:BP620143.1,INSD:AV550230.1,INSD:EL028965.1,
FT                   INSD:BP574341.1,INSD:EL968755.1,INSD:EL309129.1,
FT                   INSD:EH847560.1,INSD:BP663595.1,INSD:BP575144.1,
FT                   INSD:DR251758.1,INSD:AV796506.1,INSD:EH902768.1,
FT                   INSD:BP586650.1,INSD:BP809523.1,INSD:BP620206.1,
FT                   INSD:EL267027.1,INSD:EH867799.1,INSD:BP564514.1,
FT                   INSD:BP599383.1,INSD:AV544872.1,INSD:ES133332.1,
FT                   INSD:EL969882.1,INSD:EL112692.1,INSD:DR251708.1,
FT                   INSD:BP581123.1,INSD:EH915497.1,INSD:BP595560.1,
FT                   INSD:EH975830.1,INSD:BP640614.1,INSD:BP632185.1,
FT                   INSD:BP602795.1,INSD:EH956897.1,INSD:DR251739.1,
FT                   INSD:BP809191.1,INSD:AV521949.1,INSD:DR378172.1,
FT                   INSD:H36897.1,INSD:BP849232.1,INSD:EL034613.1,
FT                   INSD:BP832527.1,INSD:AV796455.1,INSD:EL263649.1,
FT                   INSD:BP593405.1,INSD:ES183603.1,INSD:BP658214.1,
FT                   INSD:EL114746.1,INSD:EL269843.1,INSD:EL252849.1,
FT                   INSD:EL117147.1,INSD:BP637473.1,INSD:BP603077.1,
FT                   INSD:EL263596.1,INSD:EL262092.1,INSD:BP584824.1,
FT                   INSD:BP617987.1,INSD:BP661283.1,INSD:EL257230.1,
FT                   INSD:BP806299.1,INSD:ES043162.1,INSD:EL333154.1,
FT                   INSD:BP617974.1,INSD:BP620523.1,INSD:EL310388.1,
FT                   INSD:EL007200.1,INSD:EL135552.1,INSD:DR251744.1,
FT                   INSD:BP606031.1,INSD:EL297042.1,INSD:BP618662.1,
FT                   INSD:EL090817.1,INSD:AV819069.1,INSD:BP601676.1,
FT                   INSD:ES203197.1,INSD:BP671915.1,INSD:EL252499.1,
FT                   INSD:ES215392.1,INSD:EL328270.1,INSD:BP658683.1,
FT                   INSD:BP616609.1,INSD:T20907.1,INSD:BP631941.1,
FT                   INSD:EL045100.1,INSD:AV532776.1,INSD:EL267737.1,
FT                   INSD:EL064799.1,INSD:AV520330.1,INSD:BP594764.1,
FT                   INSD:BP839377.1,INSD:ES205971.1,INSD:ES025560.1,
FT                   INSD:AV826737.1,INSD:ES059667.1,INSD:BP610419.1,
FT                   INSD:AV566751.1,INSD:EH849615.1,INSD:BP600336.1,
FT                   INSD:EL033432.1,INSD:H37412.1,INSD:EH933270.1,
FT                   INSD:EH954149.1,INSD:EH831811.1,INSD:AV556029.1,
FT                   INSD:EL040440.1,INSD:BP804638.1,INSD:EH990388.1,
FT                   INSD:EL186559.1,INSD:AV812365.1,INSD:EH801436.1,
FT                   INSD:BP609775.1,INSD:BP607879.1,INSD:DR251741.1,
FT                   INSD:EL037612.1,INSD:H36675.1,INSD:BP600348.1,
FT                   INSD:BP610673.1,INSD:AV796157.1,INSD:BP585667.1,
FT                   INSD:AV817675.1,INSD:BP806539.1,INSD:T42921.1,
FT                   INSD:EL303502.1,INSD:BU636047.1,INSD:EL301726.1,
FT                   INSD:EL157599.1,INSD:DR251754.1,INSD:EH857179.1,
FT                   INSD:ES049661.1,INSD:BP610391.1,INSD:BP617434.1,
FT                   INSD:BP800273.1,INSD:BP791904.1,INSD:N38396.1,
FT                   INSD:DR251752.1,INSD:DR251721.1,INSD:BP636829.1,
FT                   INSD:BP853331.1,INSD:BP631825.1,INSD:EH881399.1,
FT                   INSD:BP813865.1,INSD:EH824473.1,INSD:EL067847.1,
FT                   INSD:BP649830.1,INSD:AV552880.1,INSD:BP603295.1,
FT                   INSD:EL226029.1,INSD:BP850060.1,INSD:EL279653.1,
FT                   INSD:BP807629.1,INSD:EL317904.1,INSD:EH874407.1,
FT                   INSD:EH807399.1,INSD:EH861873.1,INSD:DR251738.1,
FT                   INSD:EH980712.1,INSD:EG426143.1,INSD:BP584351.1,
FT                   INSD:DR251698.1,INSD:CF773819.1,INSD:EL124004.1,
FT                   INSD:BP631996.1,INSD:N38390.1,INSD:EH831664.1,
FT                   INSD:EL049466.1,INSD:EH917807.1,INSD:BP613885.1,
FT                   INSD:BP823452.1,INSD:EH814184.1,INSD:BP811543.1,
FT                   INSD:BP828781.1,INSD:BP612648.1,INSD:BP608460.1,
FT                   INSD:DR251707.1,INSD:EL974354.1,INSD:EL261156.1,
FT                   INSD:BP810088.1,INSD:BP615800.1,INSD:BP575779.1,
FT                   INSD:CB258635.1,INSD:BP640158.1,INSD:BP611240.1,
FT                   INSD:EL233175.1,INSD:BP614571.1,INSD:BP843142.1,
FT                   INSD:EH852659.1,INSD:ES014657.1,INSD:H36855.1,
FT                   INSD:ES029323.1,INSD:DR251756.1,INSD:BP604642.1,
FT                   INSD:AV564244.1,INSD:BP602117.1,INSD:EH831009.1,
FT                   INSD:BP604929.1,INSD:EL193216.1,INSD:EL303290.1,
FT                   INSD:BP630471.1,INSD:T75973.1,INSD:BP603494.1,
FT                   INSD:EH989338.1,INSD:AA720159.1,INSD:EL237854.1,
FT                   INSD:EL016915.1,INSD:DR251759.1,INSD:BP859737.1,
FT                   INSD:DR251729.1,INSD:EL316820.1,INSD:EL083178.1,
FT                   INSD:CF773209.1,INSD:EL004286.1,INSD:BP608894.1,
FT                   INSD:DR251712.1,INSD:BP608359.1,INSD:BP606551.1,
FT                   INSD:BP861562.1,INSD:EL131993.1,INSD:BP608045.1,
FT                   INSD:BP586384.1,INSD:BP805311.1,INSD:ES199879.1,
FT                   INSD:AV520256.1,INSD:EL220902.1,INSD:BP836655.1,
FT                   INSD:DR251705.1,INSD:AV819562.1,INSD:CB258633.1,
FT                   INSD:BP609563.1,INSD:BP608146.1,INSD:BP644447.1,
FT                   INSD:EH920728.1,INSD:ES189993.1,INSD:EL219859.1,
FT                   INSD:BP618024.1,INSD:T44931.1,INSD:BP610990.1,
FT                   INSD:EL138931.1,INSD:BP609127.1,INSD:EH901567.1,
FT                   INSD:EL032605.1,INSD:BP622651.1,INSD:DR251704.1,
FT                   INSD:BP621341.1,INSD:BP606069.1,INSD:EL093473.1,
FT                   INSD:BP837140.1,INSD:EL235307.1,INSD:BP818222.1,
FT                   INSD:ES211422.1,INSD:EH918684.1,INSD:BP619482.1,
FT                   INSD:BP831241.1,INSD:BP601370.1,INSD:EH873264.1,
FT                   INSD:AV560457.1,INSD:DR251757.1,INSD:EH835745.1,
FT                   INSD:T44267.1,INSD:BP616084.1,INSD:DR251761.1,
FT                   INSD:BP818631.1,INSD:EH807734.1,INSD:EL049701.1,
FT                   INSD:BP598904.1,INSD:DR251717.1,INSD:EH928920.1,
FT                   INSD:BP609293.1,INSD:EL090337.1,INSD:BP809526.1,
FT                   INSD:BP827751.1,INSD:EL324225.1,INSD:BP606120.1,
FT                   INSD:BP824698.1,INSD:EL970104.1,INSD:EH894078.1,
FT                   INSD:BP632954.1,INSD:N97036.1,INSD:BP604590.1,
FT                   INSD:BP600633.1,INSD:EL161033.1,INSD:BP620287.1,
FT                   INSD:ES107208.1,INSD:BP598805.1,INSD:BP628559.1,
FT                   INSD:AV520025.1,INSD:BP579241.1,INSD:BP619833.1,
FT                   INSD:BP817151.1,INSD:AV788373.1,INSD:EL145910.1,
FT                   INSD:BP619521.1,INSD:BP806943.1,INSD:EH918693.1,
FT                   INSD:DR251760.1,INSD:DR251745.1,INSD:EL022672.1,
FT                   INSD:BP847852.1,INSD:DR251762.1,INSD:EH893628.1,
FT                   INSD:Z34252.1,INSD:EL252327.1,INSD:BP649957.1,
FT                   INSD:EH826951.1,INSD:BP808136.1,INSD:ES091419.1,
FT                   INSD:BP811489.2,INSD:BP618045.1,INSD:EH881679.1,
FT                   INSD:BP855127.1,INSD:BP622193.1,INSD:EL206306.1,
FT                   INSD:EH981204.1,INSD:BP668761.1,INSD:AV562369.1,
FT                   INSD:AV551419.1,INSD:BP811391.2,INSD:EL338047.1,
FT                   INSD:EH963952.1,INSD:AV534648.1,INSD:AV786497.1,
FT                   INSD:BP614292.1,INSD:EL146481.1,INSD:EL218814.1,
FT                   INSD:AV542815.1,INSD:ES031969.1,INSD:EL148908.1,
FT                   INSD:ES207935.1,INSD:BP859087.1,INSD:DR251733.1,
FT                   INSD:EL156430.1,INSD:EL141779.1,INSD:DR251709.1,
FT                   INSD:EH967887.1,INSD:BP808110.1,INSD:DR251718.1,
FT                   INSD:EH818061.1,INSD:AV558713.1,INSD:T04547.1,
FT                   INSD:N96473.1,INSD:EH906376.1,INSD:EL102531.1,
FT                   INSD:EH919112.1,INSD:EL238139.1,INSD:BP808318.1,
FT                   INSD:DR251706.1,INSD:DR251746.1,INSD:BE525241.1,
FT                   INSD:EL135508.1,INSD:BP598613.1,INSD:BP844179.1,
FT                   INSD:EL123077.1,INSD:BP860209.1,INSD:BE523085.1,
FT                   INSD:BP865947.1,INSD:BP572988.1,INSD:EL101396.1,
FT                   INSD:EL067661.1,INSD:BP628643.1,INSD:EL317711.1,
FT                   INSD:EL091814.1,INSD:BP601615.1,INSD:BP806858.1,
FT                   INSD:ES168314.1,INSD:EL191322.1,INSD:EH922982.1,
FT                   INSD:BP609852.1,INSD:AV541515.1,INSD:BP600948.1,
FT                   INSD:BP827590.1,INSD:EH935904.1,INSD:BP606165.1,
FT                   INSD:CF651970.1,INSD:EG490315.1,INSD:BP601141.1,
FT                   INSD:EL245640.1,INSD:BP608161.1,INSD:BP597940.1,
FT                   INSD:DR251736.1,INSD:EG468772.1,INSD:N96975.1,
FT                   INSD:BP585800.1,INSD:AV521978.1,INSD:AV556313.1,
FT                   INSD:BP609622.1,INSD:BP640275.1,INSD:AV526093.1,
FT                   INSD:AV790800.1,INSD:BP672031.1,INSD:ES020055.1,
FT                   INSD:BP803096.1,INSD:EH861080.1,INSD:DR251753.1,
FT                   INSD:AV788097.1,INSD:AV560181.1,INSD:EL302787.1,
FT                   INSD:ES200421.1,INSD:AV557985.1,INSD:AA720103.1,
FT                   INSD:BP600467.1,INSD:BP609223.1,INSD:BP617698.1,
FT                   INSD:EH986621.1,INSD:EL061034.1,INSD:BP855720.1,
FT                   INSD:BP806232.1,INSD:BP839319.1,INSD:EH941478.1,
FT                   INSD:BP610508.1,INSD:BP618899.1,INSD:AV541769.1,
FT                   INSD:EH933941.1,INSD:Z18388.1,INSD:BP809273.1,
FT                   INSD:EL064787.1,INSD:BP608067.1,INSD:EL126681.1,
FT                   INSD:EL010986.1,INSD:DR251703.1,INSD:DR251764.1,
FT                   INSD:AV538082.1,INSD:EH873527.1,INSD:EL203754.1,
FT                   INSD:EH836123.1,INSD:EL166642.1,INSD:BP601457.1,
FT                   INSD:AV556308.1,INSD:DR251699.1,INSD:EH976899.1,
FT                   INSD:BP829435.1,INSD:BP808127.1,INSD:DR230939.1,
FT                   INSD:DR376656.1,INSD:BP605405.1,INSD:BP821512.2,
FT                   INSD:BP612396.1,INSD:EH903039.1,INSD:ES159215.1,
FT                   INSD:BP632017.1,INSD:DR251748.1,INSD:BP585340.1,
FT                   INSD:EL152975.1,INSD:EL209718.1,INSD:BP573876.1,
FT                   INSD:BP806215.1,INSD:DR251714.1,INSD:T42028.1,
FT                   INSD:BP616376.1,INSD:EL328303.1,INSD:EL280920.1,
FT                   INSD:ES021756.1,INSD:DR251724.1,INSD:DR251750.1,
FT                   INSD:BP615052.1,INSD:BP601471.1,INSD:BP610038.1,
FT                   INSD:BP620768.1,INSD:EL096078.1,INSD:EL281193.1,
FT                   INSD:BP660201.1,INSD:EH850730.1,INSD:EH969529.1,
FT                   INSD:BP603342.1,INSD:BP830436.1,INSD:EL299920.1,
FT                   INSD:BP599906.1,INSD:BP849223.1,INSD:EH936321.1,
FT                   INSD:EL314079.1,INSD:DR251730.1,INSD:BP807676.1,
FT                   INSD:BP615499.1,INSD:EH925848.1,INSD:DR251710.1,
FT                   INSD:EL108199.1,INSD:BP805248.1,INSD:DR251747.1,
FT                   INSD:EL022005.1,INSD:EL226325.1,INSD:BP600686.1,
FT                   INSD:BP857739.1,INSD:DR251715.1,INSD:EL007806.1,
FT                   INSD:EH986449.1,INSD:BP617090.1,INSD:BP601369.1,
FT                   INSD:EL217592.1,INSD:ES189413.1,INSD:AV526413.1,
FT                   INSD:BP805801.1,INSD:AV522087.1,INSD:ES166867.1,
FT                   INSD:DR251726.1,INSD:R30065.1,INSD:BP602402.1,
FT                   INSD:DR251742.1,INSD:BP809039.1,INSD:EL018974.1,
FT                   INSD:EL254153.1,INSD:BP617832.1,INSD:BP616661.1,
FT                   INSD:AV539678.1,INSD:AV544554.1,INSD:BP818306.1,
FT                   INSD:DR251727.1,INSD:EH971902.1,INSD:ES208303.1,
FT                   INSD:BP832026.1,INSD:EH981507.1,INSD:DR251722.1,
FT                   INSD:EH830897.1,INSD:BP600835.1,INSD:EL140481.1,
FT                   INSD:EH859661.1,INSD:DR251755.1,INSD:BP619310.1,
FT                   INSD:DR251701.1,INSD:BP608721.1,INSD:EL090660.1,
FT                   INSD:EL024055.1,INSD:ES047848.1,INSD:EH917539.1,
FT                   INSD:CB265153.1,INSD:DR251719.1,INSD:BP613839.1,
FT                   INSD:BP642510.1,INSD:BP618660.1,INSD:EL105463.1,
FT                   INSD:BP621816.1,INSD:BP609540.1,INSD:BP598533.1,
FT                   INSD:BP600235.1,INSD:BP638647.1,INSD:EL062518.1,
FT                   INSD:EL170961.1,INSD:EL228112.1,INSD:BP601368.1,
FT                   INSD:EL250719.1,INSD:EH869655.1,INSD:ES209496.1,
FT                   INSD:EL155285.1,INSD:BP805823.1,INSD:EL223999.1,
FT                   INSD:EL185472.1,INSD:BP565317.1,INSD:EL245252.1,
FT                   INSD:EH894443.1,INSD:EH961786.1,INSD:BP604147.1,
FT                   INSD:BP831992.1,INSD:EL236607.1,INSD:EL172337.1,
FT                   INSD:AV540559.1,INSD:DR251711.1,INSD:BP610435.1,
FT                   INSD:BP654232.1,INSD:EH844945.1,INSD:BP834755.1,
FT                   INSD:BP623477.1,INSD:EH975396.1,INSD:T13969.1,
FT                   INSD:AV538089.1,INSD:BP638736.1,INSD:EG468771.1,
FT                   INSD:BP639011.1,INSD:R29973.1,INSD:BP611297.1,
FT                   INSD:EL132105.1,INSD:EH977811.1,INSD:BP611882.1,
FT                   INSD:ES090493.1,INSD:EH952215.1,INSD:EL011510.1,
FT                   INSD:EL034952.1,INSD:BP594367.1,INSD:EL308165.1,
FT                   INSD:BP807617.1,INSD:ES002126.1,INSD:EL968015.1,
FT                   INSD:BP608709.1,INSD:EH878252.1,INSD:BP605540.1,
FT                   INSD:EL313927.1,INSD:EL116342.1,INSD:EL145484.1,
FT                   INSD:Z17730.1,INSD:EH920790.1,INSD:EL083416.1,
FT                   INSD:DR251728.1,INSD:EL990130.1,INSD:EH809488.1,
FT                   INSD:EH886354.1,INSD:AV561594.1,INSD:EH851913.1,
FT                   INSD:BP862989.1,INSD:CF773169.1,INSD:DR251732.1,
FT                   INSD:EL051892.1,INSD:AV532639.1,INSD:EH951007.1,
FT                   INSD:EG514016.1,INSD:EH964652.1,INSD:BP595662.1,
FT                   INSD:EL029861.1,INSD:BP602024.1,INSD:EL043847.1,
FT                   INSD:BP809294.1,INSD:EL230677.1,INSD:N65343.1,
FT                   INSD:BP596565.1,INSD:BP647157.1,INSD:AV567710.1,
FT                   INSD:CB263037.1,INSD:EH887996.1,INSD:AV562794.1,
FT                   INSD:EH838998.1,INSD:EH896395.1,INSD:ES171939.1,
FT                   INSD:AV541043.1,INSD:T20851.1,INSD:BP618645.1,
FT                   INSD:EL311814.1,INSD:EH874635.1,INSD:BP783133.1,
FT                   INSD:BP564071.1,INSD:BP593584.1,INSD:BP803297.1,
FT                   INSD:EL088675.1,INSD:BP598220.1,INSD:BP645633.1,
FT                   INSD:ES184713.1,INSD:EL970032.1,INSD:BP571372.1,
FT                   INSD:AV565153.1,INSD:BP807951.1,INSD:BP614911.1,
FT                   INSD:BP816476.1,INSD:EH913956.1,INSD:EL281044.1,
FT                   INSD:BP667295.1,INSD:BP837592.1,INSD:BP610836.1,
FT                   INSD:AV532599.1,INSD:BP600945.1,INSD:EH929904.1,
FT                   INSD:EL263178.1,INSD:BP618957.1,INSD:CF772965.1,
FT                   INSD:EH877180.1,INSD:BP801476.1,INSD:EL028797.1,
FT                   INSD:ES183296.1,INSD:BP819051.1,INSD:EH863775.1,
FT                   INSD:AI993641.1,INSD:EH865644.1,INSD:DR251740.1,
FT                   INSD:AV559765.1,INSD:EH938792.1,INSD:EL289196.1,
FT                   INSD:EL325677.1,INSD:H37074.1,INSD:BP809525.1,
FT                   INSD:DR251763.1,INSD:BP605013.1,INSD:ES107103.1,
FT                   INSD:ES125584.1,INSD:ES116489.1,INSD:EL054124.1,
FT                   INSD:N65208.1,INSD:BP599291.1,INSD:BP809581.1,
FT                   INSD:BP830174.1,INSD:EH802275.1,INSD:EL197465.1,
FT                   INSD:BP585134.1,INSD:EL203315.1,INSD:BP804580.1,
FT                   INSD:EH931010.1,INSD:BP617708.1,INSD:BP633638.1,
FT                   INSD:DR251713.1,INSD:EH936852.1,INSD:T44607.1,
FT                   INSD:BP830749.1,INSD:BP618806.1,INSD:EL297186.1,
FT                   INSD:EL066812.1,INSD:BP809477.1,INSD:EH853207.1,
FT                   INSD:BP568845.1,INSD:BP653919.1,INSD:EH878020.1,
FT                   INSD:DR251734.1,INSD:EH977765.1,INSD:DR251743.1,
FT                   INSD:EL187521.1,INSD:EH921090.1,INSD:EH816005.1,
FT                   INSD:DR251700.1,INSD:BP613945.1,INSD:N65332.1,
FT                   INSD:EL099147.1,INSD:EL240488.1,INSD:DR251735.1,
FT                   INSD:T22686.1,INSD:BP588074.1,INSD:ES052246.1,
FT                   INSD:EL972052.1,INSD:BP617853.1,INSD:R29956.1,
FT                   INSD:EL302533.1,INSD:EL011338.1,INSD:AV786481.1,
FT                   INSD:DR251716.1,INSD:AV815685.1,INSD:DR251723.1,
FT                   INSD:EL307750.1,INSD:EH883694.1,INSD:BP623686.1,
FT                   INSD:EL057289.1,INSD:BP615535.1,INSD:BP664324.1,
FT                   INSD:DR251749.1,INSD:EL061044.1,INSD:EH977582.1,
FT                   INSD:EL043387.1,INSD:EL058035.1,INSD:DR251731.1,
FT                   INSD:EH963215.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062610.1,INSD:BX816517.1,INSD:X69294.1,
FT                   INSD:X75882.1,INSD:BT002101.1,INSD:AF348574.1"
FT   CDS_pept        complement(join(225986..226081,226171..226311,
FT                   226396..226691,226849..227176))
FT                   /codon_start=1
FT                   /gene="PIP1C"
FT                   /gene_synonym="F22L4.16"
FT                   /gene_synonym="F22L4_16"
FT                   /gene_synonym="PIP1;3"
FT                   /gene_synonym="PLASMA MEMBRANE INTRINSIC PROTEIN 1;3"
FT                   /gene_synonym="plasma membrane intrinsic protein 1C"
FT                   /gene_synonym="TMP-B"
FT                   /locus_tag="AT1G01620"
FT                   /product="plasma membrane intrinsic protein 1C"
FT                   /note="plasma membrane intrinsic protein 1C (PIP1C);
FT                   FUNCTIONS IN: water channel activity; INVOLVED IN: response
FT                   to water deprivation, response to salt stress, transport,
FT                   water transport; LOCATED IN: plasma membrane, chloroplast,
FT                   membrane; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Major
FT                   intrinsic protein, conserved site (InterPro:IPR022357),
FT                   Aquaporin (InterPro:IPR012269), Major intrinsic protein
FT                   (InterPro:IPR000425); BEST Arabidopsis thaliana protein
FT                   match is: plasma membrane intrinsic protein 1;4
FT                   (TAIR:AT4G00430.1); Has 10781 Blast hits to 10762 proteins
FT                   in 2222 species: Archae - 88; Bacteria - 5165; Metazoa -
FT                   1470; Fungi - 448; Plants - 2514; Viruses - 2; Other
FT                   Eukaryotes - 1094 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q08733"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08733"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL022688.1,INSD:AV526574.1,INSD:EH942613.1,
FT                   INSD:DR251720.1,INSD:H36992.1,INSD:BP597207.1,
FT                   INSD:DR251737.1,INSD:EL152952.1,INSD:EH894675.1,
FT                   INSD:BP660511.1,INSD:BP599962.1,INSD:BP615624.1,
FT                   INSD:CF652750.1,INSD:EL146246.1,INSD:BP662923.1,
FT                   INSD:EL037866.1,INSD:EL047245.1,INSD:EL151198.1,
FT                   INSD:BP808083.1,INSD:EL028351.1,INSD:BP607020.1,
FT                   INSD:EL206835.1,INSD:EH875654.1,INSD:EL280264.1,
FT                   INSD:BP642384.1,INSD:EL253795.1,INSD:DR251751.1,
FT                   INSD:BP607250.1,INSD:EL332827.1,INSD:AV803253.1,
FT                   INSD:EL968106.1,INSD:BP617883.1,INSD:BP615999.1,
FT                   INSD:EL971516.1,INSD:BP607216.1,INSD:EL280084.1,
FT                   INSD:EL126844.1,INSD:EL058438.1,INSD:EL221931.1,
FT                   INSD:BP579413.1,INSD:EH989311.1,INSD:EL105431.1,
FT                   INSD:BP621199.1,INSD:BP609593.1,INSD:EH991737.1,
FT                   INSD:BP620143.1,INSD:AV550230.1,INSD:EL028965.1,
FT                   INSD:BP574341.1,INSD:EL968755.1,INSD:EL309129.1,
FT                   INSD:EH847560.1,INSD:BP663595.1,INSD:BP575144.1,
FT                   INSD:DR251758.1,INSD:AV796506.1,INSD:EH902768.1,
FT                   INSD:BP586650.1,INSD:BP809523.1,INSD:BP620206.1,
FT                   INSD:EL267027.1,INSD:EH867799.1,INSD:BP564514.1,
FT                   INSD:BP599383.1,INSD:AV544872.1,INSD:ES133332.1,
FT                   INSD:EL969882.1,INSD:EL112692.1,INSD:DR251708.1,
FT                   INSD:BP581123.1,INSD:EH915497.1,INSD:BP595560.1,
FT                   INSD:EH975830.1,INSD:BP640614.1,INSD:BP632185.1,
FT                   INSD:BP602795.1,INSD:EH956897.1,INSD:DR251739.1,
FT                   INSD:BP809191.1,INSD:AV521949.1,INSD:DR378172.1,
FT                   INSD:H36897.1,INSD:BP849232.1,INSD:EL034613.1,
FT                   INSD:BP832527.1,INSD:AV796455.1,INSD:EL263649.1,
FT                   INSD:BP593405.1,INSD:ES183603.1,INSD:BP658214.1,
FT                   INSD:EL114746.1,INSD:EL269843.1,INSD:EL252849.1,
FT                   INSD:EL117147.1,INSD:BP637473.1,INSD:BP603077.1,
FT                   INSD:EL263596.1,INSD:EL262092.1,INSD:BP584824.1,
FT                   INSD:BP617987.1,INSD:BP661283.1,INSD:EL257230.1,
FT                   INSD:BP806299.1,INSD:ES043162.1,INSD:EL333154.1,
FT                   INSD:BP617974.1,INSD:BP620523.1,INSD:EL310388.1,
FT                   INSD:EL007200.1,INSD:EL135552.1,INSD:DR251744.1,
FT                   INSD:BP606031.1,INSD:EL297042.1,INSD:BP618662.1,
FT                   INSD:EL090817.1,INSD:AV819069.1,INSD:BP601676.1,
FT                   INSD:ES203197.1,INSD:BP671915.1,INSD:EL252499.1,
FT                   INSD:ES215392.1,INSD:EL328270.1,INSD:BP658683.1,
FT                   INSD:BP616609.1,INSD:T20907.1,INSD:BP631941.1,
FT                   INSD:EL045100.1,INSD:AV532776.1,INSD:EL267737.1,
FT                   INSD:EL064799.1,INSD:AV520330.1,INSD:BP594764.1,
FT                   INSD:BP839377.1,INSD:ES205971.1,INSD:ES025560.1,
FT                   INSD:AV826737.1,INSD:ES059667.1,INSD:BP610419.1,
FT                   INSD:AV566751.1,INSD:EH849615.1,INSD:BP600336.1,
FT                   INSD:EL033432.1,INSD:H37412.1,INSD:EH933270.1,
FT                   INSD:EH954149.1,INSD:EH831811.1,INSD:AV556029.1,
FT                   INSD:EL040440.1,INSD:BP804638.1,INSD:EH990388.1,
FT                   INSD:EL186559.1,INSD:AV812365.1,INSD:EH801436.1,
FT                   INSD:BP609775.1,INSD:BP607879.1,INSD:DR251741.1,
FT                   INSD:EL037612.1,INSD:H36675.1,INSD:BP600348.1,
FT                   INSD:BP610673.1,INSD:AV796157.1,INSD:BP585667.1,
FT                   INSD:AV817675.1,INSD:BP806539.1,INSD:T42921.1,
FT                   INSD:EL303502.1,INSD:BU636047.1,INSD:EL301726.1,
FT                   INSD:EL157599.1,INSD:DR251754.1,INSD:EH857179.1,
FT                   INSD:ES049661.1,INSD:BP610391.1,INSD:BP617434.1,
FT                   INSD:BP800273.1,INSD:BP791904.1,INSD:N38396.1,
FT                   INSD:DR251752.1,INSD:DR251721.1,INSD:BP636829.1,
FT                   INSD:BP853331.1,INSD:BP631825.1,INSD:EH881399.1,
FT                   INSD:BP813865.1,INSD:EH824473.1,INSD:EL067847.1,
FT                   INSD:BP649830.1,INSD:AV552880.1,INSD:BP603295.1,
FT                   INSD:EL226029.1,INSD:BP850060.1,INSD:EL279653.1,
FT                   INSD:BP807629.1,INSD:EL317904.1,INSD:EH874407.1,
FT                   INSD:EH807399.1,INSD:EH861873.1,INSD:DR251738.1,
FT                   INSD:EH980712.1,INSD:EG426143.1,INSD:BP584351.1,
FT                   INSD:DR251698.1,INSD:CF773819.1,INSD:EL124004.1,
FT                   INSD:BP631996.1,INSD:N38390.1,INSD:EH831664.1,
FT                   INSD:EL049466.1,INSD:EH917807.1,INSD:BP613885.1,
FT                   INSD:BP823452.1,INSD:EH814184.1,INSD:BP811543.1,
FT                   INSD:BP828781.1,INSD:BP612648.1,INSD:BP608460.1,
FT                   INSD:DR251707.1,INSD:EL974354.1,INSD:EL261156.1,
FT                   INSD:BP810088.1,INSD:BP615800.1,INSD:BP575779.1,
FT                   INSD:CB258635.1,INSD:BP640158.1,INSD:BP611240.1,
FT                   INSD:EL233175.1,INSD:BP614571.1,INSD:BP843142.1,
FT                   INSD:EH852659.1,INSD:ES014657.1,INSD:H36855.1,
FT                   INSD:ES029323.1,INSD:DR251756.1,INSD:BP604642.1,
FT                   INSD:AV564244.1,INSD:BP602117.1,INSD:EH831009.1,
FT                   INSD:BP604929.1,INSD:EL193216.1,INSD:EL303290.1,
FT                   INSD:BP630471.1,INSD:T75973.1,INSD:BP603494.1,
FT                   INSD:EH989338.1,INSD:AA720159.1,INSD:EL237854.1,
FT                   INSD:EL016915.1,INSD:DR251759.1,INSD:BP859737.1,
FT                   INSD:DR251729.1,INSD:EL316820.1,INSD:EL083178.1,
FT                   INSD:CF773209.1,INSD:EL004286.1,INSD:BP608894.1,
FT                   INSD:DR251712.1,INSD:BP608359.1,INSD:BP606551.1,
FT                   INSD:BP861562.1,INSD:EL131993.1,INSD:BP608045.1,
FT                   INSD:BP586384.1,INSD:BP805311.1,INSD:ES199879.1,
FT                   INSD:AV520256.1,INSD:EL220902.1,INSD:BP836655.1,
FT                   INSD:DR251705.1,INSD:AV819562.1,INSD:CB258633.1,
FT                   INSD:BP609563.1,INSD:BP608146.1,INSD:BP644447.1,
FT                   INSD:EH920728.1,INSD:ES189993.1,INSD:EL219859.1,
FT                   INSD:BP618024.1,INSD:T44931.1,INSD:BP610990.1,
FT                   INSD:EL138931.1,INSD:BP609127.1,INSD:EH901567.1,
FT                   INSD:EL032605.1,INSD:BP622651.1,INSD:DR251704.1,
FT                   INSD:BP621341.1,INSD:BP606069.1,INSD:EL093473.1,
FT                   INSD:BP837140.1,INSD:EL235307.1,INSD:BP818222.1,
FT                   INSD:ES211422.1,INSD:EH918684.1,INSD:BP619482.1,
FT                   INSD:BP831241.1,INSD:BP601370.1,INSD:EH873264.1,
FT                   INSD:AV560457.1,INSD:DR251757.1,INSD:EH835745.1,
FT                   INSD:T44267.1,INSD:BP616084.1,INSD:DR251761.1,
FT                   INSD:BP818631.1,INSD:EH807734.1,INSD:EL049701.1,
FT                   INSD:BP598904.1,INSD:DR251717.1,INSD:EH928920.1,
FT                   INSD:BP609293.1,INSD:EL090337.1,INSD:BP809526.1,
FT                   INSD:BP827751.1,INSD:EL324225.1,INSD:BP606120.1,
FT                   INSD:BP824698.1,INSD:EL970104.1,INSD:EH894078.1,
FT                   INSD:BP632954.1,INSD:N97036.1,INSD:BP604590.1,
FT                   INSD:BP600633.1,INSD:EL161033.1,INSD:BP620287.1,
FT                   INSD:ES107208.1,INSD:BP598805.1,INSD:BP628559.1,
FT                   INSD:AV520025.1,INSD:BP579241.1,INSD:BP619833.1,
FT                   INSD:BP817151.1,INSD:AV788373.1,INSD:EL145910.1,
FT                   INSD:BP619521.1,INSD:BP806943.1,INSD:EH918693.1,
FT                   INSD:DR251760.1,INSD:DR251745.1,INSD:EL022672.1,
FT                   INSD:BP847852.1,INSD:DR251762.1,INSD:EH893628.1,
FT                   INSD:Z34252.1,INSD:EL252327.1,INSD:BP649957.1,
FT                   INSD:EH826951.1,INSD:BP808136.1,INSD:ES091419.1,
FT                   INSD:BP811489.2,INSD:BP618045.1,INSD:EH881679.1,
FT                   INSD:BP855127.1,INSD:BP622193.1,INSD:EL206306.1,
FT                   INSD:EH981204.1,INSD:BP668761.1,INSD:AV562369.1,
FT                   INSD:AV551419.1,INSD:BP811391.2,INSD:EL338047.1,
FT                   INSD:EH963952.1,INSD:AV534648.1,INSD:AV786497.1,
FT                   INSD:BP614292.1,INSD:EL146481.1,INSD:EL218814.1,
FT                   INSD:AV542815.1,INSD:ES031969.1,INSD:EL148908.1,
FT                   INSD:ES207935.1,INSD:BP859087.1,INSD:DR251733.1,
FT                   INSD:EL156430.1,INSD:EL141779.1,INSD:DR251709.1,
FT                   INSD:EH967887.1,INSD:BP808110.1,INSD:DR251718.1,
FT                   INSD:EH818061.1,INSD:AV558713.1,INSD:T04547.1,
FT                   INSD:N96473.1,INSD:EH906376.1,INSD:EL102531.1,
FT                   INSD:EH919112.1,INSD:EL238139.1,INSD:BP808318.1,
FT                   INSD:DR251706.1,INSD:DR251746.1,INSD:BE525241.1,
FT                   INSD:EL135508.1,INSD:BP598613.1,INSD:BP844179.1,
FT                   INSD:EL123077.1,INSD:BP860209.1,INSD:BE523085.1,
FT                   INSD:BP865947.1,INSD:BP572988.1,INSD:EL101396.1,
FT                   INSD:EL067661.1,INSD:BP628643.1,INSD:EL317711.1,
FT                   INSD:EL091814.1,INSD:BP601615.1,INSD:BP806858.1,
FT                   INSD:ES168314.1,INSD:EL191322.1,INSD:EH922982.1,
FT                   INSD:BP609852.1,INSD:AV541515.1,INSD:BP600948.1,
FT                   INSD:BP827590.1,INSD:EH935904.1,INSD:BP606165.1,
FT                   INSD:CF651970.1,INSD:EG490315.1,INSD:BP601141.1,
FT                   INSD:EL245640.1,INSD:BP608161.1,INSD:BP597940.1,
FT                   INSD:DR251736.1,INSD:EG468772.1,INSD:N96975.1,
FT                   INSD:BP585800.1,INSD:AV521978.1,INSD:AV556313.1,
FT                   INSD:BP609622.1,INSD:BP640275.1,INSD:AV526093.1,
FT                   INSD:AV790800.1,INSD:BP672031.1,INSD:ES020055.1,
FT                   INSD:BP803096.1,INSD:EH861080.1,INSD:DR251753.1,
FT                   INSD:AV788097.1,INSD:AV560181.1,INSD:EL302787.1,
FT                   INSD:ES200421.1,INSD:AV557985.1,INSD:AA720103.1,
FT                   INSD:BP600467.1,INSD:BP609223.1,INSD:BP617698.1,
FT                   INSD:EH986621.1,INSD:EL061034.1,INSD:BP855720.1,
FT                   INSD:BP806232.1,INSD:BP839319.1,INSD:EH941478.1,
FT                   INSD:BP610508.1,INSD:BP618899.1,INSD:AV541769.1,
FT                   INSD:EH933941.1,INSD:Z18388.1,INSD:BP809273.1,
FT                   INSD:EL064787.1,INSD:BP608067.1,INSD:EL126681.1,
FT                   INSD:EL010986.1,INSD:DR251703.1,INSD:DR251764.1,
FT                   INSD:AV538082.1,INSD:EH873527.1,INSD:EL203754.1,
FT                   INSD:EH836123.1,INSD:EL166642.1,INSD:BP601457.1,
FT                   INSD:AV556308.1,INSD:DR251699.1,INSD:EH976899.1,
FT                   INSD:BP829435.1,INSD:BP808127.1,INSD:DR230939.1,
FT                   INSD:DR376656.1,INSD:BP605405.1,INSD:BP821512.2,
FT                   INSD:BP612396.1,INSD:EH903039.1,INSD:ES159215.1,
FT                   INSD:BP632017.1,INSD:DR251748.1,INSD:BP585340.1,
FT                   INSD:EL152975.1,INSD:EL209718.1,INSD:BP573876.1,
FT                   INSD:BP806215.1,INSD:DR251714.1,INSD:T42028.1,
FT                   INSD:BP616376.1,INSD:EL328303.1,INSD:EL280920.1,
FT                   INSD:ES021756.1,INSD:DR251724.1,INSD:DR251750.1,
FT                   INSD:BP615052.1,INSD:BP601471.1,INSD:BP610038.1,
FT                   INSD:BP620768.1,INSD:EL096078.1,INSD:EL281193.1,
FT                   INSD:BP660201.1,INSD:EH850730.1,INSD:EH969529.1,
FT                   INSD:BP603342.1,INSD:BP830436.1,INSD:EL299920.1,
FT                   INSD:BP599906.1,INSD:BP849223.1,INSD:EH936321.1,
FT                   INSD:EL314079.1,INSD:DR251730.1,INSD:BP807676.1,
FT                   INSD:BP615499.1,INSD:EH925848.1,INSD:DR251710.1,
FT                   INSD:EL108199.1,INSD:BP805248.1,INSD:DR251747.1,
FT                   INSD:EL022005.1,INSD:EL226325.1,INSD:BP600686.1,
FT                   INSD:BP857739.1,INSD:DR251715.1,INSD:EL007806.1,
FT                   INSD:EH986449.1,INSD:BP617090.1,INSD:BP601369.1,
FT                   INSD:EL217592.1,INSD:ES189413.1,INSD:AV526413.1,
FT                   INSD:BP805801.1,INSD:AV522087.1,INSD:ES166867.1,
FT                   INSD:DR251726.1,INSD:R30065.1,INSD:BP602402.1,
FT                   INSD:DR251742.1,INSD:BP809039.1,INSD:EL018974.1,
FT                   INSD:EL254153.1,INSD:BP617832.1,INSD:BP616661.1,
FT                   INSD:AV539678.1,INSD:AV544554.1,INSD:BP818306.1,
FT                   INSD:DR251727.1,INSD:EH971902.1,INSD:ES208303.1,
FT                   INSD:BP832026.1,INSD:EH981507.1,INSD:DR251722.1,
FT                   INSD:EH830897.1,INSD:BP600835.1,INSD:EL140481.1,
FT                   INSD:EH859661.1,INSD:DR251755.1,INSD:BP619310.1,
FT                   INSD:DR251701.1,INSD:BP608721.1,INSD:EL090660.1,
FT                   INSD:EL024055.1,INSD:ES047848.1,INSD:EH917539.1,
FT                   INSD:CB265153.1,INSD:DR251719.1,INSD:BP613839.1,
FT                   INSD:BP642510.1,INSD:BP618660.1,INSD:EL105463.1,
FT                   INSD:BP621816.1,INSD:BP609540.1,INSD:BP598533.1,
FT                   INSD:BP600235.1,INSD:BP638647.1,INSD:EL062518.1,
FT                   INSD:EL170961.1,INSD:EL228112.1,INSD:BP601368.1,
FT                   INSD:EL250719.1,INSD:EH869655.1,INSD:ES209496.1,
FT                   INSD:EL155285.1,INSD:BP805823.1,INSD:EL223999.1,
FT                   INSD:EL185472.1,INSD:BP565317.1,INSD:EL245252.1,
FT                   INSD:EH894443.1,INSD:EH961786.1,INSD:BP604147.1,
FT                   INSD:BP831992.1,INSD:EL236607.1,INSD:EL172337.1,
FT                   INSD:AV540559.1,INSD:DR251711.1,INSD:BP610435.1,
FT                   INSD:BP654232.1,INSD:EH844945.1,INSD:BP834755.1,
FT                   INSD:BP623477.1,INSD:EH975396.1,INSD:T13969.1,
FT                   INSD:AV538089.1,INSD:BP638736.1,INSD:EG468771.1,
FT                   INSD:BP639011.1,INSD:R29973.1,INSD:BP611297.1,
FT                   INSD:EL132105.1,INSD:EH977811.1,INSD:BP611882.1,
FT                   INSD:ES090493.1,INSD:EH952215.1,INSD:EL011510.1,
FT                   INSD:EL034952.1,INSD:BP594367.1,INSD:EL308165.1,
FT                   INSD:BP807617.1,INSD:ES002126.1,INSD:EL968015.1,
FT                   INSD:BP608709.1,INSD:EH878252.1,INSD:BP605540.1,
FT                   INSD:EL313927.1,INSD:EL116342.1,INSD:EL145484.1,
FT                   INSD:Z17730.1,INSD:EH920790.1,INSD:EL083416.1,
FT                   INSD:DR251728.1,INSD:EL990130.1,INSD:EH809488.1,
FT                   INSD:EH886354.1,INSD:AV561594.1,INSD:EH851913.1,
FT                   INSD:BP862989.1,INSD:CF773169.1,INSD:DR251732.1,
FT                   INSD:EL051892.1,INSD:AV532639.1,INSD:EH951007.1,
FT                   INSD:EG514016.1,INSD:EH964652.1,INSD:BP595662.1,
FT                   INSD:EL029861.1,INSD:BP602024.1,INSD:EL043847.1,
FT                   INSD:BP809294.1,INSD:EL230677.1,INSD:N65343.1,
FT                   INSD:BP596565.1,INSD:BP647157.1,INSD:AV567710.1,
FT                   INSD:CB263037.1,INSD:EH887996.1,INSD:AV562794.1,
FT                   INSD:EH838998.1,INSD:EH896395.1,INSD:ES171939.1,
FT                   INSD:AV541043.1,INSD:T20851.1,INSD:BP618645.1,
FT                   INSD:EL311814.1,INSD:EH874635.1,INSD:BP783133.1,
FT                   INSD:BP564071.1,INSD:BP593584.1,INSD:BP803297.1,
FT                   INSD:EL088675.1,INSD:BP598220.1,INSD:BP645633.1,
FT                   INSD:ES184713.1,INSD:EL970032.1,INSD:BP571372.1,
FT                   INSD:AV565153.1,INSD:BP807951.1,INSD:BP614911.1,
FT                   INSD:BP816476.1,INSD:EH913956.1,INSD:EL281044.1,
FT                   INSD:BP667295.1,INSD:BP837592.1,INSD:BP610836.1,
FT                   INSD:AV532599.1,INSD:BP600945.1,INSD:EH929904.1,
FT                   INSD:EL263178.1,INSD:BP618957.1,INSD:CF772965.1,
FT                   INSD:EH877180.1,INSD:BP801476.1,INSD:EL028797.1,
FT                   INSD:ES183296.1,INSD:BP819051.1,INSD:EH863775.1,
FT                   INSD:AI993641.1,INSD:EH865644.1,INSD:DR251740.1,
FT                   INSD:AV559765.1,INSD:EH938792.1,INSD:EL289196.1,
FT                   INSD:EL325677.1,INSD:H37074.1,INSD:BP809525.1,
FT                   INSD:DR251763.1,INSD:BP605013.1,INSD:ES107103.1,
FT                   INSD:ES125584.1,INSD:ES116489.1,INSD:EL054124.1,
FT                   INSD:N65208.1,INSD:BP599291.1,INSD:BP809581.1,
FT                   INSD:BP830174.1,INSD:EH802275.1,INSD:EL197465.1,
FT                   INSD:BP585134.1,INSD:EL203315.1,INSD:BP804580.1,
FT                   INSD:EH931010.1,INSD:BP617708.1,INSD:BP633638.1,
FT                   INSD:DR251713.1,INSD:EH936852.1,INSD:T44607.1,
FT                   INSD:BP830749.1,INSD:BP618806.1,INSD:EL297186.1,
FT                   INSD:EL066812.1,INSD:BP809477.1,INSD:EH853207.1,
FT                   INSD:BP568845.1,INSD:BP653919.1,INSD:EH878020.1,
FT                   INSD:DR251734.1,INSD:EH977765.1,INSD:DR251743.1,
FT                   INSD:EL187521.1,INSD:EH921090.1,INSD:EH816005.1,
FT                   INSD:DR251700.1,INSD:BP613945.1,INSD:N65332.1,
FT                   INSD:EL099147.1,INSD:EL240488.1,INSD:DR251735.1,
FT                   INSD:T22686.1,INSD:BP588074.1,INSD:ES052246.1,
FT                   INSD:EL972052.1,INSD:BP617853.1,INSD:R29956.1,
FT                   INSD:EL302533.1,INSD:EL011338.1,INSD:AV786481.1,
FT                   INSD:DR251716.1,INSD:AV815685.1,INSD:DR251723.1,
FT                   INSD:EL307750.1,INSD:EH883694.1,INSD:BP623686.1,
FT                   INSD:EL057289.1,INSD:BP615535.1,INSD:BP664324.1,
FT                   INSD:DR251749.1,INSD:EL061044.1,INSD:EH977582.1,
FT                   INSD:EL043387.1,INSD:EL058035.1,INSD:DR251731.1,
FT                   INSD:EH963215.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062610.1,INSD:BX816517.1,INSD:X69294.1,
FT                   INSD:X75882.1,INSD:BT002101.1,INSD:AF348574.1"
FT                   /protein_id="AEE27312.1"
FT                   /translation="MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPFFEPGEL
FT                   SSWSFYRAGIAEFIATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYC
FT                   TAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPNPYQTLGG
FT                   GANTVAHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV
FT                   HLATIPITGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHQLVIRAIP
FT                   FKSRS"
FT   CDS_pept        complement(join(225986..226081,226171..226311,
FT                   226396..226691,226849..226960))
FT                   /codon_start=1
FT                   /gene="PIP1C"
FT                   /gene_synonym="F22L4.16"
FT                   /gene_synonym="F22L4_16"
FT                   /gene_synonym="PIP1;3"
FT                   /gene_synonym="PLASMA MEMBRANE INTRINSIC PROTEIN 1;3"
FT                   /gene_synonym="plasma membrane intrinsic protein 1C"
FT                   /gene_synonym="TMP-B"
FT                   /locus_tag="AT1G01620"
FT                   /product="plasma membrane intrinsic protein 1C"
FT                   /note="plasma membrane intrinsic protein 1C (PIP1C);
FT                   FUNCTIONS IN: water channel activity; INVOLVED IN: response
FT                   to water deprivation, response to salt stress, transport,
FT                   water transport; LOCATED IN: plasma membrane, membrane;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 14
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Major intrinsic
FT                   protein, conserved site (InterPro:IPR022357), Aquaporin
FT                   (InterPro:IPR012269), Major intrinsic protein
FT                   (InterPro:IPR000425); BEST Arabidopsis thaliana protein
FT                   match is: plasma membrane intrinsic protein 1;4
FT                   (TAIR:AT4G00430.1); Has 10489 Blast hits to 10479 proteins
FT                   in 2194 species: Archae - 80; Bacteria - 5080; Metazoa -
FT                   1452; Fungi - 437; Plants - 2488; Viruses - 2; Other
FT                   Eukaryotes - 950 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01620"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01620.2"
FT                   /db_xref="GOA:A8MSF6"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A8MSF6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL022688.1,INSD:AV542815.1,INSD:ES031969.1,
FT                   INSD:EH942613.1,INSD:ES207935.1,INSD:BP597207.1,
FT                   INSD:EL156430.1,INSD:EL141779.1,INSD:EL152952.1,
FT                   INSD:EH894675.1,INSD:BP660511.1,INSD:BP599962.1,
FT                   INSD:BP615624.1,INSD:BP662923.1,INSD:EL146246.1,
FT                   INSD:EL037866.1,INSD:EL047245.1,INSD:EL151198.1,
FT                   INSD:BP607020.1,INSD:EH818061.1,INSD:AV558713.1,
FT                   INSD:EL206835.1,INSD:EH875654.1,INSD:EL280264.1,
FT                   INSD:BP642384.1,INSD:N96473.1,INSD:EL253795.1,
FT                   INSD:BP607250.1,INSD:EL332827.1,INSD:EH906376.1,
FT                   INSD:EL102531.1,INSD:EH919112.1,INSD:BP617883.1,
FT                   INSD:EL968106.1,INSD:AV803253.1,INSD:EL238139.1,
FT                   INSD:BP615999.1,INSD:EL971516.1,INSD:BP607216.1,
FT                   INSD:EL135508.1,INSD:BP598613.1,INSD:EL123077.1,
FT                   INSD:EL280084.1,INSD:EL126844.1,INSD:EL101396.1,
FT                   INSD:BP572988.1,INSD:EL067661.1,INSD:EL058438.1,
FT                   INSD:BP628643.1,INSD:EL317711.1,INSD:EL091814.1,
FT                   INSD:BP601615.1,INSD:EL221931.1,INSD:BP579413.1,
FT                   INSD:EH989311.1,INSD:ES168314.1,INSD:EL105431.1,
FT                   INSD:EL191322.1,INSD:EH922982.1,INSD:BP621199.1,
FT                   INSD:BP609852.1,INSD:AV541515.1,INSD:BP609593.1,
FT                   INSD:BP600948.1,INSD:EH935904.1,INSD:EH991737.1,
FT                   INSD:BP606165.1,INSD:EG490315.1,INSD:BP601141.1,
FT                   INSD:BP620143.1,INSD:EL245640.1,INSD:EL028965.1,
FT                   INSD:BP608161.1,INSD:BP574341.1,INSD:EL968755.1,
FT                   INSD:BP597940.1,INSD:BP663595.1,INSD:EH847560.1,
FT                   INSD:EL309129.1,INSD:BP585800.1,INSD:AV521978.1,
FT                   INSD:AV556313.1,INSD:BP609622.1,INSD:BP575144.1,
FT                   INSD:BP640275.1,INSD:AV796506.1,INSD:BP586650.1,
FT                   INSD:BP620206.1,INSD:BP672031.1,INSD:AV790800.1,
FT                   INSD:EL267027.1,INSD:EH867799.1,INSD:ES020055.1,
FT                   INSD:BP564514.1,INSD:BP599383.1,INSD:EH861080.1,
FT                   INSD:AV788097.1,INSD:AV560181.1,INSD:AV544872.1,
FT                   INSD:EL302787.1,INSD:EL969882.1,INSD:ES200421.1,
FT                   INSD:AV557985.1,INSD:EL112692.1,INSD:BP609223.1,
FT                   INSD:BP600467.1,INSD:BP617698.1,INSD:BP581123.1,
FT                   INSD:EL061034.1,INSD:EH986621.1,INSD:EH915497.1,
FT                   INSD:BP595560.1,INSD:EH975830.1,INSD:EH941478.1,
FT                   INSD:BP640614.1,INSD:BP632185.1,INSD:BP610508.1,
FT                   INSD:BP618899.1,INSD:AV541769.1,INSD:EH933941.1,
FT                   INSD:EL064787.1,INSD:BP602795.1,INSD:EH956897.1,
FT                   INSD:BP608067.1,INSD:EL126681.1,INSD:AV521949.1,
FT                   INSD:EL010986.1,INSD:DR378172.1,INSD:AV538082.1,
FT                   INSD:EH873527.1,INSD:EL203754.1,INSD:EH836123.1,
FT                   INSD:AV556308.1,INSD:EL166642.1,INSD:BP601457.1,
FT                   INSD:EL034613.1,INSD:EH976899.1,INSD:AV796455.1,
FT                   INSD:EL263649.1,INSD:BP593405.1,INSD:ES183603.1,
FT                   INSD:DR376656.1,INSD:BP658214.1,INSD:BP605405.1,
FT                   INSD:BP612396.1,INSD:EL114746.1,INSD:BP821512.2,
FT                   INSD:EL117147.1,INSD:EL252849.1,INSD:EL269843.1,
FT                   INSD:BP637473.1,INSD:EH903039.1,INSD:ES159215.1,
FT                   INSD:BP603077.1,INSD:BP632017.1,INSD:EL263596.1,
FT                   INSD:BP585340.1,INSD:EL152975.1,INSD:EL262092.1,
FT                   INSD:BP617987.1,INSD:EL209718.1,INSD:BP584824.1,
FT                   INSD:BP661283.1,INSD:EL257230.1,INSD:BP573876.1,
FT                   INSD:EL333154.1,INSD:ES043162.1,INSD:BP617974.1,
FT                   INSD:BP620523.1,INSD:EL310388.1,INSD:EL135552.1,
FT                   INSD:EL007200.1,INSD:BP606031.1,INSD:BP616376.1,
FT                   INSD:EL280920.1,INSD:EL328303.1,INSD:EL297042.1,
FT                   INSD:BP618662.1,INSD:EL090817.1,INSD:ES021756.1,
FT                   INSD:AV819069.1,INSD:BP601676.1,INSD:BP615052.1,
FT                   INSD:BP620768.1,INSD:BP610038.1,INSD:BP601471.1,
FT                   INSD:EL096078.1,INSD:BP671915.1,INSD:ES203197.1,
FT                   INSD:EL252499.1,INSD:EL281193.1,INSD:BP660201.1,
FT                   INSD:EL328270.1,INSD:ES215392.1,INSD:EH850730.1,
FT                   INSD:EH969529.1,INSD:BP658683.1,INSD:BP603342.1,
FT                   INSD:BP616609.1,INSD:BP599906.1,INSD:EH936321.1,
FT                   INSD:BP631941.1,INSD:EL045100.1,INSD:AV532776.1,
FT                   INSD:EL267737.1,INSD:EL314079.1,INSD:AV520330.1,
FT                   INSD:EL064799.1,INSD:BP615499.1,INSD:EH925848.1,
FT                   INSD:EL108199.1,INSD:BP594764.1,INSD:EL022005.1,
FT                   INSD:EL226325.1,INSD:ES205971.1,INSD:ES025560.1,
FT                   INSD:BP600686.1,INSD:ES059667.1,INSD:BP610419.1,
FT                   INSD:AV566751.1,INSD:EH849615.1,INSD:BP600336.1,
FT                   INSD:EL033432.1,INSD:EL007806.1,INSD:EH986449.1,
FT                   INSD:BP617090.1,INSD:BP601369.1,INSD:EH933270.1,
FT                   INSD:EL217592.1,INSD:AV526413.1,INSD:ES189413.1,
FT                   INSD:EH831811.1,INSD:EH954149.1,INSD:AV556029.1,
FT                   INSD:EL040440.1,INSD:EH990388.1,INSD:AV522087.1,
FT                   INSD:EL186559.1,INSD:ES166867.1,INSD:AV812365.1,
FT                   INSD:BP609775.1,INSD:BP607879.1,INSD:BP602402.1,
FT                   INSD:EL018974.1,INSD:EL037612.1,INSD:EL254153.1,
FT                   INSD:BP617832.1,INSD:H36675.1,INSD:BP616661.1,
FT                   INSD:AV539678.1,INSD:BP600348.1,INSD:AV544554.1,
FT                   INSD:BP610673.1,INSD:AV796157.1,INSD:BP585667.1,
FT                   INSD:EH971902.1,INSD:AV817675.1,INSD:ES208303.1,
FT                   INSD:DR251722.1,INSD:EH981507.1,INSD:EH830897.1,
FT                   INSD:BP600835.1,INSD:EL140481.1,INSD:EH859661.1,
FT                   INSD:EL303502.1,INSD:BP619310.1,INSD:BP608721.1,
FT                   INSD:EL090660.1,INSD:EL301726.1,INSD:EL157599.1,
FT                   INSD:EL024055.1,INSD:EH857179.1,INSD:EH917539.1,
FT                   INSD:ES047848.1,INSD:BP617434.1,INSD:BP610391.1,
FT                   INSD:ES049661.1,INSD:BP791904.1,INSD:BP613839.1,
FT                   INSD:BP642510.1,INSD:BP618660.1,INSD:EL105463.1,
FT                   INSD:T13789.1,INSD:BP621816.1,INSD:BP609540.1,
FT                   INSD:BP636829.1,INSD:BP598533.1,INSD:BP600235.1,
FT                   INSD:BP638647.1,INSD:EL062518.1,INSD:EL170961.1,
FT                   INSD:EL228112.1,INSD:BP631825.1,INSD:EH881399.1,
FT                   INSD:BP601368.1,INSD:EH824473.1,INSD:EH869655.1,
FT                   INSD:EL250719.1,INSD:ES209496.1,INSD:BP649830.1,
FT                   INSD:EL067847.1,INSD:BP603295.1,INSD:EL223999.1,
FT                   INSD:EL185472.1,INSD:BP565317.1,INSD:EL226029.1,
FT                   INSD:EL245252.1,INSD:EL279653.1,INSD:BP604147.1,
FT                   INSD:AV540559.1,INSD:EL172337.1,INSD:EL317904.1,
FT                   INSD:EH874407.1,INSD:EH807399.1,INSD:BP610435.1,
FT                   INSD:BP654232.1,INSD:EH844945.1,INSD:EH861873.1,
FT                   INSD:DR251738.1,INSD:BP623477.1,INSD:EH980712.1,
FT                   INSD:EH975396.1,INSD:AV538089.1,INSD:BP638736.1,
FT                   INSD:EG426143.1,INSD:BP584351.1,INSD:CF773819.1,
FT                   INSD:BP639011.1,INSD:BP631996.1,INSD:EL124004.1,
FT                   INSD:BP611297.1,INSD:EH831664.1,INSD:EL132105.1,
FT                   INSD:EL049466.1,INSD:BP613885.1,INSD:EH917807.1,
FT                   INSD:EH977811.1,INSD:BP611882.1,INSD:EH814184.1,
FT                   INSD:ES090493.1,INSD:EH952215.1,INSD:EL011510.1,
FT                   INSD:BP612648.1,INSD:BP608460.1,INSD:DR251707.1,
FT                   INSD:EL034952.1,INSD:EL261156.1,INSD:EL974354.1,
FT                   INSD:BP594367.1,INSD:BP615800.1,INSD:EL308165.1,
FT                   INSD:BP575779.1,INSD:BP640158.1,INSD:ES002126.1,
FT                   INSD:BP611240.1,INSD:BP608709.1,INSD:BP614571.1,
FT                   INSD:EL233175.1,INSD:EH878252.1,INSD:BP605540.1,
FT                   INSD:EL313927.1,INSD:EL145484.1,INSD:ES014657.1,
FT                   INSD:EH920790.1,INSD:EL083416.1,INSD:ES029323.1,
FT                   INSD:EL990130.1,INSD:EH809488.1,INSD:AV564244.1,
FT                   INSD:EH886354.1,INSD:BP604642.1,INSD:BP602117.1,
FT                   INSD:EH831009.1,INSD:BP604929.1,INSD:EH851913.1,
FT                   INSD:EL193216.1,INSD:EL303290.1,INSD:BP630471.1,
FT                   INSD:EL051892.1,INSD:AV532639.1,INSD:EH951007.1,
FT                   INSD:BP603494.1,INSD:EH964652.1,INSD:BP595662.1,
FT                   INSD:EL029861.1,INSD:BP602024.1,INSD:EH989338.1,
FT                   INSD:EL043847.1,INSD:AA720159.1,INSD:EL237854.1,
FT                   INSD:EL016915.1,INSD:EL230677.1,INSD:EL316820.1,
FT                   INSD:BP647157.1,INSD:BP596565.1,INSD:AV567710.1,
FT                   INSD:CB263037.1,INSD:AV562794.1,INSD:BP608894.1,
FT                   INSD:EL004286.1,INSD:EH838998.1,INSD:BP608359.1,
FT                   INSD:EH896395.1,INSD:BP606551.1,INSD:ES171939.1,
FT                   INSD:AV541043.1,INSD:EL131993.1,INSD:BP608045.1,
FT                   INSD:BP618645.1,INSD:EH874635.1,INSD:EL311814.1,
FT                   INSD:BP783133.1,INSD:BP586384.1,INSD:BP564071.1,
FT                   INSD:ES199879.1,INSD:AV520256.1,INSD:BP593584.1,
FT                   INSD:EL220902.1,INSD:BP645633.1,INSD:EL088675.1,
FT                   INSD:BP598220.1,INSD:ES184713.1,INSD:EL970032.1,
FT                   INSD:AV819562.1,INSD:AV565153.1,INSD:BP571372.1,
FT                   INSD:BP614911.1,INSD:BP609563.1,INSD:EH913956.1,
FT                   INSD:BP608146.1,INSD:BP644447.1,INSD:EH920728.1,
FT                   INSD:EL281044.1,INSD:BP667295.1,INSD:BP610836.1,
FT                   INSD:AV532599.1,INSD:ES189993.1,INSD:BP600945.1,
FT                   INSD:EL219859.1,INSD:BP618024.1,INSD:EH929904.1,
FT                   INSD:BP618957.1,INSD:EL263178.1,INSD:EH877180.1,
FT                   INSD:CF772965.1,INSD:BP610990.1,INSD:EL028797.1,
FT                   INSD:EL138931.1,INSD:ES183296.1,INSD:BP609127.1,
FT                   INSD:EL032605.1,INSD:EH901567.1,INSD:BP622651.1,
FT                   INSD:EH863775.1,INSD:DR251704.1,INSD:AI993641.1,
FT                   INSD:EH865644.1,INSD:BP621341.1,INSD:BP606069.1,
FT                   INSD:EL093473.1,INSD:AV559765.1,INSD:EL235307.1,
FT                   INSD:EH938792.1,INSD:BP619482.1,INSD:EH918684.1,
FT                   INSD:ES211422.1,INSD:EL289196.1,INSD:EL325677.1,
FT                   INSD:BP605013.1,INSD:BP601370.1,INSD:EH873264.1,
FT                   INSD:AV560457.1,INSD:ES107103.1,INSD:ES116489.1,
FT                   INSD:ES125584.1,INSD:N65208.1,INSD:EH835745.1,
FT                   INSD:BP599291.1,INSD:BP616084.1,INSD:EH802275.1,
FT                   INSD:EL197465.1,INSD:BP585134.1,INSD:EL203315.1,
FT                   INSD:EH931010.1,INSD:BP617708.1,INSD:EL049701.1,
FT                   INSD:EH807734.1,INSD:BP598904.1,INSD:BP633638.1,
FT                   INSD:BP609293.1,INSD:EH928920.1,INSD:EH936852.1,
FT                   INSD:BP606120.1,INSD:EL324225.1,INSD:EL970104.1,
FT                   INSD:BP618806.1,INSD:EL297186.1,INSD:EL066812.1,
FT                   INSD:EH853207.1,INSD:EH894078.1,INSD:BP568845.1,
FT                   INSD:BP653919.1,INSD:BP632954.1,INSD:BP604590.1,
FT                   INSD:BP600633.1,INSD:EL161033.1,INSD:BP620287.1,
FT                   INSD:ES107208.1,INSD:AV520025.1,INSD:BP628559.1,
FT                   INSD:BP598805.1,INSD:EL187521.1,INSD:EH816005.1,
FT                   INSD:EH921090.1,INSD:BP613945.1,INSD:BP619833.1,
FT                   INSD:BP579241.1,INSD:AV788373.1,INSD:EL099147.1,
FT                   INSD:N65332.1,INSD:BP619521.1,INSD:EL240488.1,
FT                   INSD:EH918693.1,INSD:DR251745.1,INSD:EL022672.1,
FT                   INSD:BP588074.1,INSD:ES052246.1,INSD:BP617853.1,
FT                   INSD:EL972052.1,INSD:EL011338.1,INSD:EL302533.1,
FT                   INSD:EH893628.1,INSD:Z34252.1,INSD:BP649957.1,
FT                   INSD:EL252327.1,INSD:AV786481.1,INSD:EH826951.1,
FT                   INSD:AV815685.1,INSD:ES091419.1,INSD:BP618045.1,
FT                   INSD:BP623686.1,INSD:EH883694.1,INSD:EL307750.1,
FT                   INSD:EL057289.1,INSD:EH881679.1,INSD:BP622193.1,
FT                   INSD:BP615535.1,INSD:EL206306.1,INSD:BP668761.1,
FT                   INSD:EH981204.1,INSD:BP664324.1,INSD:AV562369.1,
FT                   INSD:EL061044.1,INSD:EH977582.1,INSD:AV534648.1,
FT                   INSD:EH963952.1,INSD:EL338047.1,INSD:EL043387.1,
FT                   INSD:EL058035.1,INSD:BP614292.1,INSD:AV786497.1,
FT                   INSD:EL146481.1,INSD:EH963215.1,INSD:EL218814.1"
FT                   /protein_id="AEE27313.1"
FT                   /translation="MGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
FT                   TFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPNPYQTLGGGANTVAHGYTKGS
FT                   GLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGIN
FT                   PARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHQLVIRAIPFKSRS"
FT   gene            228799..230979
FT                   /gene_synonym="T1N6.1"
FT                   /gene_synonym="T1N6_1"
FT                   /locus_tag="AT1G01630"
FT   mRNA            join(228799..229343,229429..229724,229829..229934,
FT                   230349..230459,230559..230979)
FT                   /gene_synonym="T1N6.1"
FT                   /gene_synonym="T1N6_1"
FT                   /locus_tag="AT1G01630"
FT                   /product="Sec14p-like phosphatidylinositol transfer family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL026839.1,INSD:BP832142.1,INSD:AV557113.1,
FT                   INSD:EL006031.1,INSD:EL179312.1,INSD:DR314446.1,
FT                   INSD:DR379240.1,INSD:EL288009.1,INSD:DR314450.1,
FT                   INSD:BP852462.1,INSD:EH889271.1,INSD:EG480762.1,
FT                   INSD:EL279939.1,INSD:BP614889.1,INSD:DR314448.1,
FT                   INSD:AV829863.1,INSD:DR314439.1,INSD:DR252632.1,
FT                   INSD:EH858091.1,INSD:EH867699.1,INSD:CK118476.1,
FT                   INSD:EH953724.1,INSD:BP570461.1,INSD:EH804900.1,
FT                   INSD:DR381623.1,INSD:DR373158.1,INSD:EH862332.1,
FT                   INSD:EL193792.1,INSD:EH869729.1,INSD:EH821166.1,
FT                   INSD:EL254931.1,INSD:EH992033.1,INSD:EH899635.1,
FT                   INSD:EG480761.1,INSD:AV540399.1,INSD:DR370496.1,
FT                   INSD:EH805833.1,INSD:EL168841.1,INSD:EH865266.1,
FT                   INSD:DR314449.1,INSD:DR314442.1,INSD:DR314445.1,
FT                   INSD:BP631782.1,INSD:AV551875.1,INSD:EL155187.1,
FT                   INSD:DR314440.1,INSD:EL125554.1,INSD:BP666074.1,
FT                   INSD:DR314444.1,INSD:CK118669.1,INSD:EL085740.1,
FT                   INSD:CF651249.1,INSD:EG518144.1,INSD:BP671220.1,
FT                   INSD:EL156505.1,INSD:EL227617.1,INSD:EL293056.1,
FT                   INSD:DR314443.1,INSD:DR314451.1,INSD:EG518143.1,
FT                   INSD:EL013569.1,INSD:EH884435.1,INSD:AV808968.1,
FT                   INSD:EL227519.1,INSD:EH851401.1,INSD:CF651250.1,
FT                   INSD:AI995792.1,INSD:EH834581.1,INSD:EL272698.1,
FT                   INSD:AV533102.1,INSD:BP626388.1,INSD:EL039248.1,
FT                   INSD:BP573956.1,INSD:CK117639.1,INSD:EL316812.1,
FT                   INSD:EL045827.1,INSD:DR314447.1,INSD:BP860642.1,
FT                   INSD:EH815251.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY080700.1,INSD:AY085959.1,INSD:BX816497.1,
FT                   INSD:AY150445.1,INSD:BX816381.1,INSD:BX813995.1"
FT   CDS_pept        join(229206..229343,229429..229724,229829..229934,
FT                   230349..230459,230559..230675)
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.1"
FT                   /gene_synonym="T1N6_1"
FT                   /locus_tag="AT1G01630"
FT                   /product="Sec14p-like phosphatidylinositol transfer family
FT                   protein"
FT                   /note="Sec14p-like phosphatidylinositol transfer family
FT                   protein; CONTAINS InterPro DOMAIN/s: Cellular
FT                   retinaldehyde-binding/triple function, C-terminal
FT                   (InterPro:IPR001251), Cellular retinaldehyde-binding/triple
FT                   function, N-terminal (InterPro:IPR008273),
FT                   Phosphatidylinositol transfer protein-like, N-terminal
FT                   (InterPro:IPR011074); BEST Arabidopsis thaliana protein
FT                   match is: Sec14p-like phosphatidylinositol transfer family
FT                   protein (TAIR:AT1G14820.3); Has 3015 Blast hits to 3010
FT                   proteins in 234 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 1124; Fungi - 666; Plants - 866; Viruses - 0; Other
FT                   Eukaryotes - 359 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01630.1"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LQ96"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL026839.1,INSD:BP832142.1,INSD:AV557113.1,
FT                   INSD:EL006031.1,INSD:EL179312.1,INSD:DR314446.1,
FT                   INSD:DR379240.1,INSD:EL288009.1,INSD:DR314450.1,
FT                   INSD:BP852462.1,INSD:EH889271.1,INSD:EG480762.1,
FT                   INSD:EL279939.1,INSD:BP614889.1,INSD:DR314448.1,
FT                   INSD:AV829863.1,INSD:DR314439.1,INSD:DR252632.1,
FT                   INSD:EH858091.1,INSD:EH867699.1,INSD:CK118476.1,
FT                   INSD:EH953724.1,INSD:BP570461.1,INSD:EH804900.1,
FT                   INSD:DR381623.1,INSD:DR373158.1,INSD:EH862332.1,
FT                   INSD:EL193792.1,INSD:EH869729.1,INSD:EH821166.1,
FT                   INSD:EL254931.1,INSD:EH992033.1,INSD:EH899635.1,
FT                   INSD:EG480761.1,INSD:AV540399.1,INSD:DR370496.1,
FT                   INSD:EH805833.1,INSD:EL168841.1,INSD:EH865266.1,
FT                   INSD:DR314449.1,INSD:DR314442.1,INSD:DR314445.1,
FT                   INSD:BP631782.1,INSD:AV551875.1,INSD:EL155187.1,
FT                   INSD:DR314440.1,INSD:EL125554.1,INSD:BP666074.1,
FT                   INSD:DR314444.1,INSD:CK118669.1,INSD:EL085740.1,
FT                   INSD:CF651249.1,INSD:EG518144.1,INSD:BP671220.1,
FT                   INSD:EL156505.1,INSD:EL227617.1,INSD:EL293056.1,
FT                   INSD:DR314443.1,INSD:DR314451.1,INSD:EG518143.1,
FT                   INSD:EL013569.1,INSD:EH884435.1,INSD:AV808968.1,
FT                   INSD:EL227519.1,INSD:EH851401.1,INSD:CF651250.1,
FT                   INSD:AI995792.1,INSD:EH834581.1,INSD:EL272698.1,
FT                   INSD:AV533102.1,INSD:BP626388.1,INSD:EL039248.1,
FT                   INSD:BP573956.1,INSD:CK117639.1,INSD:EL316812.1,
FT                   INSD:EL045827.1,INSD:DR314447.1,INSD:BP860642.1,
FT                   INSD:EH815251.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY080700.1,INSD:AY085959.1,INSD:BX816497.1,
FT                   INSD:AY150445.1,INSD:BX816381.1,INSD:BX813995.1"
FT                   /protein_id="AEE27314.1"
FT                   /translation="MENKETKQEPAAAAEQKTVPLIEDEIERSKVGIMRALCDRQDPET
FT                   KEVDDLMIRRFLRARDLDIEKASTMFLNYLTWKRSMLPKGHIPEAEIANDLSHNKMCMQ
FT                   GHDKMGRPIAVAIGNRHNPSKGNPDEFKRFVVYTLEKICARMPRGQEKFVAIGDLQGWG
FT                   YSNCDIRGYLAALSTLQDCYPERLGKLYIVHAPYIFMTAWKVIYPFIDANTKKKIVFVE
FT                   NKKLTPTLLEDIDESQLPDIYGGKLPLVPIQET"
FT   gene            complement(230908..232630)
FT                   /gene_synonym="T1N6.2"
FT                   /gene_synonym="T1N6_2"
FT                   /locus_tag="AT1G01640"
FT                   /note="Putative role in flower development. Comparison of
FT                   SALK_011721C to Columbia wild type resulted in a trend
FT                   toward earlier flowering in the mutant (P=0.1) (Stapleton
FT                   and Woodruff 2009, personal communication)."
FT   mRNA            complement(join(230908..231655,231784..231908,
FT                   232398..232630))
FT                   /gene_synonym="T1N6.2"
FT                   /gene_synonym="T1N6_2"
FT                   /locus_tag="AT1G01640"
FT                   /product="BTB/POZ domain-containing protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU230898.1,INSD:AU239572.1,INSD:AV544937.1,
FT                   INSD:AV536151.1,INSD:BP830109.1,INSD:AV553509.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK229678.1,INSD:BT010191.1"
FT   mRNA            complement(join(230908..231655,231784..231928,
FT                   232398..232630))
FT                   /gene_synonym="T1N6.2"
FT                   /gene_synonym="T1N6_2"
FT                   /locus_tag="AT1G01640"
FT                   /product="BTB/POZ domain-containing protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BE037900.1,INSD:AU230898.1,INSD:AV544937.1,
FT                   INSD:AV536151.1,INSD:AV553509.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT010191.1"
FT   CDS_pept        complement(join(231164..231655,231784..231915))
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.2"
FT                   /gene_synonym="T1N6_2"
FT                   /locus_tag="AT1G01640"
FT                   /product="BTB/POZ domain-containing protein"
FT                   /note="BTB/POZ domain-containing protein; CONTAINS InterPro
FT                   DOMAIN/s: BTB/POZ (InterPro:IPR013069), BTB/POZ fold
FT                   (InterPro:IPR011333), Kelch related (InterPro:IPR013089),
FT                   BTB/POZ-like (InterPro:IPR000210); BEST Arabidopsis
FT                   thaliana protein match is: BTB/POZ domain-containing
FT                   protein (TAIR:AT3G56230.1); Has 4339 Blast hits to 4265
FT                   proteins in 145 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 3351; Fungi - 8; Plants - 720; Viruses - 35; Other
FT                   Eukaryotes - 225 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LQ95"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LQ95"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BE037900.1,INSD:AU230898.1,INSD:AV544937.1,
FT                   INSD:AV536151.1,INSD:AV553509.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT010191.1"
FT                   /protein_id="AEE27315.1"
FT                   /translation="MTEAEQKAAFLGGLVVSFKEQMHTDVLVKPGEEAPPIPTHKAVLA
FT                   ARSKVFRNMLDSDECKTSPEESITLPDLSHDELKSLLEFLYSGNLKAPYNQYRSLYLAA
FT                   DKYDISYLQDVCRNHFIASLSSRNVLDILELASIPCDTILKDAAINHIVKHMEEVVVPM
FT                   KYETFVQRNPDLSVEITRAYLRETKAKAKDHGAPLNGNTRPRIW"
FT   CDS_pept        complement(join(231164..231655,231784..231852))
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.2"
FT                   /gene_synonym="T1N6_2"
FT                   /locus_tag="AT1G01640"
FT                   /product="BTB/POZ domain-containing protein"
FT                   /note="BTB/POZ domain-containing protein; CONTAINS InterPro
FT                   DOMAIN/s: BTB/POZ (InterPro:IPR013069), BTB/POZ fold
FT                   (InterPro:IPR011333), Kelch related (InterPro:IPR013089),
FT                   BTB/POZ-like (InterPro:IPR000210); BEST Arabidopsis
FT                   thaliana protein match is: BTB/POZ domain-containing
FT                   protein (TAIR:AT3G56230.1); Has 4339 Blast hits to 4265
FT                   proteins in 145 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 3351; Fungi - 8; Plants - 720; Viruses - 35; Other
FT                   Eukaryotes - 225 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01640"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2H1ZE92"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU230898.1,INSD:AU239572.1,INSD:AV544937.1,
FT                   INSD:AV536151.1,INSD:BP830109.1,INSD:AV553509.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK229678.1,INSD:BT010191.1"
FT                   /protein_id="AEE27316.2"
FT                   /translation="MHTDVLVKPGEEAPPIPTHKAVLAARSKVFRNMLDSDECKTSPEE
FT                   SITLPDLSHDELKSLLEFLYSGNLKAPYNQYRSLYLAADKYDISYLQDVCRNHFIASLS
FT                   SRNVLDILELASIPCDTILKDAAINHIVKHMEEVVVPMKYETFVQRNPDLSVEITRAYL
FT                   RETKAKAKDHGAPLNGNTRPRIW"
FT   gene            complement(232840..237905)
FT                   /gene="SPPL4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA SIGNAL PEPTIDE
FT                   PEPTIDASE-LIKE 4"
FT                   /gene_synonym="ATSPPL4"
FT                   /gene_synonym="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /gene_synonym="T1N6.3"
FT                   /gene_synonym="T1N6_3"
FT                   /locus_tag="AT1G01650"
FT   mRNA            complement(join(232840..233297,233387..233470,
FT                   233548..233618,234250..234392,234529..234621,
FT                   234935..234988,235198..235360,235718..235752,
FT                   235845..236027,236145..236296,236429..236548,
FT                   236673..236784,236865..237023,237504..237905))
FT                   /gene="SPPL4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA SIGNAL PEPTIDE
FT                   PEPTIDASE-LIKE 4"
FT                   /gene_synonym="ATSPPL4"
FT                   /gene_synonym="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /gene_synonym="T1N6.3"
FT                   /gene_synonym="T1N6_3"
FT                   /locus_tag="AT1G01650"
FT                   /product="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH870987.1,INSD:BP610810.1,INSD:BX835679.1,
FT                   INSD:AV562162.1,INSD:BP571443.1,INSD:EL268105.1,
FT                   INSD:BP777783.1,INSD:BP851668.1,INSD:ES138534.1,
FT                   INSD:BP866492.1,INSD:EH980398.1,INSD:EL026856.1,
FT                   INSD:EH941380.1,INSD:ES041877.1,INSD:BP811323.1,
FT                   INSD:EH896069.1,INSD:AV804783.1,INSD:BE527162.1,
FT                   INSD:EL020874.1,INSD:EL046525.1,INSD:EG492732.1,
FT                   INSD:ES092425.1,INSD:BP606822.1,INSD:BP845300.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK229822.1,INSD:BX813620.1"
FT   mRNA            complement(join(232841..233297,233387..233470,
FT                   233548..233618,234250..234392,234529..234621,
FT                   234935..234988,235198..235360,235718..235752,
FT                   235845..236027,236145..236296,236429..236548,
FT                   236673..237023,237504..237817))
FT                   /gene="SPPL4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA SIGNAL PEPTIDE
FT                   PEPTIDASE-LIKE 4"
FT                   /gene_synonym="ATSPPL4"
FT                   /gene_synonym="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /gene_synonym="T1N6.3"
FT                   /gene_synonym="T1N6_3"
FT                   /locus_tag="AT1G01650"
FT                   /product="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT   mRNA            complement(join(232841..233297,233387..233470,
FT                   233548..233618,234250..234392,234529..234621,
FT                   234935..234988,235198..235360,235718..235752,
FT                   235845..236027,236145..236296,236429..236548,
FT                   236673..237303,237504..237817))
FT                   /gene="SPPL4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA SIGNAL PEPTIDE
FT                   PEPTIDASE-LIKE 4"
FT                   /gene_synonym="ATSPPL4"
FT                   /gene_synonym="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /gene_synonym="T1N6.3"
FT                   /gene_synonym="T1N6_3"
FT                   /locus_tag="AT1G01650"
FT                   /product="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH870987.1,INSD:BP610810.1,INSD:BX835679.1,
FT                   INSD:AV562162.1,INSD:BP571443.1,INSD:EL268105.1,
FT                   INSD:BP777783.1,INSD:BP851668.1,INSD:ES138534.1,
FT                   INSD:BP866492.1,INSD:EH980398.1,INSD:EL026856.1,
FT                   INSD:EH941380.1,INSD:ES041877.1,INSD:BP811323.1,
FT                   INSD:BX839581.1,INSD:EH896069.1,INSD:AV804783.1,
FT                   INSD:BP800285.1,INSD:BE527162.1,INSD:EL020874.1,
FT                   INSD:EL046525.1,INSD:ES092425.1,INSD:BP799504.1,
FT                   INSD:BP606822.1,INSD:BP845300.1"
FT   mRNA            complement(join(232841..233297,233387..233470,
FT                   233548..233618,234250..234392,234529..234621,
FT                   234935..234988,235198..235360,235718..235752,
FT                   235845..236027,236145..236296,236429..236548,
FT                   236673..237023,237220..237817))
FT                   /gene="SPPL4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA SIGNAL PEPTIDE
FT                   PEPTIDASE-LIKE 4"
FT                   /gene_synonym="ATSPPL4"
FT                   /gene_synonym="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /gene_synonym="T1N6.3"
FT                   /gene_synonym="T1N6_3"
FT                   /locus_tag="AT1G01650"
FT                   /product="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT   CDS_pept        complement(join(233188..233297,233387..233470,
FT                   233548..233618,234250..234392,234529..234621,
FT                   234935..234988,235198..235360,235718..235752,
FT                   235845..236027,236145..236296,236429..236548,
FT                   236673..236784,236865..237023,237504..237647))
FT                   /codon_start=1
FT                   /gene="SPPL4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA SIGNAL PEPTIDE
FT                   PEPTIDASE-LIKE 4"
FT                   /gene_synonym="ATSPPL4"
FT                   /gene_synonym="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /gene_synonym="T1N6.3"
FT                   /gene_synonym="T1N6_3"
FT                   /locus_tag="AT1G01650"
FT                   /product="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /note="SIGNAL PEPTIDE PEPTIDASE-LIKE 4 (SPPL4); FUNCTIONS
FT                   IN: peptidase activity, aspartic-type endopeptidase
FT                   activity; INVOLVED IN: proteolysis; LOCATED IN:
FT                   endomembrane system, integral to membrane; EXPRESSED IN: 24
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Protease-associated PA
FT                   (InterPro:IPR003137), Peptidase A22, presenilin signal
FT                   peptide (InterPro:IPR006639), Peptidase A22B, signal
FT                   peptide peptidase (InterPro:IPR007369); BEST Arabidopsis
FT                   thaliana protein match is: SIGNAL PEPTIDE PEPTIDASE-LIKE 2
FT                   (TAIR:AT1G63690.1); Has 1466 Blast hits to 1433 proteins in
FT                   284 species: Archae - 0; Bacteria - 176; Metazoa - 611;
FT                   Fungi - 153; Plants - 303; Viruses - 0; Other Eukaryotes -
FT                   223 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01650"
FT                   /db_xref="GOA:Q0WMJ8"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WMJ8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH870987.1,INSD:BP610810.1,INSD:BX835679.1,
FT                   INSD:AV562162.1,INSD:BP571443.1,INSD:EL268105.1,
FT                   INSD:BP777783.1,INSD:BP851668.1,INSD:ES138534.1,
FT                   INSD:BP866492.1,INSD:EH980398.1,INSD:EL026856.1,
FT                   INSD:EH941380.1,INSD:ES041877.1,INSD:BP811323.1,
FT                   INSD:EH896069.1,INSD:AV804783.1,INSD:BE527162.1,
FT                   INSD:EL020874.1,INSD:EL046525.1,INSD:EG492732.1,
FT                   INSD:ES092425.1,INSD:BP606822.1,INSD:BP845300.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK229822.1,INSD:BX813620.1"
FT                   /protein_id="AEE27317.1"
FT                   /translation="MILWKSLSCFSFVFGLLLYSASFVCAGDIVHHDDSLPQRPGCNNN
FT                   FVLVKVPTRVNGSEYTEYVGVGARFGPTLESKEKHATLIKLAIADPPDCCSTPKNKLTG
FT                   EVILVHRGKCSFTTKTKVAEAAGASAILIINNSTDLFKMVCEKGENVLDITIPVVMLPV
FT                   DAGRSLENIVKSNAIVTLQLYSPKRPAVDVAEVFLWLMAVGTILCASYWSAWTVREEAI
FT                   EQDKLLKDGSDELLQLSTTSSRGVVEVTVISAILFVVVASCFLIMLYKLMSFWFIEVLV
FT                   VLFCIGGVEGLQTCLVSLLSCFRWFRRFGESYVKVPFLGAVSYLTLAICPFCIAFAVFW
FT                   AVKRQYSYAWIGQDILGISLIITVLQIVRVPNLKVGFVLLSCAFMYDIFWVFVSKWWFR
FT                   ESVMIVVARGDRSGEDGIPMLLKIPRMFDPWGGYSIIGFGDIILPGLLVTFALRYDWLA
FT                   NKRLKSGYFLGTMSAYGLGLLITYIALNLMDGHGQPALLYIVPFILGTLFVLGHKRGDL
FT                   KTLWTTGEPDRPCPHVRLQPQSS"
FT   CDS_pept        complement(join(233188..233297,233387..233470,
FT                   233548..233618,234250..234392,234529..234621,
FT                   234935..234988,235198..235360,235718..235752,
FT                   235845..236027,236145..236296,236429..236537))
FT                   /codon_start=1
FT                   /gene="SPPL4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA SIGNAL PEPTIDE
FT                   PEPTIDASE-LIKE 4"
FT                   /gene_synonym="ATSPPL4"
FT                   /gene_synonym="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /gene_synonym="T1N6.3"
FT                   /gene_synonym="T1N6_3"
FT                   /locus_tag="AT1G01650"
FT                   /product="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /db_xref="GOA:F4HU44"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="UniProtKB/TrEMBL:F4HU44"
FT                   /protein_id="ANM60845.1"
FT                   /translation="MVCEKGENVLDITIPVVMLPVDAGRSLENIVKSNAIVTLQLYSPK
FT                   RPAVDVAEVFLWLMAVGTILCASYWSAWTVREEAIEQDKLLKDGSDELLQLSTTSSRGV
FT                   VEVTVISAILFVVVASCFLIMLYKLMSFWFIEVLVVLFCIGGVEGLQTCLVSLLSCFRW
FT                   FRRFGESYVKVPFLGAVSYLTLAICPFCIAFAVFWAVKRQYSYAWIGQDILGISLIITV
FT                   LQIVRVPNLKVGFVLLSCAFMYDIFWVFVSKWWFRESVMIVVARGDRSGEDGIPMLLKI
FT                   PRMFDPWGGYSIIGFGDIILPGLLVTFALRYDWLANKRLKSGYFLGTMSAYGLGLLITY
FT                   IALNLMDGHGQPALLYIVPFILGTLFVLGHKRGDLKTLWTTGEPDRPCPHVRLQPQSS"
FT   CDS_pept        complement(join(233188..233297,233387..233470,
FT                   233548..233618,234250..234392,234529..234621,
FT                   234935..234988,235198..235360,235718..235752,
FT                   235845..236027,236145..236296,236429..236537))
FT                   /codon_start=1
FT                   /gene="SPPL4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA SIGNAL PEPTIDE
FT                   PEPTIDASE-LIKE 4"
FT                   /gene_synonym="ATSPPL4"
FT                   /gene_synonym="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /gene_synonym="T1N6.3"
FT                   /gene_synonym="T1N6_3"
FT                   /locus_tag="AT1G01650"
FT                   /product="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /db_xref="GOA:F4HU44"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="UniProtKB/TrEMBL:F4HU44"
FT                   /protein_id="ANM60846.1"
FT                   /translation="MVCEKGENVLDITIPVVMLPVDAGRSLENIVKSNAIVTLQLYSPK
FT                   RPAVDVAEVFLWLMAVGTILCASYWSAWTVREEAIEQDKLLKDGSDELLQLSTTSSRGV
FT                   VEVTVISAILFVVVASCFLIMLYKLMSFWFIEVLVVLFCIGGVEGLQTCLVSLLSCFRW
FT                   FRRFGESYVKVPFLGAVSYLTLAICPFCIAFAVFWAVKRQYSYAWIGQDILGISLIITV
FT                   LQIVRVPNLKVGFVLLSCAFMYDIFWVFVSKWWFRESVMIVVARGDRSGEDGIPMLLKI
FT                   PRMFDPWGGYSIIGFGDIILPGLLVTFALRYDWLANKRLKSGYFLGTMSAYGLGLLITY
FT                   IALNLMDGHGQPALLYIVPFILGTLFVLGHKRGDLKTLWTTGEPDRPCPHVRLQPQSS"
FT   CDS_pept        complement(join(233188..233297,233387..233470,
FT                   233548..233618,234250..234392,234529..234621,
FT                   234935..234988,235198..235360,235718..235752,
FT                   235845..236027,236145..236296,236429..236537))
FT                   /codon_start=1
FT                   /gene="SPPL4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA SIGNAL PEPTIDE
FT                   PEPTIDASE-LIKE 4"
FT                   /gene_synonym="ATSPPL4"
FT                   /gene_synonym="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /gene_synonym="T1N6.3"
FT                   /gene_synonym="T1N6_3"
FT                   /locus_tag="AT1G01650"
FT                   /product="SIGNAL PEPTIDE PEPTIDASE-LIKE 4"
FT                   /note="SIGNAL PEPTIDE PEPTIDASE-LIKE 4 (SPPL4); FUNCTIONS
FT                   IN: peptidase activity, aspartic-type endopeptidase
FT                   activity; INVOLVED IN: proteolysis; LOCATED IN: integral to
FT                   membrane; EXPRESSED IN: 24 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Peptidase A22, presenilin signal peptide
FT                   (InterPro:IPR006639), Peptidase A22B, signal peptide
FT                   peptidase (InterPro:IPR007369); BEST Arabidopsis thaliana
FT                   protein match is: SIGNAL PEPTIDE PEPTIDASE-LIKE 2
FT                   (TAIR:AT1G63690.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01650"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01650.2"
FT                   /db_xref="GOA:F4HU44"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="UniProtKB/TrEMBL:F4HU44"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH870987.1,INSD:BP610810.1,INSD:BX835679.1,
FT                   INSD:AV562162.1,INSD:BP571443.1,INSD:EL268105.1,
FT                   INSD:BP777783.1,INSD:BP851668.1,INSD:ES138534.1,
FT                   INSD:BP866492.1,INSD:EH980398.1,INSD:EL026856.1,
FT                   INSD:EH941380.1,INSD:ES041877.1,INSD:BP811323.1,
FT                   INSD:BX839581.1,INSD:EH896069.1,INSD:AV804783.1,
FT                   INSD:BP800285.1,INSD:BE527162.1,INSD:EL020874.1,
FT                   INSD:EL046525.1,INSD:ES092425.1,INSD:BP799504.1,
FT                   INSD:BP606822.1,INSD:BP845300.1"
FT                   /protein_id="AEE27318.1"
FT                   /translation="MVCEKGENVLDITIPVVMLPVDAGRSLENIVKSNAIVTLQLYSPK
FT                   RPAVDVAEVFLWLMAVGTILCASYWSAWTVREEAIEQDKLLKDGSDELLQLSTTSSRGV
FT                   VEVTVISAILFVVVASCFLIMLYKLMSFWFIEVLVVLFCIGGVEGLQTCLVSLLSCFRW
FT                   FRRFGESYVKVPFLGAVSYLTLAICPFCIAFAVFWAVKRQYSYAWIGQDILGISLIITV
FT                   LQIVRVPNLKVGFVLLSCAFMYDIFWVFVSKWWFRESVMIVVARGDRSGEDGIPMLLKI
FT                   PRMFDPWGGYSIIGFGDIILPGLLVTFALRYDWLANKRLKSGYFLGTMSAYGLGLLITY
FT                   IALNLMDGHGQPALLYIVPFILGTLFVLGHKRGDLKTLWTTGEPDRPCPHVRLQPQSS"
FT   gene            complement(234006..234159)
FT                   /gene="MIR2112"
FT                   /locus_tag="AT1G04027"
FT   precursor_RNA   complement(234006..234159)
FT                   /gene="MIR2112"
FT                   /locus_tag="AT1G04027"
FT                   /product="microRNA ath-MIR2112 precursor"
FT   ncRNA           complement(234017..234037)
FT                   /gene="MIR2112"
FT                   /locus_tag="AT1G04027"
FT                   /product="microRNA ath-miR2112-3p"
FT                   /note="mature miRNA accession:MIMAT0011155"
FT                   /ncRNA_class="miRNA"
FT   ncRNA           complement(234126..234146)
FT                   /gene="MIR2112"
FT                   /locus_tag="AT1G04027"
FT                   /product="microRNA ath-miR2112-5p"
FT                   /note="mature miRNA accession:MIMAT0011154"
FT                   /ncRNA_class="miRNA"
FT   gene            complement(239841..242703)
FT                   /gene_synonym="T1N6.4"
FT                   /gene_synonym="T1N6_4"
FT                   /locus_tag="AT1G01660"
FT   mRNA            complement(join(239841..240242,240352..240672,
FT                   240744..240892,240965..241226,241306..241443,
FT                   241539..241719,241805..241909,241983..242113,
FT                   242214..242290,242449..242703))
FT                   /gene_synonym="T1N6.4"
FT                   /gene_synonym="T1N6_4"
FT                   /locus_tag="AT1G01660"
FT                   /product="RING/U-box superfamily protein"
FT   mRNA            complement(join(240057..240242,240352..240672,
FT                   240744..240884,240960..241226,241306..241443,
FT                   241539..241719,241805..241909,241983..242113,
FT                   242214..242290,242449..242608))
FT                   /gene_synonym="T1N6.4"
FT                   /gene_synonym="T1N6_4"
FT                   /locus_tag="AT1G01660"
FT                   /product="RING/U-box superfamily protein"
FT   CDS_pept        complement(join(240057..240242,240352..240672,
FT                   240744..240892,240965..241226,241306..241443,
FT                   241539..241719,241805..241909,241983..242113,
FT                   242214..242290,242449..242608))
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.4"
FT                   /gene_synonym="T1N6_4"
FT                   /locus_tag="AT1G01660"
FT                   /product="RING/U-box superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01660"
FT                   /db_xref="GOA:A0A1P8AQW1"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AQW1"
FT                   /protein_id="ANM59051.1"
FT                   /translation="MAELMAMGNDVVHVAVKSDVRESRSTLLWALRNLGAKKVCILHVY
FT                   QPKTASPAARKLEELEAIMYETLHDYFDFCQQEGVNEDDIYISCIEMNDVKQGILELIH
FT                   ESKIKKLVMGAASDHHYSEKMFDLKSRKAKYVYQHAPSSCEVMFMCDGHLIYTKEANLE
FT                   DCMGETESEAGQSKPKLYSSASPKCSAELVSAIVAYIDTRRDRDMLEPNASEDQSESDR
FT                   NDQLYRQLKQALMEVEESKREAYEECVRRFKAENTAVEAIRSAREYEAMYNEEAKLRKE
FT                   GKEALAKQRKMVEKTKQERDDALIIILNGRKLYNEELRRRVEAEEMLGKEKEEHERTKK
FT                   EIEEVRAIVQDGMQLYNEQLRHRKEMEESMKRQEEELEKTKKEKEEACMISKNLMQLYE
FT                   DEVRQRKEAEELVKRRREELEKVKKEKEEACSVGQNFMRLYEEEARRRKGTEEELSKVA
FT                   AEKDAASSVCSEILLLLQSYTRRHGTPSGFSDEDSVTRQPPSYFICPISQEVMREPRVA
FT                   ADGFTYEAESLREWLDNGHETSPMTNLKLAHNNLVPNHALRSAIQEWLQRNS"
FT   CDS_pept        complement(join(240057..240242,240352..240672,
FT                   240744..240884,240960..241226,241306..241443,
FT                   241539..241719,241805..241909,241983..242113,
FT                   242214..242290,242449..242608))
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.4"
FT                   /gene_synonym="T1N6_4"
FT                   /locus_tag="AT1G01660"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN:
FT                   ubiquitin-protein ligase activity; INVOLVED IN: protein
FT                   ubiquitination; LOCATED IN: ubiquitin ligase complex;
FT                   CONTAINS InterPro DOMAIN/s: U box domain
FT                   (InterPro:IPR003613); BEST Arabidopsis thaliana protein
FT                   match is: U-box domain-containing protein kinase family
FT                   protein (TAIR:AT2G45910.1); Has 73160 Blast hits to 42540
FT                   proteins in 2253 species: Archae - 866; Bacteria - 9091;
FT                   Metazoa - 34168; Fungi - 4977; Plants - 4797; Viruses -
FT                   224; Other Eukaryotes - 19037 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01660.1"
FT                   /db_xref="GOA:P0C6E7"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C6E7"
FT                   /protein_id="AEE27319.1"
FT                   /translation="MAELMAMGNDVVHVAVKSDVRESRSTLLWALRNLGAKKVCILHVY
FT                   QPKTASPAARKLEELEAIMYETLHDYFDFCQQEGVNEDDIYISCIEMNDVKQGILELIH
FT                   ESKIKKLVMGAASDHHYSEKMFDLKSRKAKYVYQHAPSSCEVMFMCDGHLIYTKEANLE
FT                   DCMGETESEAGQSKPKLYSSASPKCSAELVSAIVAYIDTRRDRDMLEPNASEDQSESDR
FT                   NDQLYRQLKQALMEVEESKREAYEECVRRFKAENTAVEAIRSAREYEAMYNEEAKLRKE
FT                   GKEALAKQRKMVEKTKQERDDALIIILNGRKLYNEELRRRVEAEEMLGKEKEEHERTKK
FT                   EIEEVRAIVQDGTLYNEQLRHRKEMEESMKRQEEELEKTKKEKEEACMISKNLMQLYED
FT                   EVRQRKEAEELVKRRREELEKVKKEKEEACSVGQNFMRLYEEEARRRKGTEEELSKVAA
FT                   EKDAASSVCSEILLLLQSYTRRHGTPSGFSDEDSVTRQPPSYFICPISQEVMREPRVAA
FT                   DGFTYEAESLREWLDNGHETSPMTNLKLAHNNLVPNHALRSAIQEWLQRNS"
FT   gene            complement(242713..246054)
FT                   /gene_synonym="T1N6.28"
FT                   /gene_synonym="T1N6_28"
FT                   /locus_tag="AT1G01670"
FT   mRNA            complement(join(242713..243128,243336..243746,
FT                   244035..244182,244257..244361,244505..244635,
FT                   244770..244873,245151..245264,245877..246054))
FT                   /gene_synonym="T1N6.28"
FT                   /gene_synonym="T1N6_28"
FT                   /locus_tag="AT1G01670"
FT                   /product="RING/U-box superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU238957.1,INSD:AU230208.1,INSD:DR235007.1,
FT                   INSD:DR235006.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK118101.1"
FT   mRNA            complement(join(242837..243128,243336..243746,
FT                   244035..244182,244257..244361,244505..244635,
FT                   244770..244873,245151..245264,245630..245676))
FT                   /gene_synonym="T1N6.28"
FT                   /gene_synonym="T1N6_28"
FT                   /locus_tag="AT1G01670"
FT                   /product="RING/U-box superfamily protein"
FT   mRNA            complement(join(242843..243128,243336..243746,
FT                   244035..244182,244257..244400))
FT                   /gene_synonym="T1N6.28"
FT                   /gene_synonym="T1N6_28"
FT                   /locus_tag="AT1G01670"
FT                   /product="RING/U-box superfamily protein"
FT   CDS_pept        complement(join(242943..243128,243336..243746,
FT                   244035..244182,244257..244361,244505..244635,
FT                   244770..244873,245151..245163))
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.28"
FT                   /gene_synonym="T1N6_28"
FT                   /locus_tag="AT1G01670"
FT                   /product="RING/U-box superfamily protein"
FT                   /db_xref="GOA:Q8GXQ7"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GXQ7"
FT                   /protein_id="ANM59608.1"
FT                   /translation="MTPSSSGLEQSEIDAIQELEQTSRNDTLLKYHDICIDEGVIEQDV
FT                   DMSCFSANSVGEWIVELIYQNNIKKLIMGATADSHYSEGMVHITPTKADYVIQHAPHCC
FT                   NIWLVCNGNLIQTREGRFEHAGSAYSSSSSLHSIDSALIPYGGAGRAERVTEPHALSSS
FT                   EEQSARGIEKMYYEEQRRRLEIEELKREKEQRDKMRRVREEALSSSSGVTKILYNEEVM
FT                   RRREVEAELNRAKAEIEDMKRVQIELKEQHYADCRLLEKERDEAIKTTEELLRALEKGE
FT                   SSIPLQWSVSIEPPQCFICPISKDIMQNPHVAADGYTYEADEFRRWLNHGGEKSPMTNL
FT                   RLENRNLIPNLVLRSAIKDWLQQHP"
FT   CDS_pept        complement(join(242943..243128,243336..243746,
FT                   244035..244182,244257..244361,244505..244635,
FT                   244770..244873,245151..245163))
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.28"
FT                   /gene_synonym="T1N6_28"
FT                   /locus_tag="AT1G01670"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN:
FT                   ubiquitin-protein ligase activity; INVOLVED IN: protein
FT                   ubiquitination; LOCATED IN: ubiquitin ligase complex;
FT                   EXPRESSED IN: 12 plant structures; EXPRESSED DURING: 7
FT                   growth stages; CONTAINS InterPro DOMAIN/s: U box domain
FT                   (InterPro:IPR003613); BEST Arabidopsis thaliana protein
FT                   match is: RING/U-box superfamily protein
FT                   (TAIR:AT3G61390.2); Has 3857 Blast hits to 3144 proteins in
FT                   246 species: Archae - 4; Bacteria - 101; Metazoa - 863;
FT                   Fungi - 177; Plants - 1725; Viruses - 10; Other Eukaryotes
FT                   - 977 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8GXQ7"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GXQ7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU238957.1,INSD:AU230208.1,INSD:DR235007.1,
FT                   INSD:DR235006.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK118101.1"
FT                   /protein_id="AEE27320.1"
FT                   /translation="MTPSSSGLEQSEIDAIQELEQTSRNDTLLKYHDICIDEGVIEQDV
FT                   DMSCFSANSVGEWIVELIYQNNIKKLIMGATADSHYSEGMVHITPTKADYVIQHAPHCC
FT                   NIWLVCNGNLIQTREGRFEHAGSAYSSSSSLHSIDSALIPYGGAGRAERVTEPHALSSS
FT                   EEQSARGIEKMYYEEQRRRLEIEELKREKEQRDKMRRVREEALSSSSGVTKILYNEEVM
FT                   RRREVEAELNRAKAEIEDMKRVQIELKEQHYADCRLLEKERDEAIKTTEELLRALEKGE
FT                   SSIPLQWSVSIEPPQCFICPISKDIMQNPHVAADGYTYEADEFRRWLNHGGEKSPMTNL
FT                   RLENRNLIPNLVLRSAIKDWLQQHP"
FT   CDS_pept        complement(join(242943..243128,243336..243746,
FT                   244035..244182,244257..244357))
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.28"
FT                   /gene_synonym="T1N6_28"
FT                   /locus_tag="AT1G01670"
FT                   /product="RING/U-box superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01670"
FT                   /db_xref="GOA:A0A1P8ASI2"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8ASI2"
FT                   /protein_id="ANM59609.1"
FT                   /translation="MVHITPTKADYVIQHAPHCCNIWLVCNGNLIQTREGRFEHAGSAY
FT                   SSSSSLHSIDSALIPYGGAGRAERVTEPHALSSSEEQSARGIEKMYYEEQRRRLEIEEL
FT                   KREKEQRDKMRRVREEALSSSSGVTKILYNEEVMRRREVEAELNRAKAEIEDMKRVQIE
FT                   LKEQHYADCRLLEKERDEAIKTTEELLRALEKGESSIPLQWSVSIEPPQCFICPISKDI
FT                   MQNPHVAADGYTYEADEFRRWLNHGGEKSPMTNLRLENRNLIPNLVLRSAIKDWLQQHP
FT                   "
FT   gene            complement(246262..248440)
FT                   /gene="PUB54"
FT                   /gene_synonym="ATPUB54"
FT                   /gene_synonym="plant U-box 54"
FT                   /gene_synonym="PLANT U-BOX 54"
FT                   /gene_synonym="T1N6.5"
FT                   /gene_synonym="T1N6_5"
FT                   /locus_tag="AT1G01680"
FT   mRNA            complement(join(246262..246608,246731..246853,
FT                   246949..247078,247167..247268,247362..247492,
FT                   247577..247680,248191..248440))
FT                   /gene="PUB54"
FT                   /gene_synonym="ATPUB54"
FT                   /gene_synonym="plant U-box 54"
FT                   /gene_synonym="PLANT U-BOX 54"
FT                   /gene_synonym="T1N6.5"
FT                   /gene_synonym="T1N6_5"
FT                   /locus_tag="AT1G01680"
FT                   /product="plant U-box 54"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL149734.1,INSD:EH857800.1,INSD:CB074904.1,
FT                   INSD:BU635944.1"
FT   CDS_pept        complement(join(246411..246608,246731..246853,
FT                   246949..247078,247167..247268,247362..247492,
FT                   247577..247680,248191..248329))
FT                   /codon_start=1
FT                   /gene="PUB54"
FT                   /gene_synonym="ATPUB54"
FT                   /gene_synonym="plant U-box 54"
FT                   /gene_synonym="PLANT U-BOX 54"
FT                   /gene_synonym="T1N6.5"
FT                   /gene_synonym="T1N6_5"
FT                   /locus_tag="AT1G01680"
FT                   /product="plant U-box 54"
FT                   /note="plant U-box 54 (PUB54); FUNCTIONS IN:
FT                   ubiquitin-protein ligase activity; INVOLVED IN: response to
FT                   stress, protein ubiquitination; LOCATED IN: ubiquitin
FT                   ligase complex; CONTAINS InterPro DOMAIN/s: UspA
FT                   (InterPro:IPR006016), U box domain (InterPro:IPR003613);
FT                   BEST Arabidopsis thaliana protein match is: RING/U-box
FT                   superfamily protein (TAIR:AT1G01660.1); Has 2251 Blast hits
FT                   to 2122 proteins in 140 species: Archae - 0; Bacteria - 22;
FT                   Metazoa - 203; Fungi - 25; Plants - 1809; Viruses - 3;
FT                   Other Eukaryotes - 189 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01680.1"
FT                   /db_xref="GOA:Q9LQ92"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LQ92"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL149734.1,INSD:EH857800.1,INSD:CB074904.1,
FT                   INSD:BU635944.1"
FT                   /protein_id="AEE27321.1"
FT                   /translation="MEDAIYVAVNQDVRESKKTLLWALKNLQVKKIFLLHVHLPFSLTT
FT                   SSSRLEQSEIDAIQDSELNTSVNSLYKYRDICINKGVNEKDVDTSMISGHDVGEGIVEL
FT                   IYQNIITNLVMGAAADPHYSRGMSITSRKAEYVSQHAPHSCKIWFICKGKLIKQRERSF
FT                   YLGNPSDSFSEFSTSAEKPISKGRRRDEEEEPESPKEHPGWILEPEESPKKGRKETIEK
FT                   SKSNESDEDPRLEDFKCPISMEIMRDPHVAADGFTYEAEEFRKWLRSGGRTSPKTNKPL
FT                   ENHNLVPNHTLRIIIKDWLEKNPNYKR"
FT   gene            249041..252522
FT                   /gene="PRD3"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PUTATIVE RECOMBINATION
FT                   INITIATION DEFECTS 3"
FT                   /gene_synonym="ATPRD3"
FT                   /gene_synonym="putative recombination initiation defects 3"
FT                   /gene_synonym="T1N6.6"
FT                   /gene_synonym="T1N6_6"
FT                   /locus_tag="AT1G01690"
FT                   /note="Encodes a novel plant-specific protein that is
FT                   involved in meiotic double strand break formation."
FT   mRNA            join(249041..249306,249543..249693,249774..249930,
FT                   250014..250151,250536..250588,250669..250863,
FT                   251004..251066,251143..251184,251260..251316,
FT                   251399..251440,251539..251594,251680..251827,
FT                   251922..252006,252121..252522)
FT                   /gene="PRD3"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PUTATIVE RECOMBINATION
FT                   INITIATION DEFECTS 3"
FT                   /gene_synonym="ATPRD3"
FT                   /gene_synonym="putative recombination initiation defects 3"
FT                   /gene_synonym="T1N6.6"
FT                   /gene_synonym="T1N6_6"
FT                   /locus_tag="AT1G01690"
FT                   /product="putative recombination initiation defects 3"
FT   mRNA            join(249081..249306,249540..249693,249774..249930,
FT                   250014..250151,250536..250588,250669..250863,
FT                   251004..251066,251143..251184,251260..251316,
FT                   251399..251440,251539..251594,251680..251827,
FT                   251922..252006,252121..252462)
FT                   /gene="PRD3"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PUTATIVE RECOMBINATION
FT                   INITIATION DEFECTS 3"
FT                   /gene_synonym="ATPRD3"
FT                   /gene_synonym="putative recombination initiation defects 3"
FT                   /gene_synonym="T1N6.6"
FT                   /gene_synonym="T1N6_6"
FT                   /locus_tag="AT1G01690"
FT                   /product="putative recombination initiation defects 3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV534454.1,INSD:ES119645.1,INSD:BP785996.1,
FT                   INSD:BP787237.1,INSD:ES095735.1,INSD:CB255501.1,
FT                   INSD:AV821613.1,INSD:EL309191.1,INSD:CB252246.1,
FT                   INSD:ES196192.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK226208.1"
FT   mRNA            join(249141..249306,249540..249693,249774..249930,
FT                   250017..250151,250536..250588,250669..250863,
FT                   251004..251066,251143..251184,251260..251316,
FT                   251399..251440,251539..251594,251680..251827,
FT                   251922..252006,252121..252462)
FT                   /gene="PRD3"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PUTATIVE RECOMBINATION
FT                   INITIATION DEFECTS 3"
FT                   /gene_synonym="ATPRD3"
FT                   /gene_synonym="putative recombination initiation defects 3"
FT                   /gene_synonym="T1N6.6"
FT                   /gene_synonym="T1N6_6"
FT                   /locus_tag="AT1G01690"
FT                   /product="putative recombination initiation defects 3"
FT   CDS_pept        join(249242..249306,249540..249693,249774..249930,
FT                   250014..250151,250536..250588,250669..250863,
FT                   251004..251066,251143..251184,251260..251316,
FT                   251399..251440,251539..251594,251680..251827,
FT                   251922..252006,252121..252221)
FT                   /codon_start=1
FT                   /gene="PRD3"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PUTATIVE RECOMBINATION
FT                   INITIATION DEFECTS 3"
FT                   /gene_synonym="ATPRD3"
FT                   /gene_synonym="putative recombination initiation defects 3"
FT                   /gene_synonym="T1N6.6"
FT                   /gene_synonym="T1N6_6"
FT                   /locus_tag="AT1G01690"
FT                   /product="putative recombination initiation defects 3"
FT                   /note="putative recombination initiation defects 3 (PRD3);
FT                   Has 279 Blast hits to 273 proteins in 87 species: Archae -
FT                   2; Bacteria - 106; Metazoa - 105; Fungi - 5; Plants - 32;
FT                   Viruses - 0; Other Eukaryotes - 29 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01690"
FT                   /db_xref="GOA:F4HU48"
FT                   /db_xref="InterPro:IPR034546"
FT                   /db_xref="UniProtKB/TrEMBL:F4HU48"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV534454.1,INSD:ES119645.1,INSD:BP785996.1,
FT                   INSD:BP787237.1,INSD:ES095735.1,INSD:CB255501.1,
FT                   INSD:AV821613.1,INSD:EL309191.1,INSD:CB252246.1,
FT                   INSD:ES196192.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK226208.1"
FT                   /protein_id="AEE27322.2"
FT                   /translation="MKMNINKACDLKSISVFPPNLRRRSAEPQASQQLRSQQSQQSFSQ
FT                   GPSSSQRGCGGFSQMTQSSIDELLINDQRFSSQERDLSLKKVSSCLPPINHKREDSQLV
FT                   ASRSSSGLSRRWSSASIGESKLAQISEELEQRFGMMETSLSRFGMMLDSIQSDIMQANR
FT                   GTKEVFLETERIQQKLTLQDTSLQQLRKEQADSKASLDGGVKFILEEFSKDPNQEKLQK
FT                   ILQMLTTIPEQVETALQKIQREICHTFTREIQVLASLRTPEPRVRVPTAPQVKAKENLP
FT                   EQRGQAAKVLTSLKMPEPRVQVPAAPQAKENFPEQRGPVAKSNSFCNTTLKTKQPQFPR
FT                   NPNDASARAVKPYLSPKIQVGCWKTVKPEKSNFKKRATRKPVKSESTRTQFEQCSVVID
FT                   SDEEDIDGGFSCLINENTRGTNFEWDAEKETERILRTARRTKRKFGNPIIIN"
FT   CDS_pept        join(249242..249306,249540..249693,249774..249930,
FT                   250017..250151,250536..250588,250669..250863,
FT                   251004..251066,251143..251184,251260..251316,
FT                   251399..251440,251539..251594,251680..251827,
FT                   251922..252006,252121..252221)
FT                   /codon_start=1
FT                   /gene="PRD3"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PUTATIVE RECOMBINATION
FT                   INITIATION DEFECTS 3"
FT                   /gene_synonym="ATPRD3"
FT                   /gene_synonym="putative recombination initiation defects 3"
FT                   /gene_synonym="T1N6.6"
FT                   /gene_synonym="T1N6_6"
FT                   /locus_tag="AT1G01690"
FT                   /product="putative recombination initiation defects 3"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01690"
FT                   /db_xref="GOA:A0A1P8AUL3"
FT                   /db_xref="InterPro:IPR034546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AUL3"
FT                   /protein_id="ANM60354.1"
FT                   /translation="MKMNINKACDLKSISVFPPNLRRRSAEPQASQQLRSQQSQQSFSQ
FT                   GPSSSQRGCGGFSQMTQSSIDELLINDQRFSSQERDLSLKKVSSCLPPINHKREDSQLV
FT                   ASRSSSGLSRRWSSASIGESKSQISEELEQRFGMMETSLSRFGMMLDSIQSDIMQANRG
FT                   TKEVFLETERIQQKLTLQDTSLQQLRKEQADSKASLDGGVKFILEEFSKDPNQEKLQKI
FT                   LQMLTTIPEQVETALQKIQREICHTFTREIQVLASLRTPEPRVRVPTAPQVKAKENLPE
FT                   QRGQAAKVLTSLKMPEPRVQVPAAPQAKENFPEQRGPVAKSNSFCNTTLKTKQPQFPRN
FT                   PNDASARAVKPYLSPKIQVGCWKTVKPEKSNFKKRATRKPVKSESTRTQFEQCSVVIDS
FT                   DEEDIDGGFSCLINENTRGTNFEWDAEKETERILRTARRTKRKFGNPIIIN"
FT   CDS_pept        join(249242..249306,249543..249693,249774..249930,
FT                   250014..250151,250536..250588,250669..250863,
FT                   251004..251066,251143..251184,251260..251316,
FT                   251399..251440,251539..251594,251680..251827,
FT                   251922..252006,252121..252221)
FT                   /codon_start=1
FT                   /gene="PRD3"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PUTATIVE RECOMBINATION
FT                   INITIATION DEFECTS 3"
FT                   /gene_synonym="ATPRD3"
FT                   /gene_synonym="putative recombination initiation defects 3"
FT                   /gene_synonym="T1N6.6"
FT                   /gene_synonym="T1N6_6"
FT                   /locus_tag="AT1G01690"
FT                   /product="putative recombination initiation defects 3"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01690"
FT                   /db_xref="GOA:A0A178WD31"
FT                   /db_xref="InterPro:IPR034546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178WD31"
FT                   /protein_id="ANM60353.1"
FT                   /translation="MKMNINKACDLKSISVFPPNLRRSAEPQASQQLRSQQSQQSFSQG
FT                   PSSSQRGCGGFSQMTQSSIDELLINDQRFSSQERDLSLKKVSSCLPPINHKREDSQLVA
FT                   SRSSSGLSRRWSSASIGESKLAQISEELEQRFGMMETSLSRFGMMLDSIQSDIMQANRG
FT                   TKEVFLETERIQQKLTLQDTSLQQLRKEQADSKASLDGGVKFILEEFSKDPNQEKLQKI
FT                   LQMLTTIPEQVETALQKIQREICHTFTREIQVLASLRTPEPRVRVPTAPQVKAKENLPE
FT                   QRGQAAKVLTSLKMPEPRVQVPAAPQAKENFPEQRGPVAKSNSFCNTTLKTKQPQFPRN
FT                   PNDASARAVKPYLSPKIQVGCWKTVKPEKSNFKKRATRKPVKSESTRTQFEQCSVVIDS
FT                   DEEDIDGGFSCLINENTRGTNFEWDAEKETERILRTARRTKRKFGNPIIIN"
FT   gene            252626..254530
FT                   /gene="TRM33"
FT                   /gene_synonym="TON1 Recruiting Motif 33"
FT                   /locus_tag="AT1G01695"
FT   mRNA            join(252626..253457,253531..253679,253775..253874,
FT                   253954..254530)
FT                   /gene="TRM33"
FT                   /gene_synonym="TON1 Recruiting Motif 33"
FT                   /locus_tag="AT1G01695"
FT                   /product="Phosphatidylinositol
FT                   N-acetyglucosaminlytransferase subunit P-like protein"
FT   CDS_pept        join(252947..253457,253531..253679,253775..253874,
FT                   253954..254495)
FT                   /codon_start=1
FT                   /gene="TRM33"
FT                   /gene_synonym="TON1 Recruiting Motif 33"
FT                   /locus_tag="AT1G01695"
FT                   /product="Phosphatidylinositol
FT                   N-acetyglucosaminlytransferase subunit P-like protein"
FT                   /note="Phosphatidylinositol N-acetyglucosaminlytransferase
FT                   subunit P-related; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; BEST Arabidopsis thaliana
FT                   protein match is: Protein of unknown function (DUF3741)
FT                   (TAIR:AT4G00440.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01695.1"
FT                   /db_xref="GOA:B3H5G8"
FT                   /db_xref="InterPro:IPR025486"
FT                   /db_xref="UniProtKB/TrEMBL:B3H5G8"
FT                   /protein_id="AEE27323.1"
FT                   /translation="MPVEKHVEEKLRSNRKERGWISGIFRRKKRSPQEEEVDNENNSSE
FT                   DSRLMGAKNLHLFLSEIMRKLKHAIRKEKPDKRLLGKKKSFEKSLSTKDHFFLERMTSI
FT                   SQKRFHQEHNDPNLATSKQVQRNHERIVWLPEYSSPFSSPGRIWKQNSTVLLRSSSYDF
FT                   IKSETIADDSITLKEIGTASSSEGSSSPLLSKSNQIVDEMSKVAAYGAENEGEFLEETL
FT                   SLPSVGSPSHYISKTEEYDFVLEPLFISPARGEAKIQPLCNQLQEKNRHKESVFKYVKA
FT                   VLEAIDSNWEELYLKTEISDQLLYPALISNIPFYPNQLCVEHELLFDCINEVLFEFCRF
FT                   PQWVSFAETRTQVLPYSVESIVPEVQEKVYCHLLPMQLRRSLEERVREDMAKHRSWLDI
FT                   RCDLECIGFETSELILNELLEQLMLELEDNHKNG"
FT   gene            254830..257582
FT                   /locus_tag="AT1G08775"
FT   misc_RNA        join(254830..255074,255230..255366,257225..257582)
FT                   /locus_tag="AT1G08775"
FT                   /note="novel transcribed region; AT1G08775.1"
FT   gene            255022..255384
FT                   /locus_tag="AT1G04033"
FT   ncRNA           255022..255384
FT                   /locus_tag="AT1G04033"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   misc_RNA        join(255228..255366,257225..257356)
FT                   /locus_tag="AT1G08775"
FT                   /note="novel transcribed region; AT1G08775.2"
FT   gene            complement(258717..258963)
FT                   /locus_tag="AT1G04037"
FT   ncRNA           complement(258717..258963)
FT                   /locus_tag="AT1G04037"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(259307..261667)
FT                   /gene="ROPGEF2"
FT                   /gene_synonym="ATROPGEF2"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 2"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 2"
FT                   /gene_synonym="T1N6.8"
FT                   /gene_synonym="T1N6_8"
FT                   /locus_tag="AT1G01700"
FT                   /note="Encodes a member of KPP-like gene family, homolog of
FT                   KPP (kinase partner protein) gene in tomato. Also a member
FT                   of the RopGEF (guanine nucleotide exchange factor) family,
FT                   containing the novel PRONE domain (plant-specific Rop
FT                   nucleotide exchanger), which is exclusively active towards
FT                   members of the Rop subfamily."
FT   mRNA            complement(join(259307..259614,259690..260034,
FT                   260118..260417,260508..260582,260670..260824,
FT                   260921..261037,261129..261667))
FT                   /gene="ROPGEF2"
FT                   /gene_synonym="ATROPGEF2"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 2"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 2"
FT                   /gene_synonym="T1N6.8"
FT                   /gene_synonym="T1N6_8"
FT                   /locus_tag="AT1G01700"
FT                   /product="RHO guanyl-nucleotide exchange factor 2"
FT                   /inference="similar to RNA sequence, EST:INSD:AA721856.1"
FT   mRNA            complement(join(259307..259614,259690..260417,
FT                   260508..260582,260670..260824,260921..261037,
FT                   261129..261667))
FT                   /gene="ROPGEF2"
FT                   /gene_synonym="ATROPGEF2"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 2"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 2"
FT                   /gene_synonym="T1N6.8"
FT                   /gene_synonym="T1N6_8"
FT                   /locus_tag="AT1G01700"
FT                   /product="RHO guanyl-nucleotide exchange factor 2"
FT   mRNA            complement(join(259486..260034,260118..260417,
FT                   260508..260603,260670..260824,260921..261037,
FT                   261129..261474))
FT                   /gene="ROPGEF2"
FT                   /gene_synonym="ATROPGEF2"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 2"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 2"
FT                   /gene_synonym="T1N6.8"
FT                   /gene_synonym="T1N6_8"
FT                   /locus_tag="AT1G01700"
FT                   /product="RHO guanyl-nucleotide exchange factor 2"
FT   mRNA            complement(join(259495..259614,259690..260034,
FT                   260118..260582,260670..260824,260921..261037,
FT                   261129..261615))
FT                   /gene="ROPGEF2"
FT                   /gene_synonym="ATROPGEF2"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 2"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 2"
FT                   /gene_synonym="T1N6.8"
FT                   /gene_synonym="T1N6_8"
FT                   /locus_tag="AT1G01700"
FT                   /product="RHO guanyl-nucleotide exchange factor 2"
FT   CDS_pept        complement(join(259495..259614,259690..260034,
FT                   260118..260417,260508..260582,260670..260824,
FT                   260921..261037,261129..261474))
FT                   /codon_start=1
FT                   /gene="ROPGEF2"
FT                   /gene_synonym="ATROPGEF2"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 2"
FT                   /gene_synonym="T1N6.8"
FT                   /gene_synonym="T1N6_8"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 2"
FT                   /locus_tag="AT1G01700"
FT                   /product="RHO guanyl-nucleotide exchange factor 2"
FT                   /note="RHO guanyl-nucleotide exchange factor 2 (ROPGEF2);
FT                   CONTAINS InterPro DOMAIN/s: Rop nucleotide exchanger, PRONE
FT                   (InterPro:IPR005512); BEST Arabidopsis thaliana protein
FT                   match is: RHO guanyl-nucleotide exchange factor 3
FT                   (TAIR:AT4G00460.2); Has 308 Blast hits to 304 proteins in
FT                   16 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 308; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01700"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01700.1"
FT                   /db_xref="GOA:Q9LQ89"
FT                   /db_xref="InterPro:IPR005512"
FT                   /db_xref="InterPro:IPR038937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LQ89"
FT                   /inference="similar to RNA sequence, EST:INSD:AA721856.1"
FT                   /protein_id="AEE27324.1"
FT                   /translation="MENLPNHEENDDVGYHQSPGPIDPNDHSASETPVYSTMSTDSFAY
FT                   HRTCSETSGGGFSDQIDETSSFCTEASPSDWPVLTESNNSASSNFPTVFDLKHNQIETD
FT                   EHLAVQEISEPELETMKERFSKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLR
FT                   LEPLEIEQKTTWKREMNCLLSVCDYIFEFIPKSQNLSNGATVEVMESRPRADIYINLPA
FT                   LRKLDSMLMEALDSFQKTEFWYAEEGSLSMKSTRSATGSFRKVIVQRKEEKWWLPIPLV
FT                   PLQGLSEKARKQLKSKRESTNQIHKAAMAINSSILGEMDIPDSYMATLPKSGKASTGDA
FT                   IYRHMTSSGRFSPEKLLDRLKIVSEHEALQLADRVEASMYTWRRKACLNNSKSSWNMVK
FT                   DLMSITERSDKNYVLAERAESLLFCLKQRYPELSQTSLDICKIHCNKDVGKAVLESYSR
FT                   VLEGLAFNIVAWIDDVLYVDKTMRGEE"
FT   CDS_pept        complement(join(259495..259614,259690..260034,
FT                   260118..260582,260670..260824,260921..261037,
FT                   261129..261474))
FT                   /codon_start=1
FT                   /gene="ROPGEF2"
FT                   /gene_synonym="ATROPGEF2"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 2"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 2"
FT                   /gene_synonym="T1N6.8"
FT                   /gene_synonym="T1N6_8"
FT                   /locus_tag="AT1G01700"
FT                   /product="RHO guanyl-nucleotide exchange factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01700"
FT                   /db_xref="GOA:A0A1P8ASA3"
FT                   /db_xref="InterPro:IPR005512"
FT                   /db_xref="InterPro:IPR038937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8ASA3"
FT                   /protein_id="ANM59534.1"
FT                   /translation="MENLPNHEENDDVGYHQSPGPIDPNDHSASETPVYSTMSTDSFAY
FT                   HRTCSETSGGGFSDQIDETSSFCTEASPSDWPVLTESNNSASSNFPTVFDLKHNQIETD
FT                   EHLAVQEISEPELETMKERFSKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLR
FT                   LEPLEIEQKTTWKREMNCLLSVCDYIFEFIPKSQNLSNGATVEVMESRPRADIYINLPA
FT                   LRKLDSMLMVVTTPEQEAIINKIDSVNIPHKSHSLCFLQEALDSFQKTEFWYAEEGSLS
FT                   MKSTRSATGSFRKVIVQRKEEKWWLPIPLVPLQGLSEKARKQLKSKRESTNQIHKAAMA
FT                   INSSILGEMDIPDSYMATLPKSGKASTGDAIYRHMTSSGRFSPEKLLDRLKIVSEHEAL
FT                   QLADRVEASMYTWRRKACLNNSKSSWNMVKDLMSITERSDKNYVLAERAESLLFCLKQR
FT                   YPELSQTSLDICKIHCNKDVGKAVLESYSRVLEGLAFNIVAWIDDVLYVDKTMRGEE"
FT   mRNA            complement(join(259640..260417,260508..260582,
FT                   260670..260824,260921..261037,261129..261667))
FT                   /gene="ROPGEF2"
FT                   /gene_synonym="ATROPGEF2"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 2"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 2"
FT                   /gene_synonym="T1N6.8"
FT                   /gene_synonym="T1N6_8"
FT                   /locus_tag="AT1G01700"
FT                   /product="RHO guanyl-nucleotide exchange factor 2"
FT   CDS_pept        complement(join(259663..260034,260118..260417,
FT                   260508..260603,260670..260824,260921..261037,
FT                   261129..261474))
FT                   /codon_start=1
FT                   /gene="ROPGEF2"
FT                   /gene_synonym="ATROPGEF2"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 2"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 2"
FT                   /gene_synonym="T1N6.8"
FT                   /gene_synonym="T1N6_8"
FT                   /locus_tag="AT1G01700"
FT                   /product="RHO guanyl-nucleotide exchange factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01700"
FT                   /db_xref="GOA:A0A1P8ASE8"
FT                   /db_xref="InterPro:IPR005512"
FT                   /db_xref="InterPro:IPR038937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8ASE8"
FT                   /protein_id="ANM59537.1"
FT                   /translation="MENLPNHEENDDVGYHQSPGPIDPNDHSASETPVYSTMSTDSFAY
FT                   HRTCSETSGGGFSDQIDETSSFCTEASPSDWPVLTESNNSASSNFPTVFDLKHNQIETD
FT                   EHLAVQEISEPELETMKERFSKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLR
FT                   LEPLEIEQKTTWKREMNCLLSVCDYIFEFIPKSQNLSNGATVELLRFFCQVMESRPRAD
FT                   IYINLPALRKLDSMLMEALDSFQKTEFWYAEEGSLSMKSTRSATGSFRKVIVQRKEEKW
FT                   WLPIPLVPLQGLSEKARKQLKSKRESTNQIHKAAMAINSSILGEMDIPDSYMATLPKSG
FT                   KASTGDAIYRHMTSSGRFSPEKLLDRLKIVSEHEALQLADRVEASMYTWRRKACLNNSK
FT                   SSWNMVKDLMSITERSDKNYVLAERAESLLFCLKQRYPELSQTSLDICKIHCNKVIKKQ
FT                   TVT"
FT   CDS_pept        complement(join(259992..260417,260508..260582,
FT                   260670..260824,260921..261037,261129..261474))
FT                   /codon_start=1
FT                   /gene="ROPGEF2"
FT                   /gene_synonym="ATROPGEF2"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 2"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 2"
FT                   /gene_synonym="T1N6.8"
FT                   /gene_synonym="T1N6_8"
FT                   /locus_tag="AT1G01700"
FT                   /product="RHO guanyl-nucleotide exchange factor 2"
FT                   /db_xref="GOA:A0A1P8ASC5"
FT                   /db_xref="InterPro:IPR005512"
FT                   /db_xref="InterPro:IPR038937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8ASC5"
FT                   /protein_id="ANM59535.1"
FT                   /translation="MENLPNHEENDDVGYHQSPGPIDPNDHSASETPVYSTMSTDSFAY
FT                   HRTCSETSGGGFSDQIDETSSFCTEASPSDWPVLTESNNSASSNFPTVFDLKHNQIETD
FT                   EHLAVQEISEPELETMKERFSKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLR
FT                   LEPLEIEQKTTWKREMNCLLSVCDYIFEFIPKSQNLSNGATVEVMESRPRADIYINLPA
FT                   LRKLDSMLMEALDSFQKTEFWYAEEGSLSMKSTRSATGSFRKVIVQRKEEKWWLPIPLV
FT                   PLQGLSEKARKQLKSKRESTNQIHKAAMAINSSILGEMDIPDSYMATLPKVTTLKMILK
FT                   FWFSIFGVIFLLTILCICRAEKRAQEMQSIDT"
FT   CDS_pept        complement(join(259992..260417,260508..260582,
FT                   260670..260824,260921..261037,261129..261474))
FT                   /codon_start=1
FT                   /gene="ROPGEF2"
FT                   /gene_synonym="ATROPGEF2"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 2"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 2"
FT                   /gene_synonym="T1N6.8"
FT                   /gene_synonym="T1N6_8"
FT                   /locus_tag="AT1G01700"
FT                   /product="RHO guanyl-nucleotide exchange factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01700"
FT                   /db_xref="GOA:A0A1P8ASC5"
FT                   /db_xref="InterPro:IPR005512"
FT                   /db_xref="InterPro:IPR038937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8ASC5"
FT                   /protein_id="ANM59536.1"
FT                   /translation="MENLPNHEENDDVGYHQSPGPIDPNDHSASETPVYSTMSTDSFAY
FT                   HRTCSETSGGGFSDQIDETSSFCTEASPSDWPVLTESNNSASSNFPTVFDLKHNQIETD
FT                   EHLAVQEISEPELETMKERFSKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLR
FT                   LEPLEIEQKTTWKREMNCLLSVCDYIFEFIPKSQNLSNGATVEVMESRPRADIYINLPA
FT                   LRKLDSMLMEALDSFQKTEFWYAEEGSLSMKSTRSATGSFRKVIVQRKEEKWWLPIPLV
FT                   PLQGLSEKARKQLKSKRESTNQIHKAAMAINSSILGEMDIPDSYMATLPKVTTLKMILK
FT                   FWFSIFGVIFLLTILCICRAEKRAQEMQSIDT"
FT   gene            262828..266324
FT                   /gene_synonym="T1N6.10"
FT                   /gene_synonym="T1N6.9"
FT                   /gene_synonym="T1N6_10"
FT                   /gene_synonym="T1N6_9"
FT                   /locus_tag="AT1G01710"
FT   mRNA            join(262828..262965,263047..263139,263232..263299,
FT                   263369..263444,263526..263572,263645..263770,
FT                   263857..263934,264073..264160,264280..264392,
FT                   264520..264582,264657..264712,264797..264901,
FT                   265021..265077,265336..265437,265578..265626,
FT                   265777..265845,265952..266324)
FT                   /gene_synonym="T1N6.10"
FT                   /gene_synonym="T1N6.9"
FT                   /gene_synonym="T1N6_10"
FT                   /gene_synonym="T1N6_9"
FT                   /locus_tag="AT1G01710"
FT                   /product="acyl-CoA thioesterase II"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI999643.1,INSD:EL999442.1,INSD:BX834655.1,
FT                   INSD:BP793073.1,INSD:ES130840.1,INSD:ES103540.1,
FT                   INSD:ES175377.1,INSD:DR364231.1,INSD:AV535337.1,
FT                   INSD:EL182964.1,INSD:AU229328.1,INSD:ES016080.1,
FT                   INSD:CB254939.1,INSD:ES133967.1,INSD:DR362539.1,
FT                   INSD:BP840016.1,INSD:ES193219.1,INSD:ES009569.1,
FT                   INSD:EL009583.1,INSD:AV531734.1,INSD:BP852458.1,
FT                   INSD:ES168165.1,INSD:ES041687.1,INSD:BX837773.1,
FT                   INSD:BX837564.1,INSD:CK119352.1,INSD:BP668231.1,
FT                   INSD:EL075999.1,INSD:T04836.1,INSD:BG459603.1,
FT                   INSD:AU238185.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX815016.1,INSD:BX813700.1,INSD:BT005354.1,
FT                   INSD:AY456749.1,INSD:AK117346.1"
FT   CDS_pept        join(262950..262965,263047..263139,263232..263299,
FT                   263369..263444,263526..263572,263645..263770,
FT                   263857..263934,264073..264160,264280..264392,
FT                   264520..264582,264657..264712,264797..264901,
FT                   265021..265077,265336..265437,265578..265626,
FT                   265777..265845,265952..266029)
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.10"
FT                   /gene_synonym="T1N6.9"
FT                   /gene_synonym="T1N6_10"
FT                   /gene_synonym="T1N6_9"
FT                   /locus_tag="AT1G01710"
FT                   /product="acyl-CoA thioesterase II"
FT                   /note="Acyl-CoA thioesterase family protein; FUNCTIONS IN:
FT                   cyclic nucleotide binding, acyl-CoA thioesterase activity;
FT                   INVOLVED IN: acyl-CoA metabolic process; LOCATED IN:
FT                   peroxisome; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Cyclic nucleotide-binding (InterPro:IPR000595), Cyclic
FT                   nucleotide-binding-like (InterPro:IPR018490), Acyl-CoA
FT                   thioesterase (InterPro:IPR003703), RmlC-like jelly roll
FT                   fold (InterPro:IPR014710); BEST Arabidopsis thaliana
FT                   protein match is: Acyl-CoA thioesterase family protein
FT                   (TAIR:AT4G00520.2); Has 3628 Blast hits to 3595 proteins in
FT                   999 species: Archae - 0; Bacteria - 1940; Metazoa - 444;
FT                   Fungi - 348; Plants - 71; Viruses - 0; Other Eukaryotes -
FT                   825 (source: NCBI BLink)."
FT                   /db_xref="GOA:F4HU51"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:F4HU51"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI999643.1,INSD:EL999442.1,INSD:BX834655.1,
FT                   INSD:BP793073.1,INSD:ES130840.1,INSD:ES103540.1,
FT                   INSD:ES175377.1,INSD:DR364231.1,INSD:AV535337.1,
FT                   INSD:EL182964.1,INSD:AU229328.1,INSD:ES016080.1,
FT                   INSD:CB254939.1,INSD:ES133967.1,INSD:DR362539.1,
FT                   INSD:BP840016.1,INSD:ES193219.1,INSD:ES009569.1,
FT                   INSD:EL009583.1,INSD:AV531734.1,INSD:BP852458.1,
FT                   INSD:ES168165.1,INSD:ES041687.1,INSD:BX837773.1,
FT                   INSD:BX837564.1,INSD:CK119352.1,INSD:BP668231.1,
FT                   INSD:EL075999.1,INSD:T04836.1,INSD:BG459603.1,
FT                   INSD:AU238185.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX815016.1,INSD:BX813700.1,INSD:BT005354.1,
FT                   INSD:AY456749.1,INSD:AK117346.1"
FT                   /protein_id="AEE27325.1"
FT                   /translation="MNTESVVEFLGNVPLLQKLPSSSLKKIAQVVVPKRYGKGDYVVRE
FT                   DQTWDGCYFILQGEAQVSGPDEEDNRSEFLLKQYDYFGVGLSGNVHSADIVAMSQLTCL
FT                   VLPRDHCHLLETNSIWQSDTSLDKCSLVERILQLDPLELNIFRGITLPDAPIFGKVFGG
FT                   QFVGQALAAASKTVDFLKVVHSLHSYFLLVGDIDIPIIYQVHRIRDGNNFATRRVDAVQ
FT                   KGNIIFILLASFQKEQQGFEHQESTMPSVPDPDTLLSLEELRESRITDPHLPRSYRNKV
FT                   ATRNFVPWPIEIRFCEPSNSTNQTKSPPRLNYWFRAKGRLSDDQALHRCVVAFASDLIF
FT                   CGVGLNPHRRKGVKSAALSLDHAMWFHRPLRADEWLLYVIVSPTAHETRGFVTGQMFNR
FT                   KGELVVSLTQEALLREARPPKPSGTSKL"
FT   gene            266333..267883
FT                   /locus_tag="AT1G01715"
FT   mRNA            join(266333..266724,267293..267577,267677..267883)
FT                   /locus_tag="AT1G01715"
FT                   /product="hypothetical protein"
FT   mRNA            join(266342..266724,267293..267533)
FT                   /locus_tag="AT1G01715"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(266517..266724,267293..267504)
FT                   /codon_start=1
FT                   /locus_tag="AT1G01715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AM80"
FT                   /protein_id="ANM57726.1"
FT                   /translation="MAFEHRNEDLNSLDSEEDLEKMESEVEQMSRKVSEYRKSLPSNLS
FT                   NSVISSRRSNFPNIDSLGFRTTSTALVSRDGAHIGGIEQESRDSLIQLKERVYENIATV
FT                   PLVVERMRESKERIDKSISFNGTTMHPAFTRRKAS"
FT   CDS_pept        join(266517..266724,267293..267504)
FT                   /codon_start=1
FT                   /locus_tag="AT1G01715"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AM80"
FT                   /protein_id="ANM57727.1"
FT                   /translation="MAFEHRNEDLNSLDSEEDLEKMESEVEQMSRKVSEYRKSLPSNLS
FT                   NSVISSRRSNFPNIDSLGFRTTSTALVSRDGAHIGGIEQESRDSLIQLKERVYENIATV
FT                   PLVVERMRESKERIDKSISFNGTTMHPAFTRRKAS"
FT   gene            267993..269819
FT                   /gene="ATAF1"
FT                   /gene_synonym="ANAC002"
FT                   /gene_synonym="ANAC2"
FT                   /gene_synonym="Arabidopsis NAC domain containing protein 2"
FT                   /gene_synonym="T1N6.12"
FT                   /gene_synonym="T1N6_12"
FT                   /locus_tag="AT1G01720"
FT                   /note="Belongs to a large family of putative
FT                   transcriptional activators with NAC domain. Transcript
FT                   level increases in response to wounding and abscisic acid.
FT                   ATAF1 attentuates ABA signaling and sythesis. Mutants are
FT                   hyposensitive to ABA."
FT   mRNA            join(267993..268630,268717..268994,269083..269819)
FT                   /gene="ATAF1"
FT                   /gene_synonym="ANAC002"
FT                   /gene_synonym="ANAC2"
FT                   /gene_synonym="Arabidopsis NAC domain containing protein 2"
FT                   /gene_synonym="T1N6.12"
FT                   /gene_synonym="T1N6_12"
FT                   /locus_tag="AT1G01720"
FT                   /product="NAC (No Apical Meristem) domain transcriptional
FT                   regulator superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP840739.1,INSD:BP671435.1,INSD:EH901918.1,
FT                   INSD:BP646569.1,INSD:BP828136.1,INSD:BP836712.1,
FT                   INSD:AV784444.1,INSD:BP669918.1,INSD:AV790061.1,
FT                   INSD:CD532989.1,INSD:EG490319.1,INSD:AV788807.1,
FT                   INSD:AV818022.1,INSD:BP811221.1,INSD:BP792889.1,
FT                   INSD:EG484517.1,INSD:BE527367.1,INSD:BP652100.1,
FT                   INSD:ES213177.1,INSD:DR266607.1,INSD:BP839425.1,
FT                   INSD:EG490317.1,INSD:EG490321.1,INSD:BP574243.1,
FT                   INSD:BP614748.1,INSD:BP658342.1,INSD:BP651854.1,
FT                   INSD:BP865047.1,INSD:DR750993.1,INSD:BP567417.1,
FT                   INSD:CB264696.1,INSD:BP832338.1,INSD:BP652509.1,
FT                   INSD:ES102302.1,INSD:EG441564.1,INSD:AI100172.1,
FT                   INSD:DR266604.1,INSD:EG484515.1,INSD:BP819279.1,
FT                   INSD:CB259118.1,INSD:DR373284.1,INSD:DR266606.1,
FT                   INSD:BP824772.1,INSD:EL041370.1,INSD:CB258738.1,
FT                   INSD:AV788365.1,INSD:BP833850.1,INSD:BP564406.1,
FT                   INSD:DR380186.1,INSD:EG490322.1,INSD:BP644294.1,
FT                   INSD:BE520586.1,INSD:ES103653.1,INSD:EL261842.1,
FT                   INSD:BE038340.1,INSD:BP814330.1,INSD:EG484509.1,
FT                   INSD:BP664296.1,INSD:EG450313.1,INSD:EH964124.1,
FT                   INSD:DR266611.1,INSD:BP656185.1,INSD:EG450315.1,
FT                   INSD:ES113729.1,INSD:BP647420.1,INSD:BP830370.1,
FT                   INSD:BP817398.1,INSD:BP655475.1,INSD:EL330229.1,
FT                   INSD:EL137838.1,INSD:BP596668.1,INSD:EG455808.1,
FT                   INSD:AV825267.1,INSD:BP829737.1,INSD:BP560502.1,
FT                   INSD:BP792761.1,INSD:BP661971.1,INSD:BP638831.1,
FT                   INSD:AV790807.1,INSD:ES061973.1,INSD:AV781656.1,
FT                   INSD:BP837492.1,INSD:EG476789.1,INSD:EL093990.1,
FT                   INSD:BP651288.1,INSD:BP831289.1,INSD:AI996805.1,
FT                   INSD:AV786733.1,INSD:DR750994.1,INSD:BP831583.1,
FT                   INSD:BP654197.1,INSD:EG486149.1,INSD:DR266605.1,
FT                   INSD:AV784749.1,INSD:BP597628.1,INSD:EL175504.1,
FT                   INSD:BP656998.1,INSD:EG484491.1,INSD:DR216921.1,
FT                   INSD:EH914063.1,INSD:BP619669.1,INSD:DR370900.1,
FT                   INSD:ES103616.1,INSD:ES067142.1,INSD:DR266602.1,
FT                   INSD:CF773317.1,INSD:DR266603.1,INSD:BE520587.1,
FT                   INSD:ES159033.1,INSD:EG476785.1,INSD:EL088657.1,
FT                   INSD:BP647265.1,INSD:ES107628.1,INSD:BP648369.1,
FT                   INSD:EL080184.1,INSD:BP561074.1,INSD:BP619744.1,
FT                   INSD:BP820853.1,INSD:ES137526.1,INSD:BP651985.1,
FT                   INSD:BP785895.1,INSD:BP833732.1,INSD:DR266609.1,
FT                   INSD:AV803203.1,INSD:CF773707.1,INSD:EG500731.1,
FT                   INSD:DR266610.1,INSD:EG484492.1,INSD:BP836642.1,
FT                   INSD:EG484510.1,INSD:BP804455.1,INSD:DR266608.1,
FT                   INSD:BP648571.1,INSD:DR214509.1,INSD:ES140865.1,
FT                   INSD:EG484514.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY086063.1,INSD:BX841823.1,INSD:BT024513.1,
FT                   INSD:AF370617.1,INSD:BX815579.1,INSD:AY050799.1,
FT                   INSD:BX814879.1,INSD:X74755.1"
FT   gene            complement(267993..268336)
FT                   /locus_tag="AT1G04043"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT1G01720"
FT   ncRNA           complement(267993..268336)
FT                   /locus_tag="AT1G04043"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   CDS_pept        join(268471..268630,268717..268994,269083..269514)
FT                   /codon_start=1
FT                   /gene="ATAF1"
FT                   /gene_synonym="ANAC002"
FT                   /gene_synonym="Arabidopsis NAC domain containing protein 2"
FT                   /gene_synonym="T1N6.12"
FT                   /gene_synonym="T1N6_12"
FT                   /gene_synonym="ANAC2"
FT                   /locus_tag="AT1G01720"
FT                   /product="NAC (No Apical Meristem) domain transcriptional
FT                   regulator superfamily protein"
FT                   /note="ATAF1; CONTAINS InterPro DOMAIN/s: No apical
FT                   meristem (NAM) protein (InterPro:IPR003441); BEST
FT                   Arabidopsis thaliana protein match is: NAC domain
FT                   containing protein 32 (TAIR:AT1G77450.1); Has 3043 Blast
FT                   hits to 3037 proteins in 75 species: Archae - 0; Bacteria -
FT                   0; Metazoa - 0; Fungi - 0; Plants - 3043; Viruses - 0;
FT                   Other Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q39013"
FT                   /db_xref="InterPro:IPR003441"
FT                   /db_xref="InterPro:IPR036093"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39013"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP840739.1,INSD:BP671435.1,INSD:EH901918.1,
FT                   INSD:BP646569.1,INSD:BP828136.1,INSD:BP836712.1,
FT                   INSD:AV784444.1,INSD:BP669918.1,INSD:AV790061.1,
FT                   INSD:CD532989.1,INSD:EG490319.1,INSD:AV788807.1,
FT                   INSD:AV818022.1,INSD:BP811221.1,INSD:BP792889.1,
FT                   INSD:EG484517.1,INSD:BE527367.1,INSD:BP652100.1,
FT                   INSD:ES213177.1,INSD:DR266607.1,INSD:BP839425.1,
FT                   INSD:EG490317.1,INSD:EG490321.1,INSD:BP574243.1,
FT                   INSD:BP614748.1,INSD:BP658342.1,INSD:BP651854.1,
FT                   INSD:BP865047.1,INSD:DR750993.1,INSD:BP567417.1,
FT                   INSD:CB264696.1,INSD:BP832338.1,INSD:BP652509.1,
FT                   INSD:ES102302.1,INSD:EG441564.1,INSD:AI100172.1,
FT                   INSD:DR266604.1,INSD:EG484515.1,INSD:BP819279.1,
FT                   INSD:CB259118.1,INSD:DR373284.1,INSD:DR266606.1,
FT                   INSD:BP824772.1,INSD:EL041370.1,INSD:CB258738.1,
FT                   INSD:AV788365.1,INSD:BP833850.1,INSD:BP564406.1,
FT                   INSD:DR380186.1,INSD:EG490322.1,INSD:BP644294.1,
FT                   INSD:BE520586.1,INSD:ES103653.1,INSD:EL261842.1,
FT                   INSD:BE038340.1,INSD:BP814330.1,INSD:EG484509.1,
FT                   INSD:BP664296.1,INSD:EG450313.1,INSD:EH964124.1,
FT                   INSD:DR266611.1,INSD:BP656185.1,INSD:EG450315.1,
FT                   INSD:ES113729.1,INSD:BP647420.1,INSD:BP830370.1,
FT                   INSD:BP817398.1,INSD:BP655475.1,INSD:EL330229.1,
FT                   INSD:EL137838.1,INSD:BP596668.1,INSD:EG455808.1,
FT                   INSD:AV825267.1,INSD:BP829737.1,INSD:BP560502.1,
FT                   INSD:BP792761.1,INSD:BP661971.1,INSD:BP638831.1,
FT                   INSD:AV790807.1,INSD:ES061973.1,INSD:AV781656.1,
FT                   INSD:BP837492.1,INSD:EG476789.1,INSD:EL093990.1,
FT                   INSD:BP651288.1,INSD:BP831289.1,INSD:AI996805.1,
FT                   INSD:AV786733.1,INSD:DR750994.1,INSD:BP831583.1,
FT                   INSD:BP654197.1,INSD:EG486149.1,INSD:DR266605.1,
FT                   INSD:AV784749.1,INSD:BP597628.1,INSD:EL175504.1,
FT                   INSD:BP656998.1,INSD:EG484491.1,INSD:DR216921.1,
FT                   INSD:EH914063.1,INSD:BP619669.1,INSD:DR370900.1,
FT                   INSD:ES103616.1,INSD:ES067142.1,INSD:DR266602.1,
FT                   INSD:CF773317.1,INSD:DR266603.1,INSD:BE520587.1,
FT                   INSD:ES159033.1,INSD:EG476785.1,INSD:EL088657.1,
FT                   INSD:BP647265.1,INSD:ES107628.1,INSD:BP648369.1,
FT                   INSD:EL080184.1,INSD:BP561074.1,INSD:BP619744.1,
FT                   INSD:BP820853.1,INSD:ES137526.1,INSD:BP651985.1,
FT                   INSD:BP785895.1,INSD:BP833732.1,INSD:DR266609.1,
FT                   INSD:AV803203.1,INSD:CF773707.1,INSD:EG500731.1,
FT                   INSD:DR266610.1,INSD:EG484492.1,INSD:BP836642.1,
FT                   INSD:EG484510.1,INSD:BP804455.1,INSD:DR266608.1,
FT                   INSD:BP648571.1,INSD:DR214509.1,INSD:ES140865.1,
FT                   INSD:EG484514.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY086063.1,INSD:BX841823.1,INSD:BT024513.1,
FT                   INSD:AF370617.1,INSD:BX815579.1,INSD:AY050799.1,
FT                   INSD:BX814879.1,INSD:X74755.1"
FT                   /protein_id="AEE27326.1"
FT                   /translation="MSELLQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDLY
FT                   KYDPWELPGLALYGEKEWYFFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGLPKPVG
FT                   IKKALVFYAGKAPKGEKTNWIMHEYRLADVDRSVRKKKNSLRLDDWVLCRIYNKKGATE
FT                   RRGPPPPVVYGDEIMEEKPKVTEMVMPPPPQQTSEFAYFDTSDSVPKLHTTDSSCSEQV
FT                   VSPEFTSEVQSEPKWKDWSAVSNDNNNTLDFGFNYIDATVDNAFGGGGSSNQMFPLQDM
FT                   FMYMQKPY"
FT   gene            complement(269792..270859)
FT                   /locus_tag="AT1G01725"
FT   mRNA            complement(join(269792..270090,270622..270859))
FT                   /locus_tag="AT1G01725"
FT                   /product="adenylosuccinate synthetase"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CF773646.1,INSD:BP652509.1,INSD:BE520587.1,
FT                   INSD:BP655475.1,INSD:BP596668.1,INSD:EG455808.1,
FT                   INSD:EL060569.1,INSD:AI100172.1,INSD:AI995757.1,
FT                   INSD:AV784444.1,INSD:AV790061.1,INSD:EG476785.1,
FT                   INSD:DR373284.1,INSD:BP565383.1,INSD:BP661971.1,
FT                   INSD:CD532989.1,INSD:BP638831.1,INSD:BP648369.1,
FT                   INSD:AV788807.1,INSD:AV781656.1,INSD:AV788365.1,
FT                   INSD:BP619744.1,INSD:BP792889.1,INSD:EL337465.1,
FT                   INSD:ES201760.1,INSD:AV786733.1,INSD:BP564406.1,
FT                   INSD:BP785895.1,INSD:AV803203.1,INSD:EL292039.1,
FT                   INSD:BP614748.1,INSD:BP574243.1,INSD:BP597628.1,
FT                   INSD:AV784749.1,INSD:EG500731.1,INSD:EG433097.1,
FT                   INSD:BP664296.1,INSD:BP619669.1,INSD:BP567417.1,
FT                   INSD:DR370900.1,INSD:BP656185.1,INSD:BP648571.1,
FT                   INSD:ES103616.1,INSD:EG450315.1,INSD:BP647420.1,
FT                   INSD:DR214509.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF332440.1,INSD:AY088343.1"
FT   CDS_pept        complement(join(270016..270090,270622..270735))
FT                   /codon_start=1
FT                   /locus_tag="AT1G01725"
FT                   /product="adenylosuccinate synthetase"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: endomembrane system; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 14 growth stages; BEST Arabidopsis
FT                   thaliana protein match is: unknown protein
FT                   (TAIR:AT4G00530.1); Has 20 Blast hits to 20 proteins in 7
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 20; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01725.1"
FT                   /db_xref="GOA:Q9LQ84"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LQ84"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CF773646.1,INSD:BP652509.1,INSD:BE520587.1,
FT                   INSD:BP655475.1,INSD:BP596668.1,INSD:EG455808.1,
FT                   INSD:EL060569.1,INSD:AI100172.1,INSD:AI995757.1,
FT                   INSD:AV784444.1,INSD:AV790061.1,INSD:EG476785.1,
FT                   INSD:DR373284.1,INSD:BP565383.1,INSD:BP661971.1,
FT                   INSD:CD532989.1,INSD:BP638831.1,INSD:BP648369.1,
FT                   INSD:AV788807.1,INSD:AV781656.1,INSD:AV788365.1,
FT                   INSD:BP619744.1,INSD:BP792889.1,INSD:EL337465.1,
FT                   INSD:ES201760.1,INSD:AV786733.1,INSD:BP564406.1,
FT                   INSD:BP785895.1,INSD:AV803203.1,INSD:EL292039.1,
FT                   INSD:BP614748.1,INSD:BP574243.1,INSD:BP597628.1,
FT                   INSD:AV784749.1,INSD:EG500731.1,INSD:EG433097.1,
FT                   INSD:BP664296.1,INSD:BP619669.1,INSD:BP567417.1,
FT                   INSD:DR370900.1,INSD:BP656185.1,INSD:BP648571.1,
FT                   INSD:ES103616.1,INSD:EG450315.1,INSD:BP647420.1,
FT                   INSD:DR214509.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF332440.1,INSD:AY088343.1"
FT                   /protein_id="AEE27327.1"
FT                   /translation="MNPQIEKVVKVTSVVATAVVSYFLLTADYGPEPNALDPIRQRILS
FT                   AQDSVKEFIFPSKKSDK"
FT   gene            270067..270517
FT                   /locus_tag="AT1G04047"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT1G01725"
FT   ncRNA           270067..270517
FT                   /locus_tag="AT1G04047"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            270797..272189
FT                   /gene_synonym="T1N6.14"
FT                   /gene_synonym="T1N6_14"
FT                   /locus_tag="AT1G01730"
FT   mRNA            join(270797..271289,271379..271433,271541..272189)
FT                   /gene_synonym="T1N6.14"
FT                   /gene_synonym="T1N6_14"
FT                   /locus_tag="AT1G01730"
FT                   /product="hypothetical protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL226774.1,INSD:EL023356.1,INSD:BP591834.1,
FT                   INSD:BP577615.1,INSD:BP629926.1,INSD:BP623394.1,
FT                   INSD:ES094531.1,INSD:EG515599.1,INSD:DR378576.1,
FT                   INSD:AV824878.1,INSD:BP587990.1,INSD:DR213419.1,
FT                   INSD:AI997176.1,INSD:EH795613.1,INSD:CB255965.1,
FT                   INSD:BP581641.1,INSD:DR213418.1,INSD:EL175126.1,
FT                   INSD:BP568738.1,INSD:EL974463.1,INSD:ES030186.1,
FT                   INSD:AV788295.1,INSD:Z29911.1,INSD:BP578018.1,
FT                   INSD:ES190486.1,INSD:BE527683.1,INSD:BP834416.1,
FT                   INSD:BP633430.1,INSD:EH957267.1,INSD:EL086218.1,
FT                   INSD:EL168249.1,INSD:EL239164.1,INSD:BP567743.1,
FT                   INSD:BP629365.1,INSD:BP601600.1,INSD:BP649564.1,
FT                   INSD:BX838431.1,INSD:DR254144.1,INSD:EL115030.1,
FT                   INSD:EG482190.1,INSD:EL030915.1,INSD:BP640628.1,
FT                   INSD:ES138912.1,INSD:EG515598.1,INSD:BP645386.1,
FT                   INSD:ES138880.1,INSD:AA395420.1,INSD:BP665977.1,
FT                   INSD:BE530272.1,INSD:ES129680.1,INSD:DR213420.1,
FT                   INSD:BE530102.1,INSD:EL258478.1,INSD:EL240833.1,
FT                   INSD:DR370552.1,INSD:EH800402.1,INSD:Z27282.1,
FT                   INSD:BP803441.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY089105.1,INSD:AY065416.1,INSD:BX818113.1,
FT                   INSD:AF334726.1"
FT   CDS_pept        join(271002..271289,271379..271433,271541..271872)
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.14"
FT                   /gene_synonym="T1N6_14"
FT                   /locus_tag="AT1G01730"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: chloroplast; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; Has 42 Blast hits to 42
FT                   proteins in 17 species: Archae - 0; Bacteria - 2; Metazoa -
FT                   5; Fungi - 1; Plants - 34; Viruses - 0; Other Eukaryotes -
FT                   0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01730.1"
FT                   /db_xref="GOA:Q9LQ83"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LQ83"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL226774.1,INSD:EL023356.1,INSD:BP591834.1,
FT                   INSD:BP577615.1,INSD:BP629926.1,INSD:BP623394.1,
FT                   INSD:ES094531.1,INSD:EG515599.1,INSD:DR378576.1,
FT                   INSD:AV824878.1,INSD:BP587990.1,INSD:DR213419.1,
FT                   INSD:AI997176.1,INSD:EH795613.1,INSD:CB255965.1,
FT                   INSD:BP581641.1,INSD:DR213418.1,INSD:EL175126.1,
FT                   INSD:BP568738.1,INSD:EL974463.1,INSD:ES030186.1,
FT                   INSD:AV788295.1,INSD:Z29911.1,INSD:BP578018.1,
FT                   INSD:ES190486.1,INSD:BE527683.1,INSD:BP834416.1,
FT                   INSD:BP633430.1,INSD:EH957267.1,INSD:EL086218.1,
FT                   INSD:EL168249.1,INSD:EL239164.1,INSD:BP567743.1,
FT                   INSD:BP629365.1,INSD:BP601600.1,INSD:BP649564.1,
FT                   INSD:BX838431.1,INSD:DR254144.1,INSD:EL115030.1,
FT                   INSD:EG482190.1,INSD:EL030915.1,INSD:BP640628.1,
FT                   INSD:ES138912.1,INSD:EG515598.1,INSD:BP645386.1,
FT                   INSD:ES138880.1,INSD:AA395420.1,INSD:BP665977.1,
FT                   INSD:BE530272.1,INSD:ES129680.1,INSD:DR213420.1,
FT                   INSD:BE530102.1,INSD:EL258478.1,INSD:EL240833.1,
FT                   INSD:DR370552.1,INSD:EH800402.1,INSD:Z27282.1,
FT                   INSD:BP803441.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY089105.1,INSD:AY065416.1,INSD:BX818113.1,
FT                   INSD:AF334726.1"
FT                   /protein_id="AEE27328.1"
FT                   /translation="MEKSTSPATRVTEPPPAATSSLPAQAPPLPTSADQRSAELPSPAQ
FT                   PAQMTAPPSTVTTDPSSRGRKRALEANLQIESSNYYKMRLLVKDLRPHVLEVLRTPDLR
FT                   NSKAVIEIQEKMKLMLQLYEEMIGESPKREKTAKSDSLSNGKATTTTTTTTSVLRSSET
FT                   EKHSSDGDGDKVVGGSAFGWNFITSGGPGTEPVYSGMSKEEYRSSHPIMQVEAELELPN
FT                   TF"
FT   gene            complement(272111..274930)
FT                   /gene="BSK4"
FT                   /gene_synonym="brassinosteroid-signaling kinase 4"
FT                   /gene_synonym="T1N6.15"
FT                   /gene_synonym="T1N6_15"
FT                   /locus_tag="AT1G01740"
FT   mRNA            complement(join(272111..272362,272445..272555,
FT                   272651..272983,273064..273149,273234..273339,
FT                   273429..273562,273653..273788,273863..274083,
FT                   274171..274289,274384..274930))
FT                   /gene="BSK4"
FT                   /gene_synonym="brassinosteroid-signaling kinase 4"
FT                   /gene_synonym="T1N6.15"
FT                   /gene_synonym="T1N6_15"
FT                   /locus_tag="AT1G01740"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT   mRNA            complement(join(272111..272362,272445..272555,
FT                   272651..272983,273064..273149,273234..273339,
FT                   273429..273562,273653..273788,273863..274083,
FT                   274167..274289,274384..274792))
FT                   /gene="BSK4"
FT                   /gene_synonym="brassinosteroid-signaling kinase 4"
FT                   /gene_synonym="T1N6.15"
FT                   /gene_synonym="T1N6_15"
FT                   /locus_tag="AT1G01740"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT   mRNA            complement(join(272111..272362,272445..272555,
FT                   272651..272983,273064..273149,273234..273339,
FT                   273429..273562,273653..273788,273863..274083,
FT                   274171..274249,274384..274569))
FT                   /gene="BSK4"
FT                   /gene_synonym="brassinosteroid-signaling kinase 4"
FT                   /gene_synonym="T1N6.15"
FT                   /gene_synonym="T1N6_15"
FT                   /locus_tag="AT1G01740"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT   mRNA            complement(join(272111..272362,272445..272531,
FT                   272651..272983,273064..273149,273234..273339,
FT                   273429..273562,273653..273788,273863..274083,
FT                   274167..274249,274384..274569))
FT                   /gene="BSK4"
FT                   /gene_synonym="brassinosteroid-signaling kinase 4"
FT                   /gene_synonym="T1N6.15"
FT                   /gene_synonym="T1N6_15"
FT                   /locus_tag="AT1G01740"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT   mRNA            complement(join(272111..272362,272445..272555,
FT                   272651..272983,273064..273149,273234..273339,
FT                   273429..273562,273653..273788,273863..274083,
FT                   274167..274249,274384..274569))
FT                   /gene="BSK4"
FT                   /gene_synonym="T1N6.15"
FT                   /gene_synonym="T1N6_15"
FT                   /gene_synonym="brassinosteroid-signaling kinase 4"
FT                   /locus_tag="AT1G01740"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT   CDS_pept        complement(join(272111..272362,272445..272531,
FT                   272651..272983,273064..273149,273234..273339,
FT                   273429..273562,273653..273788,273863..274083,
FT                   274167..274239))
FT                   /codon_start=1
FT                   /gene="BSK4"
FT                   /gene_synonym="brassinosteroid-signaling kinase 4"
FT                   /gene_synonym="T1N6.15"
FT                   /gene_synonym="T1N6_15"
FT                   /locus_tag="AT1G01740"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01740"
FT                   /db_xref="GOA:A0A178WBE7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178WBE7"
FT                   /protein_id="ANM59848.1"
FT                   /translation="MGGQSSKIGTCCSHKTTALEAPDVENKENGEVNGVHSFREYSLEQ
FT                   LKIATSCFALENVVSEHGETAPNVVYQGKLENHMKIAIKRFSGTAWPDPRQFLEEARLV
FT                   GQLRSKRMANLLGYCCEGGERLLVAEFMPNETLAKHLFHWDTEPMKWAMRLRVALYISE
FT                   ALEYCSNNGHTLYHDLNAYRVLFDEECNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLR
FT                   TGRITAESVIYSFGTLLLDLLTGKHIPPSHALDLIRDRNLQTLTDSCLEGQFSDSDGTE
FT                   LVRLTSCCLQYEARERPNIKSLVTALISLQKDTEVLSHVLMGLPQSGTFASPPSPFAEA
FT                   CSGKDLTSMVEILEKIGYKDDEDMQEAINSKKKGDIAFRRKDFSEAIEFYTQFLDLGMI
FT                   SATVLVRRSQSYLMSNMAKEALDDAMKAQGISPVWYVALYLQSAALSVLGMEKESQIAL
FT                   TEGSILEARKISASTQN"
FT   CDS_pept        complement(join(272111..272362,272445..272555,
FT                   272651..272983,273064..273149,273234..273339,
FT                   273429..273562,273653..273788,273863..274083,
FT                   274167..274239))
FT                   /codon_start=1
FT                   /gene="BSK4"
FT                   /gene_synonym="T1N6.15"
FT                   /gene_synonym="T1N6_15"
FT                   /gene_synonym="brassinosteroid-signaling kinase 4"
FT                   /locus_tag="AT1G01740"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT                   /note="Protein kinase protein with tetratricopeptide repeat
FT                   domain; FUNCTIONS IN: protein serine/threonine kinase
FT                   activity, binding, protein kinase activity, kinase
FT                   activity, ATP binding; INVOLVED IN: protein amino acid
FT                   phosphorylation, N-terminal protein myristoylation; LOCATED
FT                   IN: plasma membrane; EXPRESSED IN: 22 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Tetratricopeptide-like helical
FT                   (InterPro:IPR011990), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290),
FT                   Serine-threonine/tyrosine-protein kinase
FT                   (InterPro:IPR001245), Tyrosine-protein kinase, catalytic
FT                   domain (InterPro:IPR020635), Protein kinase-like domain
FT                   (InterPro:IPR011009); BEST Arabidopsis thaliana protein
FT                   match is: BR-signaling kinase 3 (TAIR:AT4G00710.1); Has
FT                   33834 Blast hits to 33303 proteins in 1392 species: Archae
FT                   - 10; Bacteria - 2383; Metazoa - 7709; Fungi - 204; Plants
FT                   - 21978; Viruses - 102; Other Eukaryotes - 1448 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01740"
FT                   /db_xref="GOA:F4HU55"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4HU55"
FT                   /protein_id="AEE27329.1"
FT                   /translation="MGGQSSKIGTCCSHKTTALEAPDVENKENGEVNGVHSFREYSLEQ
FT                   LKIATSCFALENVVSEHGETAPNVVYQGKLENHMKIAIKRFSGTAWPDPRQFLEEARLV
FT                   GQLRSKRMANLLGYCCEGGERLLVAEFMPNETLAKHLFHWDTEPMKWAMRLRVALYISE
FT                   ALEYCSNNGHTLYHDLNAYRVLFDEECNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLR
FT                   TGRITAESVIYSFGTLLLDLLTGKHIPPSHALDLIRDRNLQTLTDSCLEGQFSDSDGTE
FT                   LVRLTSCCLQYEARERPNIKSLVTALISLQKDTEVLSHVLMGLPQSGTFASPPSPFAEA
FT                   CSGKDLTSMVEILEKIGYKDDEDLSFMWTEQMQEAINSKKKGDIAFRRKDFSEAIEFYT
FT                   QFLDLGMISATVLVRRSQSYLMSNMAKEALDDAMKAQGISPVWYVALYLQSAALSVLGM
FT                   EKESQIALTEGSILEARKISASTQN"
FT   CDS_pept        complement(join(272111..272362,272445..272555,
FT                   272651..272983,273064..273149,273234..273339,
FT                   273429..273562,273653..273788,273863..274083,
FT                   274167..274239))
FT                   /codon_start=1
FT                   /gene="BSK4"
FT                   /gene_synonym="T1N6.15"
FT                   /gene_synonym="T1N6_15"
FT                   /gene_synonym="brassinosteroid-signaling kinase 4"
FT                   /locus_tag="AT1G01740"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT                   /note="Protein kinase protein with tetratricopeptide repeat
FT                   domain; FUNCTIONS IN: protein serine/threonine kinase
FT                   activity, binding, protein kinase activity, kinase
FT                   activity, ATP binding; INVOLVED IN: protein amino acid
FT                   phosphorylation; EXPRESSED IN: 22 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Tetratricopeptide-like helical
FT                   (InterPro:IPR011990), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), Tyrosine-protein kinase,
FT                   catalytic domain (InterPro:IPR020635),
FT                   Serine-threonine/tyrosine-protein kinase
FT                   (InterPro:IPR001245), Protein kinase-like domain
FT                   (InterPro:IPR011009); BEST Arabidopsis thaliana protein
FT                   match is: BR-signaling kinase 3 (TAIR:AT4G00710.1)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01740.1"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01740.2"
FT                   /db_xref="GOA:F4HU55"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4HU55"
FT                   /protein_id="AEE27330.1"
FT                   /translation="MGGQSSKIGTCCSHKTTALEAPDVENKENGEVNGVHSFREYSLEQ
FT                   LKIATSCFALENVVSEHGETAPNVVYQGKLENHMKIAIKRFSGTAWPDPRQFLEEARLV
FT                   GQLRSKRMANLLGYCCEGGERLLVAEFMPNETLAKHLFHWDTEPMKWAMRLRVALYISE
FT                   ALEYCSNNGHTLYHDLNAYRVLFDEECNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLR
FT                   TGRITAESVIYSFGTLLLDLLTGKHIPPSHALDLIRDRNLQTLTDSCLEGQFSDSDGTE
FT                   LVRLTSCCLQYEARERPNIKSLVTALISLQKDTEVLSHVLMGLPQSGTFASPPSPFAEA
FT                   CSGKDLTSMVEILEKIGYKDDEDLSFMWTEQMQEAINSKKKGDIAFRRKDFSEAIEFYT
FT                   QFLDLGMISATVLVRRSQSYLMSNMAKEALDDAMKAQGISPVWYVALYLQSAALSVLGM
FT                   EKESQIALTEGSILEARKISASTQN"
FT   CDS_pept        complement(join(272111..272362,272445..272555,
FT                   272651..272983,273064..273149,273234..273339,
FT                   273429..273562,273653..273788,273863..273922))
FT                   /codon_start=1
FT                   /gene="BSK4"
FT                   /gene_synonym="brassinosteroid-signaling kinase 4"
FT                   /gene_synonym="T1N6.15"
FT                   /gene_synonym="T1N6_15"
FT                   /locus_tag="AT1G01740"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT                   /db_xref="GOA:A0A1P8AT62"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AT62"
FT                   /protein_id="ANM59849.1"
FT                   /translation="MKIAIKRFSGTAWPDPRQFLEEARLVGQLRSKRMANLLGYCCEGG
FT                   ERLLVAEFMPNETLAKHLFHWDTEPMKWAMRLRVALYISEALEYCSNNGHTLYHDLNAY
FT                   RVLFDEECNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLRTGRITAESVIYSFGTLLLD
FT                   LLTGKHIPPSHALDLIRDRNLQTLTDSCLEGQFSDSDGTELVRLTSCCLQYEARERPNI
FT                   KSLVTALISLQKDTEVLSHVLMGLPQSGTFASPPSPFAEACSGKDLTSMVEILEKIGYK
FT                   DDEDLSFMWTEQMQEAINSKKKGDIAFRRKDFSEAIEFYTQFLDLGMISATVLVRRSQS
FT                   YLMSNMAKEALDDAMKAQGISPVWYVALYLQSAALSVLGMEKESQIALTEGSILEARKI
FT                   SASTQN"
FT   CDS_pept        complement(join(272111..272362,272445..272555,
FT                   272651..272983,273064..273149,273234..273339,
FT                   273429..273562,273653..273788,273863..273922))
FT                   /codon_start=1
FT                   /gene="BSK4"
FT                   /gene_synonym="brassinosteroid-signaling kinase 4"
FT                   /gene_synonym="T1N6.15"
FT                   /gene_synonym="T1N6_15"
FT                   /locus_tag="AT1G01740"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01740"
FT                   /db_xref="GOA:A0A1P8AT62"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AT62"
FT                   /protein_id="ANM59850.1"
FT                   /translation="MKIAIKRFSGTAWPDPRQFLEEARLVGQLRSKRMANLLGYCCEGG
FT                   ERLLVAEFMPNETLAKHLFHWDTEPMKWAMRLRVALYISEALEYCSNNGHTLYHDLNAY
FT                   RVLFDEECNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLRTGRITAESVIYSFGTLLLD
FT                   LLTGKHIPPSHALDLIRDRNLQTLTDSCLEGQFSDSDGTELVRLTSCCLQYEARERPNI
FT                   KSLVTALISLQKDTEVLSHVLMGLPQSGTFASPPSPFAEACSGKDLTSMVEILEKIGYK
FT                   DDEDLSFMWTEQMQEAINSKKKGDIAFRRKDFSEAIEFYTQFLDLGMISATVLVRRSQS
FT                   YLMSNMAKEALDDAMKAQGISPVWYVALYLQSAALSVLGMEKESQIALTEGSILEARKI
FT                   SASTQN"
FT   gene            275188..276310
FT                   /gene="ADF11"
FT                   /gene_synonym="actin depolymerizing factor 11"
FT                   /gene_synonym="T1N6.16"
FT                   /gene_synonym="T1N6_16"
FT                   /locus_tag="AT1G01750"
FT   mRNA            join(275188..275530,275632..275897,275973..276310)
FT                   /gene="ADF11"
FT                   /gene_synonym="actin depolymerizing factor 11"
FT                   /gene_synonym="T1N6.16"
FT                   /gene_synonym="T1N6_16"
FT                   /locus_tag="AT1G01750"
FT                   /product="actin depolymerizing factor 11"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR370049.1,INSD:AV810029.1,INSD:AV544501.1,
FT                   INSD:EL265206.1,INSD:BP569862.1,INSD:DR215176.1,
FT                   INSD:DR215175.1,INSD:BP802505.1,INSD:DR215177.1,
FT                   INSD:AA720247.1,INSD:ES112027.1,INSD:DR215174.1,
FT                   INSD:BP562206.2,INSD:BP798758.1,INSD:BP572423.1,
FT                   INSD:ES166501.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY088305.1,INSD:AY072410.1"
FT   mRNA            join(275331..275897,275973..276126)
FT                   /gene="ADF11"
FT                   /gene_synonym="actin depolymerizing factor 11"
FT                   /gene_synonym="T1N6.16"
FT                   /gene_synonym="T1N6_16"
FT                   /locus_tag="AT1G01750"
FT                   /product="actin depolymerizing factor 11"
FT   gene            complement(275473..276319)
FT                   /locus_tag="AT1G04053"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT1G01750"
FT   ncRNA           complement(join(275473..275977,276247..276319))
FT                   /locus_tag="AT1G04053"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   CDS_pept        join(275528..275530,275632..275897,275973..276126)
FT                   /codon_start=1
FT                   /gene="ADF11"
FT                   /gene_synonym="actin depolymerizing factor 11"
FT                   /gene_synonym="T1N6.16"
FT                   /gene_synonym="T1N6_16"
FT                   /locus_tag="AT1G01750"
FT                   /product="actin depolymerizing factor 11"
FT                   /note="actin depolymerizing factor 11 (ADF11); FUNCTIONS
FT                   IN: actin binding; INVOLVED IN: biological_process unknown;
FT                   LOCATED IN: intracellular; EXPRESSED IN: 6 plant
FT                   structures; EXPRESSED DURING: 4 anthesis, petal
FT                   differentiation and expansion stage; CONTAINS InterPro
FT                   DOMAIN/s: Actin-binding, cofilin/tropomyosin type
FT                   (InterPro:IPR002108); BEST Arabidopsis thaliana protein
FT                   match is: actin depolymerizing factor 8 (TAIR:AT4G00680.1);
FT                   Has 1654 Blast hits to 1631 proteins in 274 species: Archae
FT                   - 0; Bacteria - 5; Metazoa - 781; Fungi - 163; Plants -
FT                   515; Viruses - 0; Other Eukaryotes - 190 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01750"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01750.1"
FT                   /db_xref="GOA:Q9LQ81"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LQ81"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR370049.1,INSD:AV810029.1,INSD:AV544501.1,
FT                   INSD:EL265206.1,INSD:BP569862.1,INSD:DR215176.1,
FT                   INSD:DR215175.1,INSD:BP802505.1,INSD:DR215177.1,
FT                   INSD:AA720247.1,INSD:ES112027.1,INSD:DR215174.1,
FT                   INSD:BP562206.2,INSD:BP798758.1,INSD:BP572423.1,
FT                   INSD:ES166501.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY088305.1,INSD:AY072410.1"
FT                   /protein_id="AEE27331.1"
FT                   /translation="MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDK
FT                   LGNPEETYEDFTRSIPEDECRYAVYDYDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYA
FT                   SSKDRFKRELDGIQVELQATDPSEMSLDIIKGRVNL"
FT   CDS_pept        join(275614..275897,275973..276126)
FT                   /codon_start=1
FT                   /gene="ADF11"
FT                   /gene_synonym="actin depolymerizing factor 11"
FT                   /gene_synonym="T1N6.16"
FT                   /gene_synonym="T1N6_16"
FT                   /locus_tag="AT1G01750"
FT                   /product="actin depolymerizing factor 11"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01750"
FT                   /db_xref="GOA:A0A1P8AMT9"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AMT9"
FT                   /protein_id="ANM57970.1"
FT                   /translation="MCLTVQANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQ
FT                   VMIDKLGNPEETYEDFTRSIPEDECRYAVYDYDFTTPENCQKSKIFFIAWSPDTSRVRS
FT                   KMLYASSKDRFKRELDGIQVELQATDPSEMSLDIIKGRVNL"
FT   gene            complement(276266..278599)
FT                   /gene_synonym="AtTAD1"
FT                   /gene_synonym="ortholog of yeast Tad1"
FT                   /gene_synonym="T1N6.17"
FT                   /gene_synonym="T1N6_17"
FT                   /gene_synonym="TAD1"
FT                   /locus_tag="AT1G01760"
FT   mRNA            complement(join(276266..276307,276405..276519,
FT                   276706..276793,276870..276989,277077..277153,
FT                   277232..277401,277493..277606,277717..277863,
FT                   277947..278252,278316..278448))
FT                   /gene_synonym="T1N6.17"
FT                   /gene_synonym="T1N6_17"
FT                   /gene_synonym="AtTAD1"
FT                   /gene_synonym="ortholog of yeast Tad1"
FT                   /gene_synonym="TAD1"
FT                   /locus_tag="AT1G01760"
FT                   /product="denosine deaminases acting on tRNA"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG440303.1,INSD:EG440301.1"
FT   mRNA            complement(join(276368..276519,276623..276793,
FT                   276870..276989,277077..277153,277232..277401,
FT                   277493..277606,277717..277863,277947..278252,
FT                   278316..278599))
FT                   /gene_synonym="AtTAD1"
FT                   /gene_synonym="ortholog of yeast Tad1"
FT                   /gene_synonym="T1N6.17"
FT                   /gene_synonym="T1N6_17"
FT                   /gene_synonym="TAD1"
FT                   /locus_tag="AT1G01760"
FT                   /product="denosine deaminases acting on tRNA"
FT   mRNA            complement(join(276412..276519,276706..276793,
FT                   276870..276989,277077..277153,277232..277401,
FT                   277493..277606,277717..277863,277947..278252,
FT                   278316..278599))
FT                   /gene_synonym="AtTAD1"
FT                   /gene_synonym="ortholog of yeast Tad1"
FT                   /gene_synonym="T1N6.17"
FT                   /gene_synonym="T1N6_17"
FT                   /gene_synonym="TAD1"
FT                   /locus_tag="AT1G01760"
FT                   /product="denosine deaminases acting on tRNA"
FT   CDS_pept        complement(join(276412..276519,276706..276793,
FT                   276870..276989,277077..277153,277232..277401,
FT                   277493..277606,277717..277863,277947..278252,
FT                   278316..278487))
FT                   /codon_start=1
FT                   /gene_synonym="AtTAD1"
FT                   /gene_synonym="ortholog of yeast Tad1"
FT                   /gene_synonym="T1N6.17"
FT                   /gene_synonym="T1N6_17"
FT                   /gene_synonym="TAD1"
FT                   /locus_tag="AT1G01760"
FT                   /product="denosine deaminases acting on tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01760"
FT                   /db_xref="GOA:A0A178W782"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178W782"
FT                   /protein_id="ANM59690.1"
FT                   /translation="MNESTDLFVGIVAMEEDWGKTVSEKVISAYMSLPKKGKPQGREVT
FT                   VLSAFLVSSPSQDPKVIALGTGTKCVSGSLLSPRGDIVNDSHAEVVARRALIRFFYSEI
FT                   QRMQLTSGKSNEAKRQRIDSETSSILESADSSCPGEVKYKLKSGCLLHLYISQLPCGYA
FT                   STSSPLYALKKIPSTQVDDSLLVQASDICSSRHSDVPEIGSNSNKGNGSQVADMVQRKP
FT                   GRGETTLSVSCSDKIARWNVLGVQGALLYQVLQPVYISTITVGQSLHSPDNFSLADHLR
FT                   RSLYERILPLSDELLTSFRLNKPLFFVAPVPPSEFQHSETAQATLTCGYSLCWNYSGLH
FT                   EVILGTTGRKQGTSAKGALYPSTQSSICKQRLLELFLKETHGHKRESSKSKKSYRELKN
FT                   KATEYYLMSKIFKGKYPFNNWLRKPLNCEDFLIN"
FT   mRNA            complement(join(276412..276519,276706..276793,
FT                   276870..276989,277077..277153,277232..277401,
FT                   277493..277606,277717..277863,277947..278252,
FT                   278316..278448))
FT                   /gene_synonym="AtTAD1"
FT                   /gene_synonym="ortholog of yeast Tad1"
FT                   /gene_synonym="T1N6.17"
FT                   /gene_synonym="T1N6_17"
FT                   /gene_synonym="TAD1"
FT                   /locus_tag="AT1G01760"
FT                   /product="denosine deaminases acting on tRNA"
FT   CDS_pept        complement(join(276412..276519,276706..276793,
FT                   276870..276989,277077..277153,277232..277401,
FT                   277493..277606,277717..277863,277947..278252,
FT                   278316..278448))
FT                   /codon_start=1
FT                   /gene_synonym="AtTAD1"
FT                   /gene_synonym="ortholog of yeast Tad1"
FT                   /gene_synonym="T1N6.17"
FT                   /gene_synonym="T1N6_17"
FT                   /gene_synonym="TAD1"
FT                   /locus_tag="AT1G01760"
FT                   /product="denosine deaminases acting on tRNA"
FT                   /db_xref="GOA:F4HU58"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4HU58"
FT                   /protein_id="ANM59691.1"
FT                   /translation="MEEDWGKTVSEKVISAYMSLPKKGKPQGREVTVLSAFLVSSPSQD
FT                   PKVIALGTGTKCVSGSLLSPRGDIVNDSHAEVVARRALIRFFYSEIQRMQLTSGKSNEA
FT                   KRQRIDSETSSILESADSSCPGEVKYKLKSGCLLHLYISQLPCGYASTSSPLYALKKIP
FT                   STQVDDSLLVQASDICSSRHSDVPEIGSNSNKGNGSQVADMVQRKPGRGETTLSVSCSD
FT                   KIARWNVLGVQGALLYQVLQPVYISTITVGQSLHSPDNFSLADHLRRSLYERILPLSDE
FT                   LLTSFRLNKPLFFVAPVPPSEFQHSETAQATLTCGYSLCWNYSGLHEVILGTTGRKQGT
FT                   SAKGALYPSTQSSICKQRLLELFLKETHGHKRESSKSKKSYRELKNKATEYYLMSKIFK
FT                   GKYPFNNWLRKPLNCEDFLIN"
FT   CDS_pept        complement(join(276412..276519,276706..276793,
FT                   276870..276989,277077..277153,277232..277401,
FT                   277493..277606,277717..277863,277947..278252,
FT                   278316..278448))
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.17"
FT                   /gene_synonym="T1N6_17"
FT                   /gene_synonym="AtTAD1"
FT                   /gene_synonym="ortholog of yeast Tad1"
FT                   /gene_synonym="TAD1"
FT                   /locus_tag="AT1G01760"
FT                   /product="denosine deaminases acting on tRNA"
FT                   /note="adenosine deaminases;RNA binding;RNA
FT                   binding;adenosine deaminases; FUNCTIONS IN: RNA binding,
FT                   adenosine deaminase activity; INVOLVED IN: RNA processing;
FT                   LOCATED IN: cellular_component unknown; CONTAINS InterPro
FT                   DOMAIN/s: Adenosine deaminase/editase (InterPro:IPR002466);
FT                   Has 30201 Blast hits to 17322 proteins in 780 species:
FT                   Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi -
FT                   3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01760"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01760.1"
FT                   /db_xref="GOA:F4HU58"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4HU58"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG440303.1,INSD:EG440301.1"
FT                   /protein_id="AEE27332.1"
FT                   /translation="MEEDWGKTVSEKVISAYMSLPKKGKPQGREVTVLSAFLVSSPSQD
FT                   PKVIALGTGTKCVSGSLLSPRGDIVNDSHAEVVARRALIRFFYSEIQRMQLTSGKSNEA
FT                   KRQRIDSETSSILESADSSCPGEVKYKLKSGCLLHLYISQLPCGYASTSSPLYALKKIP
FT                   STQVDDSLLVQASDICSSRHSDVPEIGSNSNKGNGSQVADMVQRKPGRGETTLSVSCSD
FT                   KIARWNVLGVQGALLYQVLQPVYISTITVGQSLHSPDNFSLADHLRRSLYERILPLSDE
FT                   LLTSFRLNKPLFFVAPVPPSEFQHSETAQATLTCGYSLCWNYSGLHEVILGTTGRKQGT
FT                   SAKGALYPSTQSSICKQRLLELFLKETHGHKRESSKSKKSYRELKNKATEYYLMSKIFK
FT                   GKYPFNNWLRKPLNCEDFLIN"
FT   gene            276543..276729
FT                   /locus_tag="AT1G04057"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT1G01760"
FT   ncRNA           276543..276729
FT                   /locus_tag="AT1G04057"
FT                   /product="other RNA"
FT                   /ncRNA_class="antisense_RNA"
FT   CDS_pept        complement(join(276640..276793,276870..276989,
FT                   277077..277153,277232..277401,277493..277606,
FT                   277717..277863,277947..278252,278316..278487))
FT                   /codon_start=1
FT                   /gene_synonym="AtTAD1"
FT                   /gene_synonym="ortholog of yeast Tad1"
FT                   /gene_synonym="T1N6.17"
FT                   /gene_synonym="T1N6_17"
FT                   /gene_synonym="TAD1"
FT                   /locus_tag="AT1G01760"
FT                   /product="denosine deaminases acting on tRNA"
FT                   /db_xref="GOA:A0A178W929"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178W929"
FT                   /protein_id="ANM59689.1"
FT                   /translation="MNESTDLFVGIVAMEEDWGKTVSEKVISAYMSLPKKGKPQGREVT
FT                   VLSAFLVSSPSQDPKVIALGTGTKCVSGSLLSPRGDIVNDSHAEVVARRALIRFFYSEI
FT                   QRMQLTSGKSNEAKRQRIDSETSSILESADSSCPGEVKYKLKSGCLLHLYISQLPCGYA
FT                   STSSPLYALKKIPSTQVDDSLLVQASDICSSRHSDVPEIGSNSNKGNGSQVADMVQRKP
FT                   GRGETTLSVSCSDKIARWNVLGVQGALLYQVLQPVYISTITVGQSLHSPDNFSLADHLR
FT                   RSLYERILPLSDELLTSFRLNKPLFFVAPVPPSEFQHSETAQATLTCGYSLCWNYSGLH
FT                   EVILGTTGRKQGTSAKGALYPSTQSSICKQRLLELFLKETHGHKRESSKSKKSYRELKV
FT                   CAMLILFCSFNMLPLEQLTC"
FT   gene            278600..282891
FT                   /gene_synonym="T1N6.18"
FT                   /gene_synonym="T1N6_18"
FT                   /locus_tag="AT1G01770"
FT   mRNA            join(278600..278809,278887..279088,279166..279240,
FT                   279327..279425,279536..279576,279797..279910,
FT                   279974..280088,280180..280370,280449..280568,
FT                   280657..280737,280889..281121,281309..281348,
FT                   281438..281536,281759..282189,282484..282766,
FT                   282849..282891)
FT                   /gene_synonym="T1N6.18"
FT                   /gene_synonym="T1N6_18"
FT                   /locus_tag="AT1G01770"
FT                   /product="propionyl-CoA carboxylase"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU237944.1,INSD:ES135745.1,INSD:AI993141.1,
FT                   INSD:T44786.1,INSD:BP620912.1,INSD:BP858586.1,
FT                   INSD:AI099797.1,INSD:T13084.1,INSD:BP793923.1,
FT                   INSD:BP615545.1,INSD:DR218073.1,INSD:BP800483.1,
FT                   INSD:EG514365.1,INSD:AV554043.1,INSD:BP612554.1,
FT                   INSD:EL152976.1,INSD:EL138623.1,INSD:EG514292.1,
FT                   INSD:BP808194.1,INSD:CD530068.1,INSD:AU229060.1,
FT                   INSD:T44787.1,INSD:BP619441.1,INSD:BX837736.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK117153.1"
FT   CDS_pept        join(278759..278809,278887..279088,279166..279240,
FT                   279327..279425,279536..279576,279797..279910,
FT                   279974..280088,280180..280370,280449..280568,
FT                   280657..280737,280889..281121,281309..281348,
FT                   281438..281536,281759..282189,282484..282490)
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.18"
FT                   /gene_synonym="T1N6_18"
FT                   /locus_tag="AT1G01770"
FT                   /product="propionyl-CoA carboxylase"
FT                   /note="unknown protein; CONTAINS InterPro DOMAIN/s: Protein
FT                   of unknown function DUF1446 (InterPro:IPR010839); Has 1597
FT                   Blast hits to 1509 proteins in 306 species: Archae - 4;
FT                   Bacteria - 843; Metazoa - 22; Fungi - 131; Plants - 31;
FT                   Viruses - 0; Other Eukaryotes - 566 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01770"
FT                   /db_xref="GOA:Q8GZ85"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GZ85"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU237944.1,INSD:ES135745.1,INSD:AI993141.1,
FT                   INSD:T44786.1,INSD:BP620912.1,INSD:BP858586.1,
FT                   INSD:AI099797.1,INSD:T13084.1,INSD:BP793923.1,
FT                   INSD:BP615545.1,INSD:DR218073.1,INSD:BP800483.1,
FT                   INSD:EG514365.1,INSD:AV554043.1,INSD:BP612554.1,
FT                   INSD:EL152976.1,INSD:EL138623.1,INSD:EG514292.1,
FT                   INSD:BP808194.1,INSD:CD530068.1,INSD:AU229060.1,
FT                   INSD:T44787.1,INSD:BP619441.1,INSD:BX837736.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK117153.1"
FT                   /protein_id="AEE27333.1"
FT                   /translation="MANPDVKEILCDCVINLRENPKRRRETVYVGCGAGFGGDRPLAAL
FT                   KLLQRVEELNYLVLECLAERTLADRWLSMASGGLGYDPRVSEWMQLLLPLAVERGTCII
FT                   TNMGAIDPSGAQKKVLEVAGELGLTISVAVAHEVHFETGSGSSFGGQYCSAGGTSTYLG
FT                   AAPIVECLEKYQPNVIITSRVADAALFLAPMVYELGWNWNDLELLAQGTLAGHLLECGC
FT                   QLTGGYFMHPGDQYRDMAFPLLQDLSLPYAEIGYDGKVCVSKVEGSGGILNTSTCAEQL
FT                   LYEIADPSAYITPDVVIDIRGVSFLPLSDCKVQCSGAKPSSNTSVPEKLLRLIPKECGW
FT                   KGWGEISYGGNGSIQRAKASEFLVRSWMEETIPGVNHCILSYVIGVDSLKATSNGTESW
FT                   QSCGDIRLRMDGLFKLKEHAVQLTKEFTALYTNGPAGGGGISTGHKMEIVLEKRLVSRE
FT                   SVMWKTGLQHTNTSEPETSEHHSPEKMPKLPKENPKNLTMRGYQSGFHHSPAPSGQKIP
FT                   LYSVAHSRAGDKGNDINFSIIPHYSPDVERLKLIITPQWVKHVMSVLLSTSSFLELDAK
FT                   PMDENVSVEIYDVEGIHAMNVVVRNILDGGVNCSRRIDRHGKTISDLILCQQVVLI"
FT   gene            282761..284245
FT                   /gene="PLIM2b"
FT                   /gene_synonym="T1N6.19"
FT                   /gene_synonym="T1N6_19"
FT                   /locus_tag="AT1G01780"
FT                   /note="Encodes a member of the Arabidopsis LIM proteins: a
FT                   family of actin bundlers with distinct expression patterns.
FT                   WLIM1, WLIM2a, and WLIM2b are widely expressed, whereas
FT                   PLIM2a, PLIM2b, and PLIM2c are predominantly expressed in
FT                   pollen. Regulates actin cytoskeleton organization."
FT   mRNA            join(282761..283053,283132..283231,283314..283336,
FT                   283444..283533,283813..284245)
FT                   /gene="PLIM2b"
FT                   /gene_synonym="T1N6.19"
FT                   /gene_synonym="T1N6_19"
FT                   /locus_tag="AT1G01780"
FT                   /product="GATA type zinc finger transcription factor family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR366903.1,INSD:BP647907.1,INSD:BP575474.1,
FT                   INSD:AV550289.1,INSD:AI099797.1,INSD:AV794129.1,
FT                   INSD:AV530706.1,INSD:BP565707.1,INSD:ES128298.1,
FT                   INSD:BP570787.1,INSD:DR382469.1,INSD:BX834620.1,
FT                   INSD:BP578457.1,INSD:BP802605.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT025779.1,INSD:BX817923.1"
FT   CDS_pept        join(282919..283053,283132..283231,283314..283336,
FT                   283444..283533,283813..284082)
FT                   /codon_start=1
FT                   /gene="PLIM2b"
FT                   /gene_synonym="T1N6.19"
FT                   /gene_synonym="T1N6_19"
FT                   /locus_tag="AT1G01780"
FT                   /product="GATA type zinc finger transcription factor family
FT                   protein"
FT                   /note="GATA type zinc finger transcription factor family
FT                   protein; FUNCTIONS IN: zinc ion binding; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: cellular_component
FT                   unknown; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Zinc
FT                   finger, LIM-type (InterPro:IPR001781); BEST Arabidopsis
FT                   thaliana protein match is: GATA type zinc finger
FT                   transcription factor family protein (TAIR:AT2G45800.1); Has
FT                   4819 Blast hits to 3002 proteins in 170 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 4032; Fungi - 22; Plants - 446;
FT                   Viruses - 0; Other Eukaryotes - 319 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01780"
FT                   /db_xref="GOA:Q1ECF5"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1ECF5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR366903.1,INSD:BP647907.1,INSD:BP575474.1,
FT                   INSD:AV550289.1,INSD:AI099797.1,INSD:AV794129.1,
FT                   INSD:AV530706.1,INSD:BP565707.1,INSD:ES128298.1,
FT                   INSD:BP570787.1,INSD:DR382469.1,INSD:BX834620.1,
FT                   INSD:BP578457.1,INSD:BP802605.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT025779.1,INSD:BX817923.1"
FT                   /protein_id="AEE27334.1"
FT                   /translation="MSFTGTLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQ
FT                   MSNYSSMDGVLYCKTHFEQLFKESGNFSKNFQPGKTEKPELTRTPSKISSIFCGTQDKC
FT                   AACEKTVYPLEKIQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEK
FT                   GNYAHVLQAANHRRTASGNTLPPEPTEDVAVEAKEENGVSES"
FT   gene            284350..291203
FT                   /gene="KEA1"
FT                   /gene_synonym="ATKEA1"
FT                   /gene_synonym="K+ efflux antiporter 1"
FT                   /gene_synonym="K+ EFFLUX ANTIPORTER 1"
FT                   /gene_synonym="T1N6.21"
FT                   /gene_synonym="T1N6_21"
FT                   /locus_tag="AT1G01790"
FT                   /note="K efflux antiporter KEA1"
FT   mRNA            join(284350..284635,284722..286351,286452..286623,
FT                   286717..286807,286997..287133,287221..287280,
FT                   287395..287514,287642..287710,287789..287854,
FT                   288087..288176,288401..288505,288593..288721,
FT                   288882..289091,289237..289386,289539..289592,
FT                   289718..289776,290028..290094,290170..290346,
FT                   290439..290495,290578..290652,290747..291201)
FT                   /gene="KEA1"
FT                   /gene_synonym="ATKEA1"
FT                   /gene_synonym="K+ efflux antiporter 1"
FT                   /gene_synonym="K+ EFFLUX ANTIPORTER 1"
FT                   /gene_synonym="T1N6.21"
FT                   /gene_synonym="T1N6_21"
FT                   /locus_tag="AT1G01790"
FT                   /product="K+ efflux antiporter 1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH993989.1,INSD:AV522276.1,INSD:EL139115.1,
FT                   INSD:DR243681.1,INSD:EL126893.1,INSD:CF773131.1,
FT                   INSD:EL223227.1,INSD:T44799.1,INSD:ES076347.1,
FT                   INSD:EH866203.1,INSD:DR379486.1,INSD:ES046296.1,
FT                   INSD:EL108022.1,INSD:EH810687.1,INSD:EL053051.1,
FT                   INSD:AI997899.1,INSD:EL066751.1,INSD:EH936094.1,
FT                   INSD:ES159048.1,INSD:EH955416.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AF003382.1"
FT   mRNA            join(284460..286351,286452..286623,286717..286807,
FT                   286997..287133,287221..287280,287395..287514,
FT                   287642..287710,287789..287854,288087..288176,
FT                   288401..288505,288593..288721,288882..289091,
FT                   289237..289386,289539..289592,289718..289776,
FT                   290028..290094,290170..290346,290439..290495,
FT                   290578..290652,290747..291203)
FT                   /gene="KEA1"
FT                   /gene_synonym="ATKEA1"
FT                   /gene_synonym="K+ efflux antiporter 1"
FT                   /gene_synonym="K+ EFFLUX ANTIPORTER 1"
FT                   /gene_synonym="T1N6.21"
FT                   /gene_synonym="T1N6_21"
FT                   /locus_tag="AT1G01790"
FT                   /product="K+ efflux antiporter 1"
FT   CDS_pept        join(284781..286351,286452..286623,286717..286807,
FT                   286997..287133,287221..287280,287395..287514,
FT                   287642..287710,287789..287854,288087..288176,
FT                   288401..288505,288593..288721,288882..289091,
FT                   289237..289386,289539..289592,289718..289776,
FT                   290028..290094,290170..290346,290439..290495,
FT                   290578..290652,290747..290869)
FT                   /codon_start=1
FT                   /gene="KEA1"
FT                   /gene_synonym="ATKEA1"
FT                   /gene_synonym="K+ efflux antiporter 1"
FT                   /gene_synonym="K+ EFFLUX ANTIPORTER 1"
FT                   /gene_synonym="T1N6.21"
FT                   /gene_synonym="T1N6_21"
FT                   /locus_tag="AT1G01790"
FT                   /product="K+ efflux antiporter 1"
FT                   /db_xref="GOA:Q9ZTZ7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZTZ7"
FT                   /protein_id="ANM58176.1"
FT                   /translation="MEYASTFQRPILFHGGDGASYCFPNRLISPKGISITSGDSKVHSC
FT                   FRLRRNVAQSGTLNLMNACFSGRFYSGHLHSTKSILGNGHQAKRIPFGFRLRCQGHESL
FT                   GNADSNDHRIGESSESSDETEATDLKDARVENDTDSLEELKELLHKAIKELEVARLNST
FT                   MFEEKAQRISERAIALKDEAATAWLDVNKTLDVIRDTVYEEALAKEAVQTATMALSLAE
FT                   ARLQVIVESLEAGAGNDIPHVSEETEETIDVNDKEEALLAAKDDIKECQVNLDNCESQL
FT                   SALLSKKDELQKEVDKLNEFAETIQISSLKAEEDVTNIMKLAEQAVAFELEATQRVNDA
FT                   EIALQRAEKSLSISQTPEETQGQLSDEETSQEDAMVLSGNVEDVTHQVEKESPKDGDLP
FT                   VVQITAELVPDIVGQRNKKLTQPYESSDHENGKPSVESSKVVEADSEKPKINVQTKKQE
FT                   TQKDLPKEGSSLNSPKASFNKSSRFFSASFFSSNPDGTATVFGSLVGSVKQQWPKLVLG
FT                   LALLGAGLTLYSNGVGGNNQLLQQPDVTSTSTEDVSSSTKPLIRQVQKLPKRIKKLLEM
FT                   IPHQEVNEEEASLFDFLWLLLASVIFVPLFQKIPGGSPVLGYLAAGILIGPYGLSIIRN
FT                   VHGTRAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAAVVGLLAHYVAG
FT                   QAGPAAIVIGNGLALSSTAVVLQVLQERGESTSRHGRASFSVLLFQDLAVVVLLILIPL
FT                   ISPNSSKGGIGFQAIAEALGLAAVKAAVAITAIIAGGRLLLRPIYKQIAENRNAEIFSA
FT                   NTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTV
FT                   GMSIDPKLLLSNFPVIVGTLGLLIVGKTMLVVIMGKLFGISIISAIRVGLLLAPGGEFA
FT                   FVAFGEAVNQGIMSPQLSSLLFLVVGISMAITPWLAAGGQLIASRFELHDVRSLLPVES
FT                   ETDDLQGHIIICGFGRVGQIIAQLLSERLIPFVALDVSSDRVTIGRSLDLPVYFGDAGS
FT                   KEVLHKIGAGRACAAVVALDAPGANYRCVWALSKFYPNVKTFVRAHDVVHGLNLEKAGA
FT                   TAVVPETLEPSLQLAAAVLAQAKLPTSEIANTINEFRTRHLSELTELCEASGSSLGYGY
FT                   SRTSKPKPQPSDASGDNQIIEGGTVVI"
FT   CDS_pept        join(284781..286351,286452..286623,286717..286807,
FT                   286997..287133,287221..287280,287395..287514,
FT                   287642..287710,287789..287854,288087..288176,
FT                   288401..288505,288593..288721,288882..289091,
FT                   289237..289386,289539..289592,289718..289776,
FT                   290028..290094,290170..290346,290439..290495,
FT                   290578..290652,290747..290869)
FT                   /codon_start=1
FT                   /gene="KEA1"
FT                   /gene_synonym="ATKEA1"
FT                   /gene_synonym="K+ efflux antiporter 1"
FT                   /gene_synonym="K+ EFFLUX ANTIPORTER 1"
FT                   /gene_synonym="T1N6.21"
FT                   /gene_synonym="T1N6_21"
FT                   /locus_tag="AT1G01790"
FT                   /product="K+ efflux antiporter 1"
FT                   /note="K+ efflux antiporter 1 (KEA1); FUNCTIONS IN:
FT                   potassium:hydrogen antiporter activity, potassium ion
FT                   transmembrane transporter activity; INVOLVED IN: potassium
FT                   ion transport, cation transport, metabolic process,
FT                   transmembrane transport; LOCATED IN: chloroplast,
FT                   chloroplast envelope; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: K+/H+ exchanger (InterPro:IPR004771), Cation/H+
FT                   exchanger (InterPro:IPR006153), NAD(P)-binding domain
FT                   (InterPro:IPR016040), Regulator of K+ conductance,
FT                   N-terminal (InterPro:IPR003148); BEST Arabidopsis thaliana
FT                   protein match is: K+ efflux antiporter 2
FT                   (TAIR:AT4G00630.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01790.1"
FT                   /db_xref="GOA:Q9ZTZ7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZTZ7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH993989.1,INSD:AV522276.1,INSD:EL139115.1,
FT                   INSD:DR243681.1,INSD:EL126893.1,INSD:CF773131.1,
FT                   INSD:EL223227.1,INSD:T44799.1,INSD:ES076347.1,
FT                   INSD:EH866203.1,INSD:DR379486.1,INSD:ES046296.1,
FT                   INSD:EL108022.1,INSD:EH810687.1,INSD:EL053051.1,
FT                   INSD:AI997899.1,INSD:EL066751.1,INSD:EH936094.1,
FT                   INSD:ES159048.1,INSD:EH955416.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AF003382.1"
FT                   /protein_id="AEE27335.1"
FT                   /translation="MEYASTFQRPILFHGGDGASYCFPNRLISPKGISITSGDSKVHSC
FT                   FRLRRNVAQSGTLNLMNACFSGRFYSGHLHSTKSILGNGHQAKRIPFGFRLRCQGHESL
FT                   GNADSNDHRIGESSESSDETEATDLKDARVENDTDSLEELKELLHKAIKELEVARLNST
FT                   MFEEKAQRISERAIALKDEAATAWLDVNKTLDVIRDTVYEEALAKEAVQTATMALSLAE
FT                   ARLQVIVESLEAGAGNDIPHVSEETEETIDVNDKEEALLAAKDDIKECQVNLDNCESQL
FT                   SALLSKKDELQKEVDKLNEFAETIQISSLKAEEDVTNIMKLAEQAVAFELEATQRVNDA
FT                   EIALQRAEKSLSISQTPEETQGQLSDEETSQEDAMVLSGNVEDVTHQVEKESPKDGDLP
FT                   VVQITAELVPDIVGQRNKKLTQPYESSDHENGKPSVESSKVVEADSEKPKINVQTKKQE
FT                   TQKDLPKEGSSLNSPKASFNKSSRFFSASFFSSNPDGTATVFGSLVGSVKQQWPKLVLG
FT                   LALLGAGLTLYSNGVGGNNQLLQQPDVTSTSTEDVSSSTKPLIRQVQKLPKRIKKLLEM
FT                   IPHQEVNEEEASLFDFLWLLLASVIFVPLFQKIPGGSPVLGYLAAGILIGPYGLSIIRN
FT                   VHGTRAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLVTAAVVGLLAHYVAG
FT                   QAGPAAIVIGNGLALSSTAVVLQVLQERGESTSRHGRASFSVLLFQDLAVVVLLILIPL
FT                   ISPNSSKGGIGFQAIAEALGLAAVKAAVAITAIIAGGRLLLRPIYKQIAENRNAEIFSA
FT                   NTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTV
FT                   GMSIDPKLLLSNFPVIVGTLGLLIVGKTMLVVIMGKLFGISIISAIRVGLLLAPGGEFA
FT                   FVAFGEAVNQGIMSPQLSSLLFLVVGISMAITPWLAAGGQLIASRFELHDVRSLLPVES
FT                   ETDDLQGHIIICGFGRVGQIIAQLLSERLIPFVALDVSSDRVTIGRSLDLPVYFGDAGS
FT                   KEVLHKIGAGRACAAVVALDAPGANYRCVWALSKFYPNVKTFVRAHDVVHGLNLEKAGA
FT                   TAVVPETLEPSLQLAAAVLAQAKLPTSEIANTINEFRTRHLSELTELCEASGSSLGYGY
FT                   SRTSKPKPQPSDASGDNQIIEGGTVVI"
FT   gene            complement(291594..292061)
FT                   /locus_tag="AT1G04063"
FT   ncRNA           complement(291594..292061)
FT                   /locus_tag="AT1G04063"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            293246..295086
FT                   /gene_synonym="T1N6.22"
FT                   /gene_synonym="T1N6_22"
FT                   /locus_tag="AT1G01800"
FT   mRNA            join(293246..293409,293500..293752,294055..294120,
FT                   294210..294386,294511..295086)
FT                   /gene_synonym="T1N6.22"
FT                   /gene_synonym="T1N6_22"
FT                   /locus_tag="AT1G01800"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP581582.1,INSD:BP623829.1,INSD:EL236538.1,
FT                   INSD:BP577896.1,INSD:EL308189.1,INSD:EH963667.1,
FT                   INSD:DR376007.1,INSD:EH970904.1,INSD:EL132447.1,
FT                   INSD:EL035047.1,INSD:BP868992.1,INSD:BP610373.1,
FT                   INSD:BP574864.1,INSD:EH847347.1,INSD:BP601911.1,
FT                   INSD:BP606853.1,INSD:AV556166.1,INSD:EH910929.1,
FT                   INSD:EL134809.1,INSD:AV534908.1,INSD:EH937331.1,
FT                   INSD:AV795111.1,INSD:AV545650.1,INSD:ES012738.1,
FT                   INSD:BP575257.1,INSD:DR271763.1,INSD:BP566095.1,
FT                   INSD:BP628667.1,INSD:EL107280.1,INSD:EH892564.1,
FT                   INSD:BP614117.1,INSD:EH995172.1,INSD:BP579243.1,
FT                   INSD:EL246189.1,INSD:BP570363.1,INSD:BP598188.1,
FT                   INSD:EL034468.1,INSD:BP563134.1,INSD:BP595806.1,
FT                   INSD:BP632594.1,INSD:AV538983.1,INSD:BP575141.1,
FT                   INSD:EL164746.1,INSD:BP579216.1,INSD:BP663473.1,
FT                   INSD:ES007847.1,INSD:EH989534.1,INSD:BP597069.1,
FT                   INSD:ES016929.1,INSD:BP568022.1,INSD:BP582638.1,
FT                   INSD:EL173547.1,INSD:EL245601.1,INSD:EH870643.1,
FT                   INSD:AV783242.1,INSD:BP800575.1,INSD:EL195400.1"
FT   mRNA            join(293342..293409,293500..293756,294055..294120,
FT                   294210..294386,294511..295040)
FT                   /gene_synonym="T1N6.22"
FT                   /gene_synonym="T1N6_22"
FT                   /locus_tag="AT1G01800"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP581582.1,INSD:DR271770.1,INSD:DR271764.1,
FT                   INSD:BP623829.1,INSD:EG524224.1,INSD:EL236538.1,
FT                   INSD:BP577896.1,INSD:EL308189.1,INSD:EH963667.1,
FT                   INSD:DR376007.1,INSD:EH970904.1,INSD:EL132447.1,
FT                   INSD:BP798374.1,INSD:BP842473.1,INSD:EL035047.1,
FT                   INSD:BP610373.1,INSD:DR271765.1,INSD:BP574864.1,
FT                   INSD:BP866531.1,INSD:DR271771.1,INSD:EH847347.1,
FT                   INSD:BP601911.1,INSD:BP606853.1,INSD:AV556166.1,
FT                   INSD:EH910929.1,INSD:EL134809.1,INSD:AV534908.1,
FT                   INSD:EH937331.1,INSD:AV795111.1,INSD:AV545650.1,
FT                   INSD:EG524225.1,INSD:ES012738.1,INSD:BP575257.1,
FT                   INSD:DR271763.1,INSD:BP566095.1,INSD:BP628667.1,
FT                   INSD:EL107280.1,INSD:EH892564.1,INSD:BP614117.1,
FT                   INSD:EH995172.1,INSD:BP579243.1,INSD:DR271762.1,
FT                   INSD:EL246189.1,INSD:BP847589.1,INSD:BP570363.1,
FT                   INSD:AV822467.1,INSD:BP598188.1,INSD:EL034468.1,
FT                   INSD:BP563134.1,INSD:BP632594.1,INSD:BP595806.1,
FT                   INSD:AV538983.1,INSD:BP575141.1,INSD:BP799927.1,
FT                   INSD:BP579216.1,INSD:BP663473.1,INSD:EL135966.1,
FT                   INSD:ES007847.1,INSD:EH989534.1,INSD:BP597069.1,
FT                   INSD:DR271772.1,INSD:AV554466.1,INSD:ES016929.1,
FT                   INSD:BP851033.1,INSD:BP568022.1,INSD:DR271769.1,
FT                   INSD:BP582638.1,INSD:EL173547.1,INSD:EL245601.1,
FT                   INSD:DR271766.1,INSD:DR271768.1,INSD:EH870643.1,
FT                   INSD:AV783242.1,INSD:EL195400.1,INSD:DR271767.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX813813.1,INSD:AF370343.1"
FT   CDS_pept        join(293396..293409,293500..293752,294055..294120,
FT                   294210..294386,294511..294888)
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.22"
FT                   /gene_synonym="T1N6_22"
FT                   /locus_tag="AT1G01800"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /note="NAD(P)-binding Rossmann-fold superfamily protein;
FT                   FUNCTIONS IN: oxidoreductase activity, binding, catalytic
FT                   activity; INVOLVED IN: oxidation reduction, metabolic
FT                   process; LOCATED IN: plant-type cell wall; EXPRESSED IN: 22
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: NAD(P)-binding domain
FT                   (InterPro:IPR016040), Glucose/ribitol dehydrogenase
FT                   (InterPro:IPR002347), Short-chain dehydrogenase/reductase
FT                   SDR (InterPro:IPR002198); BEST Arabidopsis thaliana protein
FT                   match is: NAD(P)-binding Rossmann-fold superfamily protein
FT                   (TAIR:AT3G61220.1); Has 66869 Blast hits to 66825 proteins
FT                   in 3161 species: Archae - 673; Bacteria - 45998; Metazoa -
FT                   3911; Fungi - 3425; Plants - 2362; Viruses - 0; Other
FT                   Eukaryotes - 10500 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q94K30"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q94K30"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP581582.1,INSD:DR271770.1,INSD:DR271764.1,
FT                   INSD:BP623829.1,INSD:EG524224.1,INSD:EL236538.1,
FT                   INSD:BP577896.1,INSD:EL308189.1,INSD:EH963667.1,
FT                   INSD:DR376007.1,INSD:EH970904.1,INSD:EL132447.1,
FT                   INSD:BP798374.1,INSD:BP842473.1,INSD:EL035047.1,
FT                   INSD:BP610373.1,INSD:DR271765.1,INSD:BP574864.1,
FT                   INSD:BP866531.1,INSD:DR271771.1,INSD:EH847347.1,
FT                   INSD:BP601911.1,INSD:BP606853.1,INSD:AV556166.1,
FT                   INSD:EH910929.1,INSD:EL134809.1,INSD:AV534908.1,
FT                   INSD:EH937331.1,INSD:AV795111.1,INSD:AV545650.1,
FT                   INSD:EG524225.1,INSD:ES012738.1,INSD:BP575257.1,
FT                   INSD:DR271763.1,INSD:BP566095.1,INSD:BP628667.1,
FT                   INSD:EL107280.1,INSD:EH892564.1,INSD:BP614117.1,
FT                   INSD:EH995172.1,INSD:BP579243.1,INSD:DR271762.1,
FT                   INSD:EL246189.1,INSD:BP847589.1,INSD:BP570363.1,
FT                   INSD:AV822467.1,INSD:BP598188.1,INSD:EL034468.1,
FT                   INSD:BP563134.1,INSD:BP632594.1,INSD:BP595806.1,
FT                   INSD:AV538983.1,INSD:BP575141.1,INSD:BP799927.1,
FT                   INSD:BP579216.1,INSD:BP663473.1,INSD:EL135966.1,
FT                   INSD:ES007847.1,INSD:EH989534.1,INSD:BP597069.1,
FT                   INSD:DR271772.1,INSD:AV554466.1,INSD:ES016929.1,
FT                   INSD:BP851033.1,INSD:BP568022.1,INSD:DR271769.1,
FT                   INSD:BP582638.1,INSD:EL173547.1,INSD:EL245601.1,
FT                   INSD:DR271766.1,INSD:DR271768.1,INSD:EH870643.1,
FT                   INSD:AV783242.1,INSD:EL195400.1,INSD:DR271767.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX813813.1,INSD:AF370343.1"
FT                   /protein_id="AEE27336.1"
FT                   /translation="MADPRVAVVTGSNKGIGFEICRQLANNGITVVLTARDENKGLAAV
FT                   QKLKTENGFSDQAISFHPLDVSNPDTIASLAAFVKTRFGKLDILVNNAGVGGANVNVDV
FT                   LKAQIAEAGAPTDISKIMSDTYEIVEECVKTNYYGVKRMCEAMIPLLQSSDSPRIVSIA
FT                   STMGKLENVSNEWAKGVLSDAENLTEEKIDEVINEYLKDYKEGALQVKGWPTVMSGYIL
FT                   SKAAVIALTRVLAKRHKSFIINSVCPGFVNTEINFNTGILSVEEGAASPVKLALVPNGD
FT                   PSGLFFDRANVSNF"
FT   CDS_pept        join(293595..293756,294055..294120,294210..294386,
FT                   294511..294888)
FT                   /codon_start=1
FT                   /gene_synonym="T1N6.22"
FT                   /gene_synonym="T1N6_22"
FT                   /locus_tag="AT1G01800"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /note="NAD(P)-binding Rossmann-fold superfamily protein;
FT                   FUNCTIONS IN: oxidoreductase activity, binding, catalytic
FT                   activity; INVOLVED IN: oxidation reduction, metabolic
FT                   process; LOCATED IN: plant-type cell wall; EXPRESSED IN: 22
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: NAD(P)-binding domain
FT                   (InterPro:IPR016040), Glucose/ribitol dehydrogenase
FT                   (InterPro:IPR002347), Short-chain dehydrogenase/reductase
FT                   SDR (InterPro:IPR002198); BEST Arabidopsis thaliana protein
FT                   match is: NAD(P)-binding Rossmann-fold superfamily protein
FT                   (TAIR:AT3G61220.1); Has 1448 Blast hits to 1439 proteins in
FT                   381 species: Archae - 10; Bacteria - 625; Metazoa - 292;
FT                   Fungi - 52; Plants - 346; Viruses - 0; Other Eukaryotes -
FT                   123 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT1G01800"
FT                   /db_xref="EnsemblGenomes-Tr:AT1G01800.2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8MQD9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP581582.1,INSD:BP623829.1,INSD:EL236538.1,
FT                   INSD:BP577896.1,INSD:EL308189.1,INSD:EH963667.1,
FT                   INSD:DR376007.1,INSD:EH970904.1,INSD:EL132447.1,
FT                   INSD:EL035047.1,INSD:BP868992.1,INSD:BP610373.1,
FT                   INSD:BP574864.1,INSD:EH847347.1,INSD:BP601911.1,
FT                   INSD:BP606853.1,INSD:AV556166.1,INSD:EH910929.1,
FT                   INSD:EL134809.1,INSD:AV534908.1,INSD:EH937331.1,
FT                   INSD:AV795111.1,INSD:AV545650.1,INSD:ES012738.1,
FT                   INSD:BP575257.1,INSD:DR271763.1,INSD:BP566095.1,
FT                   INSD:BP628667.1,INSD:EL107280.1,INSD:EH892564.1,
FT                   INSD:BP614117.1,INSD:EH995172.1,INSD:BP579243.1,
FT                   INSD:EL246189.1,INSD:BP570363.1,INSD:BP598188.1,
FT                   INSD:EL034468.1,INSD:BP563134.1,INSD:BP595806.1,
FT                   INSD:BP632594.1,INSD:AV538983.1,INSD:BP575141.1,
FT                   INSD:EL164746.1,INSD:BP579216.1,INSD:BP663473.1,
FT                   INSD:ES007847.1,INSD:EH989534.1,INSD:BP597069.1,
FT                   INSD:ES016929.1,INSD:BP568022.1,INSD:BP582638.1,
FT                   INSD:EL173547.1,INSD:EL245601.1,INSD:EH870643.1,
FT                   INSD:AV783242.1,INSD:BP800575.1,INSD:EL195400.1"
FT                   /protein_id="AEE27337.1"
FT                   /translation="MKTRVLLLSKSSRLRMVFLIKPSPFTLLMSPTQTPSLLLLLLSRP
FT                   ASANSIFWQVNNAGVGGANVNVDVLKAQIAEAGAPTDISKIMSDTYEIVEECVKTNYYG
FT                   VKRMCEAMIPLLQSSDSPRIVSIASTMGKLENVSNEWAKGVLSDAENLTEEKIDEVINE
FT                   YLKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRHKSFIINSVCPGFVNTEINF
FT                   NTGILSVEEGAASPVKLALVPNGDPSGLFFDRANVSNF"
FT   gene            295207..295859
FT                   /gene_synonym="T1N6.23"
FT                   /gene_synonym="T1N6_23"
FT                   /locus_tag="AT1G01810"
FT   mRNA            295207..295859
FT                   /gene_synonym="T1N6.23"
FT                   /gene_synonym="T1N6_23"
FT                   /locus_tag="AT1G01810"
FT                   /product="hypothetical protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG472273.1,INSD:EG472268.1,INSD:EG472269.1,
FT                   INSD:EG419404.1,INSD:EG419403.1,INSD:EG472279.1,
FT                   INSD:EG472270.1,INSD:EG472275.1,INSD:EG472266.1,
FT                   INSD:EG472261.1,INSD:EG472259.1,INSD:EG472263.1,
FT                   INSD:EG472260.1,INSD:EG472262.1,INSD:EG472272.1,
FT                   INSD:EG472267.1,INSD:EG472289.1,INSD:EG472286.1,
FT                   INSD:EG472271.1,INSD:EG472290.1,INSD:EG472274.1,
FT                   INSD:EG47