(data stored in ACNUC13479 zone)

EMBL: CP002685

ID   CP002685; SV 1; linear; genomic DNA; STD; PLN; 19698289 BP.
XX
AC   CP002685;
XX
PR   Project:PRJNA116;
XX
DT   13-MAY-2011 (Rel. 108, Created)
DT   29-JUN-2017 (Rel. 133, Last updated, Version 6)
XX
DE   Arabidopsis thaliana chromosome 2 sequence.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-19698289
RX   DOI; 10.1038/45471.
RX   PUBMED; 10617197.
RA   Lin X., Kaul S., Rounsley S., Shea T.P., Benito M.I., Town C.D.,
RA   Fujii C.Y., Mason T., Bowman C.L., Barnstead M., Feldblyum T.V.,
RA   Buell C.R., Ketchum K.A., Lee J., Ronning C.M., Koo H.L., Moffat K.S.,
RA   Cronin L.A., Shen M., Pai G., Van Aken S., Umayam L., Tallon L.J.,
RA   Gill J.E., Adams M.D., Carrera A.J., Creasy T.H., Goodman H.M.,
RA   Somerville C.R., Copenhaver G.P., Preuss D., Nierman W.C., White O.,
RA   Eisen J.A., Salzberg S.L., Fraser C.M., Venter J.C.;
RT   "Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana";
RL   Nature 402(6763):761-768(1999).
XX
RN   [2]
RP   1-19698289
RG   TAIR
RA   Swarbreck D., Lamesch P., Wilks C., Huala E.;
RT   ;
RL   Submitted (18-FEB-2011) to the INSDC.
RL   Department of Plant Biology, Carnegie Institution, 260 Panama Street,
RL   Stanford, CA, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-19698289
RA   Krishnakumar V., Cheng C.-Y., Chan A.P., Schobel S., Kim M., Ferlanti E.S.,
RA   Belyaeva I., Rosen B.D., Micklem G., Miller J.R., Vaughn M., Town C.D.;
RT   ;
RL   Submitted (17-MAY-2016) to the INSDC.
RL   Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr,
RL   Rockville, MD 20850, USA
XX
DR   MD5; 837e6cf18d30dda428a08ac2cb4061f2.
DR   BioSample; SAMN03081427.
DR   EnsemblGenomes-Gn; AT2G01010.
DR   EnsemblGenomes-Gn; AT2G01020.
DR   EnsemblGenomes-Gn; AT2G01160.
DR   EnsemblGenomes-Gn; AT2G01240.
DR   EnsemblGenomes-Gn; AT2G01422.
DR   EnsemblGenomes-Gn; AT2G02350.
DR   EnsemblGenomes-Gn; AT2G02600.
DR   EnsemblGenomes-Gn; AT2G02710.
DR   EnsemblGenomes-Gn; AT2G02741.
DR   EnsemblGenomes-Gn; AT2G02900.
DR   EnsemblGenomes-Gn; AT2G03445.
DR   EnsemblGenomes-Gn; AT2G03490.
DR   EnsemblGenomes-Gn; AT2G03660.
DR   EnsemblGenomes-Gn; AT2G03700.
DR   EnsemblGenomes-Gn; AT2G03790.
DR   EnsemblGenomes-Gn; AT2G03855.
DR   EnsemblGenomes-Gn; AT2G03885.
DR   EnsemblGenomes-Gn; AT2G03895.
DR   EnsemblGenomes-Gn; AT2G03905.
DR   EnsemblGenomes-Gn; AT2G03925.
DR   EnsemblGenomes-Gn; AT2G03937.
DR   EnsemblGenomes-Gn; AT2G03945.
DR   EnsemblGenomes-Gn; AT2G03975.
DR   EnsemblGenomes-Gn; AT2G03985.
DR   EnsemblGenomes-Gn; AT2G03995.
DR   EnsemblGenomes-Gn; AT2G04005.
DR   EnsemblGenomes-Gn; AT2G04015.
DR   EnsemblGenomes-Gn; AT2G04020.
DR   EnsemblGenomes-Gn; AT2G04065.
DR   EnsemblGenomes-Gn; AT2G04075.
DR   EnsemblGenomes-Gn; AT2G04085.
DR   EnsemblGenomes-Gn; AT2G04095.
DR   EnsemblGenomes-Gn; AT2G04125.
DR   EnsemblGenomes-Gn; AT2G04145.
DR   EnsemblGenomes-Gn; AT2G04155.
DR   EnsemblGenomes-Gn; AT2G04175.
DR   EnsemblGenomes-Gn; AT2G04185.
DR   EnsemblGenomes-Gn; AT2G04195.
DR   EnsemblGenomes-Gn; AT2G04205.
DR   EnsemblGenomes-Gn; AT2G04215.
DR   EnsemblGenomes-Gn; AT2G04225.
DR   EnsemblGenomes-Gn; AT2G04255.
DR   EnsemblGenomes-Gn; AT2G04265.
DR   EnsemblGenomes-Gn; AT2G04285.
DR   EnsemblGenomes-Gn; AT2G04295.
DR   EnsemblGenomes-Gn; AT2G04315.
DR   EnsemblGenomes-Gn; AT2G04325.
DR   EnsemblGenomes-Gn; AT2G04335.
DR   EnsemblGenomes-Gn; AT2G04345.
DR   EnsemblGenomes-Gn; AT2G04355.
DR   EnsemblGenomes-Gn; AT2G04365.
DR   EnsemblGenomes-Gn; AT2G04375.
DR   EnsemblGenomes-Gn; AT2G04405.
DR   EnsemblGenomes-Gn; AT2G04435.
DR   EnsemblGenomes-Gn; AT2G04455.
DR   EnsemblGenomes-Gn; AT2G04465.
DR   EnsemblGenomes-Gn; AT2G04485.
DR   EnsemblGenomes-Gn; AT2G04505.
DR   EnsemblGenomes-Gn; AT2G04525.
DR   EnsemblGenomes-Gn; AT2G04535.
DR   EnsemblGenomes-Gn; AT2G04545.
DR   EnsemblGenomes-Gn; AT2G04555.
DR   EnsemblGenomes-Gn; AT2G04565.
DR   EnsemblGenomes-Gn; AT2G04575.
DR   EnsemblGenomes-Gn; AT2G04595.
DR   EnsemblGenomes-Gn; AT2G04605.
DR   EnsemblGenomes-Gn; AT2G04615.
DR   EnsemblGenomes-Gn; AT2G04635.
DR   EnsemblGenomes-Gn; AT2G04645.
DR   EnsemblGenomes-Gn; AT2G04655.
DR   EnsemblGenomes-Gn; AT2G04665.
DR   EnsemblGenomes-Gn; AT2G04685.
DR   EnsemblGenomes-Gn; AT2G04695.
DR   EnsemblGenomes-Gn; AT2G04705.
DR   EnsemblGenomes-Gn; AT2G04715.
DR   EnsemblGenomes-Gn; AT2G04725.
DR   EnsemblGenomes-Gn; AT2G04735.
DR   EnsemblGenomes-Gn; AT2G04745.
DR   EnsemblGenomes-Gn; AT2G04755.
DR   EnsemblGenomes-Gn; AT2G04765.
DR   EnsemblGenomes-Gn; AT2G04775.
DR   EnsemblGenomes-Gn; AT2G04785.
DR   EnsemblGenomes-Gn; AT2G04805.
DR   EnsemblGenomes-Gn; AT2G04815.
DR   EnsemblGenomes-Gn; AT2G04825.
DR   EnsemblGenomes-Gn; AT2G04835.
DR   EnsemblGenomes-Gn; AT2G04852.
DR   EnsemblGenomes-Gn; AT2G04855.
DR   EnsemblGenomes-Gn; AT2G04875.
DR   EnsemblGenomes-Gn; AT2G04885.
DR   EnsemblGenomes-Gn; AT2G04895.
DR   EnsemblGenomes-Gn; AT2G04905.
DR   EnsemblGenomes-Gn; AT2G04915.
DR   EnsemblGenomes-Gn; AT2G04935.
DR   EnsemblGenomes-Gn; AT2G04945.
DR   EnsemblGenomes-Gn; AT2G04955.
DR   EnsemblGenomes-Gn; AT2G04965.
DR   EnsemblGenomes-Gn; AT2G04975.
DR   EnsemblGenomes-Gn; AT2G04985.
DR   EnsemblGenomes-Gn; AT2G04995.
DR   EnsemblGenomes-Gn; AT2G05005.
DR   EnsemblGenomes-Gn; AT2G05015.
DR   EnsemblGenomes-Gn; AT2G05035.
DR   EnsemblGenomes-Gn; AT2G05045.
DR   EnsemblGenomes-Gn; AT2G05065.
DR   EnsemblGenomes-Gn; AT2G05075.
DR   EnsemblGenomes-Gn; AT2G05085.
DR   EnsemblGenomes-Gn; AT2G05095.
DR   EnsemblGenomes-Gn; AT2G05125.
DR   EnsemblGenomes-Gn; AT2G05145.
DR   EnsemblGenomes-Gn; AT2G05155.
DR   EnsemblGenomes-Gn; AT2G05205.
DR   EnsemblGenomes-Gn; AT2G05215.
DR   EnsemblGenomes-Gn; AT2G05245.
DR   EnsemblGenomes-Gn; AT2G05255.
DR   EnsemblGenomes-Gn; AT2G05315.
DR   EnsemblGenomes-Gn; AT2G05355.
DR   EnsemblGenomes-Gn; AT2G05365.
DR   EnsemblGenomes-Gn; AT2G05395.
DR   EnsemblGenomes-Gn; AT2G05405.
DR   EnsemblGenomes-Gn; AT2G05415.
DR   EnsemblGenomes-Gn; AT2G05425.
DR   EnsemblGenomes-Gn; AT2G05445.
DR   EnsemblGenomes-Gn; AT2G05455.
DR   EnsemblGenomes-Gn; AT2G05465.
DR   EnsemblGenomes-Gn; AT2G05485.
DR   EnsemblGenomes-Gn; AT2G05495.
DR   EnsemblGenomes-Gn; AT2G05505.
DR   EnsemblGenomes-Gn; AT2G05515.
DR   EnsemblGenomes-Gn; AT2G05518.
DR   EnsemblGenomes-Gn; AT2G05525.
DR   EnsemblGenomes-Gn; AT2G05535.
DR   EnsemblGenomes-Gn; AT2G05545.
DR   EnsemblGenomes-Gn; AT2G05555.
DR   EnsemblGenomes-Gn; AT2G05565.
DR   EnsemblGenomes-Gn; AT2G05575.
DR   EnsemblGenomes-Gn; AT2G05585.
DR   EnsemblGenomes-Gn; AT2G05605.
DR   EnsemblGenomes-Gn; AT2G05615.
DR   EnsemblGenomes-Gn; AT2G05625.
DR   EnsemblGenomes-Gn; AT2G05665.
DR   EnsemblGenomes-Gn; AT2G05675.
DR   EnsemblGenomes-Gn; AT2G05685.
DR   EnsemblGenomes-Gn; AT2G05695.
DR   EnsemblGenomes-Gn; AT2G05705.
DR   EnsemblGenomes-Gn; AT2G05725.
DR   EnsemblGenomes-Gn; AT2G05765.
DR   EnsemblGenomes-Gn; AT2G05785.
DR   EnsemblGenomes-Gn; AT2G05812.
DR   EnsemblGenomes-Gn; AT2G05815.
DR   EnsemblGenomes-Gn; AT2G05825.
DR   EnsemblGenomes-Gn; AT2G05835.
DR   EnsemblGenomes-Gn; AT2G05855.
DR   EnsemblGenomes-Gn; AT2G05865.
DR   EnsemblGenomes-Gn; AT2G05875.
DR   EnsemblGenomes-Gn; AT2G05885.
DR   EnsemblGenomes-Gn; AT2G05895.
DR   EnsemblGenomes-Gn; AT2G05905.
DR   EnsemblGenomes-Gn; AT2G05914.
DR   EnsemblGenomes-Gn; AT2G05925.
DR   EnsemblGenomes-Gn; AT2G05945.
DR   EnsemblGenomes-Gn; AT2G05965.
DR   EnsemblGenomes-Gn; AT2G05975.
DR   EnsemblGenomes-Gn; AT2G05995.
DR   EnsemblGenomes-Gn; AT2G06002.
DR   EnsemblGenomes-Gn; AT2G06035.
DR   EnsemblGenomes-Gn; AT2G06065.
DR   EnsemblGenomes-Gn; AT2G06075.
DR   EnsemblGenomes-Gn; AT2G06085.
DR   EnsemblGenomes-Gn; AT2G06115.
DR   EnsemblGenomes-Gn; AT2G06135.
DR   EnsemblGenomes-Gn; AT2G06145.
DR   EnsemblGenomes-Gn; AT2G06175.
DR   EnsemblGenomes-Gn; AT2G06185.
DR   EnsemblGenomes-Gn; AT2G06210.
DR   EnsemblGenomes-Gn; AT2G06215.
DR   EnsemblGenomes-Gn; AT2G06225.
DR   EnsemblGenomes-Gn; AT2G06275.
DR   EnsemblGenomes-Gn; AT2G06305.
DR   EnsemblGenomes-Gn; AT2G06315.
DR   EnsemblGenomes-Gn; AT2G06345.
DR   EnsemblGenomes-Gn; AT2G06355.
DR   EnsemblGenomes-Gn; AT2G06365.
DR   EnsemblGenomes-Gn; AT2G06375.
DR   EnsemblGenomes-Gn; AT2G06385.
DR   EnsemblGenomes-Gn; AT2G06395.
DR   EnsemblGenomes-Gn; AT2G06405.
DR   EnsemblGenomes-Gn; AT2G06415.
DR   EnsemblGenomes-Gn; AT2G06435.
DR   EnsemblGenomes-Gn; AT2G06445.
DR   EnsemblGenomes-Gn; AT2G06455.
DR   EnsemblGenomes-Gn; AT2G06465.
DR   EnsemblGenomes-Gn; AT2G06475.
DR   EnsemblGenomes-Gn; AT2G06485.
DR   EnsemblGenomes-Gn; AT2G06495.
DR   EnsemblGenomes-Gn; AT2G06505.
DR   EnsemblGenomes-Gn; AT2G06515.
DR   EnsemblGenomes-Gn; AT2G06525.
DR   EnsemblGenomes-Gn; AT2G06535.
DR   EnsemblGenomes-Gn; AT2G06562.
DR   EnsemblGenomes-Gn; AT2G06575.
DR   EnsemblGenomes-Gn; AT2G06585.
DR   EnsemblGenomes-Gn; AT2G06595.
DR   EnsemblGenomes-Gn; AT2G06605.
DR   EnsemblGenomes-Gn; AT2G06615.
DR   EnsemblGenomes-Gn; AT2G06625.
DR   EnsemblGenomes-Gn; AT2G06635.
DR   EnsemblGenomes-Gn; AT2G06655.
DR   EnsemblGenomes-Gn; AT2G06665.
DR   EnsemblGenomes-Gn; AT2G06685.
DR   EnsemblGenomes-Gn; AT2G06695.
DR   EnsemblGenomes-Gn; AT2G06705.
DR   EnsemblGenomes-Gn; AT2G06725.
DR   EnsemblGenomes-Gn; AT2G06745.
DR   EnsemblGenomes-Gn; AT2G06755.
DR   EnsemblGenomes-Gn; AT2G06765.
DR   EnsemblGenomes-Gn; AT2G06785.
DR   EnsemblGenomes-Gn; AT2G06795.
DR   EnsemblGenomes-Gn; AT2G06805.
DR   EnsemblGenomes-Gn; AT2G06815.
DR   EnsemblGenomes-Gn; AT2G06835.
DR   EnsemblGenomes-Gn; AT2G06855.
DR   EnsemblGenomes-Gn; AT2G06865.
DR   EnsemblGenomes-Gn; AT2G06905.
DR   EnsemblGenomes-Gn; AT2G06935.
DR   EnsemblGenomes-Gn; AT2G06945.
DR   EnsemblGenomes-Gn; AT2G06955.
DR   EnsemblGenomes-Gn; AT2G06975.
DR   EnsemblGenomes-Gn; AT2G06995.
DR   EnsemblGenomes-Gn; AT2G07005.
DR   EnsemblGenomes-Gn; AT2G07015.
DR   EnsemblGenomes-Gn; AT2G07025.
DR   EnsemblGenomes-Gn; AT2G07035.
DR   EnsemblGenomes-Gn; AT2G07042.
DR   EnsemblGenomes-Gn; AT2G07045.
DR   EnsemblGenomes-Gn; AT2G07055.
DR   EnsemblGenomes-Gn; AT2G07085.
DR   EnsemblGenomes-Gn; AT2G07095.
DR   EnsemblGenomes-Gn; AT2G07115.
DR   EnsemblGenomes-Gn; AT2G07135.
DR   EnsemblGenomes-Gn; AT2G07165.
DR   EnsemblGenomes-Gn; AT2G07175.
DR   EnsemblGenomes-Gn; AT2G07195.
DR   EnsemblGenomes-Gn; AT2G07205.
DR   EnsemblGenomes-Gn; AT2G07213.
DR   EnsemblGenomes-Gn; AT2G07225.
DR   EnsemblGenomes-Gn; AT2G07235.
DR   EnsemblGenomes-Gn; AT2G07245.
DR   EnsemblGenomes-Gn; AT2G07255.
DR   EnsemblGenomes-Gn; AT2G07265.
DR   EnsemblGenomes-Gn; AT2G07275.
DR   EnsemblGenomes-Gn; AT2G07285.
DR   EnsemblGenomes-Gn; AT2G07295.
DR   EnsemblGenomes-Gn; AT2G07305.
DR   EnsemblGenomes-Gn; AT2G07315.
DR   EnsemblGenomes-Gn; AT2G07325.
DR   EnsemblGenomes-Gn; AT2G07335.
DR   EnsemblGenomes-Gn; AT2G07345.
DR   EnsemblGenomes-Gn; AT2G07355.
DR   EnsemblGenomes-Gn; AT2G07375.
DR   EnsemblGenomes-Gn; AT2G07385.
DR   EnsemblGenomes-Gn; AT2G07405.
DR   EnsemblGenomes-Gn; AT2G07415.
DR   EnsemblGenomes-Gn; AT2G07425.
DR   EnsemblGenomes-Gn; AT2G07435.
DR   EnsemblGenomes-Gn; AT2G07445.
DR   EnsemblGenomes-Gn; AT2G07475.
DR   EnsemblGenomes-Gn; AT2G07485.
DR   EnsemblGenomes-Gn; AT2G07495.
DR   EnsemblGenomes-Gn; AT2G07515.
DR   EnsemblGenomes-Gn; AT2G07525.
DR   EnsemblGenomes-Gn; AT2G07535.
DR   EnsemblGenomes-Gn; AT2G07545.
DR   EnsemblGenomes-Gn; AT2G07555.
DR   EnsemblGenomes-Gn; AT2G07575.
DR   EnsemblGenomes-Gn; AT2G07585.
DR   EnsemblGenomes-Gn; AT2G07595.
DR   EnsemblGenomes-Gn; AT2G07605.
DR   EnsemblGenomes-Gn; AT2G07615.
DR   EnsemblGenomes-Gn; AT2G07617.
DR   EnsemblGenomes-Gn; AT2G07645.
DR   EnsemblGenomes-Gn; AT2G07672.
DR   EnsemblGenomes-Gn; AT2G07673.
DR   EnsemblGenomes-Gn; AT2G07675.
DR   EnsemblGenomes-Gn; AT2G07687.
DR   EnsemblGenomes-Gn; AT2G07695.
DR   EnsemblGenomes-Gn; AT2G07722.
DR   EnsemblGenomes-Gn; AT2G07724.
DR   EnsemblGenomes-Gn; AT2G07727.
DR   EnsemblGenomes-Gn; AT2G07734.
DR   EnsemblGenomes-Gn; AT2G07739.
DR   EnsemblGenomes-Gn; AT2G07743.
DR   EnsemblGenomes-Gn; AT2G07745.
DR   EnsemblGenomes-Gn; AT2G07746.
DR   EnsemblGenomes-Gn; AT2G07748.
DR   EnsemblGenomes-Gn; AT2G07752.
DR   EnsemblGenomes-Gn; AT2G07753.
DR   EnsemblGenomes-Gn; AT2G07754.
DR   EnsemblGenomes-Gn; AT2G07755.
DR   EnsemblGenomes-Gn; AT2G07756.
DR   EnsemblGenomes-Gn; AT2G07757.
DR   EnsemblGenomes-Gn; AT2G07758.
DR   EnsemblGenomes-Gn; AT2G07759.
DR   EnsemblGenomes-Gn; AT2G07761.
DR   EnsemblGenomes-Gn; AT2G07762.
DR   EnsemblGenomes-Gn; AT2G07763.
DR   EnsemblGenomes-Gn; AT2G07764.
DR   EnsemblGenomes-Gn; AT2G07765.
DR   EnsemblGenomes-Gn; AT2G07766.
DR   EnsemblGenomes-Gn; AT2G07792.
DR   EnsemblGenomes-Gn; AT2G07793.
DR   EnsemblGenomes-Gn; AT2G07794.
DR   EnsemblGenomes-Gn; AT2G07805.
DR   EnsemblGenomes-Gn; AT2G07840.
DR   EnsemblGenomes-Gn; AT2G07845.
DR   EnsemblGenomes-Gn; AT2G07850.
DR   EnsemblGenomes-Gn; AT2G07855.
DR   EnsemblGenomes-Gn; AT2G07860.
DR   EnsemblGenomes-Gn; AT2G07865.
DR   EnsemblGenomes-Gn; AT2G07870.
DR   EnsemblGenomes-Gn; AT2G07875.
DR   EnsemblGenomes-Gn; AT2G07885.
DR   EnsemblGenomes-Gn; AT2G07890.
DR   EnsemblGenomes-Gn; AT2G07895.
DR   EnsemblGenomes-Gn; AT2G07900.
DR   EnsemblGenomes-Gn; AT2G07905.
DR   EnsemblGenomes-Gn; AT2G07910.
DR   EnsemblGenomes-Gn; AT2G07915.
DR   EnsemblGenomes-Gn; AT2G07925.
DR   EnsemblGenomes-Gn; AT2G07935.
DR   EnsemblGenomes-Gn; AT2G07940.
DR   EnsemblGenomes-Gn; AT2G07945.
DR   EnsemblGenomes-Gn; AT2G07950.
DR   EnsemblGenomes-Gn; AT2G07960.
DR   EnsemblGenomes-Gn; AT2G07965.
DR   EnsemblGenomes-Gn; AT2G07970.
DR   EnsemblGenomes-Gn; AT2G07975.
DR   EnsemblGenomes-Gn; AT2G07985.
DR   EnsemblGenomes-Gn; AT2G07990.
DR   EnsemblGenomes-Gn; AT2G07995.
DR   EnsemblGenomes-Gn; AT2G08000.
DR   EnsemblGenomes-Gn; AT2G08005.
DR   EnsemblGenomes-Gn; AT2G08010.
DR   EnsemblGenomes-Gn; AT2G08015.
DR   EnsemblGenomes-Gn; AT2G08020.
DR   EnsemblGenomes-Gn; AT2G08025.
DR   EnsemblGenomes-Gn; AT2G08030.
DR   EnsemblGenomes-Gn; AT2G08035.
DR   EnsemblGenomes-Gn; AT2G08040.
DR   EnsemblGenomes-Gn; AT2G08045.
DR   EnsemblGenomes-Gn; AT2G08050.
DR   EnsemblGenomes-Gn; AT2G08055.
DR   EnsemblGenomes-Gn; AT2G08060.
DR   EnsemblGenomes-Gn; AT2G08070.
DR   EnsemblGenomes-Gn; AT2G08075.
DR   EnsemblGenomes-Gn; AT2G08085.
DR   EnsemblGenomes-Gn; AT2G08090.
DR   EnsemblGenomes-Gn; AT2G08095.
DR   EnsemblGenomes-Gn; AT2G08100.
DR   EnsemblGenomes-Gn; AT2G08105.
DR   EnsemblGenomes-Gn; AT2G08110.
DR   EnsemblGenomes-Gn; AT2G08115.
DR   EnsemblGenomes-Gn; AT2G08120.
DR   EnsemblGenomes-Gn; AT2G08125.
DR   EnsemblGenomes-Gn; AT2G08130.
DR   EnsemblGenomes-Gn; AT2G08135.
DR   EnsemblGenomes-Gn; AT2G08150.
DR   EnsemblGenomes-Gn; AT2G08155.
DR   EnsemblGenomes-Gn; AT2G08160.
DR   EnsemblGenomes-Gn; AT2G08165.
DR   EnsemblGenomes-Gn; AT2G08175.
DR   EnsemblGenomes-Gn; AT2G08180.
DR   EnsemblGenomes-Gn; AT2G08190.
DR   EnsemblGenomes-Gn; AT2G08195.
DR   EnsemblGenomes-Gn; AT2G08200.
DR   EnsemblGenomes-Gn; AT2G08205.
DR   EnsemblGenomes-Gn; AT2G08210.
DR   EnsemblGenomes-Gn; AT2G08215.
DR   EnsemblGenomes-Gn; AT2G08220.
DR   EnsemblGenomes-Gn; AT2G08230.
DR   EnsemblGenomes-Gn; AT2G08235.
DR   EnsemblGenomes-Gn; AT2G08240.
DR   EnsemblGenomes-Gn; AT2G08245.
DR   EnsemblGenomes-Gn; AT2G08250.
DR   EnsemblGenomes-Gn; AT2G08255.
DR   EnsemblGenomes-Gn; AT2G08260.
DR   EnsemblGenomes-Gn; AT2G08265.
DR   EnsemblGenomes-Gn; AT2G08270.
DR   EnsemblGenomes-Gn; AT2G08275.
DR   EnsemblGenomes-Gn; AT2G08280.
DR   EnsemblGenomes-Gn; AT2G08285.
DR   EnsemblGenomes-Gn; AT2G08290.
DR   EnsemblGenomes-Gn; AT2G08295.
DR   EnsemblGenomes-Gn; AT2G08300.
DR   EnsemblGenomes-Gn; AT2G08305.
DR   EnsemblGenomes-Gn; AT2G08310.
DR   EnsemblGenomes-Gn; AT2G08315.
DR   EnsemblGenomes-Gn; AT2G08320.
DR   EnsemblGenomes-Gn; AT2G08330.
DR   EnsemblGenomes-Gn; AT2G08335.
DR   EnsemblGenomes-Gn; AT2G08340.
DR   EnsemblGenomes-Gn; AT2G08345.
DR   EnsemblGenomes-Gn; AT2G08350.
DR   EnsemblGenomes-Gn; AT2G08355.
DR   EnsemblGenomes-Gn; AT2G08360.
DR   EnsemblGenomes-Gn; AT2G08365.
DR   EnsemblGenomes-Gn; AT2G08370.
DR   EnsemblGenomes-Gn; AT2G08375.
DR   EnsemblGenomes-Gn; AT2G08380.
DR   EnsemblGenomes-Gn; AT2G08385.
DR   EnsemblGenomes-Gn; AT2G08390.
DR   EnsemblGenomes-Gn; AT2G08395.
DR   EnsemblGenomes-Gn; AT2G08400.
DR   EnsemblGenomes-Gn; AT2G08405.
DR   EnsemblGenomes-Gn; AT2G08410.
DR   EnsemblGenomes-Gn; AT2G08415.
DR   EnsemblGenomes-Gn; AT2G08420.
DR   EnsemblGenomes-Gn; AT2G08425.
DR   EnsemblGenomes-Gn; AT2G08430.
DR   EnsemblGenomes-Gn; AT2G08435.
DR   EnsemblGenomes-Gn; AT2G08440.
DR   EnsemblGenomes-Gn; AT2G08445.
DR   EnsemblGenomes-Gn; AT2G08450.
DR   EnsemblGenomes-Gn; AT2G08455.
DR   EnsemblGenomes-Gn; AT2G08460.
DR   EnsemblGenomes-Gn; AT2G08465.
DR   EnsemblGenomes-Gn; AT2G08470.
DR   EnsemblGenomes-Gn; AT2G08475.
DR   EnsemblGenomes-Gn; AT2G08480.
DR   EnsemblGenomes-Gn; AT2G08485.
DR   EnsemblGenomes-Gn; AT2G08490.
DR   EnsemblGenomes-Gn; AT2G08495.
DR   EnsemblGenomes-Gn; AT2G08500.
DR   EnsemblGenomes-Gn; AT2G08505.
DR   EnsemblGenomes-Gn; AT2G08510.
DR   EnsemblGenomes-Gn; AT2G08515.
DR   EnsemblGenomes-Gn; AT2G08520.
DR   EnsemblGenomes-Gn; AT2G08525.
DR   EnsemblGenomes-Gn; AT2G08530.
DR   EnsemblGenomes-Gn; AT2G08535.
DR   EnsemblGenomes-Gn; AT2G08540.
DR   EnsemblGenomes-Gn; AT2G08545.
DR   EnsemblGenomes-Gn; AT2G08550.
DR   EnsemblGenomes-Gn; AT2G08555.
DR   EnsemblGenomes-Gn; AT2G08560.
DR   EnsemblGenomes-Gn; AT2G08565.
DR   EnsemblGenomes-Gn; AT2G08570.
DR   EnsemblGenomes-Gn; AT2G08575.
DR   EnsemblGenomes-Gn; AT2G08580.
DR   EnsemblGenomes-Gn; AT2G08585.
DR   EnsemblGenomes-Gn; AT2G08590.
DR   EnsemblGenomes-Gn; AT2G08595.
DR   EnsemblGenomes-Gn; AT2G08610.
DR   EnsemblGenomes-Gn; AT2G08620.
DR   EnsemblGenomes-Gn; AT2G08625.
DR   EnsemblGenomes-Gn; AT2G08630.
DR   EnsemblGenomes-Gn; AT2G08635.
DR   EnsemblGenomes-Gn; AT2G08640.
DR   EnsemblGenomes-Gn; AT2G08645.
DR   EnsemblGenomes-Gn; AT2G08650.
DR   EnsemblGenomes-Gn; AT2G08655.
DR   EnsemblGenomes-Gn; AT2G08660.
DR   EnsemblGenomes-Gn; AT2G08665.
DR   EnsemblGenomes-Gn; AT2G08670.
DR   EnsemblGenomes-Gn; AT2G08675.
DR   EnsemblGenomes-Gn; AT2G08680.
DR   EnsemblGenomes-Gn; AT2G08685.
DR   EnsemblGenomes-Gn; AT2G08690.
DR   EnsemblGenomes-Gn; AT2G08695.
DR   EnsemblGenomes-Gn; AT2G08700.
DR   EnsemblGenomes-Gn; AT2G08705.
DR   EnsemblGenomes-Gn; AT2G08710.
DR   EnsemblGenomes-Gn; AT2G08715.
DR   EnsemblGenomes-Gn; AT2G08720.
DR   EnsemblGenomes-Gn; AT2G08725.
DR   EnsemblGenomes-Gn; AT2G08730.
DR   EnsemblGenomes-Gn; AT2G08735.
DR   EnsemblGenomes-Gn; AT2G08740.
DR   EnsemblGenomes-Gn; AT2G08745.
DR   EnsemblGenomes-Gn; AT2G08750.
DR   EnsemblGenomes-Gn; AT2G08755.
DR   EnsemblGenomes-Gn; AT2G08760.
DR   EnsemblGenomes-Gn; AT2G08765.
DR   EnsemblGenomes-Gn; AT2G08770.
DR   EnsemblGenomes-Gn; AT2G08775.
DR   EnsemblGenomes-Gn; AT2G08780.
DR   EnsemblGenomes-Gn; AT2G08790.
DR   EnsemblGenomes-Gn; AT2G08795.
DR   EnsemblGenomes-Gn; AT2G08800.
DR   EnsemblGenomes-Gn; AT2G08805.
DR   EnsemblGenomes-Gn; AT2G08815.
DR   EnsemblGenomes-Gn; AT2G08820.
DR   EnsemblGenomes-Gn; AT2G08825.
DR   EnsemblGenomes-Gn; AT2G08830.
DR   EnsemblGenomes-Gn; AT2G08835.
DR   EnsemblGenomes-Gn; AT2G08845.
DR   EnsemblGenomes-Gn; AT2G08850.
DR   EnsemblGenomes-Gn; AT2G08855.
DR   EnsemblGenomes-Gn; AT2G08860.
DR   EnsemblGenomes-Gn; AT2G08865.
DR   EnsemblGenomes-Gn; AT2G08870.
DR   EnsemblGenomes-Gn; AT2G08875.
DR   EnsemblGenomes-Gn; AT2G08880.
DR   EnsemblGenomes-Gn; AT2G08885.
DR   EnsemblGenomes-Gn; AT2G08890.
DR   EnsemblGenomes-Gn; AT2G08895.
DR   EnsemblGenomes-Gn; AT2G08900.
DR   EnsemblGenomes-Gn; AT2G08905.
DR   EnsemblGenomes-Gn; AT2G08910.
DR   EnsemblGenomes-Gn; AT2G08915.
DR   EnsemblGenomes-Gn; AT2G08920.
DR   EnsemblGenomes-Gn; AT2G08925.
DR   EnsemblGenomes-Gn; AT2G08930.
DR   EnsemblGenomes-Gn; AT2G08935.
DR   EnsemblGenomes-Gn; AT2G08940.
DR   EnsemblGenomes-Gn; AT2G08945.
DR   EnsemblGenomes-Gn; AT2G08950.
DR   EnsemblGenomes-Gn; AT2G08955.
DR   EnsemblGenomes-Gn; AT2G08960.
DR   EnsemblGenomes-Gn; AT2G08965.
DR   EnsemblGenomes-Gn; AT2G08970.
DR   EnsemblGenomes-Gn; AT2G08975.
DR   EnsemblGenomes-Gn; AT2G08980.
DR   EnsemblGenomes-Gn; AT2G08985.
DR   EnsemblGenomes-Gn; AT2G08990.
DR   EnsemblGenomes-Gn; AT2G08995.
DR   EnsemblGenomes-Gn; AT2G09000.
DR   EnsemblGenomes-Gn; AT2G09005.
DR   EnsemblGenomes-Gn; AT2G09010.
DR   EnsemblGenomes-Gn; AT2G09015.
DR   EnsemblGenomes-Gn; AT2G09020.
DR   EnsemblGenomes-Gn; AT2G09025.
DR   EnsemblGenomes-Gn; AT2G09035.
DR   EnsemblGenomes-Gn; AT2G09040.
DR   EnsemblGenomes-Gn; AT2G09045.
DR   EnsemblGenomes-Gn; AT2G09050.
DR   EnsemblGenomes-Gn; AT2G09055.
DR   EnsemblGenomes-Gn; AT2G09060.
DR   EnsemblGenomes-Gn; AT2G09065.
DR   EnsemblGenomes-Gn; AT2G09070.
DR   EnsemblGenomes-Gn; AT2G09075.
DR   EnsemblGenomes-Gn; AT2G09080.
DR   EnsemblGenomes-Gn; AT2G09085.
DR   EnsemblGenomes-Gn; AT2G09090.
DR   EnsemblGenomes-Gn; AT2G09095.
DR   EnsemblGenomes-Gn; AT2G09100.
DR   EnsemblGenomes-Gn; AT2G09105.
DR   EnsemblGenomes-Gn; AT2G09110.
DR   EnsemblGenomes-Gn; AT2G09115.
DR   EnsemblGenomes-Gn; AT2G09120.
DR   EnsemblGenomes-Gn; AT2G09125.
DR   EnsemblGenomes-Gn; AT2G09130.
DR   EnsemblGenomes-Gn; AT2G09135.
DR   EnsemblGenomes-Gn; AT2G09140.
DR   EnsemblGenomes-Gn; AT2G09150.
DR   EnsemblGenomes-Gn; AT2G09155.
DR   EnsemblGenomes-Gn; AT2G09160.
DR   EnsemblGenomes-Gn; AT2G09165.
DR   EnsemblGenomes-Gn; AT2G09170.
DR   EnsemblGenomes-Gn; AT2G09175.
DR   EnsemblGenomes-Gn; AT2G09180.
DR   EnsemblGenomes-Gn; AT2G09185.
DR   EnsemblGenomes-Gn; AT2G09190.
DR   EnsemblGenomes-Gn; AT2G09195.
DR   EnsemblGenomes-Gn; AT2G09200.
DR   EnsemblGenomes-Gn; AT2G09205.
DR   EnsemblGenomes-Gn; AT2G09210.
DR   EnsemblGenomes-Gn; AT2G09215.
DR   EnsemblGenomes-Gn; AT2G09220.
DR   EnsemblGenomes-Gn; AT2G09225.
DR   EnsemblGenomes-Gn; AT2G09230.
DR   EnsemblGenomes-Gn; AT2G09235.
DR   EnsemblGenomes-Gn; AT2G09240.
DR   EnsemblGenomes-Gn; AT2G09245.
DR   EnsemblGenomes-Gn; AT2G09250.
DR   EnsemblGenomes-Gn; AT2G09255.
DR   EnsemblGenomes-Gn; AT2G09260.
DR   EnsemblGenomes-Gn; AT2G09265.
DR   EnsemblGenomes-Gn; AT2G09270.
DR   EnsemblGenomes-Gn; AT2G09280.
DR   EnsemblGenomes-Gn; AT2G09285.
DR   EnsemblGenomes-Gn; AT2G09290.
DR   EnsemblGenomes-Gn; AT2G09295.
DR   EnsemblGenomes-Gn; AT2G09300.
DR   EnsemblGenomes-Gn; AT2G09305.
DR   EnsemblGenomes-Gn; AT2G09310.
DR   EnsemblGenomes-Gn; AT2G09315.
DR   EnsemblGenomes-Gn; AT2G09320.
DR   EnsemblGenomes-Gn; AT2G09325.
DR   EnsemblGenomes-Gn; AT2G09330.
DR   EnsemblGenomes-Gn; AT2G09335.
DR   EnsemblGenomes-Gn; AT2G09340.
DR   EnsemblGenomes-Gn; AT2G09345.
DR   EnsemblGenomes-Gn; AT2G09350.
DR   EnsemblGenomes-Gn; AT2G09355.
DR   EnsemblGenomes-Gn; AT2G09360.
DR   EnsemblGenomes-Gn; AT2G09365.
DR   EnsemblGenomes-Gn; AT2G09370.
DR   EnsemblGenomes-Gn; AT2G09375.
DR   EnsemblGenomes-Gn; AT2G09380.
DR   EnsemblGenomes-Gn; AT2G09385.
DR   EnsemblGenomes-Gn; AT2G09390.
DR   EnsemblGenomes-Gn; AT2G09395.
DR   EnsemblGenomes-Gn; AT2G09400.
DR   EnsemblGenomes-Gn; AT2G09405.
DR   EnsemblGenomes-Gn; AT2G09410.
DR   EnsemblGenomes-Gn; AT2G09415.
DR   EnsemblGenomes-Gn; AT2G09420.
DR   EnsemblGenomes-Gn; AT2G09425.
DR   EnsemblGenomes-Gn; AT2G09430.
DR   EnsemblGenomes-Gn; AT2G09435.
DR   EnsemblGenomes-Gn; AT2G09440.
DR   EnsemblGenomes-Gn; AT2G09445.
DR   EnsemblGenomes-Gn; AT2G09450.
DR   EnsemblGenomes-Gn; AT2G09455.
DR   EnsemblGenomes-Gn; AT2G09460.
DR   EnsemblGenomes-Gn; AT2G09465.
DR   EnsemblGenomes-Gn; AT2G09470.
DR   EnsemblGenomes-Gn; AT2G09475.
DR   EnsemblGenomes-Gn; AT2G09480.
DR   EnsemblGenomes-Gn; AT2G09490.
DR   EnsemblGenomes-Gn; AT2G09495.
DR   EnsemblGenomes-Gn; AT2G09500.
DR   EnsemblGenomes-Gn; AT2G09505.
DR   EnsemblGenomes-Gn; AT2G09510.
DR   EnsemblGenomes-Gn; AT2G09515.
DR   EnsemblGenomes-Gn; AT2G09525.
DR   EnsemblGenomes-Gn; AT2G09530.
DR   EnsemblGenomes-Gn; AT2G09535.
DR   EnsemblGenomes-Gn; AT2G09540.
DR   EnsemblGenomes-Gn; AT2G09545.
DR   EnsemblGenomes-Gn; AT2G09550.
DR   EnsemblGenomes-Gn; AT2G09555.
DR   EnsemblGenomes-Gn; AT2G09560.
DR   EnsemblGenomes-Gn; AT2G09565.
DR   EnsemblGenomes-Gn; AT2G09570.
DR   EnsemblGenomes-Gn; AT2G09575.
DR   EnsemblGenomes-Gn; AT2G09585.
DR   EnsemblGenomes-Gn; AT2G09590.
DR   EnsemblGenomes-Gn; AT2G09605.
DR   EnsemblGenomes-Gn; AT2G09610.
DR   EnsemblGenomes-Gn; AT2G09615.
DR   EnsemblGenomes-Gn; AT2G09620.
DR   EnsemblGenomes-Gn; AT2G09625.
DR   EnsemblGenomes-Gn; AT2G09630.
DR   EnsemblGenomes-Gn; AT2G09635.
DR   EnsemblGenomes-Gn; AT2G09640.
DR   EnsemblGenomes-Gn; AT2G09645.
DR   EnsemblGenomes-Gn; AT2G09650.
DR   EnsemblGenomes-Gn; AT2G09655.
DR   EnsemblGenomes-Gn; AT2G09660.
DR   EnsemblGenomes-Gn; AT2G09665.
DR   EnsemblGenomes-Gn; AT2G09670.
DR   EnsemblGenomes-Gn; AT2G09675.
DR   EnsemblGenomes-Gn; AT2G09680.
DR   EnsemblGenomes-Gn; AT2G09685.
DR   EnsemblGenomes-Gn; AT2G09690.
DR   EnsemblGenomes-Gn; AT2G09695.
DR   EnsemblGenomes-Gn; AT2G09700.
DR   EnsemblGenomes-Gn; AT2G09705.
DR   EnsemblGenomes-Gn; AT2G09710.
DR   EnsemblGenomes-Gn; AT2G09715.
DR   EnsemblGenomes-Gn; AT2G09720.
DR   EnsemblGenomes-Gn; AT2G09725.
DR   EnsemblGenomes-Gn; AT2G09730.
DR   EnsemblGenomes-Gn; AT2G09735.
DR   EnsemblGenomes-Gn; AT2G09740.
DR   EnsemblGenomes-Gn; AT2G09745.
DR   EnsemblGenomes-Gn; AT2G09750.
DR   EnsemblGenomes-Gn; AT2G09755.
DR   EnsemblGenomes-Gn; AT2G09760.
DR   EnsemblGenomes-Gn; AT2G09765.
DR   EnsemblGenomes-Gn; AT2G09770.
DR   EnsemblGenomes-Gn; AT2G09775.
DR   EnsemblGenomes-Gn; AT2G09780.
DR   EnsemblGenomes-Gn; AT2G09785.
DR   EnsemblGenomes-Gn; AT2G09795.
DR   EnsemblGenomes-Gn; AT2G09805.
DR   EnsemblGenomes-Gn; AT2G09815.
DR   EnsemblGenomes-Gn; AT2G09825.
DR   EnsemblGenomes-Gn; AT2G09835.
DR   EnsemblGenomes-Gn; AT2G09845.
DR   EnsemblGenomes-Gn; AT2G09875.
DR   EnsemblGenomes-Gn; AT2G09885.
DR   EnsemblGenomes-Gn; AT2G09895.
DR   EnsemblGenomes-Gn; AT2G09905.
DR   EnsemblGenomes-Gn; AT2G09915.
DR   EnsemblGenomes-Gn; AT2G09925.
DR   EnsemblGenomes-Gn; AT2G09935.
DR   EnsemblGenomes-Gn; AT2G09945.
DR   EnsemblGenomes-Gn; AT2G09955.
DR   EnsemblGenomes-Gn; AT2G09965.
DR   EnsemblGenomes-Gn; AT2G09975.
DR   EnsemblGenomes-Gn; AT2G09995.
DR   EnsemblGenomes-Gn; AT2G10537.
DR   EnsemblGenomes-Gn; AT2G10606.
DR   EnsemblGenomes-Gn; AT2G10921.
DR   EnsemblGenomes-Gn; AT2G11852.
DR   EnsemblGenomes-Gn; AT2G13100.
DR   EnsemblGenomes-Gn; AT2G13665.
DR   EnsemblGenomes-Gn; AT2G14115.
DR   EnsemblGenomes-Gn; AT2G14440.
DR   EnsemblGenomes-Gn; AT2G14878.
DR   EnsemblGenomes-Gn; AT2G15128.
DR   EnsemblGenomes-Gn; AT2G15292.
DR   EnsemblGenomes-Gn; AT2G15555.
DR   EnsemblGenomes-Gn; AT2G15950.
DR   EnsemblGenomes-Gn; AT2G16145.
DR   EnsemblGenomes-Gn; AT2G16240.
DR   EnsemblGenomes-Gn; AT2G16245.
DR   EnsemblGenomes-Gn; AT2G16360.
DR   EnsemblGenomes-Gn; AT2G17260.
DR   EnsemblGenomes-Gn; AT2G17295.
DR   EnsemblGenomes-Gn; AT2G17770.
DR   EnsemblGenomes-Gn; AT2G17810.
DR   EnsemblGenomes-Gn; AT2G17900.
DR   EnsemblGenomes-Gn; AT2G18310.
DR   EnsemblGenomes-Gn; AT2G18440.
DR   EnsemblGenomes-Gn; AT2G18735.
DR   EnsemblGenomes-Gn; AT2G18917.
DR   EnsemblGenomes-Gn; AT2G19425.
DR   EnsemblGenomes-Gn; AT2G19572.
DR   EnsemblGenomes-Gn; AT2G19582.
DR   EnsemblGenomes-Gn; AT2G19796.
DR   EnsemblGenomes-Gn; AT2G19830.
DR   EnsemblGenomes-Gn; AT2G19940.
DR   EnsemblGenomes-Gn; AT2G20625.
DR   EnsemblGenomes-Gn; AT2G20721.
DR   EnsemblGenomes-Gn; AT2G20722.
DR   EnsemblGenomes-Gn; AT2G20723.
DR   EnsemblGenomes-Gn; AT2G21105.
DR   EnsemblGenomes-Gn; AT2G21187.
DR   EnsemblGenomes-Gn; AT2G21188.
DR   EnsemblGenomes-Gn; AT2G21360.
DR   EnsemblGenomes-Gn; AT2G21570.
DR   EnsemblGenomes-Gn; AT2G21670.
DR   EnsemblGenomes-Gn; AT2G21700.
DR   EnsemblGenomes-Gn; AT2G21930.
DR   EnsemblGenomes-Gn; AT2G22110.
DR   EnsemblGenomes-Gn; AT2G22220.
DR   EnsemblGenomes-Gn; AT2G22280.
DR   EnsemblGenomes-Gn; AT2G22380.
DR   EnsemblGenomes-Gn; AT2G22482.
DR   EnsemblGenomes-Gn; AT2G22496.
DR   EnsemblGenomes-Gn; AT2G22580.
DR   EnsemblGenomes-Gn; AT2G22668.
DR   EnsemblGenomes-Gn; AT2G22821.
DR   EnsemblGenomes-Gn; AT2G22941.
DR   EnsemblGenomes-Gn; AT2G22955.
DR   EnsemblGenomes-Gn; AT2G22960.
DR   EnsemblGenomes-Gn; AT2G23020.
DR   EnsemblGenomes-Gn; AT2G23040.
DR   EnsemblGenomes-Gn; AT2G23347.
DR   EnsemblGenomes-Gn; AT2G23445.
DR   EnsemblGenomes-Gn; AT2G23570.
DR   EnsemblGenomes-Gn; AT2G23650.
DR   EnsemblGenomes-Gn; AT2G23672.
DR   EnsemblGenomes-Gn; AT2G24103.
DR   EnsemblGenomes-Gn; AT2G24380.
DR   EnsemblGenomes-Gn; AT2G24545.
DR   EnsemblGenomes-Gn; AT2G24592.
DR   EnsemblGenomes-Gn; AT2G24735.
DR   EnsemblGenomes-Gn; AT2G24755.
DR   EnsemblGenomes-Gn; AT2G25011.
DR   EnsemblGenomes-Gn; AT2G25050.
DR   EnsemblGenomes-Gn; AT2G25095.
DR   EnsemblGenomes-Gn; AT2G25171.
DR   EnsemblGenomes-Gn; AT2G25210.
DR   EnsemblGenomes-Gn; AT2G25400.
DR   EnsemblGenomes-Gn; AT2G25540.
DR   EnsemblGenomes-Gn; AT2G26090.
DR   EnsemblGenomes-Gn; AT2G26211.
DR   EnsemblGenomes-Gn; AT2G26260.
DR   EnsemblGenomes-Gn; AT2G26355.
DR   EnsemblGenomes-Gn; AT2G26692.
DR   EnsemblGenomes-Gn; AT2G26882.
DR   EnsemblGenomes-Gn; AT2G27400.
DR   EnsemblGenomes-Gn; AT2G27560.
DR   EnsemblGenomes-Gn; AT2G27850.
DR   EnsemblGenomes-Gn; AT2G28056.
DR   EnsemblGenomes-Gn; AT2G28730.
DR   EnsemblGenomes-Gn; AT2G28770.
DR   EnsemblGenomes-Gn; AT2G28830.
DR   EnsemblGenomes-Gn; AT2G29030.
DR   EnsemblGenomes-Gn; AT2G29040.
DR   EnsemblGenomes-Gn; AT2G29170.
DR   EnsemblGenomes-Gn; AT2G29520.
DR   EnsemblGenomes-Gn; AT2G30115.
DR   EnsemblGenomes-Gn; AT2G30180.
DR   EnsemblGenomes-Gn; AT2G30190.
DR   EnsemblGenomes-Gn; AT2G30362.
DR   EnsemblGenomes-Gn; AT2G30450.
DR   EnsemblGenomes-Gn; AT2G30850.
DR   EnsemblGenomes-Gn; AT2G30945.
DR   EnsemblGenomes-Gn; AT2G30984.
DR   EnsemblGenomes-Gn; AT2G31100.
DR   EnsemblGenomes-Gn; AT2G31220.
DR   EnsemblGenomes-Gn; AT2G31550.
DR   EnsemblGenomes-Gn; AT2G31585.
DR   EnsemblGenomes-Gn; AT2G31751.
DR   EnsemblGenomes-Gn; AT2G31902.
DR   EnsemblGenomes-Gn; AT2G31957.
DR   EnsemblGenomes-Gn; AT2G32110.
DR   EnsemblGenomes-Gn; AT2G32179.
DR   EnsemblGenomes-Gn; AT2G32273.
DR   EnsemblGenomes-Gn; AT2G32315.
DR   EnsemblGenomes-Gn; AT2G32698.
DR   EnsemblGenomes-Gn; AT2G32795.
DR   EnsemblGenomes-Gn; AT2G33051.
DR   EnsemblGenomes-Gn; AT2G33140.
DR   EnsemblGenomes-Gn; AT2G33650.
DR   EnsemblGenomes-Gn; AT2G33660.
DR   EnsemblGenomes-Gn; AT2G33815.
DR   EnsemblGenomes-Gn; AT2G33890.
DR   EnsemblGenomes-Gn; AT2G33900.
DR   EnsemblGenomes-Gn; AT2G33910.
DR   EnsemblGenomes-Gn; AT2G33920.
DR   EnsemblGenomes-Gn; AT2G33930.
DR   EnsemblGenomes-Gn; AT2G33940.
DR   EnsemblGenomes-Gn; AT2G33950.
DR   EnsemblGenomes-Gn; AT2G33960.
DR   EnsemblGenomes-Gn; AT2G33970.
DR   EnsemblGenomes-Gn; AT2G34202.
DR   EnsemblGenomes-Gn; AT2G34204.
DR   EnsemblGenomes-Gn; AT2G34208.
DR   EnsemblGenomes-Gn; AT2G34950.
DR   EnsemblGenomes-Gn; AT2G34985.
DR   EnsemblGenomes-Gn; AT2G35220.
DR   EnsemblGenomes-Gn; AT2G35382.
DR   EnsemblGenomes-Gn; AT2G35384.
DR   EnsemblGenomes-Gn; AT2G35387.
DR   EnsemblGenomes-Gn; AT2G35637.
DR   EnsemblGenomes-Gn; AT2G35738.
DR   EnsemblGenomes-Gn; AT2G35742.
DR   EnsemblGenomes-Gn; AT2G35744.
DR   EnsemblGenomes-Gn; AT2G35747.
DR   EnsemblGenomes-Gn; AT2G35859.
DR   EnsemblGenomes-Gn; AT2G35945.
DR   EnsemblGenomes-Gn; AT2G36140.
DR   EnsemblGenomes-Gn; AT2G36150.
DR   EnsemblGenomes-Gn; AT2G36280.
DR   EnsemblGenomes-Gn; AT2G36307.
DR   EnsemblGenomes-Gn; AT2G36510.
DR   EnsemblGenomes-Gn; AT2G36520.
DR   EnsemblGenomes-Gn; AT2G36600.
DR   EnsemblGenomes-Gn; AT2G36792.
DR   EnsemblGenomes-Gn; AT2G36860.
DR   EnsemblGenomes-Gn; AT2G37362.
DR   EnsemblGenomes-Gn; AT2G37555.
DR   EnsemblGenomes-Gn; AT2G38030.
DR   EnsemblGenomes-Gn; AT2G38325.
DR   EnsemblGenomes-Gn; AT2G39175.
DR   EnsemblGenomes-Gn; AT2G39600.
DR   EnsemblGenomes-Gn; AT2G39610.
DR   EnsemblGenomes-Gn; AT2G39675.
DR   EnsemblGenomes-Gn; AT2G39681.
DR   EnsemblGenomes-Gn; AT2G39860.
DR   EnsemblGenomes-Gn; AT2G39885.
DR   EnsemblGenomes-Gn; AT2G40008.
DR   EnsemblGenomes-Gn; AT2G40440.
DR   EnsemblGenomes-Gn; AT2G40700.
DR   EnsemblGenomes-Gn; AT2G40805.
DR   EnsemblGenomes-Gn; AT2G41178.
DR   EnsemblGenomes-Gn; AT2G41312.
DR   EnsemblGenomes-Gn; AT2G41616.
DR   EnsemblGenomes-Gn; AT2G42020.
DR   EnsemblGenomes-Gn; AT2G42247.
DR   EnsemblGenomes-Gn; AT2G42365.
DR   EnsemblGenomes-Gn; AT2G42388.
DR   EnsemblGenomes-Gn; AT2G42420.
DR   EnsemblGenomes-Gn; AT2G42425.
DR   EnsemblGenomes-Gn; AT2G42485.
DR   EnsemblGenomes-Gn; AT2G42835.
DR   EnsemblGenomes-Gn; AT2G42970.
DR   EnsemblGenomes-Gn; AT2G43137.
DR   EnsemblGenomes-Gn; AT2G43138.
DR   EnsemblGenomes-Gn; AT2G43139.
DR   EnsemblGenomes-Gn; AT2G43141.
DR   EnsemblGenomes-Gn; AT2G43300.
DR   EnsemblGenomes-Gn; AT2G43375.
DR   EnsemblGenomes-Gn; AT2G43910.
DR   EnsemblGenomes-Gn; AT2G44255.
DR   EnsemblGenomes-Gn; AT2G44320.
DR   EnsemblGenomes-Gn; AT2G44798.
DR   EnsemblGenomes-Gn; AT2G44810.
DR   EnsemblGenomes-Gn; AT2G44995.
DR   EnsemblGenomes-Gn; AT2G45020.
DR   EnsemblGenomes-Gn; AT2G45023.
DR   EnsemblGenomes-Gn; AT2G45245.
DR   EnsemblGenomes-Gn; AT2G45315.
DR   EnsemblGenomes-Gn; AT2G45390.
DR   EnsemblGenomes-Gn; AT2G45685.
DR   EnsemblGenomes-Gn; AT2G45780.
DR   EnsemblGenomes-Gn; AT2G46120.
DR   EnsemblGenomes-Gn; AT2G46192.
DR   EnsemblGenomes-Gn; AT2G46255.
DR   EnsemblGenomes-Gn; AT2G46493.
DR   EnsemblGenomes-Gn; AT2G46572.
DR   EnsemblGenomes-Gn; AT2G46685.
DR   EnsemblGenomes-Gn; AT2G47015.
DR   EnsemblGenomes-Gn; AT2G47100.
DR   EnsemblGenomes-Gn; AT2G47220.
DR   EnsemblGenomes-Gn; AT2G47275.
DR   EnsemblGenomes-Gn; AT2G47570.
DR   EnsemblGenomes-Gn; AT2G47585.
DR   EnsemblGenomes-Gn; AT2G47740.
DR   EnsemblGenomes-Gn; AT2G47895.
DR   EnsemblGenomes-Gn; ENSRNA049492366.
DR   EnsemblGenomes-Gn; ENSRNA049492367.
DR   EnsemblGenomes-Gn; ENSRNA049492369.
DR   EnsemblGenomes-Gn; ENSRNA049492370.
DR   EnsemblGenomes-Gn; ENSRNA049492373.
DR   EnsemblGenomes-Gn; ENSRNA049492375.
DR   EnsemblGenomes-Gn; ENSRNA049492377.
DR   EnsemblGenomes-Gn; ENSRNA049492378.
DR   EnsemblGenomes-Gn; ENSRNA049492379.
DR   EnsemblGenomes-Gn; ENSRNA049492381.
DR   EnsemblGenomes-Gn; ENSRNA049492382.
DR   EnsemblGenomes-Gn; ENSRNA049492383.
DR   EnsemblGenomes-Gn; ENSRNA049492385.
DR   EnsemblGenomes-Gn; ENSRNA049492386.
DR   EnsemblGenomes-Gn; ENSRNA049492387.
DR   EnsemblGenomes-Gn; ENSRNA049492388.
DR   EnsemblGenomes-Gn; ENSRNA049492389.
DR   EnsemblGenomes-Gn; ENSRNA049492390.
DR   EnsemblGenomes-Gn; ENSRNA049492391.
DR   EnsemblGenomes-Gn; ENSRNA049492393.
DR   EnsemblGenomes-Gn; ENSRNA049492394.
DR   EnsemblGenomes-Gn; ENSRNA049492395.
DR   EnsemblGenomes-Gn; ENSRNA049492396.
DR   EnsemblGenomes-Gn; ENSRNA049492397.
DR   EnsemblGenomes-Gn; ENSRNA049492398.
DR   EnsemblGenomes-Gn; ENSRNA049492399.
DR   EnsemblGenomes-Gn; ENSRNA049492400.
DR   EnsemblGenomes-Gn; ENSRNA049492401.
DR   EnsemblGenomes-Gn; ENSRNA049492402.
DR   EnsemblGenomes-Gn; ENSRNA049492403.
DR   EnsemblGenomes-Gn; ENSRNA049492404.
DR   EnsemblGenomes-Gn; ENSRNA049492405.
DR   EnsemblGenomes-Gn; ENSRNA049492406.
DR   EnsemblGenomes-Gn; ENSRNA049492407.
DR   EnsemblGenomes-Gn; ENSRNA049492408.
DR   EnsemblGenomes-Gn; ENSRNA049492409.
DR   EnsemblGenomes-Gn; ENSRNA049492410.
DR   EnsemblGenomes-Gn; ENSRNA049492411.
DR   EnsemblGenomes-Gn; ENSRNA049492412.
DR   EnsemblGenomes-Gn; ENSRNA049492413.
DR   EnsemblGenomes-Gn; ENSRNA049492414.
DR   EnsemblGenomes-Gn; ENSRNA049494572.
DR   EnsemblGenomes-Gn; ENSRNA049494578.
DR   EnsemblGenomes-Gn; ENSRNA049494580.
DR   EnsemblGenomes-Gn; ENSRNA049494583.
DR   EnsemblGenomes-Gn; ENSRNA049494585.
DR   EnsemblGenomes-Gn; ENSRNA049494588.
DR   EnsemblGenomes-Gn; ENSRNA049494589.
DR   EnsemblGenomes-Gn; ENSRNA049494591.
DR   EnsemblGenomes-Gn; ENSRNA049494594.
DR   EnsemblGenomes-Gn; ENSRNA049494595.
DR   EnsemblGenomes-Gn; ENSRNA049494597.
DR   EnsemblGenomes-Gn; ENSRNA049494599.
DR   EnsemblGenomes-Gn; ENSRNA049494601.
DR   EnsemblGenomes-Gn; ENSRNA049494604.
DR   EnsemblGenomes-Gn; ENSRNA049494608.
DR   EnsemblGenomes-Gn; ENSRNA049494610.
DR   EnsemblGenomes-Gn; ENSRNA049494614.
DR   EnsemblGenomes-Gn; ENSRNA049494622.
DR   EnsemblGenomes-Gn; ENSRNA049494626.
DR   EnsemblGenomes-Gn; ENSRNA049494629.
DR   EnsemblGenomes-Gn; ENSRNA049494636.
DR   EnsemblGenomes-Gn; ENSRNA049494643.
DR   EnsemblGenomes-Gn; ENSRNA049494645.
DR   EnsemblGenomes-Gn; ENSRNA049495734.
DR   EnsemblGenomes-Gn; ENSRNA049495735.
DR   EnsemblGenomes-Gn; ENSRNA049495736.
DR   EnsemblGenomes-Gn; ENSRNA049495737.
DR   EnsemblGenomes-Gn; ENSRNA049495738.
DR   EnsemblGenomes-Gn; ENSRNA049495739.
DR   EnsemblGenomes-Gn; ENSRNA049495740.
DR   EnsemblGenomes-Gn; ENSRNA049495741.
DR   EnsemblGenomes-Gn; ENSRNA049495742.
DR   EnsemblGenomes-Gn; ENSRNA049495743.
DR   EnsemblGenomes-Gn; ENSRNA049495744.
DR   EnsemblGenomes-Gn; ENSRNA049495745.
DR   EnsemblGenomes-Gn; ENSRNA049495746.
DR   EnsemblGenomes-Gn; ENSRNA049495747.
DR   EnsemblGenomes-Gn; ENSRNA049495748.
DR   EnsemblGenomes-Gn; ENSRNA049495749.
DR   EnsemblGenomes-Gn; ENSRNA049495750.
DR   EnsemblGenomes-Tr; AT2G01010.1.
DR   EnsemblGenomes-Tr; AT2G01020.1.
DR   EnsemblGenomes-Tr; AT2G01022.1.
DR   EnsemblGenomes-Tr; AT2G01024.1.
DR   EnsemblGenomes-Tr; AT2G01026.1.
DR   EnsemblGenomes-Tr; AT2G01028.1.
DR   EnsemblGenomes-Tr; AT2G01029.1.
DR   EnsemblGenomes-Tr; AT2G01031.1.
DR   EnsemblGenomes-Tr; AT2G01034.1.
DR   EnsemblGenomes-Tr; AT2G01037.1.
DR   EnsemblGenomes-Tr; AT2G01040.1.
DR   EnsemblGenomes-Tr; AT2G01160.1.
DR   EnsemblGenomes-Tr; AT2G01240.1.
DR   EnsemblGenomes-Tr; AT2G01320.3.
DR   EnsemblGenomes-Tr; AT2G01372.1.
DR   EnsemblGenomes-Tr; AT2G01422.1.
DR   EnsemblGenomes-Tr; AT2G01422.2.
DR   EnsemblGenomes-Tr; AT2G01550.1.
DR   EnsemblGenomes-Tr; AT2G01700.1.
DR   EnsemblGenomes-Tr; AT2G01830.1.
DR   EnsemblGenomes-Tr; AT2G01830.3.
DR   EnsemblGenomes-Tr; AT2G01840.1.
DR   EnsemblGenomes-Tr; AT2G01890.2.
DR   EnsemblGenomes-Tr; AT2G01910.2.
DR   EnsemblGenomes-Tr; AT2G01973.1.
DR   EnsemblGenomes-Tr; AT2G02110.1.
DR   EnsemblGenomes-Tr; AT2G02135.1.
DR   EnsemblGenomes-Tr; AT2G02190.1.
DR   EnsemblGenomes-Tr; AT2G02200.1.
DR   EnsemblGenomes-Tr; AT2G02205.1.
DR   EnsemblGenomes-Tr; AT2G02210.1.
DR   EnsemblGenomes-Tr; AT2G02260.1.
DR   EnsemblGenomes-Tr; AT2G02270.1.
DR   EnsemblGenomes-Tr; AT2G02330.1.
DR   EnsemblGenomes-Tr; AT2G02390.3.
DR   EnsemblGenomes-Tr; AT2G02430.1.
DR   EnsemblGenomes-Tr; AT2G02470.2.
DR   EnsemblGenomes-Tr; AT2G02560.2.
DR   EnsemblGenomes-Tr; AT2G02600.1.
DR   EnsemblGenomes-Tr; AT2G02670.1.
DR   EnsemblGenomes-Tr; AT2G02710.2.
DR   EnsemblGenomes-Tr; AT2G02710.3.
DR   EnsemblGenomes-Tr; AT2G02740.2.
DR   EnsemblGenomes-Tr; AT2G02741.1.
DR   EnsemblGenomes-Tr; AT2G02830.1.
DR   EnsemblGenomes-Tr; AT2G02900.1.
DR   EnsemblGenomes-Tr; AT2G03080.1.
DR   EnsemblGenomes-Tr; AT2G03100.1.
DR   EnsemblGenomes-Tr; AT2G03291.1.
DR   EnsemblGenomes-Tr; AT2G03445.1.
DR   EnsemblGenomes-Tr; AT2G03480.2.
DR   EnsemblGenomes-Tr; AT2G03490.1.
DR   EnsemblGenomes-Tr; AT2G03540.1.
DR   EnsemblGenomes-Tr; AT2G03650.1.
DR   EnsemblGenomes-Tr; AT2G03660.1.
DR   EnsemblGenomes-Tr; AT2G03700.1.
DR   EnsemblGenomes-Tr; AT2G03710.2.
DR   EnsemblGenomes-Tr; AT2G03710.3.
DR   EnsemblGenomes-Tr; AT2G03790.1.
DR   EnsemblGenomes-Tr; AT2G03860.1.
DR   EnsemblGenomes-Tr; AT2G03900.1.
DR   EnsemblGenomes-Tr; AT2G03910.1.
DR   EnsemblGenomes-Tr; AT2G03915.1.
DR   EnsemblGenomes-Tr; AT2G03920.1.
DR   EnsemblGenomes-Tr; AT2G03934.1.
DR   EnsemblGenomes-Tr; AT2G03935.1.
DR   EnsemblGenomes-Tr; AT2G03937.2.
DR   EnsemblGenomes-Tr; AT2G03940.1.
DR   EnsemblGenomes-Tr; AT2G03950.1.
DR   EnsemblGenomes-Tr; AT2G03958.1.
DR   EnsemblGenomes-Tr; AT2G03960.1.
DR   EnsemblGenomes-Tr; AT2G03970.1.
DR   EnsemblGenomes-Tr; AT2G03972.1.
DR   EnsemblGenomes-Tr; AT2G03972.2.
DR   EnsemblGenomes-Tr; AT2G03990.1.
DR   EnsemblGenomes-Tr; AT2G04000.1.
DR   EnsemblGenomes-Tr; AT2G04010.1.
DR   EnsemblGenomes-Tr; AT2G04033.1.
DR   EnsemblGenomes-Tr; AT2G04035.1.
DR   EnsemblGenomes-Tr; AT2G04036.1.
DR   EnsemblGenomes-Tr; AT2G04042.1.
DR   EnsemblGenomes-Tr; AT2G04043.1.
DR   EnsemblGenomes-Tr; AT2G04047.1.
DR   EnsemblGenomes-Tr; AT2G04110.1.
DR   EnsemblGenomes-Tr; AT2G04120.1.
DR   EnsemblGenomes-Tr; AT2G04130.1.
DR   EnsemblGenomes-Tr; AT2G04135.1.
DR   EnsemblGenomes-Tr; AT2G04140.1.
DR   EnsemblGenomes-Tr; AT2G04150.1.
DR   EnsemblGenomes-Tr; AT2G04180.1.
DR   EnsemblGenomes-Tr; AT2G04200.1.
DR   EnsemblGenomes-Tr; AT2G04210.1.
DR   EnsemblGenomes-Tr; AT2G04250.1.
DR   EnsemblGenomes-Tr; AT2G04260.1.
DR   EnsemblGenomes-Tr; AT2G04270.3.
DR   EnsemblGenomes-Tr; AT2G04270.4.
DR   EnsemblGenomes-Tr; AT2G04290.1.
DR   EnsemblGenomes-Tr; AT2G04300.1.
DR   EnsemblGenomes-Tr; AT2G04310.1.
DR   EnsemblGenomes-Tr; AT2G04320.1.
DR   EnsemblGenomes-Tr; AT2G04330.1.
DR   EnsemblGenomes-Tr; AT2G04460.1.
DR   EnsemblGenomes-Tr; AT2G04470.1.
DR   EnsemblGenomes-Tr; AT2G04490.1.
DR   EnsemblGenomes-Tr; AT2G04510.1.
DR   EnsemblGenomes-Tr; AT2G04550.3.
DR   EnsemblGenomes-Tr; AT2G04580.1.
DR   EnsemblGenomes-Tr; AT2G04590.1.
DR   EnsemblGenomes-Tr; AT2G04600.1.
DR   EnsemblGenomes-Tr; AT2G04610.1.
DR   EnsemblGenomes-Tr; AT2G04620.1.
DR   EnsemblGenomes-Tr; AT2G04625.1.
DR   EnsemblGenomes-Tr; AT2G04670.1.
DR   EnsemblGenomes-Tr; AT2G04710.1.
DR   EnsemblGenomes-Tr; AT2G04720.1.
DR   EnsemblGenomes-Tr; AT2G04730.1.
DR   EnsemblGenomes-Tr; AT2G04760.1.
DR   EnsemblGenomes-Tr; AT2G04770.1.
DR   EnsemblGenomes-Tr; AT2G04820.1.
DR   EnsemblGenomes-Tr; AT2G04852.1.
DR   EnsemblGenomes-Tr; AT2G04950.1.
DR   EnsemblGenomes-Tr; AT2G04970.1.
DR   EnsemblGenomes-Tr; AT2G04980.1.
DR   EnsemblGenomes-Tr; AT2G04990.1.
DR   EnsemblGenomes-Tr; AT2G05000.1.
DR   EnsemblGenomes-Tr; AT2G05010.1.
DR   EnsemblGenomes-Tr; AT2G05020.1.
DR   EnsemblGenomes-Tr; AT2G05025.1.
DR   EnsemblGenomes-Tr; AT2G05030.1.
DR   EnsemblGenomes-Tr; AT2G05040.1.
DR   EnsemblGenomes-Tr; AT2G05080.1.
DR   EnsemblGenomes-Tr; AT2G05082.1.
DR   EnsemblGenomes-Tr; AT2G05084.1.
DR   EnsemblGenomes-Tr; AT2G05087.1.
DR   EnsemblGenomes-Tr; AT2G05090.1.
DR   EnsemblGenomes-Tr; AT2G05110.1.
DR   EnsemblGenomes-Tr; AT2G05115.1.
DR   EnsemblGenomes-Tr; AT2G05130.1.
DR   EnsemblGenomes-Tr; AT2G05133.1.
DR   EnsemblGenomes-Tr; AT2G05150.1.
DR   EnsemblGenomes-Tr; AT2G05171.1.
DR   EnsemblGenomes-Tr; AT2G05190.1.
DR   EnsemblGenomes-Tr; AT2G05200.1.
DR   EnsemblGenomes-Tr; AT2G05240.1.
DR   EnsemblGenomes-Tr; AT2G05280.1.
DR   EnsemblGenomes-Tr; AT2G05290.1.
DR   EnsemblGenomes-Tr; AT2G05300.1.
DR   EnsemblGenomes-Tr; AT2G05340.1.
DR   EnsemblGenomes-Tr; AT2G05390.1.
DR   EnsemblGenomes-Tr; AT2G05435.1.
DR   EnsemblGenomes-Tr; AT2G05441.1.
DR   EnsemblGenomes-Tr; AT2G05450.1.
DR   EnsemblGenomes-Tr; AT2G05460.1.
DR   EnsemblGenomes-Tr; AT2G05470.1.
DR   EnsemblGenomes-Tr; AT2G05475.1.
DR   EnsemblGenomes-Tr; AT2G05480.1.
DR   EnsemblGenomes-Tr; AT2G05490.1.
DR   EnsemblGenomes-Tr; AT2G05518.1.
DR   EnsemblGenomes-Tr; AT2G05550.1.
DR   EnsemblGenomes-Tr; AT2G05560.1.
DR   EnsemblGenomes-Tr; AT2G05562.1.
DR   EnsemblGenomes-Tr; AT2G05564.1.
DR   EnsemblGenomes-Tr; AT2G05567.1.
DR   EnsemblGenomes-Tr; AT2G05570.1.
DR   EnsemblGenomes-Tr; AT2G05610.1.
DR   EnsemblGenomes-Tr; AT2G05640.1.
DR   EnsemblGenomes-Tr; AT2G05647.1.
DR   EnsemblGenomes-Tr; AT2G05660.1.
DR   EnsemblGenomes-Tr; AT2G05670.1.
DR   EnsemblGenomes-Tr; AT2G05680.1.
DR   EnsemblGenomes-Tr; AT2G05690.1.
DR   EnsemblGenomes-Tr; AT2G05700.1.
DR   EnsemblGenomes-Tr; AT2G05715.1.
DR   EnsemblGenomes-Tr; AT2G05730.1.
DR   EnsemblGenomes-Tr; AT2G05740.1.
DR   EnsemblGenomes-Tr; AT2G05750.1.
DR   EnsemblGenomes-Tr; AT2G05765.1.
DR   EnsemblGenomes-Tr; AT2G05770.1.
DR   EnsemblGenomes-Tr; AT2G05780.1.
DR   EnsemblGenomes-Tr; AT2G05800.1.
DR   EnsemblGenomes-Tr; AT2G05801.1.
DR   EnsemblGenomes-Tr; AT2G05812.1.
DR   EnsemblGenomes-Tr; AT2G05820.1.
DR   EnsemblGenomes-Tr; AT2G05830.2.
DR   EnsemblGenomes-Tr; AT2G05830.3.
DR   EnsemblGenomes-Tr; AT2G05845.1.
DR   EnsemblGenomes-Tr; AT2G05860.1.
DR   EnsemblGenomes-Tr; AT2G05870.1.
DR   EnsemblGenomes-Tr; AT2G05880.1.
DR   EnsemblGenomes-Tr; AT2G05890.1.
DR   EnsemblGenomes-Tr; AT2G05914.1.
DR   EnsemblGenomes-Tr; AT2G05930.1.
DR   EnsemblGenomes-Tr; AT2G05935.1.
DR   EnsemblGenomes-Tr; AT2G05950.1.
DR   EnsemblGenomes-Tr; AT2G05960.1.
DR   EnsemblGenomes-Tr; AT2G05980.1.
DR   EnsemblGenomes-Tr; AT2G05985.1.
DR   EnsemblGenomes-Tr; AT2G05995.1.
DR   EnsemblGenomes-Tr; AT2G06002.1.
DR   EnsemblGenomes-Tr; AT2G06045.1.
DR   EnsemblGenomes-Tr; AT2G06060.1.
DR   EnsemblGenomes-Tr; AT2G06070.1.
DR   EnsemblGenomes-Tr; AT2G06080.1.
DR   EnsemblGenomes-Tr; AT2G06100.1.
DR   EnsemblGenomes-Tr; AT2G06110.1.
DR   EnsemblGenomes-Tr; AT2G06120.1.
DR   EnsemblGenomes-Tr; AT2G06125.1.
DR   EnsemblGenomes-Tr; AT2G06130.1.
DR   EnsemblGenomes-Tr; AT2G06140.1.
DR   EnsemblGenomes-Tr; AT2G06150.1.
DR   EnsemblGenomes-Tr; AT2G06160.1.
DR   EnsemblGenomes-Tr; AT2G06165.1.
DR   EnsemblGenomes-Tr; AT2G06170.1.
DR   EnsemblGenomes-Tr; AT2G06180.1.
DR   EnsemblGenomes-Tr; AT2G06190.1.
DR   EnsemblGenomes-Tr; AT2G06220.1.
DR   EnsemblGenomes-Tr; AT2G06230.1.
DR   EnsemblGenomes-Tr; AT2G06235.1.
DR   EnsemblGenomes-Tr; AT2G06240.1.
DR   EnsemblGenomes-Tr; AT2G06245.1.
DR   EnsemblGenomes-Tr; AT2G06250.1.
DR   EnsemblGenomes-Tr; AT2G06260.1.
DR   EnsemblGenomes-Tr; AT2G06270.1.
DR   EnsemblGenomes-Tr; AT2G06280.1.
DR   EnsemblGenomes-Tr; AT2G06285.1.
DR   EnsemblGenomes-Tr; AT2G06290.1.
DR   EnsemblGenomes-Tr; AT2G06296.1.
DR   EnsemblGenomes-Tr; AT2G06303.1.
DR   EnsemblGenomes-Tr; AT2G06310.1.
DR   EnsemblGenomes-Tr; AT2G06330.1.
DR   EnsemblGenomes-Tr; AT2G06335.1.
DR   EnsemblGenomes-Tr; AT2G06340.1.
DR   EnsemblGenomes-Tr; AT2G06350.1.
DR   EnsemblGenomes-Tr; AT2G06370.1.
DR   EnsemblGenomes-Tr; AT2G06380.1.
DR   EnsemblGenomes-Tr; AT2G06390.1.
DR   EnsemblGenomes-Tr; AT2G06400.1.
DR   EnsemblGenomes-Tr; AT2G06410.1.
DR   EnsemblGenomes-Tr; AT2G06430.1.
DR   EnsemblGenomes-Tr; AT2G06440.1.
DR   EnsemblGenomes-Tr; AT2G06450.1.
DR   EnsemblGenomes-Tr; AT2G06460.1.
DR   EnsemblGenomes-Tr; AT2G06470.1.
DR   EnsemblGenomes-Tr; AT2G06480.1.
DR   EnsemblGenomes-Tr; AT2G06490.1.
DR   EnsemblGenomes-Tr; AT2G06540.1.
DR   EnsemblGenomes-Tr; AT2G06550.1.
DR   EnsemblGenomes-Tr; AT2G06560.1.
DR   EnsemblGenomes-Tr; AT2G06562.1.
DR   EnsemblGenomes-Tr; AT2G06580.1.
DR   EnsemblGenomes-Tr; AT2G06590.1.
DR   EnsemblGenomes-Tr; AT2G06600.1.
DR   EnsemblGenomes-Tr; AT2G06610.1.
DR   EnsemblGenomes-Tr; AT2G06620.1.
DR   EnsemblGenomes-Tr; AT2G06630.1.
DR   EnsemblGenomes-Tr; AT2G06640.1.
DR   EnsemblGenomes-Tr; AT2G06650.1.
DR   EnsemblGenomes-Tr; AT2G06660.1.
DR   EnsemblGenomes-Tr; AT2G06670.1.
DR   EnsemblGenomes-Tr; AT2G06680.1.
DR   EnsemblGenomes-Tr; AT2G06690.1.
DR   EnsemblGenomes-Tr; AT2G06700.1.
DR   EnsemblGenomes-Tr; AT2G06710.1.
DR   EnsemblGenomes-Tr; AT2G06715.1.
DR   EnsemblGenomes-Tr; AT2G06720.1.
DR   EnsemblGenomes-Tr; AT2G06740.1.
DR   EnsemblGenomes-Tr; AT2G06750.1.
DR   EnsemblGenomes-Tr; AT2G06760.1.
DR   EnsemblGenomes-Tr; AT2G06770.1.
DR   EnsemblGenomes-Tr; AT2G06775.1.
DR   EnsemblGenomes-Tr; AT2G06780.1.
DR   EnsemblGenomes-Tr; AT2G06790.1.
DR   EnsemblGenomes-Tr; AT2G06800.1.
DR   EnsemblGenomes-Tr; AT2G06810.1.
DR   EnsemblGenomes-Tr; AT2G06820.1.
DR   EnsemblGenomes-Tr; AT2G06822.1.
DR   EnsemblGenomes-Tr; AT2G06830.1.
DR   EnsemblGenomes-Tr; AT2G06840.1.
DR   EnsemblGenomes-Tr; AT2G06860.1.
DR   EnsemblGenomes-Tr; AT2G06870.1.
DR   EnsemblGenomes-Tr; AT2G06875.1.
DR   EnsemblGenomes-Tr; AT2G06880.1.
DR   EnsemblGenomes-Tr; AT2G06885.1.
DR   EnsemblGenomes-Tr; AT2G06890.1.
DR   EnsemblGenomes-Tr; AT2G06900.1.
DR   EnsemblGenomes-Tr; AT2G06902.1.
DR   EnsemblGenomes-Tr; AT2G06910.1.
DR   EnsemblGenomes-Tr; AT2G06912.1.
DR   EnsemblGenomes-Tr; AT2G06914.1.
DR   EnsemblGenomes-Tr; AT2G06917.1.
DR   EnsemblGenomes-Tr; AT2G06920.1.
DR   EnsemblGenomes-Tr; AT2G06922.1.
DR   EnsemblGenomes-Tr; AT2G06930.1.
DR   EnsemblGenomes-Tr; AT2G06940.1.
DR   EnsemblGenomes-Tr; AT2G06950.1.
DR   EnsemblGenomes-Tr; AT2G06965.1.
DR   EnsemblGenomes-Tr; AT2G06967.1.
DR   EnsemblGenomes-Tr; AT2G06973.1.
DR   EnsemblGenomes-Tr; AT2G06980.1.
DR   EnsemblGenomes-Tr; AT2G06985.1.
DR   EnsemblGenomes-Tr; AT2G07010.1.
DR   EnsemblGenomes-Tr; AT2G07030.1.
DR   EnsemblGenomes-Tr; AT2G07042.1.
DR   EnsemblGenomes-Tr; AT2G07070.1.
DR   EnsemblGenomes-Tr; AT2G07080.1.
DR   EnsemblGenomes-Tr; AT2G07090.1.
DR   EnsemblGenomes-Tr; AT2G07100.1.
DR   EnsemblGenomes-Tr; AT2G07130.1.
DR   EnsemblGenomes-Tr; AT2G07150.1.
DR   EnsemblGenomes-Tr; AT2G07155.1.
DR   EnsemblGenomes-Tr; AT2G07160.1.
DR   EnsemblGenomes-Tr; AT2G07185.1.
DR   EnsemblGenomes-Tr; AT2G07210.1.
DR   EnsemblGenomes-Tr; AT2G07212.1.
DR   EnsemblGenomes-Tr; AT2G07213.1.
DR   EnsemblGenomes-Tr; AT2G07220.1.
DR   EnsemblGenomes-Tr; AT2G07230.1.
DR   EnsemblGenomes-Tr; AT2G07250.1.
DR   EnsemblGenomes-Tr; AT2G07260.1.
DR   EnsemblGenomes-Tr; AT2G07270.1.
DR   EnsemblGenomes-Tr; AT2G07300.1.
DR   EnsemblGenomes-Tr; AT2G07320.1.
DR   EnsemblGenomes-Tr; AT2G07330.1.
DR   EnsemblGenomes-Tr; AT2G07365.1.
DR   EnsemblGenomes-Tr; AT2G07380.1.
DR   EnsemblGenomes-Tr; AT2G07390.1.
DR   EnsemblGenomes-Tr; AT2G07395.1.
DR   EnsemblGenomes-Tr; AT2G07400.1.
DR   EnsemblGenomes-Tr; AT2G07410.1.
DR   EnsemblGenomes-Tr; AT2G07420.1.
DR   EnsemblGenomes-Tr; AT2G07430.1.
DR   EnsemblGenomes-Tr; AT2G07450.1.
DR   EnsemblGenomes-Tr; AT2G07455.1.
DR   EnsemblGenomes-Tr; AT2G07460.1.
DR   EnsemblGenomes-Tr; AT2G07470.1.
DR   EnsemblGenomes-Tr; AT2G07480.1.
DR   EnsemblGenomes-Tr; AT2G07483.1.
DR   EnsemblGenomes-Tr; AT2G07486.1.
DR   EnsemblGenomes-Tr; AT2G07490.1.
DR   EnsemblGenomes-Tr; AT2G07500.1.
DR   EnsemblGenomes-Tr; AT2G07510.1.
DR   EnsemblGenomes-Tr; AT2G07520.1.
DR   EnsemblGenomes-Tr; AT2G07530.1.
DR   EnsemblGenomes-Tr; AT2G07540.1.
DR   EnsemblGenomes-Tr; AT2G07550.1.
DR   EnsemblGenomes-Tr; AT2G07570.1.
DR   EnsemblGenomes-Tr; AT2G07580.1.
DR   EnsemblGenomes-Tr; AT2G07590.1.
DR   EnsemblGenomes-Tr; AT2G07600.1.
DR   EnsemblGenomes-Tr; AT2G07620.1.
DR   EnsemblGenomes-Tr; AT2G07630.1.
DR   EnsemblGenomes-Tr; AT2G07635.1.
DR   EnsemblGenomes-Tr; AT2G07650.1.
DR   EnsemblGenomes-Tr; AT2G07660.1.
DR   EnsemblGenomes-Tr; AT2G07663.1.
DR   EnsemblGenomes-Tr; AT2G07664.1.
DR   EnsemblGenomes-Tr; AT2G07666.1.
DR   EnsemblGenomes-Tr; AT2G07670.1.
DR   EnsemblGenomes-Tr; AT2G07672.1.
DR   EnsemblGenomes-Tr; AT2G07673.1.
DR   EnsemblGenomes-Tr; AT2G07677.1.
DR   EnsemblGenomes-Tr; AT2G07682.1.
DR   EnsemblGenomes-Tr; AT2G07683.1.
DR   EnsemblGenomes-Tr; AT2G07685.1.
DR   EnsemblGenomes-Tr; AT2G07686.1.
DR   EnsemblGenomes-Tr; AT2G07688.1.
DR   EnsemblGenomes-Tr; AT2G07693.1.
DR   EnsemblGenomes-Tr; AT2G07694.1.
DR   EnsemblGenomes-Tr; AT2G07695.1.
DR   EnsemblGenomes-Tr; AT2G07697.1.
DR   EnsemblGenomes-Tr; AT2G07699.1.
DR   EnsemblGenomes-Tr; AT2G07700.1.
DR   EnsemblGenomes-Tr; AT2G07703.1.
DR   EnsemblGenomes-Tr; AT2G07704.1.
DR   EnsemblGenomes-Tr; AT2G07709.1.
DR   EnsemblGenomes-Tr; AT2G07710.1.
DR   EnsemblGenomes-Tr; AT2G07711.1.
DR   EnsemblGenomes-Tr; AT2G07712.1.
DR   EnsemblGenomes-Tr; AT2G07716.1.
DR   EnsemblGenomes-Tr; AT2G07717.1.
DR   EnsemblGenomes-Tr; AT2G07720.1.
DR   EnsemblGenomes-Tr; AT2G07722.1.
DR   EnsemblGenomes-Tr; AT2G07723.1.
DR   EnsemblGenomes-Tr; AT2G07724.1.
DR   EnsemblGenomes-Tr; AT2G07726.1.
DR   EnsemblGenomes-Tr; AT2G07729.1.
DR   EnsemblGenomes-Tr; AT2G07730.1.
DR   EnsemblGenomes-Tr; AT2G07731.1.
DR   EnsemblGenomes-Tr; AT2G07733.1.
DR   EnsemblGenomes-Tr; AT2G07735.1.
DR   EnsemblGenomes-Tr; AT2G07736.1.
DR   EnsemblGenomes-Tr; AT2G07737.1.
DR   EnsemblGenomes-Tr; AT2G07739.1.
DR   EnsemblGenomes-Tr; AT2G07740.1.
DR   EnsemblGenomes-Tr; AT2G07742.1.
DR   EnsemblGenomes-Tr; AT2G07743.1.
DR   EnsemblGenomes-Tr; AT2G07744.1.
DR   EnsemblGenomes-Tr; AT2G07745.1.
DR   EnsemblGenomes-Tr; AT2G07746.1.
DR   EnsemblGenomes-Tr; AT2G07747.1.
DR   EnsemblGenomes-Tr; AT2G07748.1.
DR   EnsemblGenomes-Tr; AT2G07752.1.
DR   EnsemblGenomes-Tr; AT2G07753.1.
DR   EnsemblGenomes-Tr; AT2G07754.1.
DR   EnsemblGenomes-Tr; AT2G07755.1.
DR   EnsemblGenomes-Tr; AT2G07756.1.
DR   EnsemblGenomes-Tr; AT2G07757.1.
DR   EnsemblGenomes-Tr; AT2G07758.1.
DR   EnsemblGenomes-Tr; AT2G07759.1.
DR   EnsemblGenomes-Tr; AT2G07761.1.
DR   EnsemblGenomes-Tr; AT2G07762.1.
DR   EnsemblGenomes-Tr; AT2G07763.1.
DR   EnsemblGenomes-Tr; AT2G07764.1.
DR   EnsemblGenomes-Tr; AT2G07765.1.
DR   EnsemblGenomes-Tr; AT2G07766.1.
DR   EnsemblGenomes-Tr; AT2G07767.1.
DR   EnsemblGenomes-Tr; AT2G07769.1.
DR   EnsemblGenomes-Tr; AT2G07770.1.
DR   EnsemblGenomes-Tr; AT2G07778.1.
DR   EnsemblGenomes-Tr; AT2G07780.1.
DR   EnsemblGenomes-Tr; AT2G07783.1.
DR   EnsemblGenomes-Tr; AT2G07784.1.
DR   EnsemblGenomes-Tr; AT2G07786.1.
DR   EnsemblGenomes-Tr; AT2G07788.1.
DR   EnsemblGenomes-Tr; AT2G07789.1.
DR   EnsemblGenomes-Tr; AT2G07790.1.
DR   EnsemblGenomes-Tr; AT2G07791.1.
DR   EnsemblGenomes-Tr; AT2G07792.1.
DR   EnsemblGenomes-Tr; AT2G07793.1.
DR   EnsemblGenomes-Tr; AT2G07794.1.
DR   EnsemblGenomes-Tr; AT2G07799.1.
DR   EnsemblGenomes-Tr; AT2G07807.1.
DR   EnsemblGenomes-Tr; AT2G07808.1.
DR   EnsemblGenomes-Tr; AT2G07809.1.
DR   EnsemblGenomes-Tr; AT2G07811.1.
DR   EnsemblGenomes-Tr; AT2G07812.1.
DR   EnsemblGenomes-Tr; AT2G07813.1.
DR   EnsemblGenomes-Tr; AT2G07826.1.
DR   EnsemblGenomes-Tr; AT2G07880.1.
DR   EnsemblGenomes-Tr; AT2G09187.1.
DR   EnsemblGenomes-Tr; AT2G09589.1.
DR   EnsemblGenomes-Tr; AT2G09790.1.
DR   EnsemblGenomes-Tr; AT2G09795.1.
DR   EnsemblGenomes-Tr; AT2G09795.2.
DR   EnsemblGenomes-Tr; AT2G09795.3.
DR   EnsemblGenomes-Tr; AT2G09800.1.
DR   EnsemblGenomes-Tr; AT2G09810.1.
DR   EnsemblGenomes-Tr; AT2G09820.1.
DR   EnsemblGenomes-Tr; AT2G09830.1.
DR   EnsemblGenomes-Tr; AT2G09850.1.
DR   EnsemblGenomes-Tr; AT2G09860.1.
DR   EnsemblGenomes-Tr; AT2G09862.1.
DR   EnsemblGenomes-Tr; AT2G09865.1.
DR   EnsemblGenomes-Tr; AT2G09870.1.
DR   EnsemblGenomes-Tr; AT2G09880.1.
DR   EnsemblGenomes-Tr; AT2G09890.1.
DR   EnsemblGenomes-Tr; AT2G09900.1.
DR   EnsemblGenomes-Tr; AT2G09910.1.
DR   EnsemblGenomes-Tr; AT2G09920.1.
DR   EnsemblGenomes-Tr; AT2G09930.1.
DR   EnsemblGenomes-Tr; AT2G09950.1.
DR   EnsemblGenomes-Tr; AT2G09953.1.
DR   EnsemblGenomes-Tr; AT2G09956.1.
DR   EnsemblGenomes-Tr; AT2G09960.1.
DR   EnsemblGenomes-Tr; AT2G09992.1.
DR   EnsemblGenomes-Tr; AT2G09994.1.
DR   EnsemblGenomes-Tr; AT2G10000.1.
DR   EnsemblGenomes-Tr; AT2G10010.1.
DR   EnsemblGenomes-Tr; AT2G10030.1.
DR   EnsemblGenomes-Tr; AT2G10040.1.
DR   EnsemblGenomes-Tr; AT2G10050.1.
DR   EnsemblGenomes-Tr; AT2G10070.1.
DR   EnsemblGenomes-Tr; AT2G10070.2.
DR   EnsemblGenomes-Tr; AT2G10080.1.
DR   EnsemblGenomes-Tr; AT2G10090.1.
DR   EnsemblGenomes-Tr; AT2G10100.1.
DR   EnsemblGenomes-Tr; AT2G10105.1.
DR   EnsemblGenomes-Tr; AT2G10110.1.
DR   EnsemblGenomes-Tr; AT2G10120.1.
DR   EnsemblGenomes-Tr; AT2G10130.1.
DR   EnsemblGenomes-Tr; AT2G10140.1.
DR   EnsemblGenomes-Tr; AT2G10150.1.
DR   EnsemblGenomes-Tr; AT2G10160.1.
DR   EnsemblGenomes-Tr; AT2G10165.1.
DR   EnsemblGenomes-Tr; AT2G10170.1.
DR   EnsemblGenomes-Tr; AT2G10175.1.
DR   EnsemblGenomes-Tr; AT2G10180.1.
DR   EnsemblGenomes-Tr; AT2G10190.1.
DR   EnsemblGenomes-Tr; AT2G10200.1.
DR   EnsemblGenomes-Tr; AT2G10205.1.
DR   EnsemblGenomes-Tr; AT2G10210.1.
DR   EnsemblGenomes-Tr; AT2G10220.1.
DR   EnsemblGenomes-Tr; AT2G10223.1.
DR   EnsemblGenomes-Tr; AT2G10226.1.
DR   EnsemblGenomes-Tr; AT2G10230.1.
DR   EnsemblGenomes-Tr; AT2G10232.1.
DR   EnsemblGenomes-Tr; AT2G10234.1.
DR   EnsemblGenomes-Tr; AT2G10237.1.
DR   EnsemblGenomes-Tr; AT2G10240.1.
DR   EnsemblGenomes-Tr; AT2G10250.1.
DR   EnsemblGenomes-Tr; AT2G10253.1.
DR   EnsemblGenomes-Tr; AT2G10256.1.
DR   EnsemblGenomes-Tr; AT2G10265.1.
DR   EnsemblGenomes-Tr; AT2G10270.1.
DR   EnsemblGenomes-Tr; AT2G10280.1.
DR   EnsemblGenomes-Tr; AT2G10285.1.
DR   EnsemblGenomes-Tr; AT2G10290.1.
DR   EnsemblGenomes-Tr; AT2G10300.1.
DR   EnsemblGenomes-Tr; AT2G10310.1.
DR   EnsemblGenomes-Tr; AT2G10320.1.
DR   EnsemblGenomes-Tr; AT2G10330.1.
DR   EnsemblGenomes-Tr; AT2G10350.1.
DR   EnsemblGenomes-Tr; AT2G10360.1.
DR   EnsemblGenomes-Tr; AT2G10370.1.
DR   EnsemblGenomes-Tr; AT2G10380.1.
DR   EnsemblGenomes-Tr; AT2G10390.1.
DR   EnsemblGenomes-Tr; AT2G10400.1.
DR   EnsemblGenomes-Tr; AT2G10405.1.
DR   EnsemblGenomes-Tr; AT2G10410.1.
DR   EnsemblGenomes-Tr; AT2G10420.1.
DR   EnsemblGenomes-Tr; AT2G10430.1.
DR   EnsemblGenomes-Tr; AT2G10440.2.
DR   EnsemblGenomes-Tr; AT2G10460.1.
DR   EnsemblGenomes-Tr; AT2G10465.1.
DR   EnsemblGenomes-Tr; AT2G10470.1.
DR   EnsemblGenomes-Tr; AT2G10480.1.
DR   EnsemblGenomes-Tr; AT2G10490.1.
DR   EnsemblGenomes-Tr; AT2G10500.1.
DR   EnsemblGenomes-Tr; AT2G10510.1.
DR   EnsemblGenomes-Tr; AT2G10520.1.
DR   EnsemblGenomes-Tr; AT2G10530.1.
DR   EnsemblGenomes-Tr; AT2G10537.1.
DR   EnsemblGenomes-Tr; AT2G10540.1.
DR   EnsemblGenomes-Tr; AT2G10555.1.
DR   EnsemblGenomes-Tr; AT2G10570.1.
DR   EnsemblGenomes-Tr; AT2G10589.1.
DR   EnsemblGenomes-Tr; AT2G10590.1.
DR   EnsemblGenomes-Tr; AT2G10600.1.
DR   EnsemblGenomes-Tr; AT2G10605.1.
DR   EnsemblGenomes-Tr; AT2G10606.1.
DR   EnsemblGenomes-Tr; AT2G10610.1.
DR   EnsemblGenomes-Tr; AT2G10611.1.
DR   EnsemblGenomes-Tr; AT2G10614.1.
DR   EnsemblGenomes-Tr; AT2G10617.1.
DR   EnsemblGenomes-Tr; AT2G10620.1.
DR   EnsemblGenomes-Tr; AT2G10630.1.
DR   EnsemblGenomes-Tr; AT2G10640.1.
DR   EnsemblGenomes-Tr; AT2G10650.1.
DR   EnsemblGenomes-Tr; AT2G10660.1.
DR   EnsemblGenomes-Tr; AT2G10670.1.
DR   EnsemblGenomes-Tr; AT2G10680.1.
DR   EnsemblGenomes-Tr; AT2G10690.1.
DR   EnsemblGenomes-Tr; AT2G10710.1.
DR   EnsemblGenomes-Tr; AT2G10720.1.
DR   EnsemblGenomes-Tr; AT2G10730.1.
DR   EnsemblGenomes-Tr; AT2G10735.1.
DR   EnsemblGenomes-Tr; AT2G10740.1.
DR   EnsemblGenomes-Tr; AT2G10760.1.
DR   EnsemblGenomes-Tr; AT2G10770.1.
DR   EnsemblGenomes-Tr; AT2G10780.1.
DR   EnsemblGenomes-Tr; AT2G10790.1.
DR   EnsemblGenomes-Tr; AT2G10800.1.
DR   EnsemblGenomes-Tr; AT2G10802.1.
DR   EnsemblGenomes-Tr; AT2G10810.1.
DR   EnsemblGenomes-Tr; AT2G10820.1.
DR   EnsemblGenomes-Tr; AT2G10830.1.
DR   EnsemblGenomes-Tr; AT2G10833.1.
DR   EnsemblGenomes-Tr; AT2G10836.1.
DR   EnsemblGenomes-Tr; AT2G10840.1.
DR   EnsemblGenomes-Tr; AT2G10850.1.
DR   EnsemblGenomes-Tr; AT2G10850.2.
DR   EnsemblGenomes-Tr; AT2G10860.1.
DR   EnsemblGenomes-Tr; AT2G10870.1.
DR   EnsemblGenomes-Tr; AT2G10880.1.
DR   EnsemblGenomes-Tr; AT2G10890.1.
DR   EnsemblGenomes-Tr; AT2G10895.1.
DR   EnsemblGenomes-Tr; AT2G10900.1.
DR   EnsemblGenomes-Tr; AT2G10910.1.
DR   EnsemblGenomes-Tr; AT2G10921.1.
DR   EnsemblGenomes-Tr; AT2G10960.1.
DR   EnsemblGenomes-Tr; AT2G10980.1.
DR   EnsemblGenomes-Tr; AT2G10990.1.
DR   EnsemblGenomes-Tr; AT2G11020.1.
DR   EnsemblGenomes-Tr; AT2G11030.1.
DR   EnsemblGenomes-Tr; AT2G11040.1.
DR   EnsemblGenomes-Tr; AT2G11050.1.
DR   EnsemblGenomes-Tr; AT2G11060.1.
DR   EnsemblGenomes-Tr; AT2G11070.1.
DR   EnsemblGenomes-Tr; AT2G11080.1.
DR   EnsemblGenomes-Tr; AT2G11090.1.
DR   EnsemblGenomes-Tr; AT2G11100.1.
DR   EnsemblGenomes-Tr; AT2G11110.1.
DR   EnsemblGenomes-Tr; AT2G11115.1.
DR   EnsemblGenomes-Tr; AT2G11120.1.
DR   EnsemblGenomes-Tr; AT2G11130.1.
DR   EnsemblGenomes-Tr; AT2G11135.1.
DR   EnsemblGenomes-Tr; AT2G11140.1.
DR   EnsemblGenomes-Tr; AT2G11150.1.
DR   EnsemblGenomes-Tr; AT2G11165.1.
DR   EnsemblGenomes-Tr; AT2G11166.1.
DR   EnsemblGenomes-Tr; AT2G11168.1.
DR   EnsemblGenomes-Tr; AT2G11170.1.
DR   EnsemblGenomes-Tr; AT2G11180.1.
DR   EnsemblGenomes-Tr; AT2G11190.1.
DR   EnsemblGenomes-Tr; AT2G11210.1.
DR   EnsemblGenomes-Tr; AT2G11220.1.
DR   EnsemblGenomes-Tr; AT2G11230.1.
DR   EnsemblGenomes-Tr; AT2G11235.1.
DR   EnsemblGenomes-Tr; AT2G11240.1.
DR   EnsemblGenomes-Tr; AT2G11280.1.
DR   EnsemblGenomes-Tr; AT2G11290.1.
DR   EnsemblGenomes-Tr; AT2G11300.1.
DR   EnsemblGenomes-Tr; AT2G11310.1.
DR   EnsemblGenomes-Tr; AT2G11320.1.
DR   EnsemblGenomes-Tr; AT2G11330.1.
DR   EnsemblGenomes-Tr; AT2G11340.1.
DR   EnsemblGenomes-Tr; AT2G11345.1.
DR   EnsemblGenomes-Tr; AT2G11350.1.
DR   EnsemblGenomes-Tr; AT2G11360.1.
DR   EnsemblGenomes-Tr; AT2G11370.1.
DR   EnsemblGenomes-Tr; AT2G11380.1.
DR   EnsemblGenomes-Tr; AT2G11390.1.
DR   EnsemblGenomes-Tr; AT2G11400.1.
DR   EnsemblGenomes-Tr; AT2G11410.1.
DR   EnsemblGenomes-Tr; AT2G11420.1.
DR   EnsemblGenomes-Tr; AT2G11430.1.
DR   EnsemblGenomes-Tr; AT2G11440.1.
DR   EnsemblGenomes-Tr; AT2G11450.1.
DR   EnsemblGenomes-Tr; AT2G11460.1.
DR   EnsemblGenomes-Tr; AT2G11465.1.
DR   EnsemblGenomes-Tr; AT2G11480.1.
DR   EnsemblGenomes-Tr; AT2G11485.1.
DR   EnsemblGenomes-Tr; AT2G11490.1.
DR   EnsemblGenomes-Tr; AT2G11500.1.
DR   EnsemblGenomes-Tr; AT2G11502.1.
DR   EnsemblGenomes-Tr; AT2G11504.1.
DR   EnsemblGenomes-Tr; AT2G11507.1.
DR   EnsemblGenomes-Tr; AT2G11510.1.
DR   EnsemblGenomes-Tr; AT2G11530.1.
DR   EnsemblGenomes-Tr; AT2G11550.1.
DR   EnsemblGenomes-Tr; AT2G11590.1.
DR   EnsemblGenomes-Tr; AT2G11600.1.
DR   EnsemblGenomes-Tr; AT2G11610.1.
DR   EnsemblGenomes-Tr; AT2G11630.1.
DR   EnsemblGenomes-Tr; AT2G11640.1.
DR   EnsemblGenomes-Tr; AT2G11650.1.
DR   EnsemblGenomes-Tr; AT2G11660.1.
DR   EnsemblGenomes-Tr; AT2G11670.1.
DR   EnsemblGenomes-Tr; AT2G11680.1.
DR   EnsemblGenomes-Tr; AT2G11690.1.
DR   EnsemblGenomes-Tr; AT2G11700.1.
DR   EnsemblGenomes-Tr; AT2G11720.1.
DR   EnsemblGenomes-Tr; AT2G11730.1.
DR   EnsemblGenomes-Tr; AT2G11740.1.
DR   EnsemblGenomes-Tr; AT2G11750.1.
DR   EnsemblGenomes-Tr; AT2G11770.1.
DR   EnsemblGenomes-Tr; AT2G11775.1.
DR   EnsemblGenomes-Tr; AT2G11780.1.
DR   EnsemblGenomes-Tr; AT2G11790.1.
DR   EnsemblGenomes-Tr; AT2G11800.1.
DR   EnsemblGenomes-Tr; AT2G11810.2.
DR   EnsemblGenomes-Tr; AT2G11820.1.
DR   EnsemblGenomes-Tr; AT2G11830.1.
DR   EnsemblGenomes-Tr; AT2G11840.1.
DR   EnsemblGenomes-Tr; AT2G11850.1.
DR   EnsemblGenomes-Tr; AT2G11852.1.
DR   EnsemblGenomes-Tr; AT2G11870.1.
DR   EnsemblGenomes-Tr; AT2G11880.1.
DR   EnsemblGenomes-Tr; AT2G11930.1.
DR   EnsemblGenomes-Tr; AT2G11940.1.
DR   EnsemblGenomes-Tr; AT2G11950.1.
DR   EnsemblGenomes-Tr; AT2G11970.1.
DR   EnsemblGenomes-Tr; AT2G11980.1.
DR   EnsemblGenomes-Tr; AT2G11983.1.
DR   EnsemblGenomes-Tr; AT2G11990.1.
DR   EnsemblGenomes-Tr; AT2G12000.1.
DR   EnsemblGenomes-Tr; AT2G12010.1.
DR   EnsemblGenomes-Tr; AT2G12020.1.
DR   EnsemblGenomes-Tr; AT2G12025.1.
DR   EnsemblGenomes-Tr; AT2G12040.1.
DR   EnsemblGenomes-Tr; AT2G12050.1.
DR   EnsemblGenomes-Tr; AT2G12060.1.
DR   EnsemblGenomes-Tr; AT2G12066.1.
DR   EnsemblGenomes-Tr; AT2G12083.1.
DR   EnsemblGenomes-Tr; AT2G12100.1.
DR   EnsemblGenomes-Tr; AT2G12110.1.
DR   EnsemblGenomes-Tr; AT2G12120.1.
DR   EnsemblGenomes-Tr; AT2G12130.1.
DR   EnsemblGenomes-Tr; AT2G12140.1.
DR   EnsemblGenomes-Tr; AT2G12150.1.
DR   EnsemblGenomes-Tr; AT2G12160.1.
DR   EnsemblGenomes-Tr; AT2G12195.1.
DR   EnsemblGenomes-Tr; AT2G12210.1.
DR   EnsemblGenomes-Tr; AT2G12230.1.
DR   EnsemblGenomes-Tr; AT2G12240.1.
DR   EnsemblGenomes-Tr; AT2G12250.1.
DR   EnsemblGenomes-Tr; AT2G12260.1.
DR   EnsemblGenomes-Tr; AT2G12270.1.
DR   EnsemblGenomes-Tr; AT2G12300.1.
DR   EnsemblGenomes-Tr; AT2G12305.1.
DR   EnsemblGenomes-Tr; AT2G12320.1.
DR   EnsemblGenomes-Tr; AT2G12325.1.
DR   EnsemblGenomes-Tr; AT2G12330.1.
DR   EnsemblGenomes-Tr; AT2G12340.1.
DR   EnsemblGenomes-Tr; AT2G12345.1.
DR   EnsemblGenomes-Tr; AT2G12360.1.
DR   EnsemblGenomes-Tr; AT2G12370.1.
DR   EnsemblGenomes-Tr; AT2G12380.1.
DR   EnsemblGenomes-Tr; AT2G12385.1.
DR   EnsemblGenomes-Tr; AT2G12390.1.
DR   EnsemblGenomes-Tr; AT2G12407.1.
DR   EnsemblGenomes-Tr; AT2G12408.1.
DR   EnsemblGenomes-Tr; AT2G12410.1.
DR   EnsemblGenomes-Tr; AT2G12420.1.
DR   EnsemblGenomes-Tr; AT2G12430.1.
DR   EnsemblGenomes-Tr; AT2G12440.1.
DR   EnsemblGenomes-Tr; AT2G12450.1.
DR   EnsemblGenomes-Tr; AT2G12460.1.
DR   EnsemblGenomes-Tr; AT2G12470.1.
DR   EnsemblGenomes-Tr; AT2G12490.1.
DR   EnsemblGenomes-Tr; AT2G12500.1.
DR   EnsemblGenomes-Tr; AT2G12505.1.
DR   EnsemblGenomes-Tr; AT2G12510.1.
DR   EnsemblGenomes-Tr; AT2G12520.1.
DR   EnsemblGenomes-Tr; AT2G12530.1.
DR   EnsemblGenomes-Tr; AT2G12540.1.
DR   EnsemblGenomes-Tr; AT2G12560.1.
DR   EnsemblGenomes-Tr; AT2G12570.1.
DR   EnsemblGenomes-Tr; AT2G12580.1.
DR   EnsemblGenomes-Tr; AT2G12590.1.
DR   EnsemblGenomes-Tr; AT2G12600.1.
DR   EnsemblGenomes-Tr; AT2G12610.1.
DR   EnsemblGenomes-Tr; AT2G12620.1.
DR   EnsemblGenomes-Tr; AT2G12630.1.
DR   EnsemblGenomes-Tr; AT2G12640.1.
DR   EnsemblGenomes-Tr; AT2G12650.1.
DR   EnsemblGenomes-Tr; AT2G12660.1.
DR   EnsemblGenomes-Tr; AT2G12670.1.
DR   EnsemblGenomes-Tr; AT2G12680.1.
DR   EnsemblGenomes-Tr; AT2G12685.1.
DR   EnsemblGenomes-Tr; AT2G12690.1.
DR   EnsemblGenomes-Tr; AT2G12695.1.
DR   EnsemblGenomes-Tr; AT2G12700.1.
DR   EnsemblGenomes-Tr; AT2G12710.1.
DR   EnsemblGenomes-Tr; AT2G12720.1.
DR   EnsemblGenomes-Tr; AT2G12730.1.
DR   EnsemblGenomes-Tr; AT2G12740.1.
DR   EnsemblGenomes-Tr; AT2G12750.1.
DR   EnsemblGenomes-Tr; AT2G12760.1.
DR   EnsemblGenomes-Tr; AT2G12770.1.
DR   EnsemblGenomes-Tr; AT2G12780.1.
DR   EnsemblGenomes-Tr; AT2G12800.1.
DR   EnsemblGenomes-Tr; AT2G12810.1.
DR   EnsemblGenomes-Tr; AT2G12815.1.
DR   EnsemblGenomes-Tr; AT2G12820.1.
DR   EnsemblGenomes-Tr; AT2G12830.1.
DR   EnsemblGenomes-Tr; AT2G12832.1.
DR   EnsemblGenomes-Tr; AT2G12835.1.
DR   EnsemblGenomes-Tr; AT2G12840.1.
DR   EnsemblGenomes-Tr; AT2G12845.1.
DR   EnsemblGenomes-Tr; AT2G12850.1.
DR   EnsemblGenomes-Tr; AT2G12855.1.
DR   EnsemblGenomes-Tr; AT2G12860.1.
DR   EnsemblGenomes-Tr; AT2G12870.1.
DR   EnsemblGenomes-Tr; AT2G12890.1.
DR   EnsemblGenomes-Tr; AT2G12910.1.
DR   EnsemblGenomes-Tr; AT2G12920.1.
DR   EnsemblGenomes-Tr; AT2G12930.1.
DR   EnsemblGenomes-Tr; AT2G12950.1.
DR   EnsemblGenomes-Tr; AT2G12960.1.
DR   EnsemblGenomes-Tr; AT2G12970.1.
DR   EnsemblGenomes-Tr; AT2G12980.1.
DR   EnsemblGenomes-Tr; AT2G12990.1.
DR   EnsemblGenomes-Tr; AT2G13000.1.
DR   EnsemblGenomes-Tr; AT2G13010.1.
DR   EnsemblGenomes-Tr; AT2G13020.1.
DR   EnsemblGenomes-Tr; AT2G13040.1.
DR   EnsemblGenomes-Tr; AT2G13050.1.
DR   EnsemblGenomes-Tr; AT2G13060.1.
DR   EnsemblGenomes-Tr; AT2G13070.1.
DR   EnsemblGenomes-Tr; AT2G13080.1.
DR   EnsemblGenomes-Tr; AT2G13090.1.
DR   EnsemblGenomes-Tr; AT2G13100.2.
DR   EnsemblGenomes-Tr; AT2G13110.1.
DR   EnsemblGenomes-Tr; AT2G13115.1.
DR   EnsemblGenomes-Tr; AT2G13116.1.
DR   EnsemblGenomes-Tr; AT2G13118.1.
DR   EnsemblGenomes-Tr; AT2G13120.1.
DR   EnsemblGenomes-Tr; AT2G13128.1.
DR   EnsemblGenomes-Tr; AT2G13130.1.
DR   EnsemblGenomes-Tr; AT2G13140.1.
DR   EnsemblGenomes-Tr; AT2G13142.1.
DR   EnsemblGenomes-Tr; AT2G13143.1.
DR   EnsemblGenomes-Tr; AT2G13145.1.
DR   EnsemblGenomes-Tr; AT2G13146.1.
DR   EnsemblGenomes-Tr; AT2G13160.1.
DR   EnsemblGenomes-Tr; AT2G13170.1.
DR   EnsemblGenomes-Tr; AT2G13175.1.
DR   EnsemblGenomes-Tr; AT2G13180.1.
DR   EnsemblGenomes-Tr; AT2G13190.1.
DR   EnsemblGenomes-Tr; AT2G13200.1.
DR   EnsemblGenomes-Tr; AT2G13230.1.
DR   EnsemblGenomes-Tr; AT2G13240.1.
DR   EnsemblGenomes-Tr; AT2G13250.1.
DR   EnsemblGenomes-Tr; AT2G13260.1.
DR   EnsemblGenomes-Tr; AT2G13270.1.
DR   EnsemblGenomes-Tr; AT2G13274.1.
DR   EnsemblGenomes-Tr; AT2G13280.1.
DR   EnsemblGenomes-Tr; AT2G13300.1.
DR   EnsemblGenomes-Tr; AT2G13310.1.
DR   EnsemblGenomes-Tr; AT2G13320.1.
DR   EnsemblGenomes-Tr; AT2G13330.1.
DR   EnsemblGenomes-Tr; AT2G13335.1.
DR   EnsemblGenomes-Tr; AT2G13380.1.
DR   EnsemblGenomes-Tr; AT2G13390.1.
DR   EnsemblGenomes-Tr; AT2G13400.1.
DR   EnsemblGenomes-Tr; AT2G13410.1.
DR   EnsemblGenomes-Tr; AT2G13420.1.
DR   EnsemblGenomes-Tr; AT2G13431.1.
DR   EnsemblGenomes-Tr; AT2G13460.1.
DR   EnsemblGenomes-Tr; AT2G13469.1.
DR   EnsemblGenomes-Tr; AT2G13470.1.
DR   EnsemblGenomes-Tr; AT2G13480.1.
DR   EnsemblGenomes-Tr; AT2G13490.1.
DR   EnsemblGenomes-Tr; AT2G13520.1.
DR   EnsemblGenomes-Tr; AT2G13530.1.
DR   EnsemblGenomes-Tr; AT2G13580.1.
DR   EnsemblGenomes-Tr; AT2G13590.1.
DR   EnsemblGenomes-Tr; AT2G13650.2.
DR   EnsemblGenomes-Tr; AT2G13665.1.
DR   EnsemblGenomes-Tr; AT2G13665.2.
DR   EnsemblGenomes-Tr; AT2G13700.1.
DR   EnsemblGenomes-Tr; AT2G13705.1.
DR   EnsemblGenomes-Tr; AT2G13706.1.
DR   EnsemblGenomes-Tr; AT2G13710.1.
DR   EnsemblGenomes-Tr; AT2G13730.1.
DR   EnsemblGenomes-Tr; AT2G13740.1.
DR   EnsemblGenomes-Tr; AT2G13750.1.
DR   EnsemblGenomes-Tr; AT2G13820.2.
DR   EnsemblGenomes-Tr; AT2G13830.1.
DR   EnsemblGenomes-Tr; AT2G13850.1.
DR   EnsemblGenomes-Tr; AT2G13851.1.
DR   EnsemblGenomes-Tr; AT2G13860.1.
DR   EnsemblGenomes-Tr; AT2G13865.1.
DR   EnsemblGenomes-Tr; AT2G13870.1.
DR   EnsemblGenomes-Tr; AT2G13890.1.
DR   EnsemblGenomes-Tr; AT2G13910.1.
DR   EnsemblGenomes-Tr; AT2G13920.1.
DR   EnsemblGenomes-Tr; AT2G13930.1.
DR   EnsemblGenomes-Tr; AT2G13940.1.
DR   EnsemblGenomes-Tr; AT2G13970.1.
DR   EnsemblGenomes-Tr; AT2G13975.1.
DR   EnsemblGenomes-Tr; AT2G13975.2.
DR   EnsemblGenomes-Tr; AT2G13990.1.
DR   EnsemblGenomes-Tr; AT2G14010.1.
DR   EnsemblGenomes-Tr; AT2G14020.1.
DR   EnsemblGenomes-Tr; AT2G14030.1.
DR   EnsemblGenomes-Tr; AT2G14040.1.
DR   EnsemblGenomes-Tr; AT2G14090.1.
DR   EnsemblGenomes-Tr; AT2G14115.1.
DR   EnsemblGenomes-Tr; AT2G14130.1.
DR   EnsemblGenomes-Tr; AT2G14140.1.
DR   EnsemblGenomes-Tr; AT2G14150.1.
DR   EnsemblGenomes-Tr; AT2G14180.1.
DR   EnsemblGenomes-Tr; AT2G14190.1.
DR   EnsemblGenomes-Tr; AT2G14200.1.
DR   EnsemblGenomes-Tr; AT2G14220.1.
DR   EnsemblGenomes-Tr; AT2G14230.1.
DR   EnsemblGenomes-Tr; AT2G14240.1.
DR   EnsemblGenomes-Tr; AT2G14245.1.
DR   EnsemblGenomes-Tr; AT2G14280.1.
DR   EnsemblGenomes-Tr; AT2G14300.1.
DR   EnsemblGenomes-Tr; AT2G14310.1.
DR   EnsemblGenomes-Tr; AT2G14320.1.
DR   EnsemblGenomes-Tr; AT2G14330.1.
DR   EnsemblGenomes-Tr; AT2G14335.1.
DR   EnsemblGenomes-Tr; AT2G14340.1.
DR   EnsemblGenomes-Tr; AT2G14350.1.
DR   EnsemblGenomes-Tr; AT2G14370.1.
DR   EnsemblGenomes-Tr; AT2G14380.1.
DR   EnsemblGenomes-Tr; AT2G14400.1.
DR   EnsemblGenomes-Tr; AT2G14405.1.
DR   EnsemblGenomes-Tr; AT2G14410.1.
DR   EnsemblGenomes-Tr; AT2G14415.1.
DR   EnsemblGenomes-Tr; AT2G14420.1.
DR   EnsemblGenomes-Tr; AT2G14430.1.
DR   EnsemblGenomes-Tr; AT2G14450.1.
DR   EnsemblGenomes-Tr; AT2G14455.1.
DR   EnsemblGenomes-Tr; AT2G14470.1.
DR   EnsemblGenomes-Tr; AT2G14475.1.
DR   EnsemblGenomes-Tr; AT2G14490.1.
DR   EnsemblGenomes-Tr; AT2G14535.1.
DR   EnsemblGenomes-Tr; AT2G14550.1.
DR   EnsemblGenomes-Tr; AT2G14570.1.
DR   EnsemblGenomes-Tr; AT2G14590.1.
DR   EnsemblGenomes-Tr; AT2G14595.1.
DR   EnsemblGenomes-Tr; AT2G14600.1.
DR   EnsemblGenomes-Tr; AT2G14605.1.
DR   EnsemblGenomes-Tr; AT2G14630.1.
DR   EnsemblGenomes-Tr; AT2G14640.1.
DR   EnsemblGenomes-Tr; AT2G14650.1.
DR   EnsemblGenomes-Tr; AT2G14661.1.
DR   EnsemblGenomes-Tr; AT2G14730.1.
DR   EnsemblGenomes-Tr; AT2G14760.2.
DR   EnsemblGenomes-Tr; AT2G14770.1.
DR   EnsemblGenomes-Tr; AT2G14770.2.
DR   EnsemblGenomes-Tr; AT2G14772.1.
DR   EnsemblGenomes-Tr; AT2G14774.1.
DR   EnsemblGenomes-Tr; AT2G14777.1.
DR   EnsemblGenomes-Tr; AT2G14780.1.
DR   EnsemblGenomes-Tr; AT2G14790.1.
DR   EnsemblGenomes-Tr; AT2G14793.1.
DR   EnsemblGenomes-Tr; AT2G14796.1.
DR   EnsemblGenomes-Tr; AT2G14840.1.
DR   EnsemblGenomes-Tr; AT2G14843.1.
DR   EnsemblGenomes-Tr; AT2G14878.1.
DR   EnsemblGenomes-Tr; AT2G14930.1.
DR   EnsemblGenomes-Tr; AT2G14940.1.
DR   EnsemblGenomes-Tr; AT2G14950.1.
DR   EnsemblGenomes-Tr; AT2G14970.1.
DR   EnsemblGenomes-Tr; AT2G14980.1.
DR   EnsemblGenomes-Tr; AT2G14990.1.
DR   EnsemblGenomes-Tr; AT2G15012.1.
DR   EnsemblGenomes-Tr; AT2G15013.1.
DR   EnsemblGenomes-Tr; AT2G15014.1.
DR   EnsemblGenomes-Tr; AT2G15015.1.
DR   EnsemblGenomes-Tr; AT2G15016.1.
DR   EnsemblGenomes-Tr; AT2G15017.1.
DR   EnsemblGenomes-Tr; AT2G15030.1.
DR   EnsemblGenomes-Tr; AT2G15040.1.
DR   EnsemblGenomes-Tr; AT2G15045.1.
DR   EnsemblGenomes-Tr; AT2G15050.2.
DR   EnsemblGenomes-Tr; AT2G15050.3.
DR   EnsemblGenomes-Tr; AT2G15060.1.
DR   EnsemblGenomes-Tr; AT2G15070.1.
DR   EnsemblGenomes-Tr; AT2G15100.1.
DR   EnsemblGenomes-Tr; AT2G15120.1.
DR   EnsemblGenomes-Tr; AT2G15128.1.
DR   EnsemblGenomes-Tr; AT2G15140.1.
DR   EnsemblGenomes-Tr; AT2G15145.1.
DR   EnsemblGenomes-Tr; AT2G15150.1.
DR   EnsemblGenomes-Tr; AT2G15160.1.
DR   EnsemblGenomes-Tr; AT2G15190.1.
DR   EnsemblGenomes-Tr; AT2G15200.1.
DR   EnsemblGenomes-Tr; AT2G15210.1.
DR   EnsemblGenomes-Tr; AT2G15250.1.
DR   EnsemblGenomes-Tr; AT2G15271.1.
DR   EnsemblGenomes-Tr; AT2G15280.2.
DR   EnsemblGenomes-Tr; AT2G15292.1.
DR   EnsemblGenomes-Tr; AT2G15330.1.
DR   EnsemblGenomes-Tr; AT2G15350.1.
DR   EnsemblGenomes-Tr; AT2G15380.1.
DR   EnsemblGenomes-Tr; AT2G15390.1.
DR   EnsemblGenomes-Tr; AT2G15410.1.
DR   EnsemblGenomes-Tr; AT2G15490.2.
DR   EnsemblGenomes-Tr; AT2G15510.1.
DR   EnsemblGenomes-Tr; AT2G15520.1.
DR   EnsemblGenomes-Tr; AT2G15540.1.
DR   EnsemblGenomes-Tr; AT2G15550.1.
DR   EnsemblGenomes-Tr; AT2G15555.1.
DR   EnsemblGenomes-Tr; AT2G15600.1.
DR   EnsemblGenomes-Tr; AT2G15650.1.
DR   EnsemblGenomes-Tr; AT2G15700.1.
DR   EnsemblGenomes-Tr; AT2G15720.1.
DR   EnsemblGenomes-Tr; AT2G15750.1.
DR   EnsemblGenomes-Tr; AT2G15765.1.
DR   EnsemblGenomes-Tr; AT2G15800.1.
DR   EnsemblGenomes-Tr; AT2G15810.1.
DR   EnsemblGenomes-Tr; AT2G15815.1.
DR   EnsemblGenomes-Tr; AT2G15840.1.
DR   EnsemblGenomes-Tr; AT2G15850.1.
DR   EnsemblGenomes-Tr; AT2G15870.1.
DR   EnsemblGenomes-Tr; AT2G15920.1.
DR   EnsemblGenomes-Tr; AT2G15940.1.
DR   EnsemblGenomes-Tr; AT2G15950.1.
DR   EnsemblGenomes-Tr; AT2G15990.1.
DR   EnsemblGenomes-Tr; AT2G16000.1.
DR   EnsemblGenomes-Tr; AT2G16010.1.
DR   EnsemblGenomes-Tr; AT2G16070.1.
DR   EnsemblGenomes-Tr; AT2G16080.1.
DR   EnsemblGenomes-Tr; AT2G16100.1.
DR   EnsemblGenomes-Tr; AT2G16110.1.
DR   EnsemblGenomes-Tr; AT2G16140.1.
DR   EnsemblGenomes-Tr; AT2G16145.1.
DR   EnsemblGenomes-Tr; AT2G16150.1.
DR   EnsemblGenomes-Tr; AT2G16160.1.
DR   EnsemblGenomes-Tr; AT2G16170.1.
DR   EnsemblGenomes-Tr; AT2G16180.1.
DR   EnsemblGenomes-Tr; AT2G16210.2.
DR   EnsemblGenomes-Tr; AT2G16240.1.
DR   EnsemblGenomes-Tr; AT2G16245.1.
DR   EnsemblGenomes-Tr; AT2G16260.1.
DR   EnsemblGenomes-Tr; AT2G16310.1.
DR   EnsemblGenomes-Tr; AT2G16320.1.
DR   EnsemblGenomes-Tr; AT2G16330.1.
DR   EnsemblGenomes-Tr; AT2G16360.1.
DR   EnsemblGenomes-Tr; AT2G16365.2.
DR   EnsemblGenomes-Tr; AT2G16365.4.
DR   EnsemblGenomes-Tr; AT2G16367.1.
DR   EnsemblGenomes-Tr; AT2G16410.1.
DR   EnsemblGenomes-Tr; AT2G16420.1.
DR   EnsemblGenomes-Tr; AT2G16430.1.
DR   EnsemblGenomes-Tr; AT2G16530.2.
DR   EnsemblGenomes-Tr; AT2G16540.1.
DR   EnsemblGenomes-Tr; AT2G16550.1.
DR   EnsemblGenomes-Tr; AT2G16560.1.
DR   EnsemblGenomes-Tr; AT2G16610.1.
DR   EnsemblGenomes-Tr; AT2G16670.1.
DR   EnsemblGenomes-Tr; AT2G16680.1.
DR   EnsemblGenomes-Tr; AT2G16690.1.
DR   EnsemblGenomes-Tr; AT2G16820.1.
DR   EnsemblGenomes-Tr; AT2G16830.1.
DR   EnsemblGenomes-Tr; AT2G16832.1.
DR   EnsemblGenomes-Tr; AT2G16840.1.
DR   EnsemblGenomes-Tr; AT2G16890.1.
DR   EnsemblGenomes-Tr; AT2G16895.1.
DR   EnsemblGenomes-Tr; AT2G16905.1.
DR   EnsemblGenomes-Tr; AT2G16950.1.
DR   EnsemblGenomes-Tr; AT2G17010.1.
DR   EnsemblGenomes-Tr; AT2G17033.1.
DR   EnsemblGenomes-Tr; AT2G17064.1.
DR   EnsemblGenomes-Tr; AT2G17115.1.
DR   EnsemblGenomes-Tr; AT2G17150.2.
DR   EnsemblGenomes-Tr; AT2G17295.1.
DR   EnsemblGenomes-Tr; AT2G17330.1.
DR   EnsemblGenomes-Tr; AT2G17460.1.
DR   EnsemblGenomes-Tr; AT2G17477.1.
DR   EnsemblGenomes-Tr; AT2G17490.1.
DR   EnsemblGenomes-Tr; AT2G17560.3.
DR   EnsemblGenomes-Tr; AT2G17610.1.
DR   EnsemblGenomes-Tr; AT2G17780.2.
DR   EnsemblGenomes-Tr; AT2G17780.3.
DR   EnsemblGenomes-Tr; AT2G17780.4.
DR   EnsemblGenomes-Tr; AT2G17810.1.
DR   EnsemblGenomes-Tr; AT2G17910.1.
DR   EnsemblGenomes-Tr; AT2G18030.2.
DR   EnsemblGenomes-Tr; AT2G18042.1.
DR   EnsemblGenomes-Tr; AT2G18115.1.
DR   EnsemblGenomes-Tr; AT2G18240.2.
DR   EnsemblGenomes-Tr; AT2G18300.1.
DR   EnsemblGenomes-Tr; AT2G18310.1.
DR   EnsemblGenomes-Tr; AT2G18323.1.
DR   EnsemblGenomes-Tr; AT2G18410.2.
DR   EnsemblGenomes-Tr; AT2G18440.1.
DR   EnsemblGenomes-Tr; AT2G18440.2.
DR   EnsemblGenomes-Tr; AT2G18580.1.
DR   EnsemblGenomes-Tr; AT2G18735.1.
DR   EnsemblGenomes-Tr; AT2G18820.1.
DR   EnsemblGenomes-Tr; AT2G18915.1.
DR   EnsemblGenomes-Tr; AT2G18917.1.
DR   EnsemblGenomes-Tr; AT2G19100.1.
DR   EnsemblGenomes-Tr; AT2G19140.1.
DR   EnsemblGenomes-Tr; AT2G19200.1.
DR   EnsemblGenomes-Tr; AT2G19250.1.
DR   EnsemblGenomes-Tr; AT2G19425.1.
DR   EnsemblGenomes-Tr; AT2G19572.1.
DR   EnsemblGenomes-Tr; AT2G19582.1.
DR   EnsemblGenomes-Tr; AT2G19640.1.
DR   EnsemblGenomes-Tr; AT2G19755.1.
DR   EnsemblGenomes-Tr; AT2G19796.1.
DR   EnsemblGenomes-Tr; AT2G19803.1.
DR   EnsemblGenomes-Tr; AT2G19806.1.
DR   EnsemblGenomes-Tr; AT2G19825.1.
DR   EnsemblGenomes-Tr; AT2G19840.1.
DR   EnsemblGenomes-Tr; AT2G19950.2.
DR   EnsemblGenomes-Tr; AT2G20100.2.
DR   EnsemblGenomes-Tr; AT2G20110.2.
DR   EnsemblGenomes-Tr; AT2G20180.1.
DR   EnsemblGenomes-Tr; AT2G20298.1.
DR   EnsemblGenomes-Tr; AT2G20460.1.
DR   EnsemblGenomes-Tr; AT2G20555.1.
DR   EnsemblGenomes-Tr; AT2G20590.2.
DR   EnsemblGenomes-Tr; AT2G20600.1.
DR   EnsemblGenomes-Tr; AT2G20610.2.
DR   EnsemblGenomes-Tr; AT2G20630.1.
DR   EnsemblGenomes-Tr; AT2G20710.2.
DR   EnsemblGenomes-Tr; AT2G20721.1.
DR   EnsemblGenomes-Tr; AT2G20722.1.
DR   EnsemblGenomes-Tr; AT2G20723.1.
DR   EnsemblGenomes-Tr; AT2G20724.1.
DR   EnsemblGenomes-Tr; AT2G20740.2.
DR   EnsemblGenomes-Tr; AT2G20740.3.
DR   EnsemblGenomes-Tr; AT2G20816.1.
DR   EnsemblGenomes-Tr; AT2G20818.1.
DR   EnsemblGenomes-Tr; AT2G20900.2.
DR   EnsemblGenomes-Tr; AT2G20900.3.
DR   EnsemblGenomes-Tr; AT2G20910.1.
DR   EnsemblGenomes-Tr; AT2G20993.1.
DR   EnsemblGenomes-Tr; AT2G21000.1.
DR   EnsemblGenomes-Tr; AT2G21020.1.
DR   EnsemblGenomes-Tr; AT2G21172.1.
DR   EnsemblGenomes-Tr; AT2G21187.1.
DR   EnsemblGenomes-Tr; AT2G21187.2.
DR   EnsemblGenomes-Tr; AT2G21187.3.
DR   EnsemblGenomes-Tr; AT2G21188.1.
DR   EnsemblGenomes-Tr; AT2G21310.1.
DR   EnsemblGenomes-Tr; AT2G21360.1.
DR   EnsemblGenomes-Tr; AT2G21460.1.
DR   EnsemblGenomes-Tr; AT2G21570.1.
DR   EnsemblGenomes-Tr; AT2G21670.1.
DR   EnsemblGenomes-Tr; AT2G21700.1.
DR   EnsemblGenomes-Tr; AT2G21760.1.
DR   EnsemblGenomes-Tr; AT2G21800.2.
DR   EnsemblGenomes-Tr; AT2G21880.2.
DR   EnsemblGenomes-Tr; AT2G21895.1.
DR   EnsemblGenomes-Tr; AT2G21905.1.
DR   EnsemblGenomes-Tr; AT2G22110.1.
DR   EnsemblGenomes-Tr; AT2G22150.1.
DR   EnsemblGenomes-Tr; AT2G22210.1.
DR   EnsemblGenomes-Tr; AT2G22220.1.
DR   EnsemblGenomes-Tr; AT2G22250.1.
DR   EnsemblGenomes-Tr; AT2G22280.1.
DR   EnsemblGenomes-Tr; AT2G22335.1.
DR   EnsemblGenomes-Tr; AT2G22350.1.
DR   EnsemblGenomes-Tr; AT2G22380.1.
DR   EnsemblGenomes-Tr; AT2G22390.1.
DR   EnsemblGenomes-Tr; AT2G22475.2.
DR   EnsemblGenomes-Tr; AT2G22482.1.
DR   EnsemblGenomes-Tr; AT2G22496.1.
DR   EnsemblGenomes-Tr; AT2G22540.2.
DR   EnsemblGenomes-Tr; AT2G22580.1.
DR   EnsemblGenomes-Tr; AT2G22668.1.
DR   EnsemblGenomes-Tr; AT2G22710.1.
DR   EnsemblGenomes-Tr; AT2G22750.1.
DR   EnsemblGenomes-Tr; AT2G22821.1.
DR   EnsemblGenomes-Tr; AT2G22920.1.
DR   EnsemblGenomes-Tr; AT2G22955.1.
DR   EnsemblGenomes-Tr; AT2G22970.2.
DR   EnsemblGenomes-Tr; AT2G22990.3.
DR   EnsemblGenomes-Tr; AT2G23020.1.
DR   EnsemblGenomes-Tr; AT2G23080.2.
DR   EnsemblGenomes-Tr; AT2G23330.1.
DR   EnsemblGenomes-Tr; AT2G23347.1.
DR   EnsemblGenomes-Tr; AT2G23480.1.
DR   EnsemblGenomes-Tr; AT2G23490.1.
DR   EnsemblGenomes-Tr; AT2G23500.1.
DR   EnsemblGenomes-Tr; AT2G23550.2.
DR   EnsemblGenomes-Tr; AT2G23570.1.
DR   EnsemblGenomes-Tr; AT2G23650.1.
DR   EnsemblGenomes-Tr; AT2G23672.1.
DR   EnsemblGenomes-Tr; AT2G23673.1.
DR   EnsemblGenomes-Tr; AT2G23680.2.
DR   EnsemblGenomes-Tr; AT2G23710.1.
DR   EnsemblGenomes-Tr; AT2G23720.1.
DR   EnsemblGenomes-Tr; AT2G23808.1.
DR   EnsemblGenomes-Tr; AT2G23850.1.
DR   EnsemblGenomes-Tr; AT2G23860.1.
DR   EnsemblGenomes-Tr; AT2G23870.1.
DR   EnsemblGenomes-Tr; AT2G23880.1.
DR   EnsemblGenomes-Tr; AT2G24000.2.
DR   EnsemblGenomes-Tr; AT2G24103.1.
DR   EnsemblGenomes-Tr; AT2G24110.1.
DR   EnsemblGenomes-Tr; AT2G24160.1.
DR   EnsemblGenomes-Tr; AT2G24165.1.
DR   EnsemblGenomes-Tr; AT2G24190.2.
DR   EnsemblGenomes-Tr; AT2G24380.1.
DR   EnsemblGenomes-Tr; AT2G24545.1.
DR   EnsemblGenomes-Tr; AT2G24545.2.
DR   EnsemblGenomes-Tr; AT2G24660.1.
DR   EnsemblGenomes-Tr; AT2G24730.1.
DR   EnsemblGenomes-Tr; AT2G24735.1.
DR   EnsemblGenomes-Tr; AT2G24748.1.
DR   EnsemblGenomes-Tr; AT2G24750.1.
DR   EnsemblGenomes-Tr; AT2G24755.1.
DR   EnsemblGenomes-Tr; AT2G24755.2.
DR   EnsemblGenomes-Tr; AT2G24755.3.
DR   EnsemblGenomes-Tr; AT2G24760.1.
DR   EnsemblGenomes-Tr; AT2G24761.1.
DR   EnsemblGenomes-Tr; AT2G24765.2.
DR   EnsemblGenomes-Tr; AT2G24791.1.
DR   EnsemblGenomes-Tr; AT2G24890.1.
DR   EnsemblGenomes-Tr; AT2G24900.1.
DR   EnsemblGenomes-Tr; AT2G24910.1.
DR   EnsemblGenomes-Tr; AT2G24915.1.
DR   EnsemblGenomes-Tr; AT2G24920.1.
DR   EnsemblGenomes-Tr; AT2G24930.1.
DR   EnsemblGenomes-Tr; AT2G25011.1.
DR   EnsemblGenomes-Tr; AT2G25015.1.
DR   EnsemblGenomes-Tr; AT2G25020.1.
DR   EnsemblGenomes-Tr; AT2G25025.1.
DR   EnsemblGenomes-Tr; AT2G25030.1.
DR   EnsemblGenomes-Tr; AT2G25040.1.
DR   EnsemblGenomes-Tr; AT2G25095.1.
DR   EnsemblGenomes-Tr; AT2G25171.1.
DR   EnsemblGenomes-Tr; AT2G25255.1.
DR   EnsemblGenomes-Tr; AT2G25380.1.
DR   EnsemblGenomes-Tr; AT2G25390.1.
DR   EnsemblGenomes-Tr; AT2G25400.1.
DR   EnsemblGenomes-Tr; AT2G25550.1.
DR   EnsemblGenomes-Tr; AT2G25687.1.
DR   EnsemblGenomes-Tr; AT2G25975.1.
DR   EnsemblGenomes-Tr; AT2G25990.1.
DR   EnsemblGenomes-Tr; AT2G26090.1.
DR   EnsemblGenomes-Tr; AT2G26211.1.
DR   EnsemblGenomes-Tr; AT2G26215.1.
DR   EnsemblGenomes-Tr; AT2G26220.1.
DR   EnsemblGenomes-Tr; AT2G26310.2.
DR   EnsemblGenomes-Tr; AT2G26310.3.
DR   EnsemblGenomes-Tr; AT2G26355.1.
DR   EnsemblGenomes-Tr; AT2G26455.1.
DR   EnsemblGenomes-Tr; AT2G26630.1.
DR   EnsemblGenomes-Tr; AT2G26670.2.
DR   EnsemblGenomes-Tr; AT2G26692.1.
DR   EnsemblGenomes-Tr; AT2G26800.1.
DR   EnsemblGenomes-Tr; AT2G26860.2.
DR   EnsemblGenomes-Tr; AT2G26882.1.
DR   EnsemblGenomes-Tr; AT2G26980.1.
DR   EnsemblGenomes-Tr; AT2G26980.2.
DR   EnsemblGenomes-Tr; AT2G27250.2.
DR   EnsemblGenomes-Tr; AT2G27375.1.
DR   EnsemblGenomes-Tr; AT2G27395.1.
DR   EnsemblGenomes-Tr; AT2G27400.1.
DR   EnsemblGenomes-Tr; AT2G27440.1.
DR   EnsemblGenomes-Tr; AT2G27500.2.
DR   EnsemblGenomes-Tr; AT2G27500.3.
DR   EnsemblGenomes-Tr; AT2G27560.1.
DR   EnsemblGenomes-Tr; AT2G27850.1.
DR   EnsemblGenomes-Tr; AT2G27870.1.
DR   EnsemblGenomes-Tr; AT2G27920.3.
DR   EnsemblGenomes-Tr; AT2G27935.1.
DR   EnsemblGenomes-Tr; AT2G27936.1.
DR   EnsemblGenomes-Tr; AT2G28053.1.
DR   EnsemblGenomes-Tr; AT2G28056.1.
DR   EnsemblGenomes-Tr; AT2G28280.1.
DR   EnsemblGenomes-Tr; AT2G28290.2.
DR   EnsemblGenomes-Tr; AT2G28290.3.
DR   EnsemblGenomes-Tr; AT2G28550.2.
DR   EnsemblGenomes-Tr; AT2G28560.1.
DR   EnsemblGenomes-Tr; AT2G28560.4.
DR   EnsemblGenomes-Tr; AT2G28670.2.
DR   EnsemblGenomes-Tr; AT2G28730.1.
DR   EnsemblGenomes-Tr; AT2G28750.1.
DR   EnsemblGenomes-Tr; AT2G28770.1.
DR   EnsemblGenomes-Tr; AT2G28800.2.
DR   EnsemblGenomes-Tr; AT2G28980.1.
DR   EnsemblGenomes-Tr; AT2G29010.1.
DR   EnsemblGenomes-Tr; AT2G29030.1.
DR   EnsemblGenomes-Tr; AT2G29160.1.
DR   EnsemblGenomes-Tr; AT2G29165.1.
DR   EnsemblGenomes-Tr; AT2G29230.1.
DR   EnsemblGenomes-Tr; AT2G29240.1.
DR   EnsemblGenomes-Tr; AT2G29270.1.
DR   EnsemblGenomes-Tr; AT2G29280.1.
DR   EnsemblGenomes-Tr; AT2G29390.2.
DR   EnsemblGenomes-Tr; AT2G29390.3.
DR   EnsemblGenomes-Tr; AT2G29390.4.
DR   EnsemblGenomes-Tr; AT2G29390.5.
DR   EnsemblGenomes-Tr; AT2G29520.1.
DR   EnsemblGenomes-Tr; AT2G29525.2.
DR   EnsemblGenomes-Tr; AT2G29610.1.
DR   EnsemblGenomes-Tr; AT2G29650.2.
DR   EnsemblGenomes-Tr; AT2G29650.3.
DR   EnsemblGenomes-Tr; AT2G29910.2.
DR   EnsemblGenomes-Tr; AT2G30115.1.
DR   EnsemblGenomes-Tr; AT2G30140.2.
DR   EnsemblGenomes-Tr; AT2G30170.2.
DR   EnsemblGenomes-Tr; AT2G30180.1.
DR   EnsemblGenomes-Tr; AT2G30190.1.
DR   EnsemblGenomes-Tr; AT2G30362.1.
DR   EnsemblGenomes-Tr; AT2G30450.1.
DR   EnsemblGenomes-Tr; AT2G30640.1.
DR   EnsemblGenomes-Tr; AT2G30850.1.
DR   EnsemblGenomes-Tr; AT2G30860.2.
DR   EnsemblGenomes-Tr; AT2G30940.1.
DR   EnsemblGenomes-Tr; AT2G30945.1.
DR   EnsemblGenomes-Tr; AT2G30984.1.
DR   EnsemblGenomes-Tr; AT2G31080.1.
DR   EnsemblGenomes-Tr; AT2G31280.2.
DR   EnsemblGenomes-Tr; AT2G31280.3.
DR   EnsemblGenomes-Tr; AT2G31350.2.
DR   EnsemblGenomes-Tr; AT2G31520.1.
DR   EnsemblGenomes-Tr; AT2G31550.1.
DR   EnsemblGenomes-Tr; AT2G31585.1.
DR   EnsemblGenomes-Tr; AT2G31585.2.
DR   EnsemblGenomes-Tr; AT2G31625.1.
DR   EnsemblGenomes-Tr; AT2G31751.1.
DR   EnsemblGenomes-Tr; AT2G31810.2.
DR   EnsemblGenomes-Tr; AT2G31810.3.
DR   EnsemblGenomes-Tr; AT2G31860.1.
DR   EnsemblGenomes-Tr; AT2G31865.2.
DR   EnsemblGenomes-Tr; AT2G31902.1.
DR   EnsemblGenomes-Tr; AT2G31955.3.
DR   EnsemblGenomes-Tr; AT2G32080.2.
DR   EnsemblGenomes-Tr; AT2G32110.1.
DR   EnsemblGenomes-Tr; AT2G32179.1.
DR   EnsemblGenomes-Tr; AT2G32250.2.
DR   EnsemblGenomes-Tr; AT2G32250.4.
DR   EnsemblGenomes-Tr; AT2G32273.1.
DR   EnsemblGenomes-Tr; AT2G32291.1.
DR   EnsemblGenomes-Tr; AT2G32315.1.
DR   EnsemblGenomes-Tr; AT2G32390.1.
DR   EnsemblGenomes-Tr; AT2G32490.1.
DR   EnsemblGenomes-Tr; AT2G32698.1.
DR   EnsemblGenomes-Tr; AT2G32710.2.
DR   EnsemblGenomes-Tr; AT2G32770.1.
DR   EnsemblGenomes-Tr; AT2G32770.2.
DR   EnsemblGenomes-Tr; AT2G32795.1.
DR   EnsemblGenomes-Tr; AT2G32860.1.
DR   EnsemblGenomes-Tr; AT2G33051.1.
DR   EnsemblGenomes-Tr; AT2G33140.1.
DR   EnsemblGenomes-Tr; AT2G33310.1.
DR   EnsemblGenomes-Tr; AT2G33310.3.
DR   EnsemblGenomes-Tr; AT2G33380.2.
DR   EnsemblGenomes-Tr; AT2G33560.2.
DR   EnsemblGenomes-Tr; AT2G33650.1.
DR   EnsemblGenomes-Tr; AT2G33660.1.
DR   EnsemblGenomes-Tr; AT2G33707.1.
DR   EnsemblGenomes-Tr; AT2G33740.1.
DR   EnsemblGenomes-Tr; AT2G33750.2.
DR   EnsemblGenomes-Tr; AT2G33815.1.
DR   EnsemblGenomes-Tr; AT2G33890.1.
DR   EnsemblGenomes-Tr; AT2G33900.1.
DR   EnsemblGenomes-Tr; AT2G33910.1.
DR   EnsemblGenomes-Tr; AT2G33920.1.
DR   EnsemblGenomes-Tr; AT2G33930.1.
DR   EnsemblGenomes-Tr; AT2G33940.1.
DR   EnsemblGenomes-Tr; AT2G33950.1.
DR   EnsemblGenomes-Tr; AT2G33960.1.
DR   EnsemblGenomes-Tr; AT2G33970.1.
DR   EnsemblGenomes-Tr; AT2G34130.1.
DR   EnsemblGenomes-Tr; AT2G34135.1.
DR   EnsemblGenomes-Tr; AT2G34202.1.
DR   EnsemblGenomes-Tr; AT2G34204.1.
DR   EnsemblGenomes-Tr; AT2G34208.1.
DR   EnsemblGenomes-Tr; AT2G34450.2.
DR   EnsemblGenomes-Tr; AT2G34630.1.
DR   EnsemblGenomes-Tr; AT2G34740.2.
DR   EnsemblGenomes-Tr; AT2G34760.1.
DR   EnsemblGenomes-Tr; AT2G34835.1.
DR   EnsemblGenomes-Tr; AT2G34850.1.
DR   EnsemblGenomes-Tr; AT2G34950.1.
DR   EnsemblGenomes-Tr; AT2G34985.1.
DR   EnsemblGenomes-Tr; AT2G35180.1.
DR   EnsemblGenomes-Tr; AT2G35210.2.
DR   EnsemblGenomes-Tr; AT2G35220.1.
DR   EnsemblGenomes-Tr; AT2G35382.1.
DR   EnsemblGenomes-Tr; AT2G35384.1.
DR   EnsemblGenomes-Tr; AT2G35387.1.
DR   EnsemblGenomes-Tr; AT2G35390.1.
DR   EnsemblGenomes-Tr; AT2G35570.1.
DR   EnsemblGenomes-Tr; AT2G35590.1.
DR   EnsemblGenomes-Tr; AT2G35613.1.
DR   EnsemblGenomes-Tr; AT2G35637.1.
DR   EnsemblGenomes-Tr; AT2G35710.2.
DR   EnsemblGenomes-Tr; AT2G35738.1.
DR   EnsemblGenomes-Tr; AT2G35738.2.
DR   EnsemblGenomes-Tr; AT2G35738.3.
DR   EnsemblGenomes-Tr; AT2G35742.1.
DR   EnsemblGenomes-Tr; AT2G35743.1.
DR   EnsemblGenomes-Tr; AT2G35744.1.
DR   EnsemblGenomes-Tr; AT2G35747.1.
DR   EnsemblGenomes-Tr; AT2G35859.1.
DR   EnsemblGenomes-Tr; AT2G35945.1.
DR   EnsemblGenomes-Tr; AT2G36010.1.
DR   EnsemblGenomes-Tr; AT2G36040.1.
DR   EnsemblGenomes-Tr; AT2G36060.2.
DR   EnsemblGenomes-Tr; AT2G36060.3.
DR   EnsemblGenomes-Tr; AT2G36080.2.
DR   EnsemblGenomes-Tr; AT2G36140.1.
DR   EnsemblGenomes-Tr; AT2G36150.1.
DR   EnsemblGenomes-Tr; AT2G36280.1.
DR   EnsemblGenomes-Tr; AT2G36307.1.
DR   EnsemblGenomes-Tr; AT2G36402.1.
DR   EnsemblGenomes-Tr; AT2G36510.1.
DR   EnsemblGenomes-Tr; AT2G36520.1.
DR   EnsemblGenomes-Tr; AT2G36600.1.
DR   EnsemblGenomes-Tr; AT2G36680.2.
DR   EnsemblGenomes-Tr; AT2G36680.3.
DR   EnsemblGenomes-Tr; AT2G36680.4.
DR   EnsemblGenomes-Tr; AT2G36792.1.
DR   EnsemblGenomes-Tr; AT2G36792.2.
DR   EnsemblGenomes-Tr; AT2G36860.1.
DR   EnsemblGenomes-Tr; AT2G36960.2.
DR   EnsemblGenomes-Tr; AT2G37362.1.
DR   EnsemblGenomes-Tr; AT2G37450.1.
DR   EnsemblGenomes-Tr; AT2G37500.2.
DR   EnsemblGenomes-Tr; AT2G37555.1.
DR   EnsemblGenomes-Tr; AT2G37700.2.
DR   EnsemblGenomes-Tr; AT2G37760.3.
DR   EnsemblGenomes-Tr; AT2G37760.4.
DR   EnsemblGenomes-Tr; AT2G37760.5.
DR   EnsemblGenomes-Tr; AT2G37770.1.
DR   EnsemblGenomes-Tr; AT2G37830.1.
DR   EnsemblGenomes-Tr; AT2G38030.1.
DR   EnsemblGenomes-Tr; AT2G38260.1.
DR   EnsemblGenomes-Tr; AT2G38290.2.
DR   EnsemblGenomes-Tr; AT2G38325.1.
DR   EnsemblGenomes-Tr; AT2G38520.1.
DR   EnsemblGenomes-Tr; AT2G38620.1.
DR   EnsemblGenomes-Tr; AT2G38720.1.
DR   EnsemblGenomes-Tr; AT2G38980.1.
DR   EnsemblGenomes-Tr; AT2G38990.1.
DR   EnsemblGenomes-Tr; AT2G39090.2.
DR   EnsemblGenomes-Tr; AT2G39175.1.
DR   EnsemblGenomes-Tr; AT2G39470.2.
DR   EnsemblGenomes-Tr; AT2G39470.3.
DR   EnsemblGenomes-Tr; AT2G39600.1.
DR   EnsemblGenomes-Tr; AT2G39610.1.
DR   EnsemblGenomes-Tr; AT2G39675.1.
DR   EnsemblGenomes-Tr; AT2G39681.1.
DR   EnsemblGenomes-Tr; AT2G39730.2.
DR   EnsemblGenomes-Tr; AT2G39760.2.
DR   EnsemblGenomes-Tr; AT2G39860.1.
DR   EnsemblGenomes-Tr; AT2G39885.1.
DR   EnsemblGenomes-Tr; AT2G40008.1.
DR   EnsemblGenomes-Tr; AT2G40440.1.
DR   EnsemblGenomes-Tr; AT2G40640.2.
DR   EnsemblGenomes-Tr; AT2G40640.3.
DR   EnsemblGenomes-Tr; AT2G40680.1.
DR   EnsemblGenomes-Tr; AT2G40805.1.
DR   EnsemblGenomes-Tr; AT2G40910.2.
DR   EnsemblGenomes-Tr; AT2G40935.2.
DR   EnsemblGenomes-Tr; AT2G40935.3.
DR   EnsemblGenomes-Tr; AT2G41178.1.
DR   EnsemblGenomes-Tr; AT2G41240.2.
DR   EnsemblGenomes-Tr; AT2G41270.1.
DR   EnsemblGenomes-Tr; AT2G41312.1.
DR   EnsemblGenomes-Tr; AT2G41312.2.
DR   EnsemblGenomes-Tr; AT2G41391.1.
DR   EnsemblGenomes-Tr; AT2G41430.3.
DR   EnsemblGenomes-Tr; AT2G41570.1.
DR   EnsemblGenomes-Tr; AT2G41580.1.
DR   EnsemblGenomes-Tr; AT2G41616.1.
DR   EnsemblGenomes-Tr; AT2G41710.1.
DR   EnsemblGenomes-Tr; AT2G41745.1.
DR   EnsemblGenomes-Tr; AT2G42020.1.
DR   EnsemblGenomes-Tr; AT2G42050.1.
DR   EnsemblGenomes-Tr; AT2G42130.1.
DR   EnsemblGenomes-Tr; AT2G42247.1.
DR   EnsemblGenomes-Tr; AT2G42280.2.
DR   EnsemblGenomes-Tr; AT2G42365.1.
DR   EnsemblGenomes-Tr; AT2G42365.2.
DR   EnsemblGenomes-Tr; AT2G42388.1.
DR   EnsemblGenomes-Tr; AT2G42420.1.
DR   EnsemblGenomes-Tr; AT2G42425.1.
DR   EnsemblGenomes-Tr; AT2G42485.1.
DR   EnsemblGenomes-Tr; AT2G42830.2.
DR   EnsemblGenomes-Tr; AT2G42835.1.
DR   EnsemblGenomes-Tr; AT2G42970.1.
DR   EnsemblGenomes-Tr; AT2G43137.1.
DR   EnsemblGenomes-Tr; AT2G43138.1.
DR   EnsemblGenomes-Tr; AT2G43139.1.
DR   EnsemblGenomes-Tr; AT2G43141.1.
DR   EnsemblGenomes-Tr; AT2G43160.4.
DR   EnsemblGenomes-Tr; AT2G43240.2.
DR   EnsemblGenomes-Tr; AT2G43300.1.
DR   EnsemblGenomes-Tr; AT2G43375.1.
DR   EnsemblGenomes-Tr; AT2G43410.1.
DR   EnsemblGenomes-Tr; AT2G43830.1.
DR   EnsemblGenomes-Tr; AT2G43910.1.
DR   EnsemblGenomes-Tr; AT2G43920.2.
DR   EnsemblGenomes-Tr; AT2G43920.3.
DR   EnsemblGenomes-Tr; AT2G43932.1.
DR   EnsemblGenomes-Tr; AT2G43950.2.
DR   EnsemblGenomes-Tr; AT2G43950.3.
DR   EnsemblGenomes-Tr; AT2G44140.2.
DR   EnsemblGenomes-Tr; AT2G44170.1.
DR   EnsemblGenomes-Tr; AT2G44255.1.
DR   EnsemblGenomes-Tr; AT2G44320.1.
DR   EnsemblGenomes-Tr; AT2G44350.1.
DR   EnsemblGenomes-Tr; AT2G44383.1.
DR   EnsemblGenomes-Tr; AT2G44470.1.
DR   EnsemblGenomes-Tr; AT2G44470.2.
DR   EnsemblGenomes-Tr; AT2G44480.2.
DR   EnsemblGenomes-Tr; AT2G44590.1.
DR   EnsemblGenomes-Tr; AT2G44590.2.
DR   EnsemblGenomes-Tr; AT2G44680.2.
DR   EnsemblGenomes-Tr; AT2G44780.1.
DR   EnsemblGenomes-Tr; AT2G44798.1.
DR   EnsemblGenomes-Tr; AT2G44798.2.
DR   EnsemblGenomes-Tr; AT2G44920.1.
DR   EnsemblGenomes-Tr; AT2G44995.1.
DR   EnsemblGenomes-Tr; AT2G45020.1.
DR   EnsemblGenomes-Tr; AT2G45023.1.
DR   EnsemblGenomes-Tr; AT2G45023.2.
DR   EnsemblGenomes-Tr; AT2G45090.1.
DR   EnsemblGenomes-Tr; AT2G45200.1.
DR   EnsemblGenomes-Tr; AT2G45230.1.
DR   EnsemblGenomes-Tr; AT2G45245.1.
DR   EnsemblGenomes-Tr; AT2G45245.2.
DR   EnsemblGenomes-Tr; AT2G45245.3.
DR   EnsemblGenomes-Tr; AT2G45245.4.
DR   EnsemblGenomes-Tr; AT2G45315.1.
DR   EnsemblGenomes-Tr; AT2G45315.2.
DR   EnsemblGenomes-Tr; AT2G45390.1.
DR   EnsemblGenomes-Tr; AT2G45560.2.
DR   EnsemblGenomes-Tr; AT2G45685.1.
DR   EnsemblGenomes-Tr; AT2G45770.2.
DR   EnsemblGenomes-Tr; AT2G45780.1.
DR   EnsemblGenomes-Tr; AT2G46120.1.
DR   EnsemblGenomes-Tr; AT2G46192.1.
DR   EnsemblGenomes-Tr; AT2G46255.1.
DR   EnsemblGenomes-Tr; AT2G46370.3.
DR   EnsemblGenomes-Tr; AT2G46493.1.
DR   EnsemblGenomes-Tr; AT2G46572.1.
DR   EnsemblGenomes-Tr; AT2G46590.1.
DR   EnsemblGenomes-Tr; AT2G46685.1.
DR   EnsemblGenomes-Tr; AT2G46700.2.
DR   EnsemblGenomes-Tr; AT2G46730.1.
DR   EnsemblGenomes-Tr; AT2G46830.2.
DR   EnsemblGenomes-Tr; AT2G46880.2.
DR   EnsemblGenomes-Tr; AT2G47015.1.
DR   EnsemblGenomes-Tr; AT2G47060.3.
DR   EnsemblGenomes-Tr; AT2G47060.4.
DR   EnsemblGenomes-Tr; AT2G47100.1.
DR   EnsemblGenomes-Tr; AT2G47275.1.
DR   EnsemblGenomes-Tr; AT2G47570.1.
DR   EnsemblGenomes-Tr; AT2G47570.2.
DR   EnsemblGenomes-Tr; AT2G47585.1.
DR   EnsemblGenomes-Tr; AT2G47740.1.
DR   EnsemblGenomes-Tr; AT2G47760.2.
DR   EnsemblGenomes-Tr; AT2G47760.3.
DR   EnsemblGenomes-Tr; AT2G47830.2.
DR   EnsemblGenomes-Tr; AT2G47895.1.
DR   EnsemblGenomes-Tr; AT2G47970.2.
DR   EnsemblGenomes-Tr; AT2G48120.2.
DR   EuropePMC; PMC3273788; 22121222.
DR   EuropePMC; PMC3585858; 22901679.
DR   EuropePMC; PMC3639923; 23557437.
DR   EuropePMC; PMC4168965; 25247119.
DR   GOA; F4IHR4.
DR   GOA; F4IMK4.
DR   GOA; O05000.
DR   GOA; O22793.
DR   GOA; O22891.
DR   GOA; O65921.
DR   GOA; O80866.
DR   GOA; O81072.
DR   GOA; O82377.
DR   GOA; P0CAY2.
DR   GOA; P0CAY8.
DR   GOA; P0DKJ1.
DR   GOA; P82781.
DR   GOA; P82784.
DR   GOA; P92515.
DR   GOA; P92516.
DR   GOA; P92517.
DR   GOA; P92518.
DR   GOA; P92519.
DR   GOA; P92520.
DR   GOA; P92547.
DR   GOA; P92553.
DR   GOA; P92555.
DR   GOA; P92558.
DR   GOA; P92560.
DR   GOA; P93290.
DR   GOA; P93293.
DR   GOA; P93294.
DR   GOA; P93295.
DR   GOA; Q0WP85.
DR   GOA; Q2V466.
DR   GOA; Q5Y750.
DR   GOA; Q6R8G4.
DR   GOA; Q7XJN0.
DR   GOA; Q7XJS0.
DR   GOA; Q8S8P0.
DR   GOA; Q94L32.
DR   GOA; Q9SIW5.
DR   GOA; Q9SIX3.
DR   GOA; Q9SJZ5.
DR   GOA; Q9SKJ5.
DR   GOA; Q9T6H8.
DR   GOA; Q9ZQQ7.
DR   GOA; Q9ZU43.
DR   GOA; Q9ZW81.
DR   InterPro; IPR000477; RT_dom.
DR   InterPro; IPR000903; MyristoylCoA_TrFase.
DR   InterPro; IPR001750; ND/Mrp_mem.
DR   InterPro; IPR002403; Cyt_P450_E_grp-IV.
DR   InterPro; IPR002893; Znf_MYND.
DR   InterPro; IPR003388; Reticulon.
DR   InterPro; IPR003567; Cyt_c_biogenesis.
DR   InterPro; IPR004977; Ribosomal_S25.
DR   InterPro; IPR010096; NADH-Q_OxRdtase_suN/2.
DR   InterPro; IPR013103; RVT_2.
DR   InterPro; IPR018086; NADH_UbQ_OxRdtase_su1_CS.
DR   InterPro; IPR018338; Carbonic_anhydrase_a-class_CS.
DR   InterPro; IPR022676; MyristoylCoA_TrFase_N.
DR   InterPro; IPR022677; MyristoylCoA_TrFase_C.
DR   InterPro; IPR022678; MyristoylCoA_TrFase_CS.
DR   InterPro; IPR023561; Carbonic_anhydrase_a-class.
DR   InterPro; IPR025724; GAG-pre-integrase_dom.
DR   InterPro; IPR036398; CA_dom_sf.
DR   InterPro; IPR039312; ZPR.
DR   InterPro; IPR039537; Retrotran_Ty1/copia-like.
DR   PDB; 5YDG; X-ray.
DR   PR2; CP002685.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00004; U2.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00026; U6.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00055; SNORD96.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00073; mir-156.
DR   RFAM; RF00075; mir-166.
DR   RFAM; RF00097; snoR71.
DR   RFAM; RF00147; SNORD34.
DR   RFAM; RF00247; mir-160.
DR   RFAM; RF00268; snoZ7.
DR   RFAM; RF00300; snoZ221_snoR21b.
DR   RFAM; RF00316; snoR43.
DR   RFAM; RF00337; snoZ112.
DR   RFAM; RF00343; snoZ122.
DR   RFAM; RF00348; snoR9_plant.
DR   RFAM; RF00351; snoR20.
DR   RFAM; RF00358; snoZ101.
DR   RFAM; RF00445; mir-399.
DR   RFAM; RF00452; mir-172.
DR   RFAM; RF00638; MIR159.
DR   RFAM; RF00647; MIR164.
DR   RFAM; RF00648; MIR396.
DR   RFAM; RF00689; MIR390.
DR   RFAM; RF00690; MIR408.
DR   RFAM; RF00695; MIR398.
DR   RFAM; RF00768; MIR405.
DR   RFAM; RF00842; MIR403.
DR   RFAM; RF00886; MIR807.
DR   RFAM; RF00893; MIR854.
DR   RFAM; RF01170; snoU61.
DR   RFAM; RF01178; snoR77Y.
DR   RFAM; RF01206; snoR109.
DR   RFAM; RF01280; snoR14.
DR   RFAM; RF01286; snoR26.
DR   RFAM; RF01287; snoR27.
DR   RFAM; RF01292; snoR2.
DR   RFAM; RF01300; snoU49.
DR   RFAM; RF01421; snoR114.
DR   RFAM; RF01428; snoR128.
DR   RFAM; RF01431; snoR135.
DR   RFAM; RF01855; Plant_SRP.
DR   RFAM; RF01960; SSU_rRNA_eukarya.
DR   SILVA-LSU; CP002685.
DR   SILVA-SSU; CP002685.
DR   TAIR; 1000429949; AT2G07743.
DR   TAIR; 1000429950; AT2G07742.
DR   TAIR; 1000429951; AT2G07762.
DR   TAIR; 1000429952; AT2G07758.
DR   TAIR; 1000429953; AT2G07756.
DR   TAIR; 1000429954; AT2G07765.
DR   TAIR; 1000429955; AT2G07761.
DR   TAIR; 1000429956; AT2G07763.
DR   TAIR; 1000429957; AT2G07764.
DR   TAIR; 1000429958; AT2G07757.
DR   TAIR; 1000429959; AT2G07759.
DR   TAIR; 1000429960; AT2G07766.
DR   TAIR; 1000429965; AT2G07752.
DR   TAIR; 1000429966; AT2G07753.
DR   TAIR; 1000429967; AT2G07755.
DR   TAIR; 1000429968; AT2G07745.
DR   TAIR; 1000429969; AT2G07748.
DR   TAIR; 1000429970; AT2G07746.
DR   TAIR; 1000429971; AT2G07754.
DR   TAIR; 1000429980; AT2G01020.
DR   TAIR; 1000429981; AT2G01010.
DR   TAIR; 1000429984; AT2G34985.
DR   TAIR; 1000529421; AT2G28056.
DR   TAIR; 1000629393; AT2G07778.
DR   TAIR; 1000629394; AT2G07793.
DR   TAIR; 1000629395; AT2G07794.
DR   TAIR; 1000629396; AT2G07792.
DR   TAIR; 1001029496; AT2G31751.
DR   TAIR; 1001029507; AT2G39681.
DR   TAIR; 1001029512; AT2G46685.
DR   TAIR; 1001029519; AT2G39675.
DR   TAIR; 1001029553; AT2G25095.
DR   TAIR; 1001029558; AT2G39175.
DR   TAIR; 1001029571; AT2G47585.
DR   TAIR; 1501129655; AT2G03445.
DR   TAIR; 1501129659; AT2G05995.
DR   TAIR; 1501129660; AT2G09795.
DR   TAIR; 1501129661; AT2G10606.
DR   TAIR; 1501129664; AT2G13665.
DR   TAIR; 1501129667; AT2G16145.
DR   TAIR; 1501129669; AT2G16245.
DR   TAIR; 1501129677; AT2G19425.
DR   TAIR; 1501129678; AT2G19582.
DR   TAIR; 1501129684; AT2G21187.
DR   TAIR; 1501129685; AT2G21188.
DR   TAIR; 1501129693; AT2G22668.
DR   TAIR; 1501129694; AT2G22955.
DR   TAIR; 1501129697; AT2G24545.
DR   TAIR; 1501129699; AT2G24755.
DR   TAIR; 1501129702; AT2G26692.
DR   TAIR; 1501129704; AT2G30362.
DR   TAIR; 1501129707; AT2G31585.
DR   TAIR; 1501129708; AT2G32273.
DR   TAIR; 1501129710; AT2G32698.
DR   TAIR; 1501129713; AT2G32795.
DR   TAIR; 1501129716; AT2G33815.
DR   TAIR; 1501129719; AT2G34202.
DR   TAIR; 1501129720; AT2G34204.
DR   TAIR; 1501129721; AT2G34208.
DR   TAIR; 1501129725; AT2G35637.
DR   TAIR; 1501129726; AT2G35738.
DR   TAIR; 1501129728; AT2G35945.
DR   TAIR; 1501129729; AT2G36307.
DR   TAIR; 1501129731; AT2G36792.
DR   TAIR; 1501129732; AT2G37555.
DR   TAIR; 1501129735; AT2G38325.
DR   TAIR; 1501129737; AT2G39885.
DR   TAIR; 1501129738; AT2G40008.
DR   TAIR; 1501129739; AT2G40805.
DR   TAIR; 1501129740; AT2G41178.
DR   TAIR; 1501129741; AT2G41312.
DR   TAIR; 1501129744; AT2G42247.
DR   TAIR; 1501129745; AT2G42365.
DR   TAIR; 1501129746; AT2G42388.
DR   TAIR; 1501129747; AT2G42485.
DR   TAIR; 1501129748; AT2G42835.
DR   TAIR; 1501129751; AT2G44255.
DR   TAIR; 1501129753; AT2G44798.
DR   TAIR; 1501129754; AT2G45245.
DR   TAIR; 1501129755; AT2G45315.
DR   TAIR; 1501129757; AT2G46255.
DR   TAIR; 1501129758; AT2G47015.
DR   TAIR; 1501129759; AT2G47275.
DR   TAIR; 1501129760; AT2G47895.
DR   TAIR; 1501130445; AT2G02741.
DR   TAIR; 1501130456; AT2G06002.
DR   TAIR; 1501130458; AT2G06562.
DR   TAIR; 1501130460; AT2G07042.
DR   TAIR; 1501130461; AT2G07213.
DR   TAIR; 1501130475; AT2G10537.
DR   TAIR; 1501130478; AT2G10921.
DR   TAIR; 1501130486; AT2G11852.
DR   TAIR; 1501130501; AT2G14115.
DR   TAIR; 1501130508; AT2G15128.
DR   TAIR; 1501130510; AT2G15555.
DR   TAIR; 1501130519; AT2G18735.
DR   TAIR; 1501130520; AT2G18917.
DR   TAIR; 1501130524; AT2G19796.
DR   TAIR; 1501130536; AT2G22496.
DR   TAIR; 1501130538; AT2G22821.
DR   TAIR; 1501130547; AT2G23347.
DR   TAIR; 1501130548; AT2G23672.
DR   TAIR; 1501130551; AT2G24103.
DR   TAIR; 1501130558; AT2G25011.
DR   TAIR; 1501130560; AT2G25171.
DR   TAIR; 1501130564; AT2G26211.
DR   TAIR; 1501130566; AT2G26355.
DR   TAIR; 1501130569; AT2G26882.
DR   TAIR; 1501130585; AT2G30984.
DR   TAIR; 1501130593; AT2G32179.
DR   TAIR; 1501130594; AT2G32315.
DR   TAIR; 1501130597; AT2G33051.
DR   TAIR; 1501130636; AT2G41616.
DR   TAIR; 1501130640; AT2G43375.
DR   TAIR; 1501130647; AT2G45023.
DR   TAIR; 1501130652; AT2G45685.
DR   TAIR; 1501130653; AT2G46192.
DR   TAIR; 1501130656; AT2G46572.
DR   TAIR; 1501132984; AT2G04852.
DR   TAIR; 1501132987; AT2G05518.
DR   TAIR; 1501133018; AT2G15292.
DR   TAIR; 1501133028; AT2G24735.
DR   TAIR; 1501133040; AT2G42425.
DR   TAIR; 1501133045; AT2G44995.
DR   TAIR; 1501165956; AT2G01422.
DR   TAIR; 1501165959; AT2G05812.
DR   TAIR; 1501165960; AT2G05914.
DR   TAIR; 1501165962; AT2G14878.
DR   TAIR; 1501165963; AT2G19572.
DR   TAIR; 1501165964; AT2G22482.
DR   TAIR; 1501165970; AT2G30945.
DR   TAIR; 1501165971; AT2G31902.
DR   TAIR; 1501165972; AT2G35859.
DR   TAIR; 1501165973; AT2G37362.
DR   TAIR; 228644; AT2G27560.
DR   TAIR; 228645; AT2G01160.
DR   TAIR; 228649; AT2G39600.
DR   TAIR; 228650; AT2G39610.
DR   TAIR; 228652; AT2G25400.
DR   TAIR; 228655; AT2G43300.
DR   TAIR; 228656; AT2G43137.
DR   TAIR; 228657; AT2G43138.
DR   TAIR; 228658; AT2G43141.
DR   TAIR; 228659; AT2G43139.
DR   TAIR; 228662; AT2G22580.
DR   TAIR; 228663; AT2G22380.
DR   TAIR; 228666; AT2G47100.
DR   TAIR; 228668; AT2G27850.
DR   TAIR; 228671; AT2G16240.
DR   TAIR; 228673; AT2G29520.
DR   TAIR; 228675; AT2G47740.
DR   TAIR; 228678; AT2G03790.
DR   TAIR; 228679; AT2G03660.
DR   TAIR; 228680; AT2G03700.
DR   TAIR; 228683; AT2G15950.
DR   TAIR; 228684; AT2G34950.
DR   TAIR; 228686; AT2G36510.
DR   TAIR; 228687; AT2G36520.
DR   TAIR; 228688; AT2G36600.
DR   TAIR; 228690; AT2G23020.
DR   TAIR; 228691; AT2G32110.
DR   TAIR; 228692; AT2G42970.
DR   TAIR; 228703; AT2G33140.
DR   TAIR; 228704; AT2G23650.
DR   TAIR; 228716; AT2G21700.
DR   TAIR; 228717; AT2G21570.
DR   TAIR; 228718; AT2G21670.
DR   TAIR; 228719; AT2G36280.
DR   TAIR; 228721; AT2G21360.
DR   TAIR; 228723; AT2G44320.
DR   TAIR; 228724; AT2G45390.
DR   TAIR; 228725; AT2G33650.
DR   TAIR; 228726; AT2G33660.
DR   TAIR; 228728; AT2G20721.
DR   TAIR; 228729; AT2G20722.
DR   TAIR; 228730; AT2G20723.
DR   TAIR; 228731; AT2G17295.
DR   TAIR; 228735; AT2G21760.
DR   TAIR; 228737; AT2G30850.
DR   TAIR; 228739; AT2G28730.
DR   TAIR; 228740; AT2G28770.
DR   TAIR; 228742; AT2G36140.
DR   TAIR; 228743; AT2G36150.
DR   TAIR; 228746; AT2G42420.
DR   TAIR; 228752; AT2G17810.
DR   TAIR; 228753; AT2G33950.
DR   TAIR; 228754; AT2G33960.
DR   TAIR; 228755; AT2G33970.
DR   TAIR; 228756; AT2G33890.
DR   TAIR; 228757; AT2G33900.
DR   TAIR; 228758; AT2G33910.
DR   TAIR; 228759; AT2G33920.
DR   TAIR; 228760; AT2G33930.
DR   TAIR; 228761; AT2G33940.
DR   TAIR; 228762; AT2G45020.
DR   TAIR; 228764; AT2G22110.
DR   TAIR; 228765; AT2G02900.
DR   TAIR; 228767; AT2G26090.
DR   TAIR; 228773; AT2G36860.
DR   TAIR; 228781; AT2G35742.
DR   TAIR; 228782; AT2G35744.
DR   TAIR; 228783; AT2G35747.
DR   TAIR; 228786; AT2G05765.
DR   TAIR; 228787; AT2G22280.
DR   TAIR; 228788; AT2G22220.
DR   TAIR; 228789; AT2G30190.
DR   TAIR; 228790; AT2G30180.
DR   TAIR; 228791; AT2G24380.
DR   TAIR; 228792; AT2G39860.
DR   TAIR; 228797; AT2G18310.
DR   TAIR; 228801; AT2G35382.
DR   TAIR; 228802; AT2G35384.
DR   TAIR; 228803; AT2G35387.
DR   TAIR; 228805; AT2G46120.
DR   TAIR; 228808; AT2G35220.
DR   TAIR; 228810; AT2G03490.
DR   TAIR; 228813; AT2G30450.
DR   TAIR; 228814; AT2G42020.
DR   TAIR; 228819; AT2G02600.
DR   TAIR; 228821; AT2G38030.
DR   TAIR; 228822; AT2G29030.
DR   TAIR; 26562; AT2G18440.
DR   TAIR; 31413; AT2G27400.
DR   TAIR; 33090; AT2G45780.
DR   TAIR; 500230854; AT2G30115.
DR   UniProtKB/Swiss-Prot; F4IHR4; ATCA2_ARATH.
DR   UniProtKB/Swiss-Prot; F4IMK4; MES19_ARATH.
DR   UniProtKB/Swiss-Prot; O05000; NU2M_ARATH.
DR   UniProtKB/Swiss-Prot; O22793; MORF2_ARATH.
DR   UniProtKB/Swiss-Prot; O22891; Y2044_ARATH.
DR   UniProtKB/Swiss-Prot; O65921; GDL35_ARATH.
DR   UniProtKB/Swiss-Prot; O80866; ORP1A_ARATH.
DR   UniProtKB/Swiss-Prot; O81072; GT11_ARATH.
DR   UniProtKB/Swiss-Prot; O82377; ESFL6_ARATH.
DR   UniProtKB/Swiss-Prot; O82394; FB321_ARATH.
DR   UniProtKB/Swiss-Prot; P0CAY2; DEF53_ARATH.
DR   UniProtKB/Swiss-Prot; P0CAY8; DF292_ARATH.
DR   UniProtKB/Swiss-Prot; P0DKJ1; P164A_ARATH.
DR   UniProtKB/Swiss-Prot; P82781; DEF03_ARATH.
DR   UniProtKB/Swiss-Prot; P82784; DEF07_ARATH.
DR   UniProtKB/Swiss-Prot; P92515; M740_ARATH.
DR   UniProtKB/Swiss-Prot; P92516; M750_ARATH.
DR   UniProtKB/Swiss-Prot; P92517; M760_ARATH.
DR   UniProtKB/Swiss-Prot; P92518; M770_ARATH.
DR   UniProtKB/Swiss-Prot; P92519; M810_ARATH.
DR   UniProtKB/Swiss-Prot; P92520; M820_ARATH.
DR   UniProtKB/Swiss-Prot; P92547; ATP62_ARATH.
DR   UniProtKB/Swiss-Prot; P92553; M1230_ARATH.
DR   UniProtKB/Swiss-Prot; P92555; M1250_ARATH.
DR   UniProtKB/Swiss-Prot; P92558; NU1M_ARATH.
DR   UniProtKB/Swiss-Prot; P92560; M1290_ARATH.
DR   UniProtKB/Swiss-Prot; P93290; M240_ARATH.
DR   UniProtKB/Swiss-Prot; P93293; M300_ARATH.
DR   UniProtKB/Swiss-Prot; P93294; M320_ARATH.
DR   UniProtKB/Swiss-Prot; P93295; M310_ARATH.
DR   UniProtKB/Swiss-Prot; Q0WP85; PP150_ARATH.
DR   UniProtKB/Swiss-Prot; Q2V466; DF191_ARATH.
DR   UniProtKB/Swiss-Prot; Q56WL5; ZPR4_ARATH.
DR   UniProtKB/Swiss-Prot; Q570N1; PP2B3_ARATH.
DR   UniProtKB/Swiss-Prot; Q5Y750; CP512_ARATH.
DR   UniProtKB/Swiss-Prot; Q6R8G4; PHO16_ARATH.
DR   UniProtKB/Swiss-Prot; Q7XJN0; RH17_ARATH.
DR   UniProtKB/Swiss-Prot; Q7XJS0; ASHR1_ARATH.
DR   UniProtKB/Swiss-Prot; Q84J62; Y2920_ARATH.
DR   UniProtKB/Swiss-Prot; Q8S8P0; SCP52_ARATH.
DR   UniProtKB/Swiss-Prot; Q94L32; NMT2_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SIW5; RS251_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SIX3; RBG1_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SJ32; FDL15_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SJZ5; RAA4E_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SKJ5; CESAA_ARATH.
DR   UniProtKB/Swiss-Prot; Q9T6H8; CCMF1_ARATH.
DR   UniProtKB/Swiss-Prot; Q9ZQQ7; Y2144_ARATH.
DR   UniProtKB/Swiss-Prot; Q9ZU43; RTNLO_ARATH.
DR   UniProtKB/Swiss-Prot; Q9ZW81; BH129_ARATH.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..19698289
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="2"
FT                   /ecotype="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   gap             1..1000
FT                   /estimated_length=1000
FT   gene            1025..3173
FT                   /locus_tag="AT2G01008"
FT   mRNA            join(1025..1272,1458..1510,1873..3173)
FT                   /locus_tag="AT2G01008"
FT                   /product="maternal effect embryo arrest protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG511870.1,INSD:EG489100.1,INSD:EG489067.1,
FT                   INSD:EG489070.1,INSD:EG463378.1,INSD:EG511877.1,
FT                   INSD:EG511871.1,INSD:EG489069.1,INSD:EG511856.1,
FT                   INSD:EG434374.1,INSD:EG463377.1,INSD:EG467956.1,
FT                   INSD:EG511889.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:EF183283.1"
FT   CDS_pept        join(1025..1272,1458..1510,1873..2111)
FT                   /codon_start=1
FT                   /locus_tag="AT2G01008"
FT                   /product="maternal effect embryo arrest protein"
FT                   /note="FUNCTIONS IN: molecular_function unknown; INVOLVED
FT                   IN: biological_process unknown; LOCATED IN:
FT                   cellular_component unknown; BEST Arabidopsis thaliana
FT                   protein match is: maternal effect embryo arrest 38
FT                   (TAIR:AT3G43160.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01008"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01008.1"
FT                   /db_xref="GOA:F4IM67"
FT                   /db_xref="UniProtKB/TrEMBL:F4IM67"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG511870.1,INSD:EG489100.1,INSD:EG489067.1,
FT                   INSD:EG489070.1,INSD:EG463378.1,INSD:EG511877.1,
FT                   INSD:EG511871.1,INSD:EG489069.1,INSD:EG511856.1,
FT                   INSD:EG434374.1,INSD:EG463377.1,INSD:EG467956.1,
FT                   INSD:EG511889.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:EF183283.1"
FT                   /protein_id="AEC05388.1"
FT                   /translation="MLDQDDEWAMKIYRVRGMVDRVREFVDQDEEWSRICRPGVEIVDR
FT                   VREFVDQDGGTLDQDDEWAMKIYRVRGMVDQKLESSTGSETSSTGSEDSSTRTAGWGWV
FT                   LRESGQSVGTPFFGSDLGSDRGMVSDIDTRNDRPSGRRDFRRKTFSATFPAIGFVAFFR
FT                   VFSAVLGQKLMNRRGE"
FT   gene            2805..3176
FT                   /gene="MIR5642b"
FT                   /locus_tag="AT2G03855"
FT   precursor_RNA   2805..3176
FT                   /gene="MIR5642b"
FT                   /locus_tag="AT2G03855"
FT                   /product="microRNA ath-MIR5642b precursor"
FT   ncRNA           3145..3164
FT                   /gene="MIR5642b"
FT                   /locus_tag="AT2G03855"
FT                   /product="microRNA ath-miR5642b"
FT                   /note="mature miRNA accession:MIMAT0022435"
FT                   /ncRNA_class="miRNA"
FT   gene            3706..5513
FT                   /gene_synonym="51593.RRNA00001"
FT                   /locus_tag="AT2G01010"
FT   rRNA            3706..5513
FT                   /gene_synonym="51593.RRNA00001"
FT                   /locus_tag="AT2G01010"
FT                   /product="18S ribosomal RNA"
FT   gene            5782..5945
FT                   /gene_synonym="51593.RRNA00002"
FT                   /locus_tag="AT2G01020"
FT                   /note="5.8SrRNA"
FT   rRNA            5782..5945
FT                   /gene_synonym="51593.RRNA00002"
FT                   /locus_tag="AT2G01020"
FT                   /product="5S ribosomal RNA"
FT   gene            6571..6672
FT                   /locus_tag="AT2G01021"
FT   mRNA            6571..6672
FT                   /locus_tag="AT2G01021"
FT                   /product="hypothetical protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV550888.1,INSD:ES003763.1,INSD:AV528184.1,
FT                   INSD:AA042643.1,INSD:ES062036.1,INSD:ES127291.1,
FT                   INSD:AV528190.1,INSD:EG515143.1,INSD:AV528806.1,
FT                   INSD:AV554739.1,INSD:ES079704.1,INSD:AV529390.1,
FT                   INSD:ES047365.1,INSD:EL975300.1,INSD:AV518379.1,
FT                   INSD:ES104298.1,INSD:AV529950.1,INSD:AV519779.1,
FT                   INSD:AV551928.1,INSD:AV519505.1,INSD:AV529485.1,
FT                   INSD:AV532365.1,INSD:BE523635.1"
FT   CDS_pept        6571..6672
FT                   /codon_start=1
FT                   /locus_tag="AT2G01021"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01021"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01021.1"
FT                   /db_xref="UniProtKB/TrEMBL:B3H4D4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV550888.1,INSD:ES003763.1,INSD:AV528184.1,
FT                   INSD:AA042643.1,INSD:ES062036.1,INSD:ES127291.1,
FT                   INSD:AV528190.1,INSD:EG515143.1,INSD:AV528806.1,
FT                   INSD:AV554739.1,INSD:ES079704.1,INSD:AV529390.1,
FT                   INSD:ES047365.1,INSD:EL975300.1,INSD:AV518379.1,
FT                   INSD:ES104298.1,INSD:AV529950.1,INSD:AV519779.1,
FT                   INSD:AV551928.1,INSD:AV519505.1,INSD:AV529485.1,
FT                   INSD:AV532365.1,INSD:BE523635.1"
FT                   /protein_id="AEC05389.1"
FT                   /translation="MRPGRMRNGAIRSADRFGAWTDADYGGGLSPGF"
FT   gene            7090..7505
FT                   /locus_tag="AT2G03865"
FT   misc_RNA        7090..7505
FT                   /locus_tag="AT2G03865"
FT                   /note="novel transcribed region; detected in root, carpel,
FT                   root apical meristem, receptacle, leaf, dark-grown
FT                   seedling, light-grown seedling, flower, pollen, aerial,
FT                   shoot apical meristem; AT2G03865.1"
FT   gene            7669..9399
FT                   /locus_tag="AT2G03875"
FT   misc_RNA        7669..9399
FT                   /locus_tag="AT2G03875"
FT                   /note="novel transcribed region; detected in root, carpel,
FT                   root apical meristem, receptacle, leaf, dark-grown
FT                   seedling, light-grown seedling, flower, pollen, aerial,
FT                   shoot apical meristem; AT2G03875.1"
FT   gene            complement(9648..9767)
FT                   /locus_tag="AT2G01023"
FT   mRNA            complement(9648..9767)
FT                   /locus_tag="AT2G01023"
FT                   /product="hypothetical protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG508416.1,INSD:CB253636.1,INSD:EG508425.1,
FT                   INSD:EG500867.1,INSD:EG516455.1,INSD:EG500866.1,
FT                   INSD:EG508424.1,INSD:EG500857.1,INSD:EG500855.1,
FT                   INSD:EG500858.1"
FT   CDS_pept        complement(9648..9767)
FT                   /codon_start=1
FT                   /locus_tag="AT2G01023"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01023"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01023.1"
FT                   /db_xref="UniProtKB/TrEMBL:B3H484"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG508416.1,INSD:CB253636.1,INSD:EG508425.1,
FT                   INSD:EG500867.1,INSD:EG516455.1,INSD:EG500866.1,
FT                   INSD:EG508424.1,INSD:EG500857.1,INSD:EG500855.1,
FT                   INSD:EG500858.1"
FT                   /protein_id="AEC05390.1"
FT                   /translation="MHLRERFGQVCLFTYSSHYAPLRALRVFKTLGEVRNLTK"
FT   gene            9849..10177
FT                   /locus_tag="AT2G00340"
FT   misc_RNA        9849..10177
FT                   /locus_tag="AT2G00340"
FT                   /note="novel transcribed region; AT2G00340.1"
FT   gene            complement(10478..12861)
FT                   /pseudo
FT                   /locus_tag="AT2G01022"
FT   mRNA            complement(<10478..>12861)
FT                   /pseudo
FT                   /locus_tag="AT2G01022"
FT                   /product="hypothetical protein"
FT   gene            complement(14395..16377)
FT                   /pseudo
FT                   /locus_tag="AT2G01024"
FT   mRNA            complement(<14395..>16377)
FT                   /pseudo
FT                   /locus_tag="AT2G01024"
FT                   /product="hypothetical protein"
FT   gene            complement(17624..22540)
FT                   /pseudo
FT                   /locus_tag="AT2G01026"
FT   mRNA            complement(<17624..>22540)
FT                   /pseudo
FT                   /locus_tag="AT2G01026"
FT                   /product="hypothetical protein"
FT   gene            complement(23971..26923)
FT                   /pseudo
FT                   /locus_tag="AT2G01028"
FT   mRNA            complement(<23971..>26923)
FT                   /pseudo
FT                   /locus_tag="AT2G01028"
FT                   /product="hypothetical protein"
FT   gap             28031..28150
FT                   /estimated_length=120
FT   gene            28465..38652
FT                   /pseudo
FT                   /locus_tag="AT2G01029"
FT   mRNA            <28465..>38652
FT                   /pseudo
FT                   /locus_tag="AT2G01029"
FT                   /product="hypothetical protein"
FT   gene            complement(39519..40358)
FT                   /pseudo
FT                   /locus_tag="AT2G01031"
FT   mRNA            complement(join(<39519..39776,39867..>40358))
FT                   /pseudo
FT                   /locus_tag="AT2G01031"
FT                   /product="hypothetical protein"
FT   gene            complement(43427..48350)
FT                   /pseudo
FT                   /locus_tag="AT2G01034"
FT   mRNA            complement(<43427..>48350)
FT                   /pseudo
FT                   /locus_tag="AT2G01034"
FT                   /product="hypothetical protein"
FT   gene            complement(50288..51487)
FT                   /locus_tag="AT2G01035"
FT   mRNA            complement(join(50288..50567,51062..51259,51363..51487))
FT                   /locus_tag="AT2G01035"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(50345..50567,51062..51259,51363..51487))
FT                   /codon_start=1
FT                   /locus_tag="AT2G01035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01035"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AX58"
FT                   /protein_id="ANM61244.1"
FT                   /translation="MCRKLHALLSSRYSKTKHWSKVTKPVDFEINFQEDSDELRGVCNQ
FT                   RNADPHCTINQIRKQISSNPKEFSWRSAYQFEAPRLSFLERPTYTLTSNSTKSYHSISV
FT                   SAARSQDKPSSNLYPRSLVRSSDSLPCSLLARSFGNLSHCSAHQSGHFSARHSDHLGEH
FT                   PTAPQQLMRSIRLPNPQA"
FT   gene            complement(53269..54468)
FT                   /locus_tag="AT2G01045"
FT   mRNA            complement(join(53269..53548,54043..54240,54344..54468))
FT                   /locus_tag="AT2G01045"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(53326..53548,54043..54240,54344..54468))
FT                   /codon_start=1
FT                   /locus_tag="AT2G01045"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AX58"
FT                   /protein_id="ANM62620.1"
FT                   /translation="MCRKLHALLSSRYSKTKHWSKVTKPVDFEINFQEDSDELRGVCNQ
FT                   RNADPHCTINQIRKQISSNPKEFSWRSAYQFEAPRLSFLERPTYTLTSNSTKSYHSISV
FT                   SAARSQDKPSSNLYPRSLVRSSDSLPCSLLARSFGNLSHCSAHQSGHFSARHSDHLGEH
FT                   PTAPQQLMRSIRLPNPQA"
FT   gene            complement(58705..64872)
FT                   /pseudo
FT                   /locus_tag="AT2G01037"
FT   mRNA            complement(<58705..>64872)
FT                   /pseudo
FT                   /locus_tag="AT2G01037"
FT                   /product="hypothetical protein"
FT   gene            complement(65436..67139)
FT                   /pseudo
FT                   /gene_synonym="F23H14.1"
FT                   /locus_tag="AT2G01040"
FT   mRNA            complement(<65436..>67139)
FT                   /pseudo
FT                   /gene_synonym="F23H14.1"
FT                   /locus_tag="AT2G01040"
FT                   /product="hypothetical protein"
FT   gene            complement(68337..69884)
FT                   /gene_synonym="F23H14.2"
FT                   /gene_synonym="F23H14_2"
FT                   /locus_tag="AT2G01050"
FT   mRNA            complement(68337..69884)
FT                   /gene_synonym="F23H14.2"
FT                   /gene_synonym="F23H14_2"
FT                   /locus_tag="AT2G01050"
FT                   /product="zinc ion binding / nucleic acid binding protein"
FT   CDS_pept        complement(68337..69884)
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.2"
FT                   /gene_synonym="F23H14_2"
FT                   /locus_tag="AT2G01050"
FT                   /product="zinc ion binding / nucleic acid binding protein"
FT                   /note="zinc ion binding;nucleic acid binding; FUNCTIONS IN:
FT                   zinc ion binding, nucleic acid binding; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: cellular_component
FT                   unknown; CONTAINS InterPro DOMAIN/s: Zinc finger, CCHC-type
FT                   (InterPro:IPR001878); BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT3G31430.1); Has 369 Blast
FT                   hits to 365 proteins in 15 species: Archae - 0; Bacteria -
FT                   2; Metazoa - 0; Fungi - 0; Plants - 367; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01050"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01050.1"
FT                   /db_xref="GOA:Q9SJW1"
FT                   /db_xref="InterPro:IPR025558"
FT                   /db_xref="InterPro:IPR040256"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SJW1"
FT                   /protein_id="AEC05391.1"
FT                   /translation="MLDVGEKGRPPGDPPDKLESWATKVKGSAGGGILKPEDVIDDEFV
FT                   RERVGLEFPDGEDEEPVITIGEEVLEAMNGLWKKCMIVKVLGSQIPISVLNRKLRELWK
FT                   PSGVMTVMDLPRQFFMIRFELEEEYMAALTGGPWRVLGNYLLVQDWSSRFDPLRDDIVT
FT                   TPVWVRLSNIPYNYYHRCLLMEIARGLGRPLKVDMNTINFDKGRFARVCIEVNLAKPLK
FT                   GTVLINGDRYFVAYEGLSKICSSCGIYGHLVHSCPRNVVVKVSAGAETVTDRAVVPVGM
FT                   EGDDGFTVVQRTARRPAAPVQKMVFAVGASGGRSKQRLRELPKNQGVDLANRFGGLDGN
FT                   GDLPDLREVAITEGPNKENEYHGRNVGKVMGVPLVKEARGSTQMEKGKGGSKGGFKWKR
FT                   NGGMKALEPIGPKQKHGAANKPARGLIFGPTKDANSVPVGEDLLSNGKRLRVEQRDVGR
FT                   PGGVYSSAMGSHAHEASFDLDSSSTLSQRFQREDLMSEIAVVSHEGSEVGNSSEGMA"
FT   gene            complement(72282..72622)
FT                   /locus_tag="AT2G03885"
FT   ncRNA           complement(72282..72622)
FT                   /locus_tag="AT2G03885"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(73208..75509)
FT                   /gene_synonym="F23H14.3"
FT                   /gene_synonym="F23H14_3"
FT                   /locus_tag="AT2G01060"
FT   mRNA            complement(join(73208..73950,74073..74142,74240..74297,
FT                   74383..74425,74509..74585,74785..74907,75190..75509))
FT                   /gene_synonym="F23H14.3"
FT                   /gene_synonym="F23H14_3"
FT                   /locus_tag="AT2G01060"
FT                   /product="myb-like HTH transcriptional regulator family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH897773.1,INSD:BP662219.1,INSD:BP656469.1,
FT                   INSD:EL264780.1,INSD:BP577126.1,INSD:EL318045.1,
FT                   INSD:AV821757.1,INSD:DR751478.1,INSD:DR348567.1,
FT                   INSD:EH950146.1,INSD:EG517114.1,INSD:EL989129.1,
FT                   INSD:ES062121.1,INSD:BP799651.1,INSD:ES206633.1,
FT                   INSD:BP570302.1,INSD:DR751331.1,INSD:DR348563.1,
FT                   INSD:DR348569.1,INSD:EL119347.1,INSD:EL969809.1,
FT                   INSD:EL151659.1,INSD:ES138043.1,INSD:ES154891.1,
FT                   INSD:DR348564.1,INSD:EH816931.1,INSD:AV782297.1,
FT                   INSD:BP662532.1,INSD:DR751479.1,INSD:EL972294.1,
FT                   INSD:EL996254.1,INSD:DR379899.1,INSD:EL048062.1,
FT                   INSD:DR750662.1,INSD:EH832334.1,INSD:ES014351.1,
FT                   INSD:EL020423.1,INSD:ES156502.1,INSD:DR348565.1,
FT                   INSD:AI100235.1,INSD:DR751170.1,INSD:BP853760.1,
FT                   INSD:EL224926.1,INSD:ES188169.1,INSD:ES093616.1,
FT                   INSD:DR750663.1,INSD:EL326668.1,INSD:EH973077.1,
FT                   INSD:EL253121.1,INSD:EL061684.1,INSD:BP778375.1,
FT                   INSD:ES171473.1,INSD:EL162018.1,INSD:DR348570.1,
FT                   INSD:BP826488.1,INSD:EL190261.1,INSD:BP844448.1,
FT                   INSD:DR348568.1,INSD:DR348566.1,INSD:EH987581.1,
FT                   INSD:EL243710.1,INSD:EL986053.1,INSD:AV807179.1,
FT                   INSD:DR751330.1,INSD:DR751172.1,INSD:T04440.1,
FT                   INSD:BP824561.1,INSD:BP837942.1,INSD:AV542678.1,
FT                   INSD:BP665392.1,INSD:ES044470.1,INSD:BP789579.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY084725.1,INSD:BT000013.1,INSD:BX819609.1,
FT                   INSD:AF370550.1"
FT   mRNA            complement(join(73258..73950,74073..74142,74240..74297,
FT                   74383..74425,74509..74907,75190..75378))
FT                   /gene_synonym="F23H14.3"
FT                   /gene_synonym="F23H14_3"
FT                   /locus_tag="AT2G01060"
FT                   /product="myb-like HTH transcriptional regulator family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH897773.1,INSD:BP662219.1,INSD:BP656469.1,
FT                   INSD:EL169484.1,INSD:EL264780.1,INSD:BP577126.1,
FT                   INSD:EL318045.1,INSD:EH950146.1,INSD:EL989129.1,
FT                   INSD:ES062121.1,INSD:ES206633.1,INSD:BP570302.1,
FT                   INSD:EL119347.1,INSD:EL969809.1,INSD:EL151659.1,
FT                   INSD:ES138043.1,INSD:ES154891.1,INSD:EH816931.1,
FT                   INSD:AV782297.1,INSD:BP662532.1,INSD:EL972294.1,
FT                   INSD:EL996254.1,INSD:DR379899.1,INSD:EL048062.1,
FT                   INSD:ES014351.1,INSD:EH832334.1,INSD:EL020423.1,
FT                   INSD:ES156502.1,INSD:AI100235.1,INSD:BP863834.1,
FT                   INSD:EL224926.1,INSD:ES188169.1,INSD:ES093616.1,
FT                   INSD:DR750663.1,INSD:EL326668.1,INSD:EH973077.1,
FT                   INSD:EL253121.1,INSD:EL061684.1,INSD:BP778375.1,
FT                   INSD:ES171473.1,INSD:EL162018.1,INSD:EL190261.1,
FT                   INSD:BP855697.1,INSD:EH987581.1,INSD:EL243710.1,
FT                   INSD:EL986053.1,INSD:AV807179.1,INSD:AV542678.1,
FT                   INSD:BP665392.1,INSD:ES044470.1,INSD:BP789579.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820595.1,INSD:BX819609.1"
FT   CDS_pept        complement(join(73456..73950,74073..74142,74240..74297,
FT                   74383..74425,74509..74585,74785..74902))
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.3"
FT                   /gene_synonym="F23H14_3"
FT                   /locus_tag="AT2G01060"
FT                   /product="myb-like HTH transcriptional regulator family
FT                   protein"
FT                   /note="myb-like HTH transcriptional regulator family
FT                   protein; CONTAINS InterPro DOMAIN/s: Homeodomain-like
FT                   (InterPro:IPR009057), Myb, DNA-binding
FT                   (InterPro:IPR014778), Myb-like DNA-binding domain, SHAQKYF
FT                   class (InterPro:IPR006447), HTH transcriptional regulator,
FT                   Myb-type, DNA-binding (InterPro:IPR017930),
FT                   Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis
FT                   thaliana protein match is: Homeodomain-like superfamily
FT                   protein (TAIR:AT3G04450.1); Has 1678 Blast hits to 1660
FT                   proteins in 60 species: Archae - 0; Bacteria - 1; Metazoa -
FT                   0; Fungi - 0; Plants - 1660; Viruses - 0; Other Eukaryotes
FT                   - 17 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01060"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01060.1"
FT                   /db_xref="GOA:Q9SJW0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR025756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SJW0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH897773.1,INSD:BP662219.1,INSD:BP656469.1,
FT                   INSD:EL264780.1,INSD:BP577126.1,INSD:EL318045.1,
FT                   INSD:AV821757.1,INSD:DR751478.1,INSD:DR348567.1,
FT                   INSD:EH950146.1,INSD:EG517114.1,INSD:EL989129.1,
FT                   INSD:ES062121.1,INSD:BP799651.1,INSD:ES206633.1,
FT                   INSD:BP570302.1,INSD:DR751331.1,INSD:DR348563.1,
FT                   INSD:DR348569.1,INSD:EL119347.1,INSD:EL969809.1,
FT                   INSD:EL151659.1,INSD:ES138043.1,INSD:ES154891.1,
FT                   INSD:DR348564.1,INSD:EH816931.1,INSD:AV782297.1,
FT                   INSD:BP662532.1,INSD:DR751479.1,INSD:EL972294.1,
FT                   INSD:EL996254.1,INSD:DR379899.1,INSD:EL048062.1,
FT                   INSD:DR750662.1,INSD:EH832334.1,INSD:ES014351.1,
FT                   INSD:EL020423.1,INSD:ES156502.1,INSD:DR348565.1,
FT                   INSD:AI100235.1,INSD:DR751170.1,INSD:BP853760.1,
FT                   INSD:EL224926.1,INSD:ES188169.1,INSD:ES093616.1,
FT                   INSD:DR750663.1,INSD:EL326668.1,INSD:EH973077.1,
FT                   INSD:EL253121.1,INSD:EL061684.1,INSD:BP778375.1,
FT                   INSD:ES171473.1,INSD:EL162018.1,INSD:DR348570.1,
FT                   INSD:BP826488.1,INSD:EL190261.1,INSD:BP844448.1,
FT                   INSD:DR348568.1,INSD:DR348566.1,INSD:EH987581.1,
FT                   INSD:EL243710.1,INSD:EL986053.1,INSD:AV807179.1,
FT                   INSD:DR751330.1,INSD:DR751172.1,INSD:T04440.1,
FT                   INSD:BP824561.1,INSD:BP837942.1,INSD:AV542678.1,
FT                   INSD:BP665392.1,INSD:ES044470.1,INSD:BP789579.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY084725.1,INSD:BT000013.1,INSD:BX819609.1,
FT                   INSD:AF370550.1"
FT                   /protein_id="AEC05393.1"
FT                   /translation="MEADNGGPNSSHASKQRLRWTHELHERFVDAVAQLGGPDRATPKG
FT                   VLRVMGVQGLTIYHVKSHLQKYRLAKYLPDSSSEGKKTDKKESGDMLSGLDGSSGMQIT
FT                   EALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLGEPSAPVTGDS
FT                   DPATPAPTSESPLQDKSGKDCGPDKSLSVDESLSSYREPLTPDSGCNIGSPDESTGEER
FT                   LSKKPRLVRGAAGYTPDIVVGHPILESGLNTSYHQSDHVLAFDQPSTSLLGAEEQLDKV
FT                   SGDNL"
FT   CDS_pept        complement(join(73456..73950,74073..74142,74240..74297,
FT                   74383..74425,74509..74556))
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.3"
FT                   /gene_synonym="F23H14_3"
FT                   /locus_tag="AT2G01060"
FT                   /product="myb-like HTH transcriptional regulator family
FT                   protein"
FT                   /note="myb-like HTH transcriptional regulator family
FT                   protein; BEST Arabidopsis thaliana protein match is:
FT                   myb-like HTH transcriptional regulator family protein
FT                   (TAIR:AT3G13040.2); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01060"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01060.2"
FT                   /db_xref="GOA:Q9SJW0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR025756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SJW0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH897773.1,INSD:BP662219.1,INSD:BP656469.1,
FT                   INSD:EL169484.1,INSD:EL264780.1,INSD:BP577126.1,
FT                   INSD:EL318045.1,INSD:EH950146.1,INSD:EL989129.1,
FT                   INSD:ES062121.1,INSD:ES206633.1,INSD:BP570302.1,
FT                   INSD:EL119347.1,INSD:EL969809.1,INSD:EL151659.1,
FT                   INSD:ES138043.1,INSD:ES154891.1,INSD:EH816931.1,
FT                   INSD:AV782297.1,INSD:BP662532.1,INSD:EL972294.1,
FT                   INSD:EL996254.1,INSD:DR379899.1,INSD:EL048062.1,
FT                   INSD:ES014351.1,INSD:EH832334.1,INSD:EL020423.1,
FT                   INSD:ES156502.1,INSD:AI100235.1,INSD:BP863834.1,
FT                   INSD:EL224926.1,INSD:ES188169.1,INSD:ES093616.1,
FT                   INSD:DR750663.1,INSD:EL326668.1,INSD:EH973077.1,
FT                   INSD:EL253121.1,INSD:EL061684.1,INSD:BP778375.1,
FT                   INSD:ES171473.1,INSD:EL162018.1,INSD:EL190261.1,
FT                   INSD:BP855697.1,INSD:EH987581.1,INSD:EL243710.1,
FT                   INSD:EL986053.1,INSD:AV807179.1,INSD:AV542678.1,
FT                   INSD:BP665392.1,INSD:ES044470.1,INSD:BP789579.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820595.1,INSD:BX819609.1"
FT                   /protein_id="AEC05392.1"
FT                   /translation="MGVQGLTIYHVKSHLQKYRLAKYLPDSSSEGKKTDKKESGDMLSG
FT                   LDGSSGMQITEALKLQMEVQKRLHEQLEVQRQLQLRIEAQGKYLKKIIEEQQRLSGVLG
FT                   EPSAPVTGDSDPATPAPTSESPLQDKSGKDCGPDKSLSVDESLSSYREPLTPDSGCNIG
FT                   SPDESTGEERLSKKPRLVRGAAGYTPDIVVGHPILESGLNTSYHQSDHVLAFDQPSTSL
FT                   LGAEEQLDKVSGDNL"
FT   gene            75520..77865
FT                   /gene_synonym="F23H14.4"
FT                   /gene_synonym="F23H14_4"
FT                   /locus_tag="AT2G01070"
FT   mRNA            join(75520..75780,75858..76779,76880..76975,77145..77400,
FT                   77475..77865)
FT                   /gene_synonym="F23H14.4"
FT                   /gene_synonym="F23H14_4"
FT                   /locus_tag="AT2G01070"
FT                   /product="Lung seven transmembrane receptor family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH877738.1,INSD:EL294524.1,INSD:ES028903.1,
FT                   INSD:EH827430.1,INSD:EH902553.1,INSD:EH898736.1,
FT                   INSD:BP789930.1,INSD:AV816964.1,INSD:ES177248.1,
FT                   INSD:AV808044.1,INSD:EH911807.1,INSD:BX835212.1,
FT                   INSD:ES147409.1,INSD:F20039.1,INSD:EL339226.1,
FT                   INSD:EH868728.1,INSD:EL282373.1,INSD:EH975367.1,
FT                   INSD:EL970620.1,INSD:EL216239.1,INSD:DR368550.1,
FT                   INSD:CB253960.1,INSD:BX838884.1,INSD:EL105483.1,
FT                   INSD:AV820186.1,INSD:ES019465.1,INSD:BP785566.1,
FT                   INSD:EL234374.1,INSD:ES108711.1,INSD:BX838671.1,
FT                   INSD:EL010707.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820756.1,INSD:BX820779.1,INSD:AK221666.1,
FT                   INSD:BX818839.1,INSD:BX818790.1"
FT   mRNA            join(75520..75780,75858..76779,76880..76975,77145..77281,
FT                   77475..77865)
FT                   /gene_synonym="F23H14.4"
FT                   /gene_synonym="F23H14_4"
FT                   /locus_tag="AT2G01070"
FT                   /product="Lung seven transmembrane receptor family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH877738.1,INSD:EL294524.1,INSD:ES028903.1,
FT                   INSD:EH827430.1,INSD:EH902553.1,INSD:EH898736.1,
FT                   INSD:ES177248.1,INSD:EH911807.1,INSD:ES147409.1,
FT                   INSD:F20039.1,INSD:EL339226.1,INSD:EH868728.1,
FT                   INSD:EL282373.1,INSD:EH975367.1,INSD:EL970620.1,
FT                   INSD:EL216239.1,INSD:EG482206.1,INSD:DR368550.1,
FT                   INSD:CB253960.1,INSD:EL105483.1,INSD:BX838884.1,
FT                   INSD:ES019465.1,INSD:BP785566.1,INSD:EL234374.1,
FT                   INSD:BX838671.1,INSD:EL010707.1"
FT   CDS_pept        join(75596..75780,75858..76779,76880..76975,77145..77281,
FT                   77475..77625)
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.4"
FT                   /gene_synonym="F23H14_4"
FT                   /locus_tag="AT2G01070"
FT                   /product="Lung seven transmembrane receptor family protein"
FT                   /note="Lung seven transmembrane receptor family protein;
FT                   FUNCTIONS IN: molecular_function unknown; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: endomembrane
FT                   system, integral to membrane; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Transmembrane receptor, eukaryota
FT                   (InterPro:IPR009637); BEST Arabidopsis thaliana protein
FT                   match is: Lung seven transmembrane receptor family protein
FT                   (TAIR:AT1G72480.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01070"
FT                   /db_xref="GOA:F4IM73"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniProtKB/TrEMBL:F4IM73"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH877738.1,INSD:EL294524.1,INSD:ES028903.1,
FT                   INSD:EH827430.1,INSD:EH902553.1,INSD:EH898736.1,
FT                   INSD:BP789930.1,INSD:AV816964.1,INSD:ES177248.1,
FT                   INSD:AV808044.1,INSD:EH911807.1,INSD:BX835212.1,
FT                   INSD:ES147409.1,INSD:F20039.1,INSD:EL339226.1,
FT                   INSD:EH868728.1,INSD:EL282373.1,INSD:EH975367.1,
FT                   INSD:EL970620.1,INSD:EL216239.1,INSD:DR368550.1,
FT                   INSD:CB253960.1,INSD:BX838884.1,INSD:EL105483.1,
FT                   INSD:AV820186.1,INSD:ES019465.1,INSD:BP785566.1,
FT                   INSD:EL234374.1,INSD:ES108711.1,INSD:BX838671.1,
FT                   INSD:EL010707.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820756.1,INSD:BX820779.1,INSD:AK221666.1,
FT                   INSD:BX818839.1,INSD:BX818790.1"
FT                   /protein_id="AEC05394.1"
FT                   /translation="MDLGKLIQLSALLCPFLLSLHFRIAGASAHIYSSQPFHDVGNSLL
FT                   LYGGSEGIFASSRSLIRFENITLWRTITGKGHRSNGLVQAVIFEASDRNNIGGSAYGGQ
FT                   RSICCTPDLAKLQGCKQGEIIRIPSPHDPQWPILLPVRFKGKRSSAKMADTEILITKTG
FT                   IYNLLFISCDPQLKGLKMTGKTVWKNPDGYLPGRMAPLVNFYVYMSLAYLLLSAVWFFQ
FT                   YLRFRMDILPLQHCITAVILLGLLEMLFWYLDYANFNHTGMRPLALTTWVVTIGALRKT
FT                   VSRILILCVSMGFGVVKSTLGGLTSKVLLVGVTYFIASEILDIAEHVGIIDDMSGRSKL
FT                   FLVLPDAFLDAFLILWIFTSLSKTLEQLQMKRTSVKLEIYRKFSNALAVMVVASVAWIV
FT                   YEVYFKATDPFNERWQTAWTITAFWDVIAFLLLCIICYLWTPSQNSQRYAYSGDVDEEN
FT                   EEAQSLTGGKQDGDISLVKQEKNAESDREEDVEEDKRE"
FT   CDS_pept        join(75596..75780,75858..76779,76880..76975,77145..77300)
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.4"
FT                   /gene_synonym="F23H14_4"
FT                   /locus_tag="AT2G01070"
FT                   /product="Lung seven transmembrane receptor family protein"
FT                   /note="Lung seven transmembrane receptor family protein;
FT                   FUNCTIONS IN: molecular_function unknown; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: endomembrane
FT                   system, integral to membrane; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Transmembrane receptor, eukaryota
FT                   (InterPro:IPR009637); BEST Arabidopsis thaliana protein
FT                   match is: Lung seven transmembrane receptor family protein
FT                   (TAIR:AT1G72480.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01070"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01070.2"
FT                   /db_xref="GOA:B3H5T8"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniProtKB/TrEMBL:B3H5T8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH877738.1,INSD:EL294524.1,INSD:ES028903.1,
FT                   INSD:EH827430.1,INSD:EH902553.1,INSD:EH898736.1,
FT                   INSD:ES177248.1,INSD:EH911807.1,INSD:ES147409.1,
FT                   INSD:F20039.1,INSD:EL339226.1,INSD:EH868728.1,
FT                   INSD:EL282373.1,INSD:EH975367.1,INSD:EL970620.1,
FT                   INSD:EL216239.1,INSD:EG482206.1,INSD:DR368550.1,
FT                   INSD:CB253960.1,INSD:EL105483.1,INSD:BX838884.1,
FT                   INSD:ES019465.1,INSD:BP785566.1,INSD:EL234374.1,
FT                   INSD:BX838671.1,INSD:EL010707.1"
FT                   /protein_id="AEC05395.1"
FT                   /translation="MDLGKLIQLSALLCPFLLSLHFRIAGASAHIYSSQPFHDVGNSLL
FT                   LYGGSEGIFASSRSLIRFENITLWRTITGKGHRSNGLVQAVIFEASDRNNIGGSAYGGQ
FT                   RSICCTPDLAKLQGCKQGEIIRIPSPHDPQWPILLPVRFKGKRSSAKMADTEILITKTG
FT                   IYNLLFISCDPQLKGLKMTGKTVWKNPDGYLPGRMAPLVNFYVYMSLAYLLLSAVWFFQ
FT                   YLRFRMDILPLQHCITAVILLGLLEMLFWYLDYANFNHTGMRPLALTTWVVTIGALRKT
FT                   VSRILILCVSMGFGVVKSTLGGLTSKVLLVGVTYFIASEILDIAEHVGIIDDMSGRSKL
FT                   FLVLPDAFLDAFLILWIFTSLSKTLEQLQMKRTSVKLEIYRKFSNALAVMVVASVAWIV
FT                   YEVYFKATDPFNERWQTAWTITAFWDVIAFLLLCIICYLWTPSQNSQRYVTST"
FT   gene            77888..79373
FT                   /gene_synonym="F23H14.5"
FT                   /gene_synonym="F23H14_5"
FT                   /locus_tag="AT2G01080"
FT   mRNA            join(77888..78646,79090..79373)
FT                   /gene_synonym="F23H14.5"
FT                   /gene_synonym="F23H14_5"
FT                   /locus_tag="AT2G01080"
FT                   /product="Late embryogenesis abundant (LEA)
FT                   hydroxyproline-rich glycoprotein family"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL156747.1,INSD:BP844691.1,INSD:DR314501.1,
FT                   INSD:ES194140.1,INSD:ES007496.1,INSD:ES055755.1,
FT                   INSD:AV781708.1,INSD:BX838262.1,INSD:ES068009.1,
FT                   INSD:EL286784.1,INSD:BX840667.1,INSD:EL287227.1,
FT                   INSD:BP835850.1,INSD:CB253960.1,INSD:DR314502.1,
FT                   INSD:BX838421.1,INSD:ES058003.1,INSD:EH970802.1,
FT                   INSD:ES157781.1,INSD:ES200858.1,INSD:AV821319.1,
FT                   INSD:BP785566.1,INSD:EL020816.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX821790.1,INSD:BX821947.1,INSD:AY059166.1,
FT                   INSD:AF378858.1"
FT   CDS_pept        join(78038..78646,79090..79176)
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.5"
FT                   /gene_synonym="F23H14_5"
FT                   /locus_tag="AT2G01080"
FT                   /product="Late embryogenesis abundant (LEA)
FT                   hydroxyproline-rich glycoprotein family"
FT                   /note="Late embryogenesis abundant (LEA)
FT                   hydroxyproline-rich glycoprotein family; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 14
FT                   plant structures; EXPRESSED DURING: 6 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Late embryogenesis abundant
FT                   protein, group 2 (InterPro:IPR004864); BEST Arabidopsis
FT                   thaliana protein match is: Late embryogenesis abundant
FT                   (LEA) hydroxyproline-rich glycoprotein family
FT                   (TAIR:AT2G27080.2); Has 675 Blast hits to 674 proteins in
FT                   28 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   2; Plants - 673; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01080.1"
FT                   /db_xref="GOA:Q9SJV8"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SJV8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL156747.1,INSD:BP844691.1,INSD:DR314501.1,
FT                   INSD:ES194140.1,INSD:ES007496.1,INSD:ES055755.1,
FT                   INSD:AV781708.1,INSD:BX838262.1,INSD:ES068009.1,
FT                   INSD:EL286784.1,INSD:BX840667.1,INSD:EL287227.1,
FT                   INSD:BP835850.1,INSD:CB253960.1,INSD:DR314502.1,
FT                   INSD:BX838421.1,INSD:ES058003.1,INSD:EH970802.1,
FT                   INSD:ES157781.1,INSD:ES200858.1,INSD:AV821319.1,
FT                   INSD:BP785566.1,INSD:EL020816.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX821790.1,INSD:BX821947.1,INSD:AY059166.1,
FT                   INSD:AF378858.1"
FT                   /protein_id="AEC05396.1"
FT                   /translation="MPPPPSSSRAGLNGDPIAAQNQQPYYRSYSSSSSASLKGCCCCLF
FT                   LLFAFLALLVLAVVLIVILAVKPKKPQFDLQQVAVVYMGISNPSAVLDPTTASLSLTIR
FT                   MLFTAVNPNKVGIRYGESSFTVMYKGMPLGRATVPGFYQDAHSTKNVEATISVDRVNLM
FT                   QAHAADLVRDASLNDRVELTVRGDVGAKIRVMNFDSPGVQVSVNCGIGISPRKQALIYK
FT                   QCGFDGLSV"
FT   gene            79779..81710
FT                   /gene_synonym="F23H14.6"
FT                   /gene_synonym="F23H14_6"
FT                   /locus_tag="AT2G01090"
FT   mRNA            join(79779..79805,79945..80061,80147..80180,80606..80690,
FT                   80856..81216)
FT                   /gene_synonym="F23H14.6"
FT                   /gene_synonym="F23H14_6"
FT                   /locus_tag="AT2G01090"
FT                   /product="Ubiquinol-cytochrome C reductase hinge protein"
FT   mRNA            join(79843..79852,79945..80061,80147..80180,80606..80690,
FT                   80856..81200)
FT                   /gene_synonym="F23H14.6"
FT                   /gene_synonym="F23H14_6"
FT                   /locus_tag="AT2G01090"
FT                   /product="Ubiquinol-cytochrome C reductase hinge protein"
FT   mRNA            join(79964..80061,80147..80180,80606..80690,80856..81212)
FT                   /gene_synonym="F23H14.6"
FT                   /gene_synonym="F23H14_6"
FT                   /locus_tag="AT2G01090"
FT                   /product="Ubiquinol-cytochrome C reductase hinge protein"
FT   mRNA            join(79989..80061,80147..80180,80606..80690,80856..80970,
FT                   81662..81710)
FT                   /gene_synonym="F23H14.6"
FT                   /gene_synonym="F23H14_6"
FT                   /locus_tag="AT2G01090"
FT                   /product="Ubiquinol-cytochrome C reductase hinge protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR261178.1,INSD:EL041221.1,INSD:EG513490.1,
FT                   INSD:EH990184.1,INSD:EL310702.1,INSD:EH912496.1,
FT                   INSD:BP653866.1,INSD:EL145271.1,INSD:BP629886.1,
FT                   INSD:Z18209.1,INSD:EL064390.1,INSD:EG513489.1,
FT                   INSD:EL033192.1,INSD:DR380031.1,INSD:DR261176.1,
FT                   INSD:EL031553.1,INSD:BP831340.1,INSD:AV786686.1,
FT                   INSD:EH977498.1,INSD:EL049044.1,INSD:EH894163.1,
FT                   INSD:AI997629.1,INSD:AV827614.1,INSD:EL156517.1,
FT                   INSD:EL056501.1,INSD:DR261175.1,INSD:AV798784.1,
FT                   INSD:EL071031.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AF360220.1"
FT   CDS_pept        join(80179..80180,80606..80690,80856..80957)
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.6"
FT                   /gene_synonym="F23H14_6"
FT                   /locus_tag="AT2G01090"
FT                   /product="Ubiquinol-cytochrome C reductase hinge protein"
FT                   /db_xref="GOA:Q9SJV7"
FT                   /db_xref="InterPro:IPR003422"
FT                   /db_xref="InterPro:IPR023184"
FT                   /db_xref="InterPro:IPR036811"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SJV7"
FT                   /protein_id="ANM63169.1"
FT                   /translation="MPEEDVVDQKRYFEESCKPKCVKPLLEYQACVKRIQDDESGHKHC
FT                   TGQYFDYWHCVDKCVSV"
FT   CDS_pept        join(80179..80180,80606..80690,80856..80957)
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.6"
FT                   /gene_synonym="F23H14_6"
FT                   /locus_tag="AT2G01090"
FT                   /product="Ubiquinol-cytochrome C reductase hinge protein"
FT                   /db_xref="GOA:Q9SJV7"
FT                   /db_xref="InterPro:IPR003422"
FT                   /db_xref="InterPro:IPR023184"
FT                   /db_xref="InterPro:IPR036811"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SJV7"
FT                   /protein_id="ANM63170.1"
FT                   /translation="MPEEDVVDQKRYFEESCKPKCVKPLLEYQACVKRIQDDESGHKHC
FT                   TGQYFDYWHCVDKCVSV"
FT   CDS_pept        join(80179..80180,80606..80690,80856..80957)
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.6"
FT                   /gene_synonym="F23H14_6"
FT                   /locus_tag="AT2G01090"
FT                   /product="Ubiquinol-cytochrome C reductase hinge protein"
FT                   /note="Ubiquinol-cytochrome C reductase hinge protein;
FT                   FUNCTIONS IN: ubiquinol-cytochrome-c reductase activity;
FT                   INVOLVED IN: mitochondrial electron transport, ubiquinol to
FT                   cytochrome c; LOCATED IN: mitochondrial respiratory chain
FT                   complex III; EXPRESSED IN: 24 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Ubiquinol-cytochrome C reductase hinge
FT                   (InterPro:IPR003422); BEST Arabidopsis thaliana protein
FT                   match is: Ubiquinol-cytochrome C reductase hinge protein
FT                   (TAIR:AT1G15120.2); Has 146 Blast hits to 146 proteins in
FT                   57 species: Archae - 0; Bacteria - 0; Metazoa - 12; Fungi -
FT                   4; Plants - 87; Viruses - 0; Other Eukaryotes - 43 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q9SJV7"
FT                   /db_xref="InterPro:IPR003422"
FT                   /db_xref="InterPro:IPR023184"
FT                   /db_xref="InterPro:IPR036811"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SJV7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR261178.1,INSD:EL041221.1,INSD:EG513490.1,
FT                   INSD:EH990184.1,INSD:EL310702.1,INSD:EH912496.1,
FT                   INSD:BP653866.1,INSD:EL145271.1,INSD:BP629886.1,
FT                   INSD:Z18209.1,INSD:EL064390.1,INSD:EG513489.1,
FT                   INSD:EL033192.1,INSD:DR380031.1,INSD:DR261176.1,
FT                   INSD:EL031553.1,INSD:BP831340.1,INSD:AV786686.1,
FT                   INSD:EH977498.1,INSD:EL049044.1,INSD:EH894163.1,
FT                   INSD:AI997629.1,INSD:AV827614.1,INSD:EL156517.1,
FT                   INSD:EL056501.1,INSD:DR261175.1,INSD:AV798784.1,
FT                   INSD:EL071031.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AF360220.1"
FT                   /protein_id="AEC05397.1"
FT                   /translation="MPEEDVVDQKRYFEESCKPKCVKPLLEYQACVKRIQDDESGHKHC
FT                   TGQYFDYWHCVDKCVSV"
FT   CDS_pept        join(80179..80180,80606..80690,80856..80957)
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.6"
FT                   /gene_synonym="F23H14_6"
FT                   /locus_tag="AT2G01090"
FT                   /product="Ubiquinol-cytochrome C reductase hinge protein"
FT                   /note="Ubiquinol-cytochrome C reductase hinge protein;
FT                   FUNCTIONS IN: ubiquinol-cytochrome-c reductase activity;
FT                   INVOLVED IN: mitochondrial electron transport, ubiquinol to
FT                   cytochrome c; LOCATED IN: mitochondrial respiratory chain
FT                   complex III; EXPRESSED IN: 24 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Ubiquinol-cytochrome C reductase hinge
FT                   (InterPro:IPR003422); BEST Arabidopsis thaliana protein
FT                   match is: Ubiquinol-cytochrome C reductase hinge protein
FT                   (TAIR:AT1G15120.2)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01090"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01090.1"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01090.2"
FT                   /db_xref="GOA:Q9SJV7"
FT                   /db_xref="InterPro:IPR003422"
FT                   /db_xref="InterPro:IPR023184"
FT                   /db_xref="InterPro:IPR036811"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SJV7"
FT                   /protein_id="AEC05398.1"
FT                   /translation="MPEEDVVDQKRYFEESCKPKCVKPLLEYQACVKRIQDDESGHKHC
FT                   TGQYFDYWHCVDKCVSV"
FT   gene            81436..83290
FT                   /gene_synonym="F23H14.7"
FT                   /gene_synonym="F23H14_7"
FT                   /locus_tag="AT2G01100"
FT   mRNA            join(81436..81512,81737..81800,82186..83217)
FT                   /gene_synonym="F23H14.7"
FT                   /gene_synonym="F23H14_7"
FT                   /locus_tag="AT2G01100"
FT                   /product="FAM133-like protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH797776.1,INSD:EG457335.1,INSD:ES024857.1,
FT                   INSD:EG456946.1,INSD:EG457334.1,INSD:DR337911.1,
FT                   INSD:EL236563.1,INSD:DR337908.1,INSD:ES212053.1,
FT                   INSD:ES027617.1,INSD:ES005369.1,INSD:EL224381.1,
FT                   INSD:AA720331.1,INSD:ES197838.1,INSD:BP827619.1,
FT                   INSD:EH868223.1,INSD:BP861274.1,INSD:ES164896.1,
FT                   INSD:EL149896.1,INSD:ES184109.1,INSD:AV815991.1,
FT                   INSD:ES199474.1,INSD:AA651066.1,INSD:EL104444.1,
FT                   INSD:DR337910.1,INSD:EL104562.1,INSD:EH854532.1,
FT                   INSD:ES034269.1,INSD:ES173599.1,INSD:EG456947.1,
FT                   INSD:ES010013.1,INSD:ES012357.1,INSD:ES116235.1,
FT                   INSD:DR337909.1,INSD:ES018213.1,INSD:EH950063.1,
FT                   INSD:BX836035.1,INSD:ES210945.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY087935.1,INSD:AY125526.1"
FT   mRNA            join(81437..81512,81737..81800,82220..83290)
FT                   /gene_synonym="F23H14.7"
FT                   /gene_synonym="F23H14_7"
FT                   /locus_tag="AT2G01100"
FT                   /product="FAM133-like protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH797776.1,INSD:EG457335.1,INSD:ES024857.1,
FT                   INSD:EG456946.1,INSD:EG457334.1,INSD:R65004.1,
FT                   INSD:EL236563.1,INSD:ES212053.1,INSD:ES027617.1,
FT                   INSD:ES005369.1,INSD:DR365593.1,INSD:EL224381.1,
FT                   INSD:AA720331.1,INSD:ES197838.1,INSD:EH868223.1,
FT                   INSD:ES164896.1,INSD:DR365592.1,INSD:EL149896.1,
FT                   INSD:ES184109.1,INSD:AV815991.1,INSD:ES199474.1,
FT                   INSD:AA651066.1,INSD:EL104444.1,INSD:EL104562.1,
FT                   INSD:EH854532.1,INSD:ES034269.1,INSD:BP845779.1,
FT                   INSD:ES173599.1,INSD:EG456947.1,INSD:ES010013.1,
FT                   INSD:ES012357.1,INSD:ES116235.1,INSD:BP562501.2,
FT                   INSD:ES018213.1,INSD:BP852866.1,INSD:EH950063.1,
FT                   INSD:ES210945.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY125526.1,INSD:AY072010.1"
FT   mRNA            join(81440..81512,81737..83217)
FT                   /gene_synonym="F23H14.7"
FT                   /gene_synonym="F23H14_7"
FT                   /locus_tag="AT2G01100"
FT                   /product="FAM133-like protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL982156.1,INSD:EH797776.1,INSD:ES024857.1,
FT                   INSD:EG457335.1,INSD:EG456946.1,INSD:EG457334.1,
FT                   INSD:EL980486.1,INSD:EL236563.1,INSD:EL989467.1,
FT                   INSD:ES027617.1,INSD:ES212053.1,INSD:EL975664.1,
FT                   INSD:BX837995.1,INSD:ES005369.1,INSD:EL989957.1,
FT                   INSD:EL224381.1,INSD:AA720331.1,INSD:ES197838.1,
FT                   INSD:EH868223.1,INSD:ES164896.1,INSD:EG517620.1,
FT                   INSD:EL975446.1,INSD:EL149896.1,INSD:ES184109.1,
FT                   INSD:AV815991.1,INSD:EL990635.1,INSD:ES000749.1,
FT                   INSD:ES199474.1,INSD:AA651066.1,INSD:EL104444.1,
FT                   INSD:EH854532.1,INSD:EG517618.1,INSD:EL104562.1,
FT                   INSD:ES034269.1,INSD:BX836911.1,INSD:ES173599.1,
FT                   INSD:EG456947.1,INSD:ES010013.1,INSD:ES012357.1,
FT                   INSD:ES116235.1,INSD:EL981720.1,INSD:ES018213.1,
FT                   INSD:EL969903.1,INSD:EH950063.1,INSD:ES210945.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820090.1,INSD:BX821013.1,INSD:AY125526.1"
FT   CDS_pept        82245..82988
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.7"
FT                   /gene_synonym="F23H14_7"
FT                   /locus_tag="AT2G01100"
FT                   /product="FAM133-like protein"
FT                   /note="unknown protein; Has 19420 Blast hits to 10641
FT                   proteins in 779 species: Archae - 0; Bacteria - 1003;
FT                   Metazoa - 10257; Fungi - 1826; Plants - 1570; Viruses - 56;
FT                   Other Eukaryotes - 4708 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9SJV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SJV6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH797776.1,INSD:EG457335.1,INSD:ES024857.1,
FT                   INSD:EG456946.1,INSD:EG457334.1,INSD:DR337911.1,
FT                   INSD:EL236563.1,INSD:DR337908.1,INSD:ES212053.1,
FT                   INSD:ES027617.1,INSD:ES005369.1,INSD:EL224381.1,
FT                   INSD:AA720331.1,INSD:ES197838.1,INSD:BP827619.1,
FT                   INSD:EH868223.1,INSD:BP861274.1,INSD:ES164896.1,
FT                   INSD:EL149896.1,INSD:ES184109.1,INSD:AV815991.1,
FT                   INSD:ES199474.1,INSD:AA651066.1,INSD:EL104444.1,
FT                   INSD:DR337910.1,INSD:EL104562.1,INSD:EH854532.1,
FT                   INSD:ES034269.1,INSD:ES173599.1,INSD:EG456947.1,
FT                   INSD:ES010013.1,INSD:ES012357.1,INSD:ES116235.1,
FT                   INSD:DR337909.1,INSD:ES018213.1,INSD:EH950063.1,
FT                   INSD:BX836035.1,INSD:ES210945.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY087935.1,INSD:AY125526.1"
FT                   /protein_id="AEC05399.1"
FT                   /translation="MDCKKFIQMVEEKKRRVLEKQEAPLKWEQKLEAAANAKADTETKV
FT                   KRSKGPKRKQRAASESSSESDSSSEVRRKSRRSHNKHRRHAHSDSDDSDRRKEKKSRRQ
FT                   KRRSLSPSDDSTGDYESGSEDELRMKIKHHRRHKWHSSRKTCDDDSTEDVRRKHLKHHR
FT                   RSEVVTSSDSEEESGRRRRGKYHRHNRGSASSSGSEEDSGKSMKRRQHKRHRLAESSSE
FT                   EDGAMRRTRHHKHGRDSASESDGRR"
FT   CDS_pept        82245..82988
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.7"
FT                   /gene_synonym="F23H14_7"
FT                   /locus_tag="AT2G01100"
FT                   /product="FAM133-like protein"
FT                   /note="unknown protein; Has 19420 Blast hits to 10641
FT                   proteins in 779 species: Archae - 0; Bacteria - 1003;
FT                   Metazoa - 10257; Fungi - 1826; Plants - 1570; Viruses - 56;
FT                   Other Eukaryotes - 4708 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01100"
FT                   /db_xref="GOA:Q9SJV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SJV6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH797776.1,INSD:EG457335.1,INSD:ES024857.1,
FT                   INSD:EG456946.1,INSD:EG457334.1,INSD:R65004.1,
FT                   INSD:EL236563.1,INSD:ES212053.1,INSD:ES027617.1,
FT                   INSD:ES005369.1,INSD:DR365593.1,INSD:EL224381.1,
FT                   INSD:AA720331.1,INSD:ES197838.1,INSD:EH868223.1,
FT                   INSD:ES164896.1,INSD:DR365592.1,INSD:EL149896.1,
FT                   INSD:ES184109.1,INSD:AV815991.1,INSD:ES199474.1,
FT                   INSD:AA651066.1,INSD:EL104444.1,INSD:EL104562.1,
FT                   INSD:EH854532.1,INSD:ES034269.1,INSD:BP845779.1,
FT                   INSD:ES173599.1,INSD:EG456947.1,INSD:ES010013.1,
FT                   INSD:ES012357.1,INSD:ES116235.1,INSD:BP562501.2,
FT                   INSD:ES018213.1,INSD:BP852866.1,INSD:EH950063.1,
FT                   INSD:ES210945.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY125526.1,INSD:AY072010.1"
FT                   /protein_id="AEC05400.1"
FT                   /translation="MDCKKFIQMVEEKKRRVLEKQEAPLKWEQKLEAAANAKADTETKV
FT                   KRSKGPKRKQRAASESSSESDSSSEVRRKSRRSHNKHRRHAHSDSDDSDRRKEKKSRRQ
FT                   KRRSLSPSDDSTGDYESGSEDELRMKIKHHRRHKWHSSRKTCDDDSTEDVRRKHLKHHR
FT                   RSEVVTSSDSEEESGRRRRGKYHRHNRGSASSSGSEEDSGKSMKRRQHKRHRLAESSSE
FT                   EDGAMRRTRHHKHGRDSASESDGRR"
FT   CDS_pept        82245..82988
FT                   /codon_start=1
FT                   /gene_synonym="F23H14.7"
FT                   /gene_synonym="F23H14_7"
FT                   /locus_tag="AT2G01100"
FT                   /product="FAM133-like protein"
FT                   /note="unknown protein; Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9SJV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SJV6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL982156.1,INSD:EH797776.1,INSD:ES024857.1,
FT                   INSD:EG457335.1,INSD:EG456946.1,INSD:EG457334.1,
FT                   INSD:EL980486.1,INSD:EL236563.1,INSD:EL989467.1,
FT                   INSD:ES027617.1,INSD:ES212053.1,INSD:EL975664.1,
FT                   INSD:BX837995.1,INSD:ES005369.1,INSD:EL989957.1,
FT                   INSD:EL224381.1,INSD:AA720331.1,INSD:ES197838.1,
FT                   INSD:EH868223.1,INSD:ES164896.1,INSD:EG517620.1,
FT                   INSD:EL975446.1,INSD:EL149896.1,INSD:ES184109.1,
FT                   INSD:AV815991.1,INSD:EL990635.1,INSD:ES000749.1,
FT                   INSD:ES199474.1,INSD:AA651066.1,INSD:EL104444.1,
FT                   INSD:EH854532.1,INSD:EG517618.1,INSD:EL104562.1,
FT                   INSD:ES034269.1,INSD:BX836911.1,INSD:ES173599.1,
FT                   INSD:EG456947.1,INSD:ES010013.1,INSD:ES012357.1,
FT                   INSD:ES116235.1,INSD:EL981720.1,INSD:ES018213.1,
FT                   INSD:EL969903.1,INSD:EH950063.1,INSD:ES210945.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820090.1,INSD:BX821013.1,INSD:AY125526.1"
FT                   /protein_id="AEC05401.1"
FT                   /translation="MDCKKFIQMVEEKKRRVLEKQEAPLKWEQKLEAAANAKADTETKV
FT                   KRSKGPKRKQRAASESSSESDSSSEVRRKSRRSHNKHRRHAHSDSDDSDRRKEKKSRRQ
FT                   KRRSLSPSDDSTGDYESGSEDELRMKIKHHRRHKWHSSRKTCDDDSTEDVRRKHLKHHR
FT                   RSEVVTSSDSEEESGRRRRGKYHRHNRGSASSSGSEEDSGKSMKRRQHKRHRLAESSSE
FT                   EDGAMRRTRHHKHGRDSASESDGRR"
FT   gene            complement(83260..85258)
FT                   /gene="APG2"
FT                   /gene_synonym="ALBINO AND PALE GREEN 2"
FT                   /gene_synonym="F23H14.8"
FT                   /gene_synonym="F23H14_8"
FT                   /gene_synonym="PGA2"
FT                   /gene_synonym="TATC"
FT                   /gene_synonym="TWIN-ARGININE TRANSLOCATION C"
FT                   /gene_synonym="UNE3"
FT                   /gene_synonym="unfertilized embryo sac 3"
FT                   /locus_tag="AT2G01110"
FT                   /note="mutant is Albino and pale green; Chloroplast Protein
FT                   Translocation (tatC). Core subunit of the chloroplast Tat
FT                   translocase. Integral chloroplast thylakoid membrane
FT                   protein."
FT   mRNA            complement(join(83260..83995,84085..84375,84450..84718,
FT                   84836..85258))
FT                   /gene="APG2"
FT                   /gene_synonym="ALBINO AND PALE GREEN 2"
FT                   /gene_synonym="F23H14.8"
FT                   /gene_synonym="F23H14_8"
FT                   /gene_synonym="PGA2"
FT                   /gene_synonym="TATC"
FT                   /gene_synonym="TWIN-ARGININE TRANSLOCATION C"
FT                   /gene_synonym="UNE3"
FT                   /gene_synonym="unfertilized embryo sac 3"
FT                   /locus_tag="AT2G01110"
FT                   /product="Sec-independent periplasmic protein translocase"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP857834.1,INSD:EH840871.1,INSD:BE037896.1,
FT                   INSD:AV805398.1,INSD:EL055345.1,INSD:EH804914.1,
FT                   INSD:DR280154.1,INSD:EL317591.1,INSD:BE039029.1,
FT                   INSD:DR280155.1,INSD:DR280153.1,INSD:EL267567.1,
FT                   INSD:EG521105.1,INSD:EH989680.1,INSD:EH829735.1,
FT                   INSD:EL079528.1,INSD:EL007742.1,INSD:EL113433.1,
FT                   INSD:EH876256.1,INSD:EL198908.1,INSD:EH802639.1,
FT                   INSD:EL173905.1,INSD:AV829300.1,INSD:EH972289.1,
FT                   INSD:BP653704.1,INSD:ES028612.1,INSD:DR280149.1,
FT                   INSD:BP859305.1,INSD:BP650497.1,INSD:BP591847.1,
FT                   INSD:EH867423.1,INSD:ES108316.1,INSD:DR280148.1,
FT                   INSD:EL051029.1,INSD:EL117982.1,INSD:EH859549.1,
FT                   INSD:EL991275.1,INSD:DR280150.1,INSD:DR380029.1,
FT                   INSD:BP812129.1,INSD:EL297296.1,INSD:EL160940.1,
FT                   INSD:EL203900.1,INSD:AV786168.1,INSD:DR280156.1,
FT                   INSD:AV541047.1,INSD:EL257346.1,INSD:EG488424.1,
FT                   INSD:EH868708.1,INSD:EL125725.1,INSD:EL070215.1,
FT                   INSD:EL243789.1,INSD:EH847515.1,INSD:EG488423.1,
FT                   INSD:EH801209.1,INSD:EL331576.1,INSD:AV798952.1,
FT                   INSD:ES152157.1,INSD:EH804047.1,INSD:BP635992.1,
FT                   INSD:ES039977.1,INSD:BP845588.1,INSD:BP662304.1,
FT                   INSD:DR280152.1,INSD:BP844555.1,INSD:BX839102.1,
FT                   INSD:BX840119.1,INSD:EL015396.1,INSD:EL086721.1,
FT                   INSD:ES165733.1,INSD:EH887049.1,INSD:EH983889.1,
FT                   INSD:EL967940.1,INSD:EL068299.1,INSD:EG521104.1,
FT                   INSD:DR280151.1,INSD:EL223325.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820908.1,INSD:AY084784.1,INSD:BX820614.1,
FT                   INSD:BX821977.1,INSD:AF145045.1,INSD:BX821288.1,
FT                   INSD:BX821937.1,INSD:BX819534.1,INSD:AY056347.1,
FT                   INSD:AF360172.1,INSD:BX819468.1,INSD:BX819191.1,
FT                   INSD:AB054096.1"
FT   CDS_pept        complement(join(83786..83995,84085..84375,84450..84718,
FT                   84836..85088))
FT                   /codon_start=1
FT                   /gene="APG2"
FT                   /gene_synonym="ALBINO AND PALE GREEN 2"
FT                   /gene_synonym="F23H14.8"
FT                   /gene_synonym="F23H14_8"
FT                   /gene_synonym="PGA2"
FT                   /gene_synonym="TATC"
FT                   /gene_synonym="TWIN-ARGININE TRANSLOCATION C"
FT                   /gene_synonym="UNE3"
FT                   /gene_synonym="unfertilized embryo sac 3"
FT                   /locus_tag="AT2G01110"
FT                   /product="Sec-independent periplasmic protein translocase"
FT                   /note="ALBINO AND PALE GREEN 2 (APG2); FUNCTIONS IN: proton
FT                   motive force dependent protein transmembrane transporter
FT                   activity; INVOLVED IN: thylakoid membrane organization,
FT                   double fertilization forming a zygote and endosperm;
FT                   LOCATED IN: chloroplast thylakoid membrane, receptor
FT                   complex, chloroplast, integral to thylakoid membrane;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Sec-independent
FT                   periplasmic protein translocase (InterPro:IPR002033),
FT                   Sec-independent periplasmic protein translocase, conserved
FT                   site (InterPro:IPR019820), Twin arginine-targeting protein
FT                   translocase, TatC (InterPro:IPR019822); Has 5953 Blast hits
FT                   to 5918 proteins in 1859 species: Archae - 177; Bacteria -
FT                   3492; Metazoa - 0; Fungi - 0; Plants - 81; Viruses - 0;
FT                   Other Eukaryotes - 2203 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9SJV5"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SJV5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP857834.1,INSD:EH840871.1,INSD:BE037896.1,
FT                   INSD:AV805398.1,INSD:EL055345.1,INSD:EH804914.1,
FT                   INSD:DR280154.1,INSD:EL317591.1,INSD:BE039029.1,
FT                   INSD:DR280155.1,INSD:DR280153.1,INSD:EL267567.1,
FT                   INSD:EG521105.1,INSD:EH989680.1,INSD:EH829735.1,
FT                   INSD:EL079528.1,INSD:EL007742.1,INSD:EL113433.1,
FT                   INSD:EH876256.1,INSD:EL198908.1,INSD:EH802639.1,
FT                   INSD:EL173905.1,INSD:AV829300.1,INSD:EH972289.1,
FT                   INSD:BP653704.1,INSD:ES028612.1,INSD:DR280149.1,
FT                   INSD:BP859305.1,INSD:BP650497.1,INSD:BP591847.1,
FT                   INSD:EH867423.1,INSD:ES108316.1,INSD:DR280148.1,
FT                   INSD:EL051029.1,INSD:EL117982.1,INSD:EH859549.1,
FT                   INSD:EL991275.1,INSD:DR280150.1,INSD:DR380029.1,
FT                   INSD:BP812129.1,INSD:EL297296.1,INSD:EL160940.1,
FT                   INSD:EL203900.1,INSD:AV786168.1,INSD:DR280156.1,
FT                   INSD:AV541047.1,INSD:EL257346.1,INSD:EG488424.1,
FT                   INSD:EH868708.1,INSD:EL125725.1,INSD:EL070215.1,
FT                   INSD:EL243789.1,INSD:EH847515.1,INSD:EG488423.1,
FT                   INSD:EH801209.1,INSD:EL331576.1,INSD:AV798952.1,
FT                   INSD:ES152157.1,INSD:EH804047.1,INSD:BP635992.1,
FT                   INSD:ES039977.1,INSD:BP845588.1,INSD:BP662304.1,
FT                   INSD:DR280152.1,INSD:BP844555.1,INSD:BX839102.1,
FT                   INSD:BX840119.1,INSD:EL015396.1,INSD:EL086721.1,
FT                   INSD:ES165733.1,INSD:EH887049.1,INSD:EH983889.1,
FT                   INSD:EL967940.1,INSD:EL068299.1,INSD:EG521104.1,
FT                   INSD:DR280151.1,INSD:EL223325.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820908.1,INSD:AY084784.1,INSD:BX820614.1,
FT                   INSD:BX821977.1,INSD:AF145045.1,INSD:BX821288.1,
FT                   INSD:BX821937.1,INSD:BX819534.1,INSD:AY056347.1,
FT                   INSD:AF360172.1,INSD:BX819468.1,INSD:BX819191.1,
FT                   INSD:AB054096.1"
FT                   /protein_id="AEC05402.1"
FT                   /translation="MSSTSTSSALIHHFRLTTRNLGSPTKQRCPYAVTFCNSWREAGLR
FT                   YSVTQRRSKGFGPVSALNDDDSPTETTPGVGSAVEDRPPDSSEDRSSSVYEFLYPRKEE
FT                   LPDDKEMTIFDHLEELRERIFVSVLAVGAAILGCFAFSKDLIVFLEAPVKTQGVRFLQL
FT                   APGEFFFTTLKVSGYCGLLLGSPVILYEIIAFVLPGLTRAERRFLGPIVFGSSLLFYAG
FT                   LAFSYWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIQLLLGQ
FT                   VGVVSGDQMLSIWRYVVVGAVVAAAVVTPSTDPVTQMLLATPLLGLYLGGAWMVKLTGR
FT                   "
FT   gene            84873..85086
FT                   /locus_tag="AT2G03895"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT2G01110"
FT   ncRNA           84873..85086
FT                   /locus_tag="AT2G03895"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            85401..88399
FT                   /gene="ORC4"
FT                   /gene_synonym="ATORC4"
FT                   /gene_synonym="F23H14.9"
FT                   /gene_synonym="F23H14_9"
FT                   /gene_synonym="origin recognition complex subunit 4"
FT                   /gene_synonym="ORIGIN RECOGNITION COMPLEX SUBUNIT 4"
FT                   /locus_tag="AT2G01120"
FT                   /note="Origin Recognition Complex subunit 4. Involved in
FT                   the initiation of DNA replication. Regulated
FT                   transcriptionally during cell cycle, peaking at G1/S-phase.
FT                   Target of E2F/DF family of transcription factors. Interacts
FT                   with all ORC subunits except ORC1b."
FT   mRNA            join(85401..85553,85642..85732,85821..85877,85965..86012,
FT                   86097..86147,86234..86277,86351..86414,86512..86601,
FT                   86748..86839,86923..87004,87121..87206,87286..87395,
FT                   87467..87559,87630..87694,87761..87904,87998..88399)
FT                   /gene="ORC4"
FT                   /gene_synonym="ATORC4"
FT                   /gene_synonym="F23H14.9"
FT                   /gene_synonym="F23H14_9"
FT                   /gene_synonym="origin recognition complex subunit 4"
FT                   /gene_synonym="ORIGIN RECOGNITION COMPLEX SUBUNIT 4"
FT                   /locus_tag="AT2G01120"
FT                   /product="origin recognition complex subunit 4"
FT   mRNA            join(85416..85553,85642..85732,85821..85877,85965..86012,
FT                   86097..86147,86234..86277,86351..86414,86512..86601,
FT                   86748..86839,86923..87004,87121..87206,87268..87395,
FT                   87467..87559,87630..87694,87761..87904,87998..88181)
FT                   /gene="ORC4"
FT                   /gene_synonym="ATORC4"
FT                   /gene_synonym="F23H14.9"
FT                   /gene_synonym="F23H14_9"
FT                   /gene_synonym="origin recognition complex subunit 4"
FT                   /gene_synonym="ORIGIN RECOGNITION COMPLEX SUBUNIT 4"
FT                   /locus_tag="AT2G01120"
FT                   /product="origin recognition complex subunit 4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL210229.1,INSD:EL990935.1,INSD:Z26381.1,
FT                   INSD:EH858442.1,INSD:EH955635.1,INSD:ES061210.1,
FT                   INSD:ES189330.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820347.1,INSD:AJ575582.1,INSD:BT011662.1,
FT                   INSD:AJ586913.1,INSD:BX819004.1,INSD:BT011206.1"
FT   CDS_pept        join(85444..85553,85642..85732,85821..85877,85965..86012,
FT                   86097..86147,86234..86277,86351..86414,86512..86601,
FT                   86748..86839,86923..87004,87121..87206,87268..87395,
FT                   87467..87559,87630..87694,87761..87904,87998..88027)
FT                   /codon_start=1
FT                   /gene="ORC4"
FT                   /gene_synonym="ATORC4"
FT                   /gene_synonym="F23H14.9"
FT                   /gene_synonym="F23H14_9"
FT                   /gene_synonym="origin recognition complex subunit 4"
FT                   /gene_synonym="ORIGIN RECOGNITION COMPLEX SUBUNIT 4"
FT                   /locus_tag="AT2G01120"
FT                   /product="origin recognition complex subunit 4"
FT                   /note="origin recognition complex subunit 4 (ORC4);
FT                   CONTAINS InterPro DOMAIN/s: ATPase, AAA-type, core
FT                   (InterPro:IPR003959), Origin recognition complex, subunit 4
FT                   (InterPro:IPR016527)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01120"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01120.2"
FT                   /db_xref="GOA:F4IM82"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR016527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032705"
FT                   /db_xref="UniProtKB/TrEMBL:F4IM82"
FT                   /protein_id="AEC05404.1"
FT                   /translation="MGKETPAEKSLNLIRGRLCDPSYVFRPLSASSDSNYSKLKFIVST
FT                   SITEGCNNSMLLLGPRGSGKAAVLDLXXGXLLEQFPDSVSVIRLNGLLHSDDNCAFKEI
FT                   AKQLCMEHHLLFSKMASFDDNSQFIIAMLRACGLAHKTIIFVLDEFDMFAQGKQRLLYS
FT                   XLDDAMQSVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKFLFLPPSREELDGLFVHLL
FT                   SLPADSGFPSGYVSRFNDKIKNLTSDTRFKDILKTLFNANSTVNSFLKFILSLDVRFCA
FT                   VSLMNLESGLLSLENFKAALSSMQRQPKLEAVRDCSVLELYLLVCMRRLEVKEQSSYNF
FT                   ISVMKEYKAIHDSFHTSDYYAQNVCLRAFEHLRERQVICYAENRGQSQTGEYRLQKLLI
FT                   SASELHQGMRSHACCPAILLKLLDH"
FT   CDS_pept        join(85444..85553,85642..85732,85821..85877,85965..86012,
FT                   86097..86147,86234..86277,86351..86414,86512..86601,
FT                   86748..86839,86923..87004,87121..87206,87286..87395,
FT                   87467..87559,87630..87694,87761..87904,87998..88027)
FT                   /codon_start=1
FT                   /gene="ORC4"
FT                   /gene_synonym="ATORC4"
FT                   /gene_synonym="F23H14.9"
FT                   /gene_synonym="F23H14_9"
FT                   /gene_synonym="origin recognition complex subunit 4"
FT                   /gene_synonym="ORIGIN RECOGNITION COMPLEX SUBUNIT 4"
FT                   /locus_tag="AT2G01120"
FT                   /product="origin recognition complex subunit 4"
FT                   /note="origin recognition complex subunit 4 (ORC4);
FT                   CONTAINS InterPro DOMAIN/s: ATPase, AAA-type, core
FT                   (InterPro:IPR003959), Origin recognition complex, subunit 4
FT                   (InterPro:IPR016527); Has 675 Blast hits to 668 proteins in
FT                   199 species: Archae - 9; Bacteria - 0; Metazoa - 335; Fungi
FT                   - 166; Plants - 90; Viruses - 0; Other Eukaryotes - 75
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q6EWX1"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR016527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032705"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6EWX1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL210229.1,INSD:EL990935.1,INSD:Z26381.1,
FT                   INSD:EH858442.1,INSD:EH955635.1,INSD:ES061210.1,
FT                   INSD:ES189330.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820347.1,INSD:AJ575582.1,INSD:BT011662.1,
FT                   INSD:AJ586913.1,INSD:BX819004.1,INSD:BT011206.1"
FT                   /protein_id="AEC05403.1"
FT                   /translation="MGKETPAEKSLNLIRGRLCDPSYVFRPLSASSDSNYSKLKFIVST
FT                   SITEGCNNSMLLLGPRGSGKAAVLDLXXGXLLEQFPDSVSVIRLNGLLHSDDNCAFKEI
FT                   AKQLCMEHHLLFSKMASFDDNSQFIIAMLRACGLAHKTIIFVLDEFDMFAQGKQRLLYS
FT                   XLDDAMQSVTSQAVVVGISSRLDADQLLEKRVRSRFSHRKFLFLPPSREELDGLFVHLL
FT                   SLPADSGFPSGYVSRFNDKIKNLTSDTRFKDILKTLFNANSTVNSFLKFIFCAVSLMNL
FT                   ESGLLSLENFKAALSSMQRQPKLEAVRDCSVLELYLLVCMRRLEVKEQSSYNFISVMKE
FT                   YKAIHDSFHTSDYYAQNVCLRAFEHLRERQVICYAENRGQSQTGEYRLQKLLISASELH
FT                   QGMRSHACCPAILLKLLDH"
FT   gene            complement(88320..94753)
FT                   /gene_synonym="F10A8.28"
FT                   /locus_tag="AT2G01130"
FT   mRNA            complement(join(88320..89308,89437..89547,89649..89801,
FT                   89897..89956,90046..90351,90671..90819,90899..90968,
FT                   91102..91305,91655..91849,92057..92329,92404..92571,
FT                   92709..92839,92925..93084,93201..93389,93529..93624,
FT                   93709..93933,94028..94115,94187..94347,94495..94753))
FT                   /gene_synonym="F10A8.28"
FT                   /locus_tag="AT2G01130"
FT                   /product="DEA(D/H)-box RNA helicase family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP810813.1,INSD:AU229921.1,INSD:BE522980.1,
FT                   INSD:BE522979.1"
FT   mRNA            complement(join(88489..89308,89437..89547,89649..89801,
FT                   89897..89956,90046..90351,90671..90819,90899..90968,
FT                   91102..91305,91655..91849,92057..92329,92404..92571,
FT                   92709..92839,92925..93084,93201..93389,93529..93624,
FT                   93709..93933,94028..94115,94187..94369))
FT                   /gene_synonym="F10A8.28"
FT                   /locus_tag="AT2G01130"
FT                   /product="DEA(D/H)-box RNA helicase family protein"
FT   CDS_pept        complement(join(88847..89308,89437..89547,89649..89801,
FT                   89897..89956,90046..90351,90671..90819,90899..90968,
FT                   91102..91305,91655..91849,92057..92329,92404..92571,
FT                   92709..92839,92925..93084,93201..93389,93529..93624,
FT                   93709..93933,94028..94115,94187..94347,94495..94635))
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.28"
FT                   /locus_tag="AT2G01130"
FT                   /product="DEA(D/H)-box RNA helicase family protein"
FT                   /note="DEA(D/H)-box RNA helicase family protein; FUNCTIONS
FT                   IN: in 6 functions; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: intracellular; EXPRESSED IN: 19 plant
FT                   structures; EXPRESSED DURING: 12 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Helicase-associated domain
FT                   (InterPro:IPR007502), DNA/RNA helicase, DEAD/DEAH box type,
FT                   N-terminal (InterPro:IPR011545), Domain of unknown function
FT                   DUF1605 (InterPro:IPR011709), Double-stranded RNA-binding
FT                   (InterPro:IPR001159), Double-stranded RNA-binding-like
FT                   (InterPro:IPR014720), DEAD-like helicase, N-terminal
FT                   (InterPro:IPR014001), DNA/RNA helicase, C-terminal
FT                   (InterPro:IPR001650), Helicase, superfamily 1/2,
FT                   ATP-binding domain (InterPro:IPR014021); BEST Arabidopsis
FT                   thaliana protein match is: DEA(D/H)-box RNA helicase family
FT                   protein (TAIR:AT1G48650.2); Has 13137 Blast hits to 8990
FT                   proteins in 1526 species: Archae - 10; Bacteria - 5358;
FT                   Metazoa - 2929; Fungi - 1766; Plants - 978; Viruses - 93;
FT                   Other Eukaryotes - 2003 (source: NCBI BLink)."
FT                   /db_xref="GOA:F4IM84"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4IM84"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP810813.1,INSD:AU229921.1,INSD:BE522980.1,
FT                   INSD:BE522979.1"
FT                   /protein_id="AEC05405.1"
FT                   /translation="MTNRLPPSLYVPPHQRLGSDYGFNPVPLSPVRYVSAYDDRVSEDR
FT                   QPQEGTFHCADLDDWNKRFSMLLKDSLKQEVISREKKDRRDFDKLAALATTLGLYSHAY
FT                   AKVVVFSKIPLPNYRFDLDDKKPQREVNLHTDLLQRVEAYLTEYLSKSSNRIDRVPANS
FT                   VSRTSSISSTDEWFSEQPLPISATKILWQRSLQLRDRQQYWQASVEGQRMLDSRTSLPA
FT                   FKQRHSVLTAISQNQVIVISGETGCGKTTQIPQFILESEIEANRGAFSSIICTQPRRIS
FT                   AMSVSERVAYERGEQLGESVGYKVRLEGVKGRDTRLLFCTTGILLRRLLVDRNLRGVTH
FT                   VIVDEIHERGMNEDFLLIILKDLLSRRSELKLILMSATLDAELFSSYFGGAGVIYIPGF
FT                   TYPVRSHFLEDILEMTRYRLTPYNQIDDYGQERTWKMNKQIPKKRKSQITFVVEDALRA
FT                   ADFKEFSPETRESLSCWYPDCIGFNLIEFLLCNICENEGPGGILIFLTGWDDISSLKEK
FT                   LQIHPIFGNPDLVMLLACHGSMETFEQRLIFEEPASGVRKIVLATNIAETSITINDVAF
FT                   VIDCGKAKETSYDALNNTPCLLPSWISKVSAQQRRGRAGRVRPGQCYHLYPKCVYDAFA
FT                   EYQLPEILRTPLHSLCLQIKSLNLGSISEFLSRALQSPELLAVQKAIAFLKIIGALDEN
FT                   EDLTTLGRYLSKLPMEPKLGKMLILGAILGCLDPILTVAAGLSVRDPFLTPQDKKDLAE
FT                   AAKSQFSRDHSDHLALVRAYEGWKKAEEESAVYDYCWKNFLSIQSLRAIDSLRKEFFSL
FT                   LKDTGLIDGNPSICNSEGNDANLTRAVICYGMYPGICSVVHNERSFSLKTMEDGQVLLY
FT                   SNSENARETKIPYPWLVFNEKIKVNSVFLRDSTACSDSTLILFGGSISKGDTDGHLKML
FT                   GGYLEFFMKPDVAEIYQTLKKELDELIQNKLLNPKVDMQAHRELLSAIRLLVSEDGCDG
FT                   RFVFGHQILRPLEISALSTKPSLFSRTESGPGGDNSKSQLQTILTRAGYTVPMYKTKQL
FT                   KNNKFQTTVEFNETQIMGQPCSNKKSAEKDAAAEAIQWLKGGAKESHEQVNHMSKLLKK
FT                   GKKDHL"
FT   CDS_pept        complement(join(88847..89308,89437..89547,89649..89801,
FT                   89897..89956,90046..90351,90671..90819,90899..90968,
FT                   91102..91305,91655..91849,92057..92329,92404..92571,
FT                   92709..92839,92925..93084,93201..93389,93529..93624,
FT                   93709..93933,94028..94115,94187..94293))
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.28"
FT                   /locus_tag="AT2G01130"
FT                   /product="DEA(D/H)-box RNA helicase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01130"
FT                   /db_xref="GOA:A0A1P8B2K8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B2K8"
FT                   /protein_id="ANM63137.1"
FT                   /translation="MLLKDSLKQEVISREKKDRRDFDKLAALATTLGLYSHAYAKVVVF
FT                   SKIPLPNYRFDLDDKKPQREVNLHTDLLQRVEAYLTEYLSKSSNRIDRVPANSVSRTSS
FT                   ISSTDEWFSEQPLPISATKILWQRSLQLRDRQQYWQASVEGQRMLDSRTSLPAFKQRHS
FT                   VLTAISQNQVIVISGETGCGKTTQIPQFILESEIEANRGAFSSIICTQPRRISAMSVSE
FT                   RVAYERGEQLGESVGYKVRLEGVKGRDTRLLFCTTGILLRRLLVDRNLRGVTHVIVDEI
FT                   HERGMNEDFLLIILKDLLSRRSELKLILMSATLDAELFSSYFGGAGVIYIPGFTYPVRS
FT                   HFLEDILEMTRYRLTPYNQIDDYGQERTWKMNKQIPKKRKSQITFVVEDALRAADFKEF
FT                   SPETRESLSCWYPDCIGFNLIEFLLCNICENEGPGGILIFLTGWDDISSLKEKLQIHPI
FT                   FGNPDLVMLLACHGSMETFEQRLIFEEPASGVRKIVLATNIAETSITINDVAFVIDCGK
FT                   AKETSYDALNNTPCLLPSWISKVSAQQRRGRAGRVRPGQCYHLYPKCVYDAFAEYQLPE
FT                   ILRTPLHSLCLQIKSLNLGSISEFLSRALQSPELLAVQKAIAFLKIIGALDENEDLTTL
FT                   GRYLSKLPMEPKLGKMLILGAILGCLDPILTVAAGLSVRDPFLTPQDKKDLAEAAKSQF
FT                   SRDHSDHLALVRAYEGWKKAEEESAVYDYCWKNFLSIQSLRAIDSLRKEFFSLLKDTGL
FT                   IDGNPSICNSEGNDANLTRAVICYGMYPGICSVVHNERSFSLKTMEDGQVLLYSNSENA
FT                   RETKIPYPWLVFNEKIKVNSVFLRDSTACSDSTLILFGGSISKGDTDGHLKMLGGYLEF
FT                   FMKPDVAEIYQTLKKELDELIQNKLLNPKVDMQAHRELLSAIRLLVSEDGCDGRFVFGH
FT                   QILRPLEISALSTKPSLFSRTESGPGGDNSKSQLQTILTRAGYTVPMYKTKQLKNNKFQ
FT                   TTVEFNETQIMGQPCSNKKSAEKDAAAEAIQWLKGGAKESHEQVNHMSKLLKKGKKDHL
FT                   "
FT   gene            complement(94727..96863)
FT                   /gene="PDE345"
FT                   /gene_synonym="AtFBA3"
FT                   /gene_synonym="FBA3"
FT                   /gene_synonym="fructose-bisphosphate aldolase 3"
FT                   /gene_synonym="PIGMENT DEFECTIVE 345"
FT                   /locus_tag="AT2G01140"
FT   mRNA            complement(join(94727..95645,95749..95858,95954..96223,
FT                   96336..96863))
FT                   /gene="PDE345"
FT                   /gene_synonym="AtFBA3"
FT                   /gene_synonym="FBA3"
FT                   /gene_synonym="fructose-bisphosphate aldolase 3"
FT                   /gene_synonym="PIGMENT DEFECTIVE 345"
FT                   /locus_tag="AT2G01140"
FT                   /product="Aldolase superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES162432.1,INSD:DR235942.1,INSD:EL994091.1,
FT                   INSD:BP798519.1,INSD:BE524465.1,INSD:BP794764.1,
FT                   INSD:EH896773.1,INSD:DR235940.1,INSD:DR235963.1,
FT                   INSD:ES210481.1,INSD:BP648129.1,INSD:EH816359.1,
FT                   INSD:AV518474.1,INSD:AV526733.1,INSD:DR235965.1,
FT                   INSD:DR235945.1,INSD:EL010849.1,INSD:BP643832.1,
FT                   INSD:BE520531.1,INSD:DR235931.1,INSD:DR235935.1,
FT                   INSD:DR235944.1,INSD:AV554829.1,INSD:DR235939.1,
FT                   INSD:BP787411.1,INSD:ES167943.1,INSD:EG494105.1,
FT                   INSD:EL105504.1,INSD:BE523667.1,INSD:BP581425.1,
FT                   INSD:AV538958.1,INSD:DR235938.1,INSD:EL094564.1,
FT                   INSD:AV793024.1,INSD:AV544361.1,INSD:EL298689.1,
FT                   INSD:EL044552.1,INSD:EH878909.1,INSD:DR235930.1,
FT                   INSD:EH992383.1,INSD:EL086779.1,INSD:BP803002.1,
FT                   INSD:BP631770.1,INSD:ES135821.1,INSD:BP835183.1,
FT                   INSD:BP857776.1,INSD:ES173031.1,INSD:ES161388.1,
FT                   INSD:AV534600.1,INSD:AV519327.1,INSD:EH959638.1,
FT                   INSD:DR235973.1,INSD:BP641982.1,INSD:BP574898.1,
FT                   INSD:DR235956.1,INSD:DR235969.1,INSD:AV551921.1,
FT                   INSD:BP565611.1,INSD:BP782972.1,INSD:DR235953.1,
FT                   INSD:EG494106.1,INSD:BE525012.1,INSD:AV533494.1,
FT                   INSD:ES156410.1,INSD:EG499065.1,INSD:ES150154.1,
FT                   INSD:EL160077.1,INSD:BE524237.1,INSD:DR235955.1,
FT                   INSD:EG478630.1,INSD:DR235959.1,INSD:AV820129.1,
FT                   INSD:BE038432.1,INSD:ES190165.1,INSD:Z18204.1,
FT                   INSD:EH852361.1,INSD:EL278802.1,INSD:EL174142.1,
FT                   INSD:T42119.1,INSD:ES154192.1,INSD:H76694.1,
FT                   INSD:EG528921.1,INSD:CD529647.1,INSD:AV532755.1,
FT                   INSD:EL258375.1,INSD:ES043581.1,INSD:BP622995.1,
FT                   INSD:EL287015.1,INSD:AV439566.1,INSD:BE530386.1,
FT                   INSD:BP578458.1,INSD:BE038731.1,INSD:AV782422.1,
FT                   INSD:EL978168.1,INSD:AV790829.1,INSD:DR235968.1,
FT                   INSD:DR235970.1,INSD:BP801127.1,INSD:ES121305.1,
FT                   INSD:ES181399.1,INSD:EH799986.1,INSD:BU636349.1,
FT                   INSD:BE525869.1,INSD:ES102320.1,INSD:ES131258.1,
FT                   INSD:EL174586.1,INSD:EH928828.1,INSD:BP795041.1,
FT                   INSD:ES141212.1,INSD:DR235972.1,INSD:BE529824.1,
FT                   INSD:EH972836.1,INSD:EL224437.1,INSD:AV818222.1,
FT                   INSD:EL312063.1,INSD:AV533326.1,INSD:DR235925.1,
FT                   INSD:DR235971.1,INSD:BE526240.1,INSD:AV543147.1,
FT                   INSD:EL969288.1,INSD:BE526426.1,INSD:AV547345.1,
FT                   INSD:DR373541.1,INSD:ES092853.1,INSD:ES168927.1,
FT                   INSD:DR235976.1,INSD:DR235957.1,INSD:BP828516.1,
FT                   INSD:EL982327.1,INSD:ES074809.1,INSD:ES095351.1,
FT                   INSD:EL970322.1,INSD:BP651627.1,INSD:AV531591.1,
FT                   INSD:EL981267.1,INSD:BP640661.1,INSD:EG520409.1,
FT                   INSD:EL198963.1,INSD:AV533593.1,INSD:DR235933.1,
FT                   INSD:DR235928.1,INSD:ES210158.1,INSD:EG456962.1,
FT                   INSD:DR235927.1,INSD:ES192091.1,INSD:BP815841.1,
FT                   INSD:BP808951.1,INSD:AV541126.1,INSD:DR235941.1,
FT                   INSD:EL263383.1,INSD:BP662038.1,INSD:CK121614.1,
FT                   INSD:ES071126.1,INSD:BP652875.1,INSD:EH888959.1,
FT                   INSD:BP626936.1,INSD:DR235934.1,INSD:AV539227.1,
FT                   INSD:BE522016.1,INSD:AV551627.1,INSD:BP779302.1,
FT                   INSD:AV540961.1,INSD:ES195809.1,INSD:EH992106.1,
FT                   INSD:DR235962.1,INSD:DR235964.1,INSD:BP645205.1,
FT                   INSD:BP816921.1,INSD:EL081733.1,INSD:ES085760.1,
FT                   INSD:AV796977.1,INSD:AV805006.1,INSD:BE527424.1,
FT                   INSD:DR235954.1,INSD:BP832704.1,INSD:DR235952.1,
FT                   INSD:DR235947.1,INSD:EG522095.1,INSD:BP820154.1,
FT                   INSD:EH940157.1,INSD:BP836164.1,INSD:ES127138.1,
FT                   INSD:AV533903.1,INSD:CB259277.1,INSD:BP582530.1,
FT                   INSD:DR235961.1,INSD:EL186821.1,INSD:DR235966.1,
FT                   INSD:BP781274.1,INSD:DR235926.1,INSD:AV830746.1,
FT                   INSD:DR235951.1,INSD:EL153983.1,INSD:EL337211.1,
FT                   INSD:EH940139.1,INSD:ES154512.1,INSD:BP579701.1,
FT                   INSD:ES094926.1,INSD:DR235958.1,INSD:BP786703.1,
FT                   INSD:EL983896.1,INSD:EL035594.1,INSD:DR235948.1,
FT                   INSD:ES058133.1,INSD:R30011.1,INSD:BE530118.1,
FT                   INSD:BE521424.1,INSD:DR235929.1,INSD:ES010937.1,
FT                   INSD:DR235975.1,INSD:EG429207.1,INSD:DR235924.1,
FT                   INSD:EG514344.1,INSD:ES110151.1,INSD:ES148791.1,
FT                   INSD:EL158956.1,INSD:CB259773.1,INSD:BE521425.1,
FT                   INSD:DR235923.1,INSD:AV821858.1,INSD:ES002140.1,
FT                   INSD:EG528923.1,INSD:EL148180.1,INSD:AV525313.1,
FT                   INSD:EG499063.1,INSD:EL321979.1,INSD:ES033084.1,
FT                   INSD:AV534892.1,INSD:EL977592.1,INSD:DR235950.1,
FT                   INSD:DR235967.1,INSD:AV534505.1,INSD:ES038487.1,
FT                   INSD:DR235960.1,INSD:ES073870.1,INSD:BP867058.1,
FT                   INSD:EL982565.1,INSD:Z30852.1,INSD:EG497886.1,
FT                   INSD:BE527549.1,INSD:ES032658.1,INSD:EH852400.1,
FT                   INSD:EH970711.1,INSD:AV812872.1,INSD:DR235949.1,
FT                   INSD:AV535833.1,INSD:EL164026.1,INSD:DR235937.1,
FT                   INSD:DR235946.1,INSD:ES069582.1,INSD:EG525499.1,
FT                   INSD:ES123751.1,INSD:BE845290.1,INSD:ES196914.1,
FT                   INSD:ES193567.1,INSD:BP841370.1,INSD:BP662796.1,
FT                   INSD:BP789624.1,INSD:EG497888.1,INSD:BP848334.1,
FT                   INSD:F15459.1,INSD:AV551677.1,INSD:AV525661.1,
FT                   INSD:ES163260.1,INSD:BP781481.1,INSD:DR235943.1,
FT                   INSD:Z29138.1,INSD:BP819287.1,INSD:BP787487.1,
FT                   INSD:AV803683.1,INSD:AV521617.1,INSD:BP786035.1,
FT                   INSD:BP581860.1,INSD:EL281821.1,INSD:BX839416.1,
FT                   INSD:BP631747.1,INSD:AV441867.1,INSD:BP801047.1,
FT                   INSD:ES043503.1,INSD:BP595583.1,INSD:BP813968.1,
FT                   INSD:BE527091.1,INSD:DR235932.1,INSD:DR235974.1,
FT                   INSD:EG478670.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX821886.1,INSD:AY086203.1,INSD:BX819026.1,
FT                   INSD:BX820040.1,INSD:AF325014.2"
FT   CDS_pept        complement(join(95006..95645,95749..95858,95954..96223,
FT                   96336..96491))
FT                   /codon_start=1
FT                   /gene="PDE345"
FT                   /gene_synonym="AtFBA3"
FT                   /gene_synonym="FBA3"
FT                   /gene_synonym="fructose-bisphosphate aldolase 3"
FT                   /gene_synonym="PIGMENT DEFECTIVE 345"
FT                   /locus_tag="AT2G01140"
FT                   /product="Aldolase superfamily protein"
FT                   /note="Aldolase superfamily protein; FUNCTIONS IN:
FT                   fructose-bisphosphate aldolase activity; INVOLVED IN:
FT                   response to oxidative stress, response to cadmium ion,
FT                   pentose-phosphate shunt; LOCATED IN: mitochondrion,
FT                   chloroplast, plastoglobule; EXPRESSED IN: 25 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Aldolase-type TIM barrel
FT                   (InterPro:IPR013785), Fructose-bisphosphate aldolase,
FT                   class-I (InterPro:IPR000741); BEST Arabidopsis thaliana
FT                   protein match is: fructose-bisphosphate aldolase 2
FT                   (TAIR:AT4G38970.1); Has 4797 Blast hits to 4792 proteins in
FT                   909 species: Archae - 0; Bacteria - 723; Metazoa - 1159;
FT                   Fungi - 8; Plants - 476; Viruses - 0; Other Eukaryotes -
FT                   2431 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01140"
FT                   /db_xref="GOA:Q9ZU52"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029768"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU52"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES162432.1,INSD:DR235942.1,INSD:EL994091.1,
FT                   INSD:BP798519.1,INSD:BE524465.1,INSD:BP794764.1,
FT                   INSD:EH896773.1,INSD:DR235940.1,INSD:DR235963.1,
FT                   INSD:ES210481.1,INSD:BP648129.1,INSD:EH816359.1,
FT                   INSD:AV518474.1,INSD:AV526733.1,INSD:DR235965.1,
FT                   INSD:DR235945.1,INSD:EL010849.1,INSD:BP643832.1,
FT                   INSD:BE520531.1,INSD:DR235931.1,INSD:DR235935.1,
FT                   INSD:DR235944.1,INSD:AV554829.1,INSD:DR235939.1,
FT                   INSD:BP787411.1,INSD:ES167943.1,INSD:EG494105.1,
FT                   INSD:EL105504.1,INSD:BE523667.1,INSD:BP581425.1,
FT                   INSD:AV538958.1,INSD:DR235938.1,INSD:EL094564.1,
FT                   INSD:AV793024.1,INSD:AV544361.1,INSD:EL298689.1,
FT                   INSD:EL044552.1,INSD:EH878909.1,INSD:DR235930.1,
FT                   INSD:EH992383.1,INSD:EL086779.1,INSD:BP803002.1,
FT                   INSD:BP631770.1,INSD:ES135821.1,INSD:BP835183.1,
FT                   INSD:BP857776.1,INSD:ES173031.1,INSD:ES161388.1,
FT                   INSD:AV534600.1,INSD:AV519327.1,INSD:EH959638.1,
FT                   INSD:DR235973.1,INSD:BP641982.1,INSD:BP574898.1,
FT                   INSD:DR235956.1,INSD:DR235969.1,INSD:AV551921.1,
FT                   INSD:BP565611.1,INSD:BP782972.1,INSD:DR235953.1,
FT                   INSD:EG494106.1,INSD:BE525012.1,INSD:AV533494.1,
FT                   INSD:ES156410.1,INSD:EG499065.1,INSD:ES150154.1,
FT                   INSD:EL160077.1,INSD:BE524237.1,INSD:DR235955.1,
FT                   INSD:EG478630.1,INSD:DR235959.1,INSD:AV820129.1,
FT                   INSD:BE038432.1,INSD:ES190165.1,INSD:Z18204.1,
FT                   INSD:EH852361.1,INSD:EL278802.1,INSD:EL174142.1,
FT                   INSD:T42119.1,INSD:ES154192.1,INSD:H76694.1,
FT                   INSD:EG528921.1,INSD:CD529647.1,INSD:AV532755.1,
FT                   INSD:EL258375.1,INSD:ES043581.1,INSD:BP622995.1,
FT                   INSD:EL287015.1,INSD:AV439566.1,INSD:BE530386.1,
FT                   INSD:BP578458.1,INSD:BE038731.1,INSD:AV782422.1,
FT                   INSD:EL978168.1,INSD:AV790829.1,INSD:DR235968.1,
FT                   INSD:DR235970.1,INSD:BP801127.1,INSD:ES121305.1,
FT                   INSD:ES181399.1,INSD:EH799986.1,INSD:BU636349.1,
FT                   INSD:BE525869.1,INSD:ES102320.1,INSD:ES131258.1,
FT                   INSD:EL174586.1,INSD:EH928828.1,INSD:BP795041.1,
FT                   INSD:ES141212.1,INSD:DR235972.1,INSD:BE529824.1,
FT                   INSD:EH972836.1,INSD:EL224437.1,INSD:AV818222.1,
FT                   INSD:EL312063.1,INSD:AV533326.1,INSD:DR235925.1,
FT                   INSD:DR235971.1,INSD:BE526240.1,INSD:AV543147.1,
FT                   INSD:EL969288.1,INSD:BE526426.1,INSD:AV547345.1,
FT                   INSD:DR373541.1,INSD:ES092853.1,INSD:ES168927.1,
FT                   INSD:DR235976.1,INSD:DR235957.1,INSD:BP828516.1,
FT                   INSD:EL982327.1,INSD:ES074809.1,INSD:ES095351.1,
FT                   INSD:EL970322.1,INSD:BP651627.1,INSD:AV531591.1,
FT                   INSD:EL981267.1,INSD:BP640661.1,INSD:EG520409.1,
FT                   INSD:EL198963.1,INSD:AV533593.1,INSD:DR235933.1,
FT                   INSD:DR235928.1,INSD:ES210158.1,INSD:EG456962.1,
FT                   INSD:DR235927.1,INSD:ES192091.1,INSD:BP815841.1,
FT                   INSD:BP808951.1,INSD:AV541126.1,INSD:DR235941.1,
FT                   INSD:EL263383.1,INSD:BP662038.1,INSD:CK121614.1,
FT                   INSD:ES071126.1,INSD:BP652875.1,INSD:EH888959.1,
FT                   INSD:BP626936.1,INSD:DR235934.1,INSD:AV539227.1,
FT                   INSD:BE522016.1,INSD:AV551627.1,INSD:BP779302.1,
FT                   INSD:AV540961.1,INSD:ES195809.1,INSD:EH992106.1,
FT                   INSD:DR235962.1,INSD:DR235964.1,INSD:BP645205.1,
FT                   INSD:BP816921.1,INSD:EL081733.1,INSD:ES085760.1,
FT                   INSD:AV796977.1,INSD:AV805006.1,INSD:BE527424.1,
FT                   INSD:DR235954.1,INSD:BP832704.1,INSD:DR235952.1,
FT                   INSD:DR235947.1,INSD:EG522095.1,INSD:BP820154.1,
FT                   INSD:EH940157.1,INSD:BP836164.1,INSD:ES127138.1,
FT                   INSD:AV533903.1,INSD:CB259277.1,INSD:BP582530.1,
FT                   INSD:DR235961.1,INSD:EL186821.1,INSD:DR235966.1,
FT                   INSD:BP781274.1,INSD:DR235926.1,INSD:AV830746.1,
FT                   INSD:DR235951.1,INSD:EL153983.1,INSD:EL337211.1,
FT                   INSD:EH940139.1,INSD:ES154512.1,INSD:BP579701.1,
FT                   INSD:ES094926.1,INSD:DR235958.1,INSD:BP786703.1,
FT                   INSD:EL983896.1,INSD:EL035594.1,INSD:DR235948.1,
FT                   INSD:ES058133.1,INSD:R30011.1,INSD:BE530118.1,
FT                   INSD:BE521424.1,INSD:DR235929.1,INSD:ES010937.1,
FT                   INSD:DR235975.1,INSD:EG429207.1,INSD:DR235924.1,
FT                   INSD:EG514344.1,INSD:ES110151.1,INSD:ES148791.1,
FT                   INSD:EL158956.1,INSD:CB259773.1,INSD:BE521425.1,
FT                   INSD:DR235923.1,INSD:AV821858.1,INSD:ES002140.1,
FT                   INSD:EG528923.1,INSD:EL148180.1,INSD:AV525313.1,
FT                   INSD:EG499063.1,INSD:EL321979.1,INSD:ES033084.1,
FT                   INSD:AV534892.1,INSD:EL977592.1,INSD:DR235950.1,
FT                   INSD:DR235967.1,INSD:AV534505.1,INSD:ES038487.1,
FT                   INSD:DR235960.1,INSD:ES073870.1,INSD:BP867058.1,
FT                   INSD:EL982565.1,INSD:Z30852.1,INSD:EG497886.1,
FT                   INSD:BE527549.1,INSD:ES032658.1,INSD:EH852400.1,
FT                   INSD:EH970711.1,INSD:AV812872.1,INSD:DR235949.1,
FT                   INSD:AV535833.1,INSD:EL164026.1,INSD:DR235937.1,
FT                   INSD:DR235946.1,INSD:ES069582.1,INSD:EG525499.1,
FT                   INSD:ES123751.1,INSD:BE845290.1,INSD:ES196914.1,
FT                   INSD:ES193567.1,INSD:BP841370.1,INSD:BP662796.1,
FT                   INSD:BP789624.1,INSD:EG497888.1,INSD:BP848334.1,
FT                   INSD:F15459.1,INSD:AV551677.1,INSD:AV525661.1,
FT                   INSD:ES163260.1,INSD:BP781481.1,INSD:DR235943.1,
FT                   INSD:Z29138.1,INSD:BP819287.1,INSD:BP787487.1,
FT                   INSD:AV803683.1,INSD:AV521617.1,INSD:BP786035.1,
FT                   INSD:BP581860.1,INSD:EL281821.1,INSD:BX839416.1,
FT                   INSD:BP631747.1,INSD:AV441867.1,INSD:BP801047.1,
FT                   INSD:ES043503.1,INSD:BP595583.1,INSD:BP813968.1,
FT                   INSD:BE527091.1,INSD:DR235932.1,INSD:DR235974.1,
FT                   INSD:EG478670.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX821886.1,INSD:AY086203.1,INSD:BX819026.1,
FT                   INSD:BX820040.1,INSD:AF325014.2"
FT                   /protein_id="AEC05406.1"
FT                   /translation="MASASFVKPNTLSSPWIGQRSFAHTSASSSPPPRVSFAIRAGAYS
FT                   DELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEDNRQAYRQLLLTTPGLGDY
FT                   ISGSILFEETLYQSTKDGKTFVDCLRDANIVPGIKVDKGLSPLAGSNEESWCQGLDGLA
FT                   SRSAEYYKQGARFAKWRTVVSVPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEIL
FT                   LDGDHPIERTLEVAEKVWSEVFFYLAQNNVMFEGILLKPSMVTPGAEHKNKASPETVAD
FT                   FTLTMLKRRVPPAVPGIMFLSGGQSEAEATLNLNAMNQSPNPWHVSFSYARALQNSVLR
FT                   TWQGKPEKIEASQKALLVRAKANSLAQLGKYSAEGENEDAKKGMFVKGYTY"
FT   gene            100484..101566
FT                   /gene="RHA2B"
FT                   /gene_synonym="F10A8.3"
FT                   /gene_synonym="F10A8_3"
FT                   /gene_synonym="RING-H2 finger protein 2B"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
FT                   /locus_tag="AT2G01150"
FT                   /note="Encodes a RING-H2 finger protein that is expressed
FT                   in vascular tissue, root tips, embryos and pistils."
FT   mRNA            100484..101524
FT                   /gene="RHA2B"
FT                   /gene_synonym="F10A8.3"
FT                   /gene_synonym="F10A8_3"
FT                   /gene_synonym="RING-H2 finger protein 2B"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
FT                   /locus_tag="AT2G01150"
FT                   /product="RING-H2 finger protein 2B"
FT   CDS_pept        100556..101146
FT                   /codon_start=1
FT                   /gene="RHA2B"
FT                   /gene_synonym="F10A8.3"
FT                   /gene_synonym="F10A8_3"
FT                   /gene_synonym="RING-H2 finger protein 2B"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
FT                   /locus_tag="AT2G01150"
FT                   /product="RING-H2 finger protein 2B"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01150"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B063"
FT                   /protein_id="ANM62281.1"
FT                   /translation="MGPTTRGLCHFFFFSIHIKKKKEMRCKVVYAARTTTRTKVTKTIS
FT                   KTISMGLQGQLSDVSSDSIPLMLLALLATFFRHVRSLLLFPSSAPVVVVTSNLSVLADQ
FT                   LNLNRLFSYRYSDNAASDCIVCLSKLKTGEEVRKLDCRHVFHKQCLEGWLQHLNFNCPL
FT                   CRSPLLPHHHQGHGSDASISAFPLRSTSTASSH"
FT   mRNA            100563..101495
FT                   /gene="RHA2B"
FT                   /gene_synonym="F10A8.3"
FT                   /gene_synonym="F10A8_3"
FT                   /gene_synonym="RING-H2 finger protein 2B"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
FT                   /locus_tag="AT2G01150"
FT                   /product="RING-H2 finger protein 2B"
FT   CDS_pept        100625..101146
FT                   /codon_start=1
FT                   /gene="RHA2B"
FT                   /gene_synonym="F10A8.3"
FT                   /gene_synonym="F10A8_3"
FT                   /gene_synonym="RING-H2 finger protein 2B"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
FT                   /locus_tag="AT2G01150"
FT                   /product="RING-H2 finger protein 2B"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01150"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B060"
FT                   /protein_id="ANM62282.1"
FT                   /translation="MRCKVVYAARTTTRTKVTKTISKTISMGLQGQLSDVSSDSIPLML
FT                   LALLATFFRHVRSLLLFPSSAPVVVVTSNLSVLADQLNLNRLFSYRYSDNAASDCIVCL
FT                   SKLKTGEEVRKLDCRHVFHKQCLEGWLQHLNFNCPLCRSPLLPHHHQGHGSDASISAFP
FT                   LRSTSTASSH"
FT   mRNA            100634..101566
FT                   /gene="RHA2B"
FT                   /gene_synonym="F10A8.3"
FT                   /gene_synonym="F10A8_3"
FT                   /gene_synonym="RING-H2 finger protein 2B"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
FT                   /locus_tag="AT2G01150"
FT                   /product="RING-H2 finger protein 2B"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH977161.1,INSD:CB263517.1,INSD:AV532494.1,
FT                   INSD:EL127274.1,INSD:EH811397.1,INSD:AA728515.1,
FT                   INSD:DR252653.1,INSD:AV537173.1,INSD:AV563006.1,
FT                   INSD:DR252655.1,INSD:T76073.1,INSD:DR749570.1,
FT                   INSD:T04686.1,INSD:DR252652.1,INSD:DR376651.1,
FT                   INSD:DR252651.1,INSD:AU229961.1,INSD:EL191079.1,
FT                   INSD:AU238728.1,INSD:DR252654.1,INSD:EL014463.1,
FT                   INSD:DR252656.1,INSD:EL273556.1,INSD:DR749538.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT025510.1,INSD:AK117891.1,INSD:AF078823.1"
FT   CDS_pept        100703..101146
FT                   /codon_start=1
FT                   /gene="RHA2B"
FT                   /gene_synonym="F10A8.3"
FT                   /gene_synonym="F10A8_3"
FT                   /gene_synonym="RING-H2 finger protein 2B"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHA2B"
FT                   /locus_tag="AT2G01150"
FT                   /product="RING-H2 finger protein 2B"
FT                   /note="RING-H2 finger protein 2B (RHA2B); CONTAINS InterPro
FT                   DOMAIN/s: Zinc finger, RING-type (InterPro:IPR001841), Zinc
FT                   finger, C3HC4 RING-type (InterPro:IPR018957); BEST
FT                   Arabidopsis thaliana protein match is: RING-H2 finger A2A
FT                   (TAIR:AT1G15100.1); Has 8536 Blast hits to 8514 proteins in
FT                   269 species: Archae - 0; Bacteria - 0; Metazoa - 2151;
FT                   Fungi - 713; Plants - 4534; Viruses - 16; Other Eukaryotes
FT                   - 1122 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01150"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01150.1"
FT                   /db_xref="GOA:Q9ZU51"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU51"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH977161.1,INSD:CB263517.1,INSD:AV532494.1,
FT                   INSD:EL127274.1,INSD:EH811397.1,INSD:AA728515.1,
FT                   INSD:DR252653.1,INSD:AV537173.1,INSD:AV563006.1,
FT                   INSD:DR252655.1,INSD:T76073.1,INSD:DR749570.1,
FT                   INSD:T04686.1,INSD:DR252652.1,INSD:DR376651.1,
FT                   INSD:DR252651.1,INSD:AU229961.1,INSD:EL191079.1,
FT                   INSD:AU238728.1,INSD:DR252654.1,INSD:EL014463.1,
FT                   INSD:DR252656.1,INSD:EL273556.1,INSD:DR749538.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT025510.1,INSD:AK117891.1,INSD:AF078823.1"
FT                   /protein_id="AEC05407.1"
FT                   /translation="MGLQGQLSDVSSDSIPLMLLALLATFFRHVRSLLLFPSSAPVVVV
FT                   TSNLSVLADQLNLNRLFSYRYSDNAASDCIVCLSKLKTGEEVRKLDCRHVFHKQCLEGW
FT                   LQHLNFNCPLCRSPLLPHHHQGHGSDASISAFPLRSTSTASSH"
FT   gene            102065..102138
FT                   /gene_synonym="48852.TRNA-ASN-1"
FT                   /locus_tag="AT2G01160"
FT   tRNA            102065..102138
FT                   /gene_synonym="48852.TRNA-ASN-1"
FT                   /locus_tag="AT2G01160"
FT                   /product="tRNA-Asn"
FT                   /note="pre-tRNA-tRNA-Asn (anticodon: GTT)"
FT   gene            complement(102156..104574)
FT                   /gene="BAT1"
FT                   /gene_synonym="AtGABP"
FT                   /gene_synonym="bidirectional amino acid transporter 1"
FT                   /gene_synonym="GABA permease"
FT                   /gene_synonym="GABP"
FT                   /locus_tag="AT2G01170"
FT                   /note="Encodes a bidirectional amino acid transporter that
FT                   can transport ala, arg, glu and lys, GABA but not pro with
FT                   both export and import activity. Its expression is
FT                   localized in the vascular tissues suggesting a function in
FT                   amino acids export from the phloem into sink tissue."
FT   mRNA            complement(join(102156..102711,102788..102917,
FT                   102999..103288,103362..103543,103623..103842,
FT                   103926..103944,104033..104293,104362..104574))
FT                   /gene="BAT1"
FT                   /gene_synonym="AtGABP"
FT                   /gene_synonym="bidirectional amino acid transporter 1"
FT                   /gene_synonym="GABA permease"
FT                   /gene_synonym="GABP"
FT                   /locus_tag="AT2G01170"
FT                   /product="bidirectional amino acid transporter 1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV548940.1,INSD:BU635510.1,INSD:AV537128.1,
FT                   INSD:DR245191.1,INSD:BX840352.1,INSD:DR245193.1,
FT                   INSD:BX836224.1,INSD:EL184261.1,INSD:AV800999.1,
FT                   INSD:BX841151.1,INSD:AI998375.1,INSD:DR376219.1,
FT                   INSD:EL331256.1,INSD:DR245192.1,INSD:DR245190.1,
FT                   INSD:T22007.1,INSD:CF652424.1,INSD:DR245194.1,
FT                   INSD:AV786208.1,INSD:AV818263.1,INSD:BP594382.1,
FT                   INSD:EL172813.1,INSD:DR378017.1,INSD:EH878607.1,
FT                   INSD:BP613000.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820764.1,INSD:BX820338.1,INSD:BT020534.1,
FT                   INSD:BX820771.1,INSD:BX820683.1,INSD:AF019637.1,
FT                   INSD:BX819028.1,INSD:BX819189.1,INSD:AY080610.1"
FT   mRNA            complement(join(102211..102711,102788..102917,
FT                   102999..103288,103362..103543,103623..103842,
FT                   103926..103944,104033..104515))
FT                   /gene="BAT1"
FT                   /gene_synonym="bidirectional amino acid transporter 1"
FT                   /gene_synonym="AtGABP"
FT                   /gene_synonym="GABA permease"
FT                   /gene_synonym="GABP"
FT                   /locus_tag="AT2G01170"
FT                   /product="bidirectional amino acid transporter 1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BU635510.1,INSD:AV537128.1,INSD:AV786208.1,
FT                   INSD:BX836224.1,INSD:EL184261.1,INSD:AV818263.1,
FT                   INSD:AV800999.1,INSD:BX839664.1,INSD:BP594382.1,
FT                   INSD:EL172813.1,INSD:DR378017.1,INSD:AI998375.1,
FT                   INSD:DR376219.1,INSD:EH878607.1,INSD:BP613000.1,
FT                   INSD:EL331256.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT020534.1,INSD:BX819189.1"
FT   CDS_pept        complement(join(102364..102711,102788..102917,
FT                   102999..103288,103362..103543,103623..103842,
FT                   103926..103944,104033..104293,104362..104462))
FT                   /codon_start=1
FT                   /gene="BAT1"
FT                   /gene_synonym="bidirectional amino acid transporter 1"
FT                   /gene_synonym="AtGABP"
FT                   /gene_synonym="GABA permease"
FT                   /gene_synonym="GABP"
FT                   /locus_tag="AT2G01170"
FT                   /product="bidirectional amino acid transporter 1"
FT                   /note="bidirectional amino acid transporter 1 (BAT1);
FT                   FUNCTIONS IN: arginine transmembrane transporter activity,
FT                   L-lysine transmembrane transporter activity, L-alanine
FT                   transmembrane transporter activity, L-glutamate
FT                   transmembrane transporter activity; INVOLVED IN: amino acid
FT                   transport, transport, transmembrane transport; LOCATED IN:
FT                   integral to membrane, membrane; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Amino acid permease subfamily
FT                   (InterPro:IPR004756), Amino acid/polyamine transporter I
FT                   (InterPro:IPR002293), Amino acid permease domain
FT                   (InterPro:IPR004841); Has 15465 Blast hits to 15422
FT                   proteins in 1894 species: Archae - 296; Bacteria - 11987;
FT                   Metazoa - 438; Fungi - 2169; Plants - 254; Viruses - 0;
FT                   Other Eukaryotes - 321 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01170"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01170.1"
FT                   /db_xref="GOA:Q9ZU50"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU50"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV548940.1,INSD:BU635510.1,INSD:AV537128.1,
FT                   INSD:DR245191.1,INSD:BX840352.1,INSD:DR245193.1,
FT                   INSD:BX836224.1,INSD:EL184261.1,INSD:AV800999.1,
FT                   INSD:BX841151.1,INSD:AI998375.1,INSD:DR376219.1,
FT                   INSD:EL331256.1,INSD:DR245192.1,INSD:DR245190.1,
FT                   INSD:T22007.1,INSD:CF652424.1,INSD:DR245194.1,
FT                   INSD:AV786208.1,INSD:AV818263.1,INSD:BP594382.1,
FT                   INSD:EL172813.1,INSD:DR378017.1,INSD:EH878607.1,
FT                   INSD:BP613000.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820764.1,INSD:BX820338.1,INSD:BT020534.1,
FT                   INSD:BX820771.1,INSD:BX820683.1,INSD:AF019637.1,
FT                   INSD:BX819028.1,INSD:BX819189.1,INSD:AY080610.1"
FT                   /protein_id="AEC05409.1"
FT                   /translation="MGLGGDQSFVPVMDSGQVRLKELGYKQELKRDLSVFSNFAISFSI
FT                   ISVLTGITTTYNTGLRFGGTVTLVYGWFLAGSFTMCVGLSMAEICSSYPTSGGLYYWSA
FT                   MLAGPRWAPLASWMTGWFNIVGQWAVTASVDFSLAQLIQVIVLLSTGGRNGGGYKGSDF
FT                   VVIGIHGGILFIHALLNSLPISVLSFIGQLAALWNLLGVLVLMILIPLVSTERATTKFV
FT                   FTNFNTDNGLGITSYAYIFVLGLLMSQYTITGYDASAHMTEETVDADKNGPRGIISAIG
FT                   ISILFGWGYILGISYAVTDIPSLLSETNNSGGYAIAEIFYLAFKNRFGSGTGGIVCLGV
FT                   VAVAVFFCGMSSVTSNSRMAYAFSRDGAMPMSPLWHKVNSREVPINAVWLSALISFCMA
FT                   LTSLGSIVAFQAMVSIATIGLYIAYAIPIILRVTLARNTFVPGPFSLGKYGMVVGWVAV
FT                   LWVVTISVLFSLPVAYPITAETLNYTPVAVAGLVAITLSYWLFSARHWFTGPISNILS"
FT   CDS_pept        complement(join(102364..102711,102788..102917,
FT                   102999..103288,103362..103543,103623..103842,
FT                   103926..103944,104033..104157))
FT                   /codon_start=1
FT                   /gene="BAT1"
FT                   /gene_synonym="bidirectional amino acid transporter 1"
FT                   /gene_synonym="AtGABP"
FT                   /gene_synonym="GABA permease"
FT                   /gene_synonym="GABP"
FT                   /locus_tag="AT2G01170"
FT                   /product="bidirectional amino acid transporter 1"
FT                   /note="bidirectional amino acid transporter 1 (BAT1);
FT                   FUNCTIONS IN: arginine transmembrane transporter activity,
FT                   L-lysine transmembrane transporter activity, L-alanine
FT                   transmembrane transporter activity, L-glutamate
FT                   transmembrane transporter activity; INVOLVED IN: transport,
FT                   amino acid transport, transmembrane transport; LOCATED IN:
FT                   integral to membrane, membrane; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Amino acid permease subfamily
FT                   (InterPro:IPR004756), Amino acid/polyamine transporter I
FT                   (InterPro:IPR002293), Amino acid permease domain
FT                   (InterPro:IPR004841); Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01170"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01170.2"
FT                   /db_xref="GOA:Q5FV40"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004756"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FV40"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BU635510.1,INSD:AV537128.1,INSD:AV786208.1,
FT                   INSD:BX836224.1,INSD:EL184261.1,INSD:AV818263.1,
FT                   INSD:AV800999.1,INSD:BX839664.1,INSD:BP594382.1,
FT                   INSD:EL172813.1,INSD:DR378017.1,INSD:AI998375.1,
FT                   INSD:DR376219.1,INSD:EH878607.1,INSD:BP613000.1,
FT                   INSD:EL331256.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT020534.1,INSD:BX819189.1"
FT                   /protein_id="AEC05408.1"
FT                   /translation="MCVGLSMAEICSSYPTSGGLYYWSAMLAGPRWAPLASWMTGWFNI
FT                   VGQWAVTASVDFSLAQLIQVIVLLSTGGRNGGGYKGSDFVVIGIHGGILFIHALLNSLP
FT                   ISVLSFIGQLAALWNLLGVLVLMILIPLVSTERATTKFVFTNFNTDNGLGITSYAYIFV
FT                   LGLLMSQYTITGYDASAHMTEETVDADKNGPRGIISAIGISILFGWGYILGISYAVTDI
FT                   PSLLSETNNSGGYAIAEIFYLAFKNRFGSGTGGIVCLGVVAVAVFFCGMSSVTSNSRMA
FT                   YAFSRDGAMPMSPLWHKVNSREVPINAVWLSALISFCMALTSLGSIVAFQAMVSIATIG
FT                   LYIAYAIPIILRVTLARNTFVPGPFSLGKYGMVVGWVAVLWVVTISVLFSLPVAYPITA
FT                   ETLNYTPVAVAGLVAITLSYWLFSARHWFTGPISNILS"
FT   gene            complement(104884..106291)
FT                   /locus_tag="AT2G01175"
FT   mRNA            complement(join(104884..105795,106072..106291))
FT                   /locus_tag="AT2G01175"
FT                   /product="transmembrane protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU229751.1,INSD:AU238559.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK117710.1,INSD:BT029198.1"
FT   CDS_pept        complement(105572..105760)
FT                   /codon_start=1
FT                   /locus_tag="AT2G01175"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: endomembrane system; Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01175"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01175.1"
FT                   /db_xref="GOA:Q3EC92"
FT                   /db_xref="UniProtKB/TrEMBL:Q3EC92"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU229751.1,INSD:AU238559.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK117710.1,INSD:BT029198.1"
FT                   /protein_id="AEC05410.1"
FT                   /translation="MLWRLRGLFKLYGHLGFLVLWLLVQPLLDQPVITWFIMSLIIHLL
FT                   FGLLVPFFKEGKYLASA"
FT   gene            complement(106621..108829)
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /note="Encodes phosphatidate phosphatase. Up-regulated by
FT                   genotoxic stress (gamma ray or UV-B) and elicitor
FT                   treatments with mastoparan and harpin. Expressed in roots
FT                   and leaves."
FT   mRNA            complement(join(106621..106854,106951..108114,
FT                   108505..108829))
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT   mRNA            complement(join(106621..106854,106951..108114,
FT                   108209..108829))
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT   mRNA            complement(join(106730..106854,106941..108114,
FT                   108505..108810))
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR231468.1,INSD:DR383707.1,INSD:EL266446.1,
FT                   INSD:EL139101.1,INSD:DR231472.1,INSD:EH929058.1,
FT                   INSD:DR231471.1,INSD:AV551263.1,INSD:EG516139.1,
FT                   INSD:EL260246.1,INSD:BP817365.1,INSD:BP854197.1,
FT                   INSD:ES075455.1,INSD:BP836515.1,INSD:BP805159.1,
FT                   INSD:EL260518.1,INSD:EL015660.1,INSD:DR231470.1,
FT                   INSD:BX835431.1,INSD:EG516143.1,INSD:DR372998.1,
FT                   INSD:BP612139.1,INSD:DR231467.1,INSD:ES096956.1,
FT                   INSD:EG513579.1,INSD:EG516090.1,INSD:EL010702.1,
FT                   INSD:AV824728.1,INSD:BP862109.1,INSD:EL155022.1,
FT                   INSD:EL315725.1,INSD:EG516072.1,INSD:DR231469.1,
FT                   INSD:AV538892.1,INSD:AI996330.1,INSD:EG479795.1,
FT                   INSD:BX840561.1,INSD:AV787398.1,INSD:EL252391.1,
FT                   INSD:BP821380.1,INSD:BP643918.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF412050.1,INSD:BX819590.1,INSD:AB004318.1,
FT                   INSD:BX820220.1,INSD:BX820958.1,INSD:BX818851.1,
FT                   INSD:BX818767.1,INSD:AB053949.1,INSD:AY085869.1,
FT                   INSD:BX819071.1,INSD:BX820540.1,INSD:AY143886.1"
FT   mRNA            complement(join(106730..106854,106941..108810))
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT   mRNA            complement(join(106842..106854,106951..108114,
FT                   108209..108231))
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT   mRNA            complement(join(106895..108114,108209..108803))
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT   mRNA            complement(join(106900..108114,108505..108818))
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT   mRNA            complement(106901..108804)
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR383707.1,INSD:BX835431.1,INSD:EL266446.1,
FT                   INSD:EL139101.1,INSD:EH929058.1,INSD:DR372998.1,
FT                   INSD:BP612139.1,INSD:EL260246.1,INSD:ES096956.1,
FT                   INSD:EL010702.1,INSD:DR365674.1,INSD:EL155022.1,
FT                   INSD:EL315725.1,INSD:ES075455.1,INSD:EG516111.1,
FT                   INSD:EG516049.1,INSD:AV538892.1,INSD:AI996330.1,
FT                   INSD:CB257205.1,INSD:EL260518.1,INSD:BX840561.1,
FT                   INSD:AV787398.1,INSD:BX839099.1,INSD:EL252391.1,
FT                   INSD:EL015660.1,INSD:BP643918.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AB053949.1,INSD:BX819931.1"
FT   CDS_pept        complement(join(107182..108114,108505..108555))
FT                   /codon_start=1
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT                   /db_xref="GOA:Q9ZU49"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU49"
FT                   /protein_id="ANM61749.1"
FT                   /translation="MTIGSFFSSLLFWRNSQDQEAQRGRMQEIDLSVHTIKSHGGRVAS
FT                   KHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVLLP
FT                   IIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPDGKE
FT                   LYDALGGVVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGHVAKL
FT                   CLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEEGWGPY
FT                   AYFKAAQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
FT   CDS_pept        complement(join(107182..108114,108505..108555))
FT                   /codon_start=1
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT                   /db_xref="GOA:Q9ZU49"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU49"
FT                   /protein_id="ANM61752.1"
FT                   /translation="MTIGSFFSSLLFWRNSQDQEAQRGRMQEIDLSVHTIKSHGGRVAS
FT                   KHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVLLP
FT                   IIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPDGKE
FT                   LYDALGGVVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGHVAKL
FT                   CLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEEGWGPY
FT                   AYFKAAQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
FT   CDS_pept        complement(join(107182..108114,108505..108555))
FT                   /codon_start=1
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT                   /note="phosphatidic acid phosphatase 1 (PAP1); FUNCTIONS
FT                   IN: phosphatidate phosphatase activity; INVOLVED IN:
FT                   phospholipid metabolic process, response to stress; LOCATED
FT                   IN: plasma membrane, integral to plasma membrane; EXPRESSED
FT                   IN: 15 plant structures; EXPRESSED DURING: 8 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Phosphatidic acid
FT                   phosphatase/chloroperoxidase, N-terminal
FT                   (InterPro:IPR016118), Phosphatidic acid phosphatase type
FT                   2/haloperoxidase (InterPro:IPR000326); BEST Arabidopsis
FT                   thaliana protein match is: lipid phosphate phosphatase 3
FT                   (TAIR:AT3G02600.1); Has 2118 Blast hits to 2110 proteins in
FT                   392 species: Archae - 9; Bacteria - 357; Metazoa - 920;
FT                   Fungi - 399; Plants - 198; Viruses - 3; Other Eukaryotes -
FT                   232 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01180"
FT                   /db_xref="GOA:Q9ZU49"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU49"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR231468.1,INSD:DR383707.1,INSD:EL266446.1,
FT                   INSD:EL139101.1,INSD:DR231472.1,INSD:EH929058.1,
FT                   INSD:DR231471.1,INSD:AV551263.1,INSD:EG516139.1,
FT                   INSD:EL260246.1,INSD:BP817365.1,INSD:BP854197.1,
FT                   INSD:ES075455.1,INSD:BP836515.1,INSD:BP805159.1,
FT                   INSD:EL260518.1,INSD:EL015660.1,INSD:DR231470.1,
FT                   INSD:BX835431.1,INSD:EG516143.1,INSD:DR372998.1,
FT                   INSD:BP612139.1,INSD:DR231467.1,INSD:ES096956.1,
FT                   INSD:EG513579.1,INSD:EG516090.1,INSD:EL010702.1,
FT                   INSD:AV824728.1,INSD:BP862109.1,INSD:EL155022.1,
FT                   INSD:EL315725.1,INSD:EG516072.1,INSD:DR231469.1,
FT                   INSD:AV538892.1,INSD:AI996330.1,INSD:EG479795.1,
FT                   INSD:BX840561.1,INSD:AV787398.1,INSD:EL252391.1,
FT                   INSD:BP821380.1,INSD:BP643918.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF412050.1,INSD:BX819590.1,INSD:AB004318.1,
FT                   INSD:BX820220.1,INSD:BX820958.1,INSD:BX818851.1,
FT                   INSD:BX818767.1,INSD:AB053949.1,INSD:AY085869.1,
FT                   INSD:BX819071.1,INSD:BX820540.1,INSD:AY143886.1"
FT                   /protein_id="AEC05412.1"
FT                   /translation="MTIGSFFSSLLFWRNSQDQEAQRGRMQEIDLSVHTIKSHGGRVAS
FT                   KHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVLLP
FT                   IIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPDGKE
FT                   LYDALGGVVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGHVAKL
FT                   CLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEEGWGPY
FT                   AYFKAAQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
FT   CDS_pept        complement(join(107182..108114,108209..108268))
FT                   /codon_start=1
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT                   /db_xref="GOA:A0A1P8AYQ5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AYQ5"
FT                   /protein_id="ANM61747.1"
FT                   /translation="MNCIPLLLSSKPEMSSPNPQDQEAQRGRMQEIDLSVHTIKSHGGR
FT                   VASKHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAV
FT                   LLPIIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPD
FT                   GKELYDALGGVVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGHV
FT                   AKLCLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEEGW
FT                   GPYAYFKAAQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
FT   CDS_pept        complement(join(107182..108114,108209..108268))
FT                   /codon_start=1
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01180"
FT                   /db_xref="GOA:A0A1P8AYQ5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AYQ5"
FT                   /protein_id="ANM61750.1"
FT                   /translation="MNCIPLLLSSKPEMSSPNPQDQEAQRGRMQEIDLSVHTIKSHGGR
FT                   VASKHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAV
FT                   LLPIIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPD
FT                   GKELYDALGGVVCHGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGHV
FT                   AKLCLVIFPLLAACLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEEGW
FT                   GPYAYFKAAQERGVPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
FT   CDS_pept        complement(join(107182..108114,108209..108229))
FT                   /codon_start=1
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01180"
FT                   /db_xref="GOA:A0A1P8AYJ4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AYJ4"
FT                   /protein_id="ANM61751.1"
FT                   /translation="MSSPNPQDQEAQRGRMQEIDLSVHTIKSHGGRVASKHKHDWIILV
FT                   ILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVLLPIIVFVCFYLK
FT                   RTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPDGKELYDALGGVVC
FT                   HGKAAEVKEGHKSFPSGHTSWSFAGLTFLSLYLSGKIKAFNNEGHVAKLCLVIFPLLAA
FT                   CLVGISRVDDYWHHWQDVFAGALIGTLVAAFCYRQFYPNPYHEEGWGPYAYFKAAQERG
FT                   VPVTSSQNGDALRAMSLQMDSTSLENMESGTSTAPR"
FT   CDS_pept        complement(107182..108090)
FT                   /codon_start=1
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT                   /db_xref="GOA:Q9ZU49"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU49"
FT                   /protein_id="ANM61748.1"
FT                   /translation="MQEIDLSVHTIKSHGGRVASKHKHDWIILVILIAIEIGLNLISPF
FT                   YRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVLLPIIVFVCFYLKRTCVYDLHHSILGLL
FT                   FAVLITGVITDSIKVATGRPRPNFYWRCFPDGKELYDALGGVVCHGKAAEVKEGHKSFP
FT                   SGHTSWSFAGLTFLSLYLSGKIKAFNNEGHVAKLCLVIFPLLAACLVGISRVDDYWHHW
FT                   QDVFAGALIGTLVAAFCYRQFYPNPYHEEGWGPYAYFKAAQERGVPVTSSQNGDALRAM
FT                   SLQMDSTSLENMESGTSTAPR"
FT   CDS_pept        complement(107182..108090)
FT                   /codon_start=1
FT                   /gene="PAP1"
FT                   /gene_synonym="ATLPP1"
FT                   /gene_synonym="ATPAP1"
FT                   /gene_synonym="F10A8.6"
FT                   /gene_synonym="F10A8_6"
FT                   /gene_synonym="LIPID PHOSPHATE PHOSPHATASE 1"
FT                   /gene_synonym="LPP1"
FT                   /gene_synonym="phosphatidic acid phosphatase 1"
FT                   /locus_tag="AT2G01180"
FT                   /product="phosphatidic acid phosphatase 1"
FT                   /note="phosphatidic acid phosphatase 1 (PAP1); FUNCTIONS
FT                   IN: phosphatidate phosphatase activity; INVOLVED IN:
FT                   phospholipid metabolic process, response to stress; LOCATED
FT                   IN: plasma membrane, integral to plasma membrane; EXPRESSED
FT                   IN: 15 plant structures; EXPRESSED DURING: 8 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Phosphatidic acid
FT                   phosphatase/chloroperoxidase, N-terminal
FT                   (InterPro:IPR016118), Phosphatidic acid phosphatase type
FT                   2/haloperoxidase (InterPro:IPR000326); BEST Arabidopsis
FT                   thaliana protein match is: lipid phosphate phosphatase 3
FT                   (TAIR:AT3G02600.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01180.2"
FT                   /db_xref="GOA:Q9ZU49"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU49"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR383707.1,INSD:BX835431.1,INSD:EL266446.1,
FT                   INSD:EL139101.1,INSD:EH929058.1,INSD:DR372998.1,
FT                   INSD:BP612139.1,INSD:EL260246.1,INSD:ES096956.1,
FT                   INSD:EL010702.1,INSD:DR365674.1,INSD:EL155022.1,
FT                   INSD:EL315725.1,INSD:ES075455.1,INSD:EG516111.1,
FT                   INSD:EG516049.1,INSD:AV538892.1,INSD:AI996330.1,
FT                   INSD:CB257205.1,INSD:EL260518.1,INSD:BX840561.1,
FT                   INSD:AV787398.1,INSD:BX839099.1,INSD:EL252391.1,
FT                   INSD:EL015660.1,INSD:BP643918.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AB053949.1,INSD:BX819931.1"
FT                   /protein_id="AEC05411.1"
FT                   /translation="MQEIDLSVHTIKSHGGRVASKHKHDWIILVILIAIEIGLNLISPF
FT                   YRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVLLPIIVFVCFYLKRTCVYDLHHSILGLL
FT                   FAVLITGVITDSIKVATGRPRPNFYWRCFPDGKELYDALGGVVCHGKAAEVKEGHKSFP
FT                   SGHTSWSFAGLTFLSLYLSGKIKAFNNEGHVAKLCLVIFPLLAACLVGISRVDDYWHHW
FT                   QDVFAGALIGTLVAAFCYRQFYPNPYHEEGWGPYAYFKAAQERGVPVTSSQNGDALRAM
FT                   SLQMDSTSLENMESGTSTAPR"
FT   gene            114926..117750
FT                   /gene="PDE331"
FT                   /gene_synonym="F10A8.7"
FT                   /gene_synonym="F10A8_7"
FT                   /gene_synonym="PIGMENT DEFECTIVE 331"
FT                   /locus_tag="AT2G01190"
FT   mRNA            join(114926..116323,116435..117750)
FT                   /gene="PDE331"
FT                   /gene_synonym="F10A8.7"
FT                   /gene_synonym="F10A8_7"
FT                   /gene_synonym="PIGMENT DEFECTIVE 331"
FT                   /locus_tag="AT2G01190"
FT                   /product="Octicosapeptide/Phox/Bem1p family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP789601.1,INSD:EL079991.1,INSD:DR269780.1,
FT                   INSD:BP602956.1,INSD:ES031002.1,INSD:EG483777.1,
FT                   INSD:BX834552.1,INSD:DR269781.1,INSD:BP811662.1,
FT                   INSD:CB257033.1,INSD:BX834902.1,INSD:BE521962.1,
FT                   INSD:BE522230.1,INSD:ES151828.1,INSD:BP602009.1,
FT                   INSD:AV552451.1,INSD:DR269782.1,INSD:AV441115.1,
FT                   INSD:BP611273.1,INSD:BP784454.1,INSD:EL130889.1,
FT                   INSD:EL336226.1,INSD:BP601516.1,INSD:BP784097.1,
FT                   INSD:BP808131.1,INSD:AV829026.1,INSD:ES119245.1,
FT                   INSD:BX834134.1,INSD:DR372811.1,INSD:BP852413.1,
FT                   INSD:EH910385.1,INSD:BP619376.1,INSD:EL200482.1,
FT                   INSD:EL147021.1,INSD:AV548395.1,INSD:AV812606.1,
FT                   INSD:DR269783.1,INSD:BP669990.1,INSD:BP808565.1,
FT                   INSD:AI998569.1,INSD:AV519351.1,INSD:EH899005.1,
FT                   INSD:BX838915.1,INSD:BG459229.1,INSD:BP782577.1,
FT                   INSD:AV803977.1,INSD:EL325097.1,INSD:EH991165.1,
FT                   INSD:BP804296.1,INSD:BP611941.1,INSD:BP783513.1,
FT                   INSD:BP587037.1,INSD:BX837332.1,INSD:AV546420.1,
FT                   INSD:BX837145.1,INSD:BP785628.1,INSD:BP790921.1,
FT                   INSD:EL206790.1,INSD:EL205939.1,INSD:AA041057.1,
FT                   INSD:BP793608.1,INSD:EL193926.1,INSD:BX837663.1,
FT                   INSD:BP781842.1,INSD:EL299341.1,INSD:BP793703.1,
FT                   INSD:BX835343.1,INSD:EG483774.1,INSD:BX836870.1,
FT                   INSD:BX838084.1,INSD:EL045497.1,INSD:BP808851.1,
FT                   INSD:DR269779.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY117302.1,INSD:AY070060.1,INSD:AY085774.1,
FT                   INSD:BX821235.1,INSD:BX821716.1,INSD:BX842018.1"
FT   CDS_pept        join(115023..116323,116435..117296)
FT                   /codon_start=1
FT                   /gene="PDE331"
FT                   /gene_synonym="F10A8.7"
FT                   /gene_synonym="F10A8_7"
FT                   /gene_synonym="PIGMENT DEFECTIVE 331"
FT                   /locus_tag="AT2G01190"
FT                   /product="Octicosapeptide/Phox/Bem1p family protein"
FT                   /note="Octicosapeptide/Phox/Bem1p family protein; LOCATED
FT                   IN: cytosol, nucleus; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Octicosapeptide/Phox/Bem1p (InterPro:IPR000270);
FT                   BEST Arabidopsis thaliana protein match is:
FT                   Octicosapeptide/Phox/Bem1p family protein
FT                   (TAIR:AT3G18230.1); Has 5347 Blast hits to 4615 proteins in
FT                   344 species: Archae - 4; Bacteria - 100; Metazoa - 2308;
FT                   Fungi - 1293; Plants - 931; Viruses - 29; Other Eukaryotes
FT                   - 682 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9ZU48"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZU48"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP789601.1,INSD:EL079991.1,INSD:DR269780.1,
FT                   INSD:BP602956.1,INSD:ES031002.1,INSD:EG483777.1,
FT                   INSD:BX834552.1,INSD:DR269781.1,INSD:BP811662.1,
FT                   INSD:CB257033.1,INSD:BX834902.1,INSD:BE521962.1,
FT                   INSD:BE522230.1,INSD:ES151828.1,INSD:BP602009.1,
FT                   INSD:AV552451.1,INSD:DR269782.1,INSD:AV441115.1,
FT                   INSD:BP611273.1,INSD:BP784454.1,INSD:EL130889.1,
FT                   INSD:EL336226.1,INSD:BP601516.1,INSD:BP784097.1,
FT                   INSD:BP808131.1,INSD:AV829026.1,INSD:ES119245.1,
FT                   INSD:BX834134.1,INSD:DR372811.1,INSD:BP852413.1,
FT                   INSD:EH910385.1,INSD:BP619376.1,INSD:EL200482.1,
FT                   INSD:EL147021.1,INSD:AV548395.1,INSD:AV812606.1,
FT                   INSD:DR269783.1,INSD:BP669990.1,INSD:BP808565.1,
FT                   INSD:AI998569.1,INSD:AV519351.1,INSD:EH899005.1,
FT                   INSD:BX838915.1,INSD:BG459229.1,INSD:BP782577.1,
FT                   INSD:AV803977.1,INSD:EL325097.1,INSD:EH991165.1,
FT                   INSD:BP804296.1,INSD:BP611941.1,INSD:BP783513.1,
FT                   INSD:BP587037.1,INSD:BX837332.1,INSD:AV546420.1,
FT                   INSD:BX837145.1,INSD:BP785628.1,INSD:BP790921.1,
FT                   INSD:EL206790.1,INSD:EL205939.1,INSD:AA041057.1,
FT                   INSD:BP793608.1,INSD:EL193926.1,INSD:BX837663.1,
FT                   INSD:BP781842.1,INSD:EL299341.1,INSD:BP793703.1,
FT                   INSD:BX835343.1,INSD:EG483774.1,INSD:BX836870.1,
FT                   INSD:BX838084.1,INSD:EL045497.1,INSD:BP808851.1,
FT                   INSD:DR269779.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY117302.1,INSD:AY070060.1,INSD:AY085774.1,
FT                   INSD:BX821235.1,INSD:BX821716.1,INSD:BX842018.1"
FT                   /protein_id="AEC05413.1"
FT                   /translation="MEPPPSSLSSTAVASTSISAATAPVPPPLPPHVTSSYPESLDSSP
FT                   RSRTTDGWDDLPAPSGGGGGGGGSAVSSKLRFMCSYGGHILPRPHDKSLCYMGGDTRIV
FT                   VVDRNSSLPSLIARLSNTLLDGRSFTLKYQLPSEDLDSLISVTTDEDLDNMIEEYDRTI
FT                   SASNSTKPSRLRLFLFTSKPEATQSMGQILESSAKSDDWFLNALNSAGLLNRGFSDSDT
FT                   NVNRLLGLDDALALRSNSGDNNNRDGDDGSVKSAKQQQPPPPQQQEQQQGGQDVNCLPD
FT                   SPMLDTSSSFGSTSSSPSLANLPPIRVHVEEPGGVRTLPDQRNLGIEEQFARFNVGNKH
FT                   QLHDDGFAAISSPPPMPVTIALPAAPVTAATVSNEFQARVYSDDERSDHGVQAGYRKPP
FT                   TPRSQPQNLPPQQAHQLKSNSGGGHELPSPNSVSSDSSMSNPMFHQRPSVYQEPIAQIP
FT                   SGSTVVTGMINPSDPSTLLSQHQNQDPAYILHPQFEQQSAQSQPQQQFIHTAAPPQYIH
FT                   HHPSSGLPVPTYIQVYPSQQPQQSFHQHAGRLDQQPYPVYYVTAPVPPRPYSMPVPQSP
FT                   SVSDAAGSIPSNHPNSTMMPPPPNNHMRSVSSGKPEMGQAGVYTTAPGVGGAQMVHQIP
FT                   TNQQQFMGYSQIRHPPQSGSAGNPNYGYEYVDNAHTQIYYTQPMGHAQYQTMTGPPPAM
FT                   VMPDGSAAAKLPAENMTQQIRSSQPL"
FT   gene            117969..120095
FT                   /gene="IAA32"
FT                   /gene_synonym="F10A8.8"
FT                   /gene_synonym="F10A8_8"
FT                   /gene_synonym="indole-3-acetic acid inducible 32"
FT                   /gene_synonym="maternal effect embryo arrest 10"
FT                   /gene_synonym="MEE10"
FT                   /locus_tag="AT2G01200"
FT                   /note="Belongs to auxin inducible gene family."
FT   mRNA            join(117969..118532,118636..118887,118967..119075,
FT                   119153..119332)
FT                   /gene="IAA32"
FT                   /gene_synonym="F10A8.8"
FT                   /gene_synonym="F10A8_8"
FT                   /gene_synonym="indole-3-acetic acid inducible 32"
FT                   /gene_synonym="maternal effect embryo arrest 10"
FT                   /gene_synonym="MEE10"
FT                   /locus_tag="AT2G01200"
FT                   /product="indole-3-acetic acid inducible 32"
FT                   /inference="similar to RNA sequence, EST:INSD:AU229023.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ446449.1,INSD:DQ652944.1,INSD:AY669803.1"
FT   mRNA            join(118018..118174,118369..118532,118636..118887,
FT                   118967..119075,119153..120095)
FT                   /gene="IAA32"
FT                   /gene_synonym="F10A8.8"
FT                   /gene_synonym="F10A8_8"
FT                   /gene_synonym="indole-3-acetic acid inducible 32"
FT                   /gene_synonym="maternal effect embryo arrest 10"
FT                   /gene_synonym="MEE10"
FT                   /locus_tag="AT2G01200"
FT                   /product="indole-3-acetic acid inducible 32"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX821769.1"
FT   CDS_pept        join(118385..118532,118636..118887,118967..119075,
FT                   119153..119219)
FT                   /codon_start=1
FT                   /gene="IAA32"
FT                   /gene_synonym="F10A8.8"
FT                   /gene_synonym="F10A8_8"
FT                   /gene_synonym="indole-3-acetic acid inducible 32"
FT                   /gene_synonym="maternal effect embryo arrest 10"
FT                   /gene_synonym="MEE10"
FT                   /locus_tag="AT2G01200"
FT                   /product="indole-3-acetic acid inducible 32"
FT                   /note="indole-3-acetic acid inducible 32 (IAA32); FUNCTIONS
FT                   IN: sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: response to auxin stimulus, embryo
FT                   development ending in seed dormancy, pollen development;
FT                   LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s:
FT                   Aux/IAA-ARF-dimerisation (InterPro:IPR011525), AUX/IAA
FT                   protein (InterPro:IPR003311); BEST Arabidopsis thaliana
FT                   protein match is: indole-3-acetic acid inducible 34
FT                   (TAIR:AT1G15050.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01200.1"
FT                   /db_xref="GOA:Q8RYC6"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR003311"
FT                   /db_xref="InterPro:IPR033389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RYC6"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX821769.1"
FT                   /protein_id="AEC05414.2"
FT                   /translation="MDPNTPADFFKGSSKFHTYYSQTKKGGGVIDLGLSLRTIQHETYL
FT                   PPARMIGLDGYGELIDWSQPSYNSITQLKSEDTGHQRLAQGYYNNEGESRGKYAYVKVN
FT                   LDGLVVGRKVCLVDQGAYATLALQLNDMFGMQTVSGLRLFQTESEFSLVYRDREGIWRN
FT                   VGDVPWKEFVESVDRMRIARRNDALLPF"
FT   CDS_pept        join(118385..118532,118636..118887,118967..119075,
FT                   119153..119219)
FT                   /codon_start=1
FT                   /gene="IAA32"
FT                   /gene_synonym="F10A8.8"
FT                   /gene_synonym="F10A8_8"
FT                   /gene_synonym="indole-3-acetic acid inducible 32"
FT                   /gene_synonym="maternal effect embryo arrest 10"
FT                   /gene_synonym="MEE10"
FT                   /locus_tag="AT2G01200"
FT                   /product="indole-3-acetic acid inducible 32"
FT                   /note="indole-3-acetic acid inducible 32 (IAA32); FUNCTIONS
FT                   IN: sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: response to auxin stimulus, embryo
FT                   development ending in seed dormancy, pollen development;
FT                   LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s:
FT                   Aux/IAA-ARF-dimerisation (InterPro:IPR011525), AUX/IAA
FT                   protein (InterPro:IPR003311); BEST Arabidopsis thaliana
FT                   protein match is: indole-3-acetic acid inducible 34
FT                   (TAIR:AT1G15050.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01200"
FT                   /db_xref="GOA:Q8RYC6"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR003311"
FT                   /db_xref="InterPro:IPR033389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RYC6"
FT                   /inference="similar to RNA sequence, EST:INSD:AU229023.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ446449.1,INSD:DQ652944.1,INSD:AY669803.1"
FT                   /protein_id="AEC05415.1"
FT                   /translation="MDPNTPADFFKGSSKFHTYYSQTKKGGGVIDLGLSLRTIQHETYL
FT                   PPARMIGLDGYGELIDWSQPSYNSITQLKSEDTGHQRLAQGYYNNEGESRGKYAYVKVN
FT                   LDGLVVGRKVCLVDQGAYATLALQLNDMFGMQTVSGLRLFQTESEFSLVYRDREGIWRN
FT                   VGDVPWKEFVESVDRMRIARRNDALLPF"
FT   gene            complement(119270..121980)
FT                   /gene_synonym="F10A8.9"
FT                   /gene_synonym="F10A8_9"
FT                   /locus_tag="AT2G01210"
FT   mRNA            complement(join(119270..120188,120264..121980))
FT                   /gene_synonym="F10A8.9"
FT                   /gene_synonym="F10A8_9"
FT                   /locus_tag="AT2G01210"
FT                   /product="Leucine-rich repeat protein kinase family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL121332.1,INSD:BX841010.1,INSD:ES132488.1,
FT                   INSD:DR230258.1,INSD:EL303351.1,INSD:CK118177.1,
FT                   INSD:EL127750.1,INSD:BX836646.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX820284.1"
FT   CDS_pept        complement(join(119509..120188,120264..121734))
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.9"
FT                   /gene_synonym="F10A8_9"
FT                   /locus_tag="AT2G01210"
FT                   /product="Leucine-rich repeat protein kinase family
FT                   protein"
FT                   /note="Leucine-rich repeat protein kinase family protein;
FT                   FUNCTIONS IN: protein serine/threonine kinase activity,
FT                   kinase activity, ATP binding; INVOLVED IN: transmembrane
FT                   receptor protein tyrosine kinase signaling pathway, protein
FT                   amino acid phosphorylation; LOCATED IN: chloroplast stroma,
FT                   chloroplast, plasma membrane, plant-type cell wall;
FT                   EXPRESSED IN: 11 plant structures; EXPRESSED DURING: 6
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Protein kinase,
FT                   catalytic domain (InterPro:IPR000719), Leucine-rich
FT                   repeat-containing N-terminal domain, type 2
FT                   (InterPro:IPR013210), Leucine-rich repeat
FT                   (InterPro:IPR001611), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271); BEST Arabidopsis thaliana
FT                   protein match is: Leucine-rich repeat protein kinase family
FT                   protein (TAIR:AT1G25320.1); Has 133812 Blast hits to 98087
FT                   proteins in 4104 species: Archae - 103; Bacteria - 11207;
FT                   Metazoa - 34549; Fungi - 6957; Plants - 66297; Viruses -
FT                   188; Other Eukaryotes - 14511 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01210.1"
FT                   /db_xref="GOA:Q9ZU46"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU46"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL121332.1,INSD:BX841010.1,INSD:ES132488.1,
FT                   INSD:DR230258.1,INSD:EL303351.1,INSD:CK118177.1,
FT                   INSD:EL127750.1,INSD:BX836646.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX820284.1"
FT                   /protein_id="AEC05416.1"
FT                   /translation="MLASLIIFVALLCNVTVISGLNDEGFALLTFKQSVHDDPTGSLNN
FT                   WNSSDENACSWNGVTCKELRVVSLSIPRKNLYGSLPSSLGFLSSLRHLNLRSNRFYGSL
FT                   PIQLFHLQGLQSLVLYGNSFDGSLSEEIGKLKLLQTLDLSQNLFNGSLPLSILQCNRLK
FT                   TLDVSRNNLSGPLPDGFGSAFVSLEKLDLAFNQFNGSIPSDIGNLSNLQGTADFSHNHF
FT                   TGSIPPALGDLPEKVYIDLTFNNLSGPIPQTGALMNRGPTAFIGNTGLCGPPLKDLCQG
FT                   YQLGLNASYPFIPSNNPPEDSDSTNSETKQKSSGLSKSAVIAIVLCDVFGICLVGLLFT
FT                   YCYSKFCACNRENQFGVEKESKKRASECLCFRKDESETPSENVEHCDIVPLDAQVAFNL
FT                   EELLKASAFVLGKSGIGIVYKVVLENGLTLAVRRLGEGGSQRFKEFQTEVEAIGKLKHP
FT                   NIASLRAYYWSVDEKLLIYDYVSNGNLATALHGKPGMMTIAPLTWSERLRIMKGIATGL
FT                   VYLHEFSPKKYVHGDLKPSNILIGQDMEPKISDFGLARLANIAGGSSPTIQSNRIIQTD
FT                   QQPQERQQHHHKSVSSEFTAHSSSGSYYQAPETLKMVKPSQKWDVYSYGIILLELIAGR
FT                   SPAVEVGTSEMDLVRWVQVCIEEKKPLCDVLDPCLAPEAETEDEIVAVLKIAISCVNSS
FT                   PEKRPTMRHVSDTLDRLPVAGD"
FT   gene            complement(122882..123086)
FT                   /locus_tag="AT2G03905"
FT   ncRNA           complement(122882..123086)
FT                   /locus_tag="AT2G03905"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            123023..126611
FT                   /gene_synonym="AT2G01230"
FT                   /gene_synonym="F10A8.10"
FT                   /gene_synonym="F10A8_10"
FT                   /locus_tag="AT2G01220"
FT   mRNA            join(123023..123390,123483..123581,123671..123755,
FT                   123854..123923,124065..124125,124216..124269,
FT                   124551..124707,124811..124907,125274..125383,
FT                   125592..125698,125876..125986,126088..126611)
FT                   /gene_synonym="AT2G01230"
FT                   /gene_synonym="F10A8.10"
FT                   /gene_synonym="F10A8_10"
FT                   /locus_tag="AT2G01220"
FT                   /product="Nucleotidylyl transferase superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL181414.1,INSD:ES082729.1,INSD:DR379508.1,
FT                   INSD:AU239296.1,INSD:CF651449.1,INSD:EH819394.1,
FT                   INSD:AV812368.1,INSD:ES014703.1,INSD:EL122216.1,
FT                   INSD:EL262829.1,INSD:DR355395.1,INSD:ES175040.1,
FT                   INSD:EG420442.1,INSD:DR355397.1,INSD:EH911227.1,
FT                   INSD:EL078843.1,INSD:ES210955.1,INSD:AV819017.1,
FT                   INSD:CB252482.1,INSD:BP832411.1,INSD:DR289356.1,
FT                   INSD:ES211159.1,INSD:ES178783.1,INSD:DR289357.1,
FT                   INSD:ES041634.1,INSD:AU230588.1,INSD:BE037752.1,
FT                   INSD:AV832063.1,INSD:ES036215.1,INSD:EL036278.1,
FT                   INSD:DR380195.1,INSD:EG420453.1,INSD:EL011887.1,
FT                   INSD:BP647225.1,INSD:CF651450.1,INSD:ES210931.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK118433.1,INSD:AK176608.1,INSD:BX842433.1,
FT                   INSD:AY120748.1,INSD:AK176125.1"
FT   mRNA            join(123276..123390,123483..123581,123671..123755,
FT                   123854..123923,124065..124125,124216..124269,
FT                   124551..124707,124814..124907,125274..125383,
FT                   125592..125698,125876..125986,126088..126407)
FT                   /gene_synonym="AT2G01230"
FT                   /gene_synonym="F10A8.10"
FT                   /gene_synonym="F10A8_10"
FT                   /locus_tag="AT2G01220"
FT                   /product="Nucleotidylyl transferase superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES082729.1,INSD:EL181414.1,INSD:DR379508.1,
FT                   INSD:AU239296.1,INSD:EH819394.1,INSD:AV812368.1,
FT                   INSD:ES014703.1,INSD:EL262829.1,INSD:EL122216.1,
FT                   INSD:DR355395.1,INSD:ES175040.1,INSD:EG420442.1,
FT                   INSD:DR355397.1,INSD:EL078843.1,INSD:ES210955.1,
FT                   INSD:AV819017.1,INSD:BP832411.1,INSD:DR289356.1,
FT                   INSD:ES211159.1,INSD:ES178783.1,INSD:ES041634.1,
FT                   INSD:AU230588.1,INSD:BE037752.1,INSD:ES036215.1,
FT                   INSD:AV832063.1,INSD:EL036278.1,INSD:DR380195.1,
FT                   INSD:EG420453.1,INSD:EL011887.1,INSD:BP647225.1,
FT                   INSD:ES210931.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY084877.1"
FT   CDS_pept        join(123301..123390,123483..123581,123671..123755,
FT                   123854..123923,124065..124125,124216..124269,
FT                   124551..124707,124811..124907,125274..125383,
FT                   125592..125698,125876..125986,126088..126213)
FT                   /codon_start=1
FT                   /gene_synonym="AT2G01230"
FT                   /gene_synonym="F10A8.10"
FT                   /gene_synonym="F10A8_10"
FT                   /locus_tag="AT2G01220"
FT                   /product="Nucleotidylyl transferase superfamily protein"
FT                   /note="Nucleotidylyl transferase superfamily protein;
FT                   FUNCTIONS IN: nucleotidyltransferase activity; INVOLVED IN:
FT                   biosynthetic process; LOCATED IN: chloroplast envelope;
FT                   EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Rossmann-like
FT                   alpha/beta/alpha sandwich fold (InterPro:IPR014729),
FT                   Cytidylyltransferase (InterPro:IPR004820); BEST Arabidopsis
FT                   thaliana protein match is: Nucleotidylyl transferase
FT                   superfamily protein (TAIR:AT3G27610.1); Has 429 Blast hits
FT                   to 422 proteins in 57 species: Archae - 6; Bacteria - 30;
FT                   Metazoa - 0; Fungi - 7; Plants - 76; Viruses - 0; Other
FT                   Eukaryotes - 310 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01220"
FT                   /db_xref="GOA:Q8L845"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8L845"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL181414.1,INSD:ES082729.1,INSD:DR379508.1,
FT                   INSD:AU239296.1,INSD:CF651449.1,INSD:EH819394.1,
FT                   INSD:AV812368.1,INSD:ES014703.1,INSD:EL122216.1,
FT                   INSD:EL262829.1,INSD:DR355395.1,INSD:ES175040.1,
FT                   INSD:EG420442.1,INSD:DR355397.1,INSD:EH911227.1,
FT                   INSD:EL078843.1,INSD:ES210955.1,INSD:AV819017.1,
FT                   INSD:CB252482.1,INSD:BP832411.1,INSD:DR289356.1,
FT                   INSD:ES211159.1,INSD:ES178783.1,INSD:DR289357.1,
FT                   INSD:ES041634.1,INSD:AU230588.1,INSD:BE037752.1,
FT                   INSD:AV832063.1,INSD:ES036215.1,INSD:EL036278.1,
FT                   INSD:DR380195.1,INSD:EG420453.1,INSD:EL011887.1,
FT                   INSD:BP647225.1,INSD:CF651450.1,INSD:ES210931.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK118433.1,INSD:AK176608.1,INSD:BX842433.1,
FT                   INSD:AY120748.1,INSD:AK176125.1"
FT                   /protein_id="AEC05417.1"
FT                   /translation="MGDAAIRTVVEAIHSSPTQAVVYLCGGASLALGWLMSVPGASNTL
FT                   LESVVPYSRVSMVQLLGRVPSQHCSQALAKEMALLAYNRALKLSKPGYPVLGVGFTGSL
FT                   VTSRPKRGDHRFFLSMRASDRILESSVTLTKNLRSREEEDKVSSCALIQAMAKACQVSG
FT                   TLDSGLTESEVPYESETHFTEEQELEQLINGHLCCKIYPFSGEAHGSDEDRKIILPGSF
FT                   NPLHEGHLKLLEVAMSVCGGGYPCFEISAINADKPPLTIAQIKDRVKQFEVVGKTIIVS
FT                   NQPYFYKKAELFPGSSFVIGADTAARLVNPKYYEGSIKRMLEILGDCKRTGCTFLVGGR
FT                   NVDGVFKVLEDVDIPEEIIDMFISIPADIFRMDISSTEIRKKQGGGTN"
FT   CDS_pept        join(123301..123390,123483..123581,123671..123755,
FT                   123854..123923,124065..124125,124216..124269,
FT                   124551..124707,124814..124907,125274..125383,
FT                   125592..125698,125876..125986,126088..126213)
FT                   /codon_start=1
FT                   /gene_synonym="AT2G01230"
FT                   /gene_synonym="F10A8.10"
FT                   /gene_synonym="F10A8_10"
FT                   /locus_tag="AT2G01220"
FT                   /product="Nucleotidylyl transferase superfamily protein"
FT                   /note="Nucleotidylyl transferase superfamily protein;
FT                   FUNCTIONS IN: nucleotidyltransferase activity; INVOLVED IN:
FT                   biosynthetic process; LOCATED IN: chloroplast envelope;
FT                   EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Rossmann-like
FT                   alpha/beta/alpha sandwich fold (InterPro:IPR014729),
FT                   Cytidylyltransferase (InterPro:IPR004820); BEST Arabidopsis
FT                   thaliana protein match is: Nucleotidylyl transferase
FT                   superfamily protein (TAIR:AT3G27610.2); Has 432 Blast hits
FT                   to 425 proteins in 57 species: Archae - 6; Bacteria - 30;
FT                   Metazoa - 0; Fungi - 7; Plants - 78; Viruses - 0; Other
FT                   Eukaryotes - 311 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01220"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01220.1"
FT                   /db_xref="GOA:F4IM97"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:F4IM97"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES082729.1,INSD:EL181414.1,INSD:DR379508.1,
FT                   INSD:AU239296.1,INSD:EH819394.1,INSD:AV812368.1,
FT                   INSD:ES014703.1,INSD:EL262829.1,INSD:EL122216.1,
FT                   INSD:DR355395.1,INSD:ES175040.1,INSD:EG420442.1,
FT                   INSD:DR355397.1,INSD:EL078843.1,INSD:ES210955.1,
FT                   INSD:AV819017.1,INSD:BP832411.1,INSD:DR289356.1,
FT                   INSD:ES211159.1,INSD:ES178783.1,INSD:ES041634.1,
FT                   INSD:AU230588.1,INSD:BE037752.1,INSD:ES036215.1,
FT                   INSD:AV832063.1,INSD:EL036278.1,INSD:DR380195.1,
FT                   INSD:EG420453.1,INSD:EL011887.1,INSD:BP647225.1,
FT                   INSD:ES210931.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY084877.1"
FT                   /protein_id="AEC05418.1"
FT                   /translation="MGDAAIRTVVEAIHSSPTQAVVYLCGGASLALGWLMSVPGASNTL
FT                   LESVVPYSRVSMVQLLGRVPSQHCSQALAKEMALLAYNRALKLSKPGYPVLGVGFTGSL
FT                   VTSRPKRGDHRFFLSMRASDRILESSVTLTKNLRSREEEDKVSSCALIQAMAKACQVSG
FT                   TLDSGLTESEVPYESETHFTEEQELEQLINGHLCCKIYPFSGAHGSDEDRKIILPGSFN
FT                   PLHEGHLKLLEVAMSVCGGGYPCFEISAINADKPPLTIAQIKDRVKQFEVVGKTIIVSN
FT                   QPYFYKKAELFPGSSFVIGADTAARLVNPKYYEGSIKRMLEILGDCKRTGCTFLVGGRN
FT                   VDGVFKVLEDVDIPEEIIDMFISIPADIFRMDISSTEIRKKQGGGTN"
FT   gene            complement(128291..129132)
FT                   /gene_synonym="F10A8.12"
FT                   /gene_synonym="F10A8_12"
FT                   /locus_tag="AT2G01240"
FT   mRNA            complement(join(128291..128594,128706..128775,
FT                   128863..128992,129083..129132))
FT                   /gene_synonym="F10A8.12"
FT                   /gene_synonym="F10A8_12"
FT                   /locus_tag="AT2G01240"
FT                   /product="reticulon-like protein B15"
FT                   /inference="similar to RNA sequence, EST:INSD:AY164889.1"
FT   CDS_pept        complement(join(128440..128594,128706..128775,
FT                   128863..128992,129083..129132))
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.12"
FT                   /gene_synonym="F10A8_12"
FT                   /locus_tag="AT2G01240"
FT                   /product="reticulon-like protein B15"
FT                   /note="Reticulon family protein; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: endoplasmic
FT                   reticulum; CONTAINS InterPro DOMAIN/s: Reticulon
FT                   (InterPro:IPR003388); BEST Arabidopsis thaliana protein
FT                   match is: VIRB2-interacting protein 2 (TAIR:AT4G11220.1);
FT                   Has 375 Blast hits to 375 proteins in 24 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 12; Fungi - 5; Plants - 358;
FT                   Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
FT                   /inference="similar to RNA sequence, EST:INSD:AY164889.1"
FT                   /protein_id="AEC05419.2"
FT                   /translation="MLILFLWAKFGEVFFTRRPPTPEELNQPDSPLKALFSMMEGHLLM
FT                   LYEIAYGKDNKTFLKTILYVAIIYNIGSYISLLTILYICLVCSMTIPVVYMQFQELIDS
FT                   FMGKVSEEKNNLLEVFKQVVSKIPRAPKVE"
FT   gene            complement(132578..134455)
FT                   /gene_synonym="F10A8.13"
FT                   /gene_synonym="F10A8_13"
FT                   /locus_tag="AT2G01250"
FT   mRNA            complement(join(132578..133158,133258..133360,
FT                   133455..133534,133773..133830,133923..134020,
FT                   134091..134273,134359..134455))
FT                   /gene_synonym="F10A8.13"
FT                   /gene_synonym="F10A8_13"
FT                   /locus_tag="AT2G01250"
FT                   /product="Ribosomal protein L30/L7 family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR294037.1,INSD:EL011713.1,INSD:EL977623.1,
FT                   INSD:ES026714.1,INSD:EH838832.1,INSD:ES011960.1,
FT                   INSD:EL053809.1,INSD:EL998579.1,INSD:DR294022.1,
FT                   INSD:ES094790.1,INSD:BP856213.1,INSD:ES060724.1,
FT                   INSD:DR294063.1,INSD:BP648015.1,INSD:ES070866.1,
FT                   INSD:BP857115.1,INSD:EL186761.1,INSD:BP861753.1,
FT                   INSD:EL263860.1,INSD:EL152969.1,INSD:EL030479.1,
FT                   INSD:EL056385.1,INSD:AA721945.1,INSD:ES088203.1,
FT                   INSD:DR294048.1,INSD:EH815901.1,INSD:DR294046.1,
FT                   INSD:ES134415.1,INSD:EL303214.1,INSD:EH800433.1,
FT                   INSD:EL117119.1,INSD:EL256430.1,INSD:EH810910.1,
FT                   INSD:EL312959.1,INSD:DR294038.1,INSD:ES052352.1,
FT                   INSD:ES166482.1,INSD:ES091302.1,INSD:EL006631.1,
FT                   INSD:BP852073.1,INSD:ES180581.1,INSD:EH810985.1,
FT                   INSD:ES117109.1,INSD:ES200285.1,INSD:EL081272.1,
FT                   INSD:ES198105.1,INSD:DR294014.1,INSD:ES050026.1,
FT                   INSD:EL082898.1,INSD:ES105732.1,INSD:DR294062.1,
FT                   INSD:EL206550.1,INSD:ES058474.1,INSD:ES196094.1,
FT                   INSD:BP857095.1,INSD:EL186085.1,INSD:ES050871.1,
FT                   INSD:EL220531.1,INSD:EL988985.1,INSD:ES058306.1,
FT                   INSD:EH914587.1,INSD:ES134928.1,INSD:EH912604.1,
FT                   INSD:EL981591.1,INSD:ES025955.1,INSD:EL970618.1,
FT                   INSD:ES208951.1,INSD:EH930637.1,INSD:ES213030.1,
FT                   INSD:EL022887.1,INSD:EL260991.1,INSD:BP837411.1,
FT                   INSD:EH961497.1,INSD:BP798646.1,INSD:AV554308.1,
FT                   INSD:EL019133.1,INSD:ES206290.1,INSD:ES034298.1,
FT                   INSD:DR294069.1,INSD:EH887225.1,INSD:EL319090.1,
FT                   INSD:ES070521.1,INSD:ES040969.1,INSD:ES053058.1,
FT                   INSD:EL092181.1,INSD:EL147685.1,INSD:DR294047.1,
FT                   INSD:ES014256.1,INSD:ES095643.1,INSD:BP866065.1,
FT                   INSD:ES025070.1,INSD:EL133428.1,INSD:EL066831.1,
FT                   INSD:ES200327.1,INSD:DR294053.1,INSD:DR294065.1,
FT                   INSD:EH960497.1,INSD:EH991345.1,INSD:ES080601.1,
FT                   INSD:EL295779.1,INSD:DR294043.1,INSD:DR294036.1,
FT                   INSD:BP857749.1,INSD:EL024884.1,INSD:ES143570.1,
FT                   INSD:DR294039.1,INSD:EH879447.1,INSD:BP826121.1,
FT                   INSD:ES165736.1,INSD:BP816624.1,INSD:EL210222.1,
FT                   INSD:ES008494.1,INSD:DR294070.1,INSD:BP867728.1,
FT                   INSD:EL264067.1,INSD:EL968786.1,INSD:DR294058.1,
FT                   INSD:ES080063.1,INSD:EL299349.1,INSD:EH847004.1,
FT                   INSD:EL222273.1,INSD:EL967501.1,INSD:ES135813.1,
FT                   INSD:EL321718.1,INSD:EL233618.1,INSD:EH798337.1,
FT                   INSD:ES080861.1,INSD:EL038365.1,INSD:EL053881.1,
FT                   INSD:ES177466.1,INSD:DR294060.1,INSD:EL318633.1,
FT                   INSD:EL207315.1,INSD:ES208418.1,INSD:DR294015.1,
FT                   INSD:EH929939.1,INSD:ES180788.1,INSD:EH836441.1,
FT                   INSD:ES177756.1,INSD:EH797171.1,INSD:AV808973.1,
FT                   INSD:EL970747.1,INSD:ES081968.1,INSD:ES139374.1,
FT                   INSD:EG528297.1,INSD:EH894329.1,INSD:EH897148.1,
FT                   INSD:ES148128.1,INSD:DR294040.1,INSD:DR294049.1,
FT                   INSD:DR294055.1,INSD:ES154215.1,INSD:ES115044.1,
FT                   INSD:ES098756.1,INSD:ES122063.1,INSD:BP652097.1,
FT                   INSD:EL333394.1,INSD:EL176088.1,INSD:EL141947.1,
FT                   INSD:EL057474.1,INSD:EH889288.1,INSD:ES065545.1,
FT                   INSD:ES148270.1,INSD:BP853572.1,INSD:BP563400.1,
FT                   INSD:ES116392.1,INSD:DR294044.1,INSD:DR294024.1,
FT                   INSD:ES028491.1,INSD:EL235644.1,INSD:ES186244.1,
FT                   INSD:EH949975.1,INSD:DR294017.1,INSD:ES157117.1,
FT                   INSD:BP832063.1,INSD:DR294056.1,INSD:ES143628.1,
FT                   INSD:EL144257.1,INSD:DR294020.1,INSD:DR294071.1,
FT                   INSD:EH952170.1,INSD:EL985424.1,INSD:DR294032.1,
FT                   INSD:EL246181.1,INSD:EL240998.1,INSD:EH932082.1,
FT                   INSD:ES021271.1,INSD:EL166173.1,INSD:EH808115.1,
FT                   INSD:DR294066.1,INSD:DR294050.1,INSD:EH800860.1,
FT                   INSD:ES175042.1,INSD:EH956977.1,INSD:ES042054.1,
FT                   INSD:ES142452.1,INSD:DR294026.1,INSD:DR294067.1,
FT                   INSD:EH989549.1,INSD:ES131259.1,INSD:DR294031.1,
FT                   INSD:DR294021.1,INSD:BP866605.1,INSD:ES152992.1,
FT                   INSD:ES156398.1,INSD:EH890466.1,INSD:ES026094.1,
FT                   INSD:EH947872.1,INSD:ES152046.1,INSD:ES207408.1,
FT                   INSD:DR294034.1,INSD:BP847361.1,INSD:ES166765.1,
FT                   INSD:ES149331.1,INSD:BP815237.2,INSD:ES009072.1,
FT                   INSD:EH822698.1,INSD:ES105123.1,INSD:EH993369.1,
FT                   INSD:ES015319.1,INSD:EL155788.1,INSD:ES059353.1,
FT                   INSD:EL305550.1,INSD:BP851384.1,INSD:EH820802.1,
FT                   INSD:EL227904.1,INSD:EL334369.1,INSD:BP839811.1,
FT                   INSD:ES022790.1,INSD:EL188906.1,INSD:EL978120.1,
FT                   INSD:EG528298.1,INSD:ES093586.1,INSD:EL151921.1,
FT                   INSD:ES082960.1,INSD:EL080049.1,INSD:EH865375.1,
FT                   INSD:ES123161.1,INSD:BP800439.1,INSD:DR294016.1,
FT                   INSD:EH959963.1,INSD:EH983054.1,INSD:AV539599.1,
FT                   INSD:ES136569.1,INSD:EL217320.1,INSD:EL003883.1,
FT                   INSD:ES164934.1,INSD:ES173126.1,INSD:DR294045.1,
FT                   INSD:ES123671.1,INSD:EH950609.1,INSD:DR294027.1,
FT                   INSD:EL025259.1,INSD:ES015113.1,INSD:EL151918.1,
FT                   INSD:EL073947.1,INSD:Z33779.1,INSD:ES111041.1,
FT                   INSD:ES105370.1,INSD:DR294029.1,INSD:DR294025.1,
FT                   INSD:ES035853.1,INSD:DR294018.1,INSD:BP803963.1,
FT                   INSD:ES170664.1,INSD:EL124576.1,INSD:EH990450.1,
FT                   INSD:ES123737.1,INSD:ES216445.1,INSD:ES093626.1,
FT                   INSD:ES181678.1,INSD:EH938832.1,INSD:EL973263.1,
FT                   INSD:BP843164.1,INSD:DR294051.1,INSD:ES130214.1,
FT                   INSD:DR294052.1,INSD:DR294041.1,INSD:EL180253.1,
FT                   INSD:BP832532.1,INSD:EL145390.1,INSD:EL288802.1,
FT                   INSD:BP863531.1,INSD:ES151774.1,INSD:ES084181.1"
FT   mRNA            complement(join(132697..133079,133258..133360,
FT                   133455..133534,133773..133830,133923..134020,
FT                   134091..134273,134359..134455))
FT                   /gene_synonym="F10A8.13"
FT                   /gene_synonym="F10A8_13"
FT                   /locus_tag="AT2G01250"
FT                   /product="Ribosomal protein L30/L7 family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR294037.1,INSD:EL289142.1,INSD:EH838832.1,
FT                   INSD:ES011960.1,INSD:ES094790.1,INSD:BP856213.1,
FT                   INSD:ES119717.1,INSD:ES060724.1,INSD:EL260357.1,
FT                   INSD:ES053914.1,INSD:ES070866.1,INSD:ES097877.1,
FT                   INSD:BP857115.1,INSD:EL186761.1,INSD:BP593542.1,
FT                   INSD:EL263860.1,INSD:EL030479.1,INSD:EL992584.1,
FT                   INSD:ES088203.1,INSD:AA721945.1,INSD:DR294048.1,
FT                   INSD:DR294046.1,INSD:EL303214.1,INSD:ES181879.1,
FT                   INSD:EL117119.1,INSD:EL256430.1,INSD:EH834840.1,
FT                   INSD:BP624637.1,INSD:BP633063.1,INSD:ES166482.1,
FT                   INSD:EL034917.1,INSD:ES091302.1,INSD:BP570454.1,
FT                   INSD:BP617868.1,INSD:EH876881.1,INSD:EL006631.1,
FT                   INSD:EH810985.1,INSD:ES180581.1,INSD:ES117109.1,
FT                   INSD:ES200285.1,INSD:AV832263.1,INSD:ES105732.1,
FT                   INSD:EL206550.1,INSD:EL186085.1,INSD:BP857095.1,
FT                   INSD:EL232261.1,INSD:EL169472.1,INSD:ES050871.1,
FT                   INSD:ES192284.1,INSD:EL981591.1,INSD:EL970618.1,
FT                   INSD:ES208951.1,INSD:EH930637.1,INSD:ES213030.1,
FT                   INSD:EL260991.1,INSD:ES168944.1,INSD:EH961497.1,
FT                   INSD:DR294057.1,INSD:BP579598.1,INSD:AV554308.1,
FT                   INSD:EL019133.1,INSD:ES034298.1,INSD:DR294069.1,
FT                   INSD:EL319090.1,INSD:EH887225.1,INSD:ES070521.1,
FT                   INSD:ES040969.1,INSD:ES053058.1,INSD:EL092181.1,
FT                   INSD:EL190892.1,INSD:EL147685.1,INSD:DR294047.1,
FT                   INSD:ES095643.1,INSD:ES020741.1,INSD:EL066831.1,
FT                   INSD:EL133428.1,INSD:EL021841.1,INSD:EH960497.1,
FT                   INSD:ES080601.1,INSD:DR294036.1,INSD:ES143570.1,
FT                   INSD:DR294039.1,INSD:BP664406.1,INSD:BP826121.1,
FT                   INSD:AV567128.1,INSD:DR294054.1,INSD:EL203865.1,
FT                   INSD:EL968786.1,INSD:BP867728.1,INSD:DR294070.1,
FT                   INSD:DR294058.1,INSD:ES080063.1,INSD:EL299349.1,
FT                   INSD:EH847004.1,INSD:EL222273.1,INSD:EL967501.1,
FT                   INSD:EL233618.1,INSD:EH798337.1,INSD:ES080861.1,
FT                   INSD:ES177466.1,INSD:BP660992.1,INSD:EL318633.1,
FT                   INSD:EL041169.1,INSD:BP580614.1,INSD:EL207315.1,
FT                   INSD:BP560500.2,INSD:BU635159.1,INSD:ES208418.1,
FT                   INSD:DR255285.1,INSD:DR294015.1,INSD:BP660459.1,
FT                   INSD:EH929939.1,INSD:ES180788.1,INSD:ES177756.1,
FT                   INSD:EH836441.1,INSD:EH797171.1,INSD:BP645966.1,
FT                   INSD:EL970747.1,INSD:EH894329.1,INSD:EH897148.1,
FT                   INSD:DR379278.1,INSD:ES107049.1,INSD:ES115044.1,
FT                   INSD:BP641595.1,INSD:EL057474.1,INSD:EL231114.1,
FT                   INSD:ES148270.1,INSD:EH891761.1,INSD:BP563400.1,
FT                   INSD:ES028491.1,INSD:BP623646.1,INSD:ES008857.1,
FT                   INSD:EH949975.1,INSD:DR294017.1,INSD:BP832063.1,
FT                   INSD:EL144257.1,INSD:ES192948.1,INSD:DR294020.1,
FT                   INSD:EL152312.1,INSD:EL985424.1,INSD:EH932082.1,
FT                   INSD:ES021271.1,INSD:EL166173.1,INSD:DR294066.1,
FT                   INSD:EH800860.1,INSD:DR294050.1,INSD:EH949171.1,
FT                   INSD:EH956977.1,INSD:ES175042.1,INSD:ES207300.1,
FT                   INSD:ES042054.1,INSD:ES091300.1,INSD:ES142452.1,
FT                   INSD:BP626851.1,INSD:BP787819.1,INSD:DR294026.1,
FT                   INSD:DR294023.1,INSD:DR294021.1,INSD:BP866605.1,
FT                   INSD:ES152992.1,INSD:EH890466.1,INSD:EH947872.1,
FT                   INSD:ES152046.1,INSD:BP584212.1,INSD:EL116898.1,
FT                   INSD:ES166765.1,INSD:ES149331.1,INSD:BP815237.2,
FT                   INSD:EH993369.1,INSD:ES015319.1,INSD:EL155788.1,
FT                   INSD:EH801739.1,INSD:EL305550.1,INSD:EL234268.1,
FT                   INSD:ES143162.1,INSD:DR372085.1,INSD:BP851384.1,
FT                   INSD:EL227904.1,INSD:BP839811.1,INSD:ES022790.1,
FT                   INSD:EH861777.1,INSD:EH869697.1,INSD:BP571087.1,
FT                   INSD:ES082960.1,INSD:EH865375.1,INSD:EL080049.1,
FT                   INSD:ES123161.1,INSD:DR294016.1,INSD:EH959963.1,
FT                   INSD:EL217320.1,INSD:EL003883.1,INSD:BP571214.1,
FT                   INSD:EH947739.1,INSD:ES173126.1,INSD:EH950609.1,
FT                   INSD:ES123671.1,INSD:EL025259.1,INSD:ES015113.1,
FT                   INSD:EH905879.1,INSD:EL073947.1,INSD:ES111041.1,
FT                   INSD:EL328877.1,INSD:AV784664.1,INSD:DR294029.1,
FT                   INSD:DR294025.1,INSD:ES136148.1,INSD:BP803963.1,
FT                   INSD:DR378178.1,INSD:ES170664.1,INSD:ES123737.1,
FT                   INSD:BP782687.1,INSD:ES109409.1,INSD:BP843164.1,
FT                   INSD:DR294051.1,INSD:DR294052.1,INSD:DR294041.1,
FT                   INSD:EL180253.1,INSD:EL145390.1,INSD:EL288802.1,
FT                   INSD:BP663847.1,INSD:ES204398.1,INSD:ES151774.1,
FT                   INSD:ES084181.1,INSD:BP589418.1,INSD:EL011713.1,
FT                   INSD:EL977623.1,INSD:EH819465.1,INSD:ES026714.1,
FT                   INSD:ES016093.1,INSD:ES175702.1,INSD:EL053809.1,
FT                   INSD:ES192557.1,INSD:EL252836.1,INSD:EL998579.1,
FT                   INSD:DR294022.1,INSD:ES138249.1,INSD:DR294063.1,
FT                   INSD:BP861753.1,INSD:EL152969.1,INSD:EL056385.1,
FT                   INSD:EH815901.1,INSD:ES209444.1,INSD:ES134415.1,
FT                   INSD:EH800433.1,INSD:EH810910.1,INSD:EL312959.1,
FT                   INSD:DR294038.1,INSD:ES052352.1,INSD:ES118326.1,
FT                   INSD:BP597382.1,INSD:BP852073.1,INSD:EL157374.1,
FT                   INSD:EL158425.1,INSD:ES184408.1,INSD:EL081272.1,
FT                   INSD:ES198105.1,INSD:DR294014.1,INSD:AV781647.1,
FT                   INSD:ES050026.1,INSD:BP567362.1,INSD:BP627919.1,
FT                   INSD:EL082898.1,INSD:AV820893.1,INSD:DR294062.1,
FT                   INSD:ES058474.1,INSD:ES196094.1,INSD:EL220531.1,
FT                   INSD:EL988985.1,INSD:EL108470.1,INSD:ES058306.1,
FT                   INSD:EH914587.1,INSD:ES134928.1,INSD:ES149935.1,
FT                   INSD:EH912604.1,INSD:ES025955.1,INSD:AV819713.1,
FT                   INSD:EL022887.1,INSD:BP837411.1,INSD:BP663013.1,
FT                   INSD:BP798646.1,INSD:ES206290.1,INSD:EL236840.1,
FT                   INSD:EH799627.1,INSD:EL290846.1,INSD:BP661431.1,
FT                   INSD:ES014256.1,INSD:ES025070.1,INSD:BP866065.1,
FT                   INSD:ES200327.1,INSD:DR294053.1,INSD:DR294065.1,
FT                   INSD:EH991345.1,INSD:EL295779.1,INSD:BP649138.1,
FT                   INSD:DR294043.1,INSD:BP857749.1,INSD:EL024884.1,
FT                   INSD:AI997918.1,INSD:EH879447.1,INSD:ES165736.1,
FT                   INSD:EL210222.1,INSD:ES008494.1,INSD:BP816624.1,
FT                   INSD:EL264067.1,INSD:CA781593.1,INSD:ES135813.1,
FT                   INSD:EL321718.1,INSD:AV804294.1,INSD:EL038365.1,
FT                   INSD:EL053881.1,INSD:BP606037.1,INSD:DR294060.1,
FT                   INSD:BP661923.1,INSD:BP577569.1,INSD:EL270271.1,
FT                   INSD:AV808973.1,INSD:EL102002.1,INSD:AV823657.1,
FT                   INSD:BP601736.1,INSD:ES081968.1,INSD:ES139374.1,
FT                   INSD:EG528297.1,INSD:ES148128.1,INSD:BP627782.1,
FT                   INSD:DR294040.1,INSD:DR294049.1,INSD:DR294055.1,
FT                   INSD:ES154215.1,INSD:ES098756.1,INSD:ES122063.1,
FT                   INSD:EL333394.1,INSD:ES046196.1,INSD:ES105024.1,
FT                   INSD:BP621626.1,INSD:EL176088.1,INSD:ES065545.1,
FT                   INSD:EH889288.1,INSD:EL141947.1,INSD:ES140070.1,
FT                   INSD:BP636565.1,INSD:BP853572.1,INSD:ES116392.1,
FT                   INSD:DR294044.1,INSD:DR294024.1,INSD:ES186244.1,
FT                   INSD:EL235644.1,INSD:EL195093.1,INSD:ES157117.1,
FT                   INSD:DR294056.1,INSD:ES143628.1,INSD:EL039900.1,
FT                   INSD:DR294071.1,INSD:EH952170.1,INSD:DR294032.1,
FT                   INSD:BP596256.1,INSD:EL246181.1,INSD:EL240998.1,
FT                   INSD:ES017502.1,INSD:EL247898.1,INSD:ES155492.1,
FT                   INSD:BP633614.1,INSD:EH808115.1,INSD:BP649171.1,
FT                   INSD:AV538194.1,INSD:DR294067.1,INSD:EH989549.1,
FT                   INSD:ES131259.1,INSD:BP635425.1,INSD:DR294031.1,
FT                   INSD:ES156398.1,INSD:ES026094.1,INSD:BP631627.1,
FT                   INSD:AV539940.1,INSD:ES207408.1,INSD:DR294034.1,
FT                   INSD:EL245459.1,INSD:BP847361.1,INSD:BP818439.1,
FT                   INSD:EH958211.1,INSD:ES009072.1,INSD:EH822698.1,
FT                   INSD:ES105123.1,INSD:EL092904.1,INSD:ES059353.1,
FT                   INSD:EH820802.1,INSD:ES038209.1,INSD:BP646219.1,
FT                   INSD:EL334369.1,INSD:BP634245.1,INSD:EL188906.1,
FT                   INSD:AV557005.1,INSD:EL978120.1,INSD:EG528298.1,
FT                   INSD:ES093586.1,INSD:EL151921.1,INSD:BP630233.1,
FT                   INSD:EL253052.1,INSD:BP800439.1,INSD:BP574113.1,
FT                   INSD:EH983054.1,INSD:BP661461.1,INSD:AV539599.1,
FT                   INSD:ES136569.1,INSD:ES164934.1,INSD:DR294045.1,
FT                   INSD:DR294027.1,INSD:EL151918.1,INSD:Z33779.1,
FT                   INSD:ES105370.1,INSD:ES035853.1,INSD:DR294018.1,
FT                   INSD:AV832224.1,INSD:EH990450.1,INSD:EL124576.1,
FT                   INSD:EL051488.1,INSD:AV521734.1,INSD:AM111229.1,
FT                   INSD:ES216445.1,INSD:ES093626.1,INSD:ES181678.1,
FT                   INSD:EL240454.1,INSD:EH938832.1,INSD:EL973263.1,
FT                   INSD:ES032293.1,INSD:ES130214.1,INSD:BP832532.1,
FT                   INSD:BP863531.1,INSD:BP592665.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY081698.1,INSD:BX818796.1,INSD:AY045994.1,
FT                   INSD:AF370484.1,INSD:AY085139.1,INSD:AY079328.1"
FT   CDS_pept        complement(join(132943..133158,133258..133360,
FT                   133455..133534,133773..133830,133923..134020,
FT                   134091..134264))
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.13"
FT                   /gene_synonym="F10A8_13"
FT                   /locus_tag="AT2G01250"
FT                   /product="Ribosomal protein L30/L7 family protein"
FT                   /note="Ribosomal protein L30/L7 family protein; FUNCTIONS
FT                   IN: structural constituent of ribosome, transcription
FT                   regulator activity; INVOLVED IN: translation; LOCATED IN:
FT                   in 8 components; EXPRESSED IN: 27 plant structures;
FT                   EXPRESSED DURING: 14 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Ribosomal protein L30, N-terminal
FT                   (InterPro:IPR012988), Ribosomal protein L7, eukaryotic
FT                   (InterPro:IPR005998), Ribosomal protein L30p/L7e, conserved
FT                   region (InterPro:IPR000517), Ribosomal protein L30,
FT                   conserved site (InterPro:IPR018038), Ribosomal protein L30,
FT                   ferredoxin-like fold domain (InterPro:IPR016082); BEST
FT                   Arabidopsis thaliana protein match is: Ribosomal protein
FT                   L30/L7 family protein (TAIR:AT3G13580.1); Has 1297 Blast
FT                   hits to 1295 proteins in 388 species: Archae - 210;
FT                   Bacteria - 1; Metazoa - 453; Fungi - 213; Plants - 195;
FT                   Viruses - 0; Other Eukaryotes - 225 (source: NCBI BLink)."
FT                   /db_xref="GOA:P60040"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60040"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR294037.1,INSD:EL289142.1,INSD:EH838832.1,
FT                   INSD:ES011960.1,INSD:ES094790.1,INSD:BP856213.1,
FT                   INSD:ES119717.1,INSD:ES060724.1,INSD:EL260357.1,
FT                   INSD:ES053914.1,INSD:ES070866.1,INSD:ES097877.1,
FT                   INSD:BP857115.1,INSD:EL186761.1,INSD:BP593542.1,
FT                   INSD:EL263860.1,INSD:EL030479.1,INSD:EL992584.1,
FT                   INSD:ES088203.1,INSD:AA721945.1,INSD:DR294048.1,
FT                   INSD:DR294046.1,INSD:EL303214.1,INSD:ES181879.1,
FT                   INSD:EL117119.1,INSD:EL256430.1,INSD:EH834840.1,
FT                   INSD:BP624637.1,INSD:BP633063.1,INSD:ES166482.1,
FT                   INSD:EL034917.1,INSD:ES091302.1,INSD:BP570454.1,
FT                   INSD:BP617868.1,INSD:EH876881.1,INSD:EL006631.1,
FT                   INSD:EH810985.1,INSD:ES180581.1,INSD:ES117109.1,
FT                   INSD:ES200285.1,INSD:AV832263.1,INSD:ES105732.1,
FT                   INSD:EL206550.1,INSD:EL186085.1,INSD:BP857095.1,
FT                   INSD:EL232261.1,INSD:EL169472.1,INSD:ES050871.1,
FT                   INSD:ES192284.1,INSD:EL981591.1,INSD:EL970618.1,
FT                   INSD:ES208951.1,INSD:EH930637.1,INSD:ES213030.1,
FT                   INSD:EL260991.1,INSD:ES168944.1,INSD:EH961497.1,
FT                   INSD:DR294057.1,INSD:BP579598.1,INSD:AV554308.1,
FT                   INSD:EL019133.1,INSD:ES034298.1,INSD:DR294069.1,
FT                   INSD:EL319090.1,INSD:EH887225.1,INSD:ES070521.1,
FT                   INSD:ES040969.1,INSD:ES053058.1,INSD:EL092181.1,
FT                   INSD:EL190892.1,INSD:EL147685.1,INSD:DR294047.1,
FT                   INSD:ES095643.1,INSD:ES020741.1,INSD:EL066831.1,
FT                   INSD:EL133428.1,INSD:EL021841.1,INSD:EH960497.1,
FT                   INSD:ES080601.1,INSD:DR294036.1,INSD:ES143570.1,
FT                   INSD:DR294039.1,INSD:BP664406.1,INSD:BP826121.1,
FT                   INSD:AV567128.1,INSD:DR294054.1,INSD:EL203865.1,
FT                   INSD:EL968786.1,INSD:BP867728.1,INSD:DR294070.1,
FT                   INSD:DR294058.1,INSD:ES080063.1,INSD:EL299349.1,
FT                   INSD:EH847004.1,INSD:EL222273.1,INSD:EL967501.1,
FT                   INSD:EL233618.1,INSD:EH798337.1,INSD:ES080861.1,
FT                   INSD:ES177466.1,INSD:BP660992.1,INSD:EL318633.1,
FT                   INSD:EL041169.1,INSD:BP580614.1,INSD:EL207315.1,
FT                   INSD:BP560500.2,INSD:BU635159.1,INSD:ES208418.1,
FT                   INSD:DR255285.1,INSD:DR294015.1,INSD:BP660459.1,
FT                   INSD:EH929939.1,INSD:ES180788.1,INSD:ES177756.1,
FT                   INSD:EH836441.1,INSD:EH797171.1,INSD:BP645966.1,
FT                   INSD:EL970747.1,INSD:EH894329.1,INSD:EH897148.1,
FT                   INSD:DR379278.1,INSD:ES107049.1,INSD:ES115044.1,
FT                   INSD:BP641595.1,INSD:EL057474.1,INSD:EL231114.1,
FT                   INSD:ES148270.1,INSD:EH891761.1,INSD:BP563400.1,
FT                   INSD:ES028491.1,INSD:BP623646.1,INSD:ES008857.1,
FT                   INSD:EH949975.1,INSD:DR294017.1,INSD:BP832063.1,
FT                   INSD:EL144257.1,INSD:ES192948.1,INSD:DR294020.1,
FT                   INSD:EL152312.1,INSD:EL985424.1,INSD:EH932082.1,
FT                   INSD:ES021271.1,INSD:EL166173.1,INSD:DR294066.1,
FT                   INSD:EH800860.1,INSD:DR294050.1,INSD:EH949171.1,
FT                   INSD:EH956977.1,INSD:ES175042.1,INSD:ES207300.1,
FT                   INSD:ES042054.1,INSD:ES091300.1,INSD:ES142452.1,
FT                   INSD:BP626851.1,INSD:BP787819.1,INSD:DR294026.1,
FT                   INSD:DR294023.1,INSD:DR294021.1,INSD:BP866605.1,
FT                   INSD:ES152992.1,INSD:EH890466.1,INSD:EH947872.1,
FT                   INSD:ES152046.1,INSD:BP584212.1,INSD:EL116898.1,
FT                   INSD:ES166765.1,INSD:ES149331.1,INSD:BP815237.2,
FT                   INSD:EH993369.1,INSD:ES015319.1,INSD:EL155788.1,
FT                   INSD:EH801739.1,INSD:EL305550.1,INSD:EL234268.1,
FT                   INSD:ES143162.1,INSD:DR372085.1,INSD:BP851384.1,
FT                   INSD:EL227904.1,INSD:BP839811.1,INSD:ES022790.1,
FT                   INSD:EH861777.1,INSD:EH869697.1,INSD:BP571087.1,
FT                   INSD:ES082960.1,INSD:EH865375.1,INSD:EL080049.1,
FT                   INSD:ES123161.1,INSD:DR294016.1,INSD:EH959963.1,
FT                   INSD:EL217320.1,INSD:EL003883.1,INSD:BP571214.1,
FT                   INSD:EH947739.1,INSD:ES173126.1,INSD:EH950609.1,
FT                   INSD:ES123671.1,INSD:EL025259.1,INSD:ES015113.1,
FT                   INSD:EH905879.1,INSD:EL073947.1,INSD:ES111041.1,
FT                   INSD:EL328877.1,INSD:AV784664.1,INSD:DR294029.1,
FT                   INSD:DR294025.1,INSD:ES136148.1,INSD:BP803963.1,
FT                   INSD:DR378178.1,INSD:ES170664.1,INSD:ES123737.1,
FT                   INSD:BP782687.1,INSD:ES109409.1,INSD:BP843164.1,
FT                   INSD:DR294051.1,INSD:DR294052.1,INSD:DR294041.1,
FT                   INSD:EL180253.1,INSD:EL145390.1,INSD:EL288802.1,
FT                   INSD:BP663847.1,INSD:ES204398.1,INSD:ES151774.1,
FT                   INSD:ES084181.1,INSD:BP589418.1,INSD:EL011713.1,
FT                   INSD:EL977623.1,INSD:EH819465.1,INSD:ES026714.1,
FT                   INSD:ES016093.1,INSD:ES175702.1,INSD:EL053809.1,
FT                   INSD:ES192557.1,INSD:EL252836.1,INSD:EL998579.1,
FT                   INSD:DR294022.1,INSD:ES138249.1,INSD:DR294063.1,
FT                   INSD:BP861753.1,INSD:EL152969.1,INSD:EL056385.1,
FT                   INSD:EH815901.1,INSD:ES209444.1,INSD:ES134415.1,
FT                   INSD:EH800433.1,INSD:EH810910.1,INSD:EL312959.1,
FT                   INSD:DR294038.1,INSD:ES052352.1,INSD:ES118326.1,
FT                   INSD:BP597382.1,INSD:BP852073.1,INSD:EL157374.1,
FT                   INSD:EL158425.1,INSD:ES184408.1,INSD:EL081272.1,
FT                   INSD:ES198105.1,INSD:DR294014.1,INSD:AV781647.1,
FT                   INSD:ES050026.1,INSD:BP567362.1,INSD:BP627919.1,
FT                   INSD:EL082898.1,INSD:AV820893.1,INSD:DR294062.1,
FT                   INSD:ES058474.1,INSD:ES196094.1,INSD:EL220531.1,
FT                   INSD:EL988985.1,INSD:EL108470.1,INSD:ES058306.1,
FT                   INSD:EH914587.1,INSD:ES134928.1,INSD:ES149935.1,
FT                   INSD:EH912604.1,INSD:ES025955.1,INSD:AV819713.1,
FT                   INSD:EL022887.1,INSD:BP837411.1,INSD:BP663013.1,
FT                   INSD:BP798646.1,INSD:ES206290.1,INSD:EL236840.1,
FT                   INSD:EH799627.1,INSD:EL290846.1,INSD:BP661431.1,
FT                   INSD:ES014256.1,INSD:ES025070.1,INSD:BP866065.1,
FT                   INSD:ES200327.1,INSD:DR294053.1,INSD:DR294065.1,
FT                   INSD:EH991345.1,INSD:EL295779.1,INSD:BP649138.1,
FT                   INSD:DR294043.1,INSD:BP857749.1,INSD:EL024884.1,
FT                   INSD:AI997918.1,INSD:EH879447.1,INSD:ES165736.1,
FT                   INSD:EL210222.1,INSD:ES008494.1,INSD:BP816624.1,
FT                   INSD:EL264067.1,INSD:CA781593.1,INSD:ES135813.1,
FT                   INSD:EL321718.1,INSD:AV804294.1,INSD:EL038365.1,
FT                   INSD:EL053881.1,INSD:BP606037.1,INSD:DR294060.1,
FT                   INSD:BP661923.1,INSD:BP577569.1,INSD:EL270271.1,
FT                   INSD:AV808973.1,INSD:EL102002.1,INSD:AV823657.1,
FT                   INSD:BP601736.1,INSD:ES081968.1,INSD:ES139374.1,
FT                   INSD:EG528297.1,INSD:ES148128.1,INSD:BP627782.1,
FT                   INSD:DR294040.1,INSD:DR294049.1,INSD:DR294055.1,
FT                   INSD:ES154215.1,INSD:ES098756.1,INSD:ES122063.1,
FT                   INSD:EL333394.1,INSD:ES046196.1,INSD:ES105024.1,
FT                   INSD:BP621626.1,INSD:EL176088.1,INSD:ES065545.1,
FT                   INSD:EH889288.1,INSD:EL141947.1,INSD:ES140070.1,
FT                   INSD:BP636565.1,INSD:BP853572.1,INSD:ES116392.1,
FT                   INSD:DR294044.1,INSD:DR294024.1,INSD:ES186244.1,
FT                   INSD:EL235644.1,INSD:EL195093.1,INSD:ES157117.1,
FT                   INSD:DR294056.1,INSD:ES143628.1,INSD:EL039900.1,
FT                   INSD:DR294071.1,INSD:EH952170.1,INSD:DR294032.1,
FT                   INSD:BP596256.1,INSD:EL246181.1,INSD:EL240998.1,
FT                   INSD:ES017502.1,INSD:EL247898.1,INSD:ES155492.1,
FT                   INSD:BP633614.1,INSD:EH808115.1,INSD:BP649171.1,
FT                   INSD:AV538194.1,INSD:DR294067.1,INSD:EH989549.1,
FT                   INSD:ES131259.1,INSD:BP635425.1,INSD:DR294031.1,
FT                   INSD:ES156398.1,INSD:ES026094.1,INSD:BP631627.1,
FT                   INSD:AV539940.1,INSD:ES207408.1,INSD:DR294034.1,
FT                   INSD:EL245459.1,INSD:BP847361.1,INSD:BP818439.1,
FT                   INSD:EH958211.1,INSD:ES009072.1,INSD:EH822698.1,
FT                   INSD:ES105123.1,INSD:EL092904.1,INSD:ES059353.1,
FT                   INSD:EH820802.1,INSD:ES038209.1,INSD:BP646219.1,
FT                   INSD:EL334369.1,INSD:BP634245.1,INSD:EL188906.1,
FT                   INSD:AV557005.1,INSD:EL978120.1,INSD:EG528298.1,
FT                   INSD:ES093586.1,INSD:EL151921.1,INSD:BP630233.1,
FT                   INSD:EL253052.1,INSD:BP800439.1,INSD:BP574113.1,
FT                   INSD:EH983054.1,INSD:BP661461.1,INSD:AV539599.1,
FT                   INSD:ES136569.1,INSD:ES164934.1,INSD:DR294045.1,
FT                   INSD:DR294027.1,INSD:EL151918.1,INSD:Z33779.1,
FT                   INSD:ES105370.1,INSD:ES035853.1,INSD:DR294018.1,
FT                   INSD:AV832224.1,INSD:EH990450.1,INSD:EL124576.1,
FT                   INSD:EL051488.1,INSD:AV521734.1,INSD:AM111229.1,
FT                   INSD:ES216445.1,INSD:ES093626.1,INSD:ES181678.1,
FT                   INSD:EL240454.1,INSD:EH938832.1,INSD:EL973263.1,
FT                   INSD:ES032293.1,INSD:ES130214.1,INSD:BP832532.1,
FT                   INSD:BP863531.1,INSD:BP592665.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY081698.1,INSD:BX818796.1,INSD:AY045994.1,
FT                   INSD:AF370484.1,INSD:AY085139.1,INSD:AY079328.1"
FT                   /protein_id="AEC05420.1"
FT                   /translation="MVESKVVVPESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLIF
FT                   KRAEQYSKEYAEKEKELISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQ
FT                   LLRLRQIFNGVFLKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKLNHQRIAL
FT                   TDNSIVEQALGKHGIICTEDLIHEILTVGPHFKEANNFLWPFQLKAPLGGLKKKRNHYV
FT                   EGGDAGNRENFINELIRRMN"
FT   CDS_pept        complement(join(133038..133079,133258..133360,
FT                   133455..133534,133773..133830,133923..134020,
FT                   134091..134264))
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.13"
FT                   /gene_synonym="F10A8_13"
FT                   /locus_tag="AT2G01250"
FT                   /product="Ribosomal protein L30/L7 family protein"
FT                   /note="Ribosomal protein L30/L7 family protein; FUNCTIONS
FT                   IN: structural constituent of ribosome; INVOLVED IN:
FT                   translation; LOCATED IN: cytosolic large ribosomal subunit,
FT                   chloroplast, plasma membrane, large ribosomal subunit,
FT                   membrane; EXPRESSED IN: 25 plant structures; EXPRESSED
FT                   DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Ribosomal protein L30, N-terminal (InterPro:IPR012988),
FT                   Ribosomal protein L30p/L7e, conserved region
FT                   (InterPro:IPR000517), Ribosomal protein L30, conserved site
FT                   (InterPro:IPR018038), Ribosomal protein L30,
FT                   ferredoxin-like fold domain (InterPro:IPR016082); BEST
FT                   Arabidopsis thaliana protein match is: Ribosomal protein
FT                   L30/L7 family protein (TAIR:AT3G13580.1); Has 1075 Blast
FT                   hits to 1075 proteins in 310 species: Archae - 55; Bacteria
FT                   - 0; Metazoa - 442; Fungi - 204; Plants - 182; Viruses - 0;
FT                   Other Eukaryotes - 192 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01250"
FT                   /db_xref="GOA:A8MRH4"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/TrEMBL:A8MRH4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR294037.1,INSD:EL011713.1,INSD:EL977623.1,
FT                   INSD:ES026714.1,INSD:EH838832.1,INSD:ES011960.1,
FT                   INSD:EL053809.1,INSD:EL998579.1,INSD:DR294022.1,
FT                   INSD:ES094790.1,INSD:BP856213.1,INSD:ES060724.1,
FT                   INSD:DR294063.1,INSD:BP648015.1,INSD:ES070866.1,
FT                   INSD:BP857115.1,INSD:EL186761.1,INSD:BP861753.1,
FT                   INSD:EL263860.1,INSD:EL152969.1,INSD:EL030479.1,
FT                   INSD:EL056385.1,INSD:AA721945.1,INSD:ES088203.1,
FT                   INSD:DR294048.1,INSD:EH815901.1,INSD:DR294046.1,
FT                   INSD:ES134415.1,INSD:EL303214.1,INSD:EH800433.1,
FT                   INSD:EL117119.1,INSD:EL256430.1,INSD:EH810910.1,
FT                   INSD:EL312959.1,INSD:DR294038.1,INSD:ES052352.1,
FT                   INSD:ES166482.1,INSD:ES091302.1,INSD:EL006631.1,
FT                   INSD:BP852073.1,INSD:ES180581.1,INSD:EH810985.1,
FT                   INSD:ES117109.1,INSD:ES200285.1,INSD:EL081272.1,
FT                   INSD:ES198105.1,INSD:DR294014.1,INSD:ES050026.1,
FT                   INSD:EL082898.1,INSD:ES105732.1,INSD:DR294062.1,
FT                   INSD:EL206550.1,INSD:ES058474.1,INSD:ES196094.1,
FT                   INSD:BP857095.1,INSD:EL186085.1,INSD:ES050871.1,
FT                   INSD:EL220531.1,INSD:EL988985.1,INSD:ES058306.1,
FT                   INSD:EH914587.1,INSD:ES134928.1,INSD:EH912604.1,
FT                   INSD:EL981591.1,INSD:ES025955.1,INSD:EL970618.1,
FT                   INSD:ES208951.1,INSD:EH930637.1,INSD:ES213030.1,
FT                   INSD:EL022887.1,INSD:EL260991.1,INSD:BP837411.1,
FT                   INSD:EH961497.1,INSD:BP798646.1,INSD:AV554308.1,
FT                   INSD:EL019133.1,INSD:ES206290.1,INSD:ES034298.1,
FT                   INSD:DR294069.1,INSD:EH887225.1,INSD:EL319090.1,
FT                   INSD:ES070521.1,INSD:ES040969.1,INSD:ES053058.1,
FT                   INSD:EL092181.1,INSD:EL147685.1,INSD:DR294047.1,
FT                   INSD:ES014256.1,INSD:ES095643.1,INSD:BP866065.1,
FT                   INSD:ES025070.1,INSD:EL133428.1,INSD:EL066831.1,
FT                   INSD:ES200327.1,INSD:DR294053.1,INSD:DR294065.1,
FT                   INSD:EH960497.1,INSD:EH991345.1,INSD:ES080601.1,
FT                   INSD:EL295779.1,INSD:DR294043.1,INSD:DR294036.1,
FT                   INSD:BP857749.1,INSD:EL024884.1,INSD:ES143570.1,
FT                   INSD:DR294039.1,INSD:EH879447.1,INSD:BP826121.1,
FT                   INSD:ES165736.1,INSD:BP816624.1,INSD:EL210222.1,
FT                   INSD:ES008494.1,INSD:DR294070.1,INSD:BP867728.1,
FT                   INSD:EL264067.1,INSD:EL968786.1,INSD:DR294058.1,
FT                   INSD:ES080063.1,INSD:EL299349.1,INSD:EH847004.1,
FT                   INSD:EL222273.1,INSD:EL967501.1,INSD:ES135813.1,
FT                   INSD:EL321718.1,INSD:EL233618.1,INSD:EH798337.1,
FT                   INSD:ES080861.1,INSD:EL038365.1,INSD:EL053881.1,
FT                   INSD:ES177466.1,INSD:DR294060.1,INSD:EL318633.1,
FT                   INSD:EL207315.1,INSD:ES208418.1,INSD:DR294015.1,
FT                   INSD:EH929939.1,INSD:ES180788.1,INSD:EH836441.1,
FT                   INSD:ES177756.1,INSD:EH797171.1,INSD:AV808973.1,
FT                   INSD:EL970747.1,INSD:ES081968.1,INSD:ES139374.1,
FT                   INSD:EG528297.1,INSD:EH894329.1,INSD:EH897148.1,
FT                   INSD:ES148128.1,INSD:DR294040.1,INSD:DR294049.1,
FT                   INSD:DR294055.1,INSD:ES154215.1,INSD:ES115044.1,
FT                   INSD:ES098756.1,INSD:ES122063.1,INSD:BP652097.1,
FT                   INSD:EL333394.1,INSD:EL176088.1,INSD:EL141947.1,
FT                   INSD:EL057474.1,INSD:EH889288.1,INSD:ES065545.1,
FT                   INSD:ES148270.1,INSD:BP853572.1,INSD:BP563400.1,
FT                   INSD:ES116392.1,INSD:DR294044.1,INSD:DR294024.1,
FT                   INSD:ES028491.1,INSD:EL235644.1,INSD:ES186244.1,
FT                   INSD:EH949975.1,INSD:DR294017.1,INSD:ES157117.1,
FT                   INSD:BP832063.1,INSD:DR294056.1,INSD:ES143628.1,
FT                   INSD:EL144257.1,INSD:DR294020.1,INSD:DR294071.1,
FT                   INSD:EH952170.1,INSD:EL985424.1,INSD:DR294032.1,
FT                   INSD:EL246181.1,INSD:EL240998.1,INSD:EH932082.1,
FT                   INSD:ES021271.1,INSD:EL166173.1,INSD:EH808115.1,
FT                   INSD:DR294066.1,INSD:DR294050.1,INSD:EH800860.1,
FT                   INSD:ES175042.1,INSD:EH956977.1,INSD:ES042054.1,
FT                   INSD:ES142452.1,INSD:DR294026.1,INSD:DR294067.1,
FT                   INSD:EH989549.1,INSD:ES131259.1,INSD:DR294031.1,
FT                   INSD:DR294021.1,INSD:BP866605.1,INSD:ES152992.1,
FT                   INSD:ES156398.1,INSD:EH890466.1,INSD:ES026094.1,
FT                   INSD:EH947872.1,INSD:ES152046.1,INSD:ES207408.1,
FT                   INSD:DR294034.1,INSD:BP847361.1,INSD:ES166765.1,
FT                   INSD:ES149331.1,INSD:BP815237.2,INSD:ES009072.1,
FT                   INSD:EH822698.1,INSD:ES105123.1,INSD:EH993369.1,
FT                   INSD:ES015319.1,INSD:EL155788.1,INSD:ES059353.1,
FT                   INSD:EL305550.1,INSD:BP851384.1,INSD:EH820802.1,
FT                   INSD:EL227904.1,INSD:EL334369.1,INSD:BP839811.1,
FT                   INSD:ES022790.1,INSD:EL188906.1,INSD:EL978120.1,
FT                   INSD:EG528298.1,INSD:ES093586.1,INSD:EL151921.1,
FT                   INSD:ES082960.1,INSD:EL080049.1,INSD:EH865375.1,
FT                   INSD:ES123161.1,INSD:BP800439.1,INSD:DR294016.1,
FT                   INSD:EH959963.1,INSD:EH983054.1,INSD:AV539599.1,
FT                   INSD:ES136569.1,INSD:EL217320.1,INSD:EL003883.1,
FT                   INSD:ES164934.1,INSD:ES173126.1,INSD:DR294045.1,
FT                   INSD:ES123671.1,INSD:EH950609.1,INSD:DR294027.1,
FT                   INSD:EL025259.1,INSD:ES015113.1,INSD:EL151918.1,
FT                   INSD:EL073947.1,INSD:Z33779.1,INSD:ES111041.1,
FT                   INSD:ES105370.1,INSD:DR294029.1,INSD:DR294025.1,
FT                   INSD:ES035853.1,INSD:DR294018.1,INSD:BP803963.1,
FT                   INSD:ES170664.1,INSD:EL124576.1,INSD:EH990450.1,
FT                   INSD:ES123737.1,INSD:ES216445.1,INSD:ES093626.1,
FT                   INSD:ES181678.1,INSD:EH938832.1,INSD:EL973263.1,
FT                   INSD:BP843164.1,INSD:DR294051.1,INSD:ES130214.1,
FT                   INSD:DR294052.1,INSD:DR294041.1,INSD:EL180253.1,
FT                   INSD:BP832532.1,INSD:EL145390.1,INSD:EL288802.1,
FT                   INSD:BP863531.1,INSD:ES151774.1,INSD:ES084181.1"
FT                   /protein_id="AEC05421.1"
FT                   /translation="MVESKVVVPESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLIF
FT                   KRAEQYSKEYAEKEKELISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQ
FT                   LLRLRQIFNGVFLKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKLNHQRIAL
FT                   TDNSIVEQPTTSFGHSSLRHH"
FT   gene            complement(135223..137916)
FT                   /gene_synonym="F10A8.14"
FT                   /gene_synonym="F10A8_14"
FT                   /locus_tag="AT2G01260"
FT   mRNA            complement(join(135223..135717,135996..136087,
FT                   136170..136255,136623..136851,136938..137164,
FT                   137253..137916))
FT                   /gene_synonym="F10A8.14"
FT                   /gene_synonym="F10A8_14"
FT                   /locus_tag="AT2G01260"
FT                   /product="hypothetical protein (DUF789)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR231737.1,INSD:EL057964.1,INSD:BP572320.1,
FT                   INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
FT                   INSD:DR231738.1,INSD:EL171190.1,INSD:BP607439.1,
FT                   INSD:DR231743.1,INSD:DR231742.1,INSD:EL043699.1,
FT                   INSD:ES012010.1,INSD:EL062481.1,INSD:EL321270.1,
FT                   INSD:AV533382.1,INSD:DR231741.1,INSD:DR231740.1,
FT                   INSD:AU226714.1,INSD:BP590301.1,INSD:DR371453.1,
FT                   INSD:EL176718.1,INSD:AI998372.1,INSD:EL218259.1,
FT                   INSD:BP847570.1,INSD:DR231739.1,INSD:EH895024.1,
FT                   INSD:BP779285.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820926.1,INSD:BX821018.1,INSD:AK228022.1,
FT                   INSD:BX820932.1,INSD:BT008310.1,INSD:AY089198.1,
FT                   INSD:BX820505.1"
FT   mRNA            complement(join(135223..135717,135996..136087,
FT                   136170..136851,136938..137164,137253..137916))
FT                   /gene_synonym="F10A8.14"
FT                   /gene_synonym="F10A8_14"
FT                   /locus_tag="AT2G01260"
FT                   /product="hypothetical protein (DUF789)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL057964.1,INSD:DR231737.1,INSD:BP572320.1,
FT                   INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
FT                   INSD:DR231738.1,INSD:EL171190.1,INSD:BP607439.1,
FT                   INSD:EL043699.1,INSD:EL062481.1,INSD:EL321270.1,
FT                   INSD:AV533382.1,INSD:DR231741.1,INSD:AU226714.1,
FT                   INSD:BP611710.1,INSD:DR231740.1,INSD:BP590301.1,
FT                   INSD:EL176718.1,INSD:EL218259.1,INSD:BP847570.1,
FT                   INSD:EH895024.1,INSD:DR231739.1,INSD:BP779285.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX820744.1"
FT   mRNA            complement(join(135227..136087,136170..136255,
FT                   136623..136851,136938..137164,137253..137806))
FT                   /gene_synonym="F10A8.14"
FT                   /gene_synonym="F10A8_14"
FT                   /locus_tag="AT2G01260"
FT                   /product="hypothetical protein (DUF789)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL057964.1,INSD:DR231737.1,INSD:BP572320.1,
FT                   INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
FT                   INSD:DR231738.1,INSD:BP796130.1,INSD:EL171190.1,
FT                   INSD:BP607439.1,INSD:ES012010.1,INSD:EL062481.1,
FT                   INSD:EL321270.1,INSD:AV533382.1,INSD:DR231741.1,
FT                   INSD:AU226714.1,INSD:DR231740.1,INSD:BP590301.1,
FT                   INSD:EL176718.1,INSD:AI998372.1,INSD:EL218259.1,
FT                   INSD:BP847570.1,INSD:EH895024.1,INSD:DR231739.1,
FT                   INSD:BP779285.1"
FT   CDS_pept        complement(join(135494..135717,135996..136087,
FT                   136170..136255,136623..136851,136938..137164,
FT                   137253..137504))
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.14"
FT                   /gene_synonym="F10A8_14"
FT                   /locus_tag="AT2G01260"
FT                   /product="hypothetical protein (DUF789)"
FT                   /note="Protein of unknown function (DUF789); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF789
FT                   (InterPro:IPR008507); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF789)
FT                   (TAIR:AT1G15030.1); Has 265 Blast hits to 263 proteins in
FT                   17 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 263; Viruses - 0; Other Eukaryotes - 2 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01260"
FT                   /db_xref="GOA:Q9ZU41"
FT                   /db_xref="InterPro:IPR008507"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZU41"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR231737.1,INSD:EL057964.1,INSD:BP572320.1,
FT                   INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
FT                   INSD:DR231738.1,INSD:EL171190.1,INSD:BP607439.1,
FT                   INSD:DR231743.1,INSD:DR231742.1,INSD:EL043699.1,
FT                   INSD:ES012010.1,INSD:EL062481.1,INSD:EL321270.1,
FT                   INSD:AV533382.1,INSD:DR231741.1,INSD:DR231740.1,
FT                   INSD:AU226714.1,INSD:BP590301.1,INSD:DR371453.1,
FT                   INSD:EL176718.1,INSD:AI998372.1,INSD:EL218259.1,
FT                   INSD:BP847570.1,INSD:DR231739.1,INSD:EH895024.1,
FT                   INSD:BP779285.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820926.1,INSD:BX821018.1,INSD:AK228022.1,
FT                   INSD:BX820932.1,INSD:BT008310.1,INSD:AY089198.1,
FT                   INSD:BX820505.1"
FT                   /protein_id="AEC05422.1"
FT                   /translation="MLGAGFQLTRGRHGDDPFYTSAKTRRANQRIDQLRRAQSDVSNVP
FT                   SSAPSPHKQQLEPSDLSSSNLDRFLESVTPSVPAQFLSKTLLRERRADDDYNKLVPYFV
FT                   LGDIWDSFAEWSAYGTGVPLVLNNNKDRVIQYYVPSLSAIQIYAHSHALDSSLKSRRPG
FT                   DSSDSDFRDSSSDVSSDSDSERVSARVDCISLRDQHQEDSSSDDGEPLGSQGRLMFEYL
FT                   ERDLPYIREPFADKVLDLAAQFPELMTLRSCDLLRSSWFSVAWYPIYRIPTGPTLKDLD
FT                   ACFLTYHSLHTSFGGEGSEQSMSLTQPRESEKMSLPVFGLASYKFRGSLWTPIGGSEHQ
FT                   LVNSLFQAADKWLHSCHVSHPDFLFFCRR"
FT   CDS_pept        complement(join(135907..136087,136170..136255,
FT                   136623..136851,136938..137164,137253..137504))
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.14"
FT                   /gene_synonym="F10A8_14"
FT                   /locus_tag="AT2G01260"
FT                   /product="hypothetical protein (DUF789)"
FT                   /note="Protein of unknown function (DUF789); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF789
FT                   (InterPro:IPR008507); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF789)
FT                   (TAIR:AT1G15030.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01260"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01260.2"
FT                   /db_xref="InterPro:IPR008507"
FT                   /db_xref="UniProtKB/TrEMBL:F4IN82"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL057964.1,INSD:DR231737.1,INSD:BP572320.1,
FT                   INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
FT                   INSD:DR231738.1,INSD:EL171190.1,INSD:BP607439.1,
FT                   INSD:EL043699.1,INSD:EL062481.1,INSD:EL321270.1,
FT                   INSD:AV533382.1,INSD:DR231741.1,INSD:AU226714.1,
FT                   INSD:BP611710.1,INSD:DR231740.1,INSD:BP590301.1,
FT                   INSD:EL176718.1,INSD:EL218259.1,INSD:BP847570.1,
FT                   INSD:EH895024.1,INSD:DR231739.1,INSD:BP779285.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX820744.1"
FT                   /protein_id="AEC05423.1"
FT                   /translation="MLGAGFQLTRGRHGDDPFYTSAKTRRANQRIDQLRRAQSDVSNVP
FT                   SSAPSPHKQQLEPSDLSSSNLDRFLESVTPSVPAQFLSKTLLRERRADDDYNKLVPYFV
FT                   LGDIWDSFAEWSAYGTGVPLVLNNNKDRVIQYYVPSLSAIQIYAHSHALDSSLKSRRPG
FT                   DSSDSDFRDSSSDVSSDSDSERVSARVDCISLRDQHQEDSSSDDGEPLGSQGRLMFEYL
FT                   ERDLPYIREPFADKVLDLAAQFPELMTLRSCDLLRSSWFSVAWYPIYRIPTGPTLKDLD
FT                   ACFLTYHSLHTSFGGKPKLFYLSKQQVVGLHCSTTYTISNQNT"
FT   CDS_pept        complement(join(136560..136851,136938..137164,
FT                   137253..137504))
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.14"
FT                   /gene_synonym="F10A8_14"
FT                   /locus_tag="AT2G01260"
FT                   /product="hypothetical protein (DUF789)"
FT                   /note="Protein of unknown function (DUF789); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF789
FT                   (InterPro:IPR008507); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF789)
FT                   (TAIR:AT1G15030.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01260"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01260.3"
FT                   /db_xref="InterPro:IPR008507"
FT                   /db_xref="UniProtKB/TrEMBL:F4IN81"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL057964.1,INSD:DR231737.1,INSD:BP572320.1,
FT                   INSD:BP600925.1,INSD:EH990366.1,INSD:AV522477.1,
FT                   INSD:DR231738.1,INSD:BP796130.1,INSD:EL171190.1,
FT                   INSD:BP607439.1,INSD:ES012010.1,INSD:EL062481.1,
FT                   INSD:EL321270.1,INSD:AV533382.1,INSD:DR231741.1,
FT                   INSD:AU226714.1,INSD:DR231740.1,INSD:BP590301.1,
FT                   INSD:EL176718.1,INSD:AI998372.1,INSD:EL218259.1,
FT                   INSD:BP847570.1,INSD:EH895024.1,INSD:DR231739.1,
FT                   INSD:BP779285.1"
FT                   /protein_id="AEC05424.2"
FT                   /translation="MLGAGFQLTRGRHGDDPFYTSAKTRRANQRIDQLRRAQSDVSNVP
FT                   SSAPSPHKQQLEPSDLSSSNLDRFLESVTPSVPAQFLSKTLLRERRADDDYNKLVPYFV
FT                   LGDIWDSFAEWSAYGTGVPLVLNNNKDRVIQYYVPSLSAIQIYAHSHALDSSLKSRRPG
FT                   DSSDSDFRDSSSDVSSDSDSERVSARVDCISLRDQHQEDSSSDDGEPLGSQGRLMFEYL
FT                   ERDLPYIREPFADKVCAFISLLEPKAWCRYYILR"
FT   gene            139309..142560
FT                   /gene="QSOX2"
FT                   /gene_synonym="AtQSOX2"
FT                   /gene_synonym="F10A8.15"
FT                   /gene_synonym="F10A8_15"
FT                   /gene_synonym="quiescin-sulfhydryl oxidase 2"
FT                   /locus_tag="AT2G01270"
FT                   /note="Encodes a protein disulfide isomerase-like (PDIL)
FT                   protein, a member of a multigene family within the
FT                   thioredoxin (TRX) superfamily. This protein also belongs to
FT                   the quiescin-sulfhydryl oxidase (QSOX) family, which
FT                   possess an Erv1-like domain at the COOH terminus in
FT                   addition to a TRX domain."
FT   mRNA            join(139309..139650,139916..139940,140010..140102,
FT                   140200..140381,140546..140615,140712..140780,
FT                   140861..140937,141030..141171,141255..141295,
FT                   141377..141523,141608..142039,142126..142560)
FT                   /gene="QSOX2"
FT                   /gene_synonym="AtQSOX2"
FT                   /gene_synonym="F10A8.15"
FT                   /gene_synonym="F10A8_15"
FT                   /gene_synonym="quiescin-sulfhydryl oxidase 2"
FT                   /locus_tag="AT2G01270"
FT                   /product="quiescin-sulfhydryl oxidase 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP837884.1,INSD:EH900279.1,INSD:BP842318.1,
FT                   INSD:AV785491.1,INSD:EL320859.1,INSD:ES015387.1,
FT                   INSD:EL180207.1,INSD:ES155146.1,INSD:BP590799.1,
FT                   INSD:AV821521.1,INSD:H37164.1,INSD:DR368200.1,
FT                   INSD:EL075624.1,INSD:AV799849.1,INSD:BP813092.1,
FT                   INSD:EL176493.1,INSD:BP598538.1,INSD:AA720220.1,
FT                   INSD:DR368201.1,INSD:EL325189.1,INSD:BX834466.1,
FT                   INSD:BP662993.1,INSD:BP614997.1,INSD:EL181282.1,
FT                   INSD:BP608741.1,INSD:BP610453.1,INSD:BP583856.1,
FT                   INSD:EH939382.1,INSD:EH890826.1,INSD:EH870237.1,
FT                   INSD:BX836846.1,INSD:EL237773.1,INSD:BP850950.1,
FT                   INSD:EG499726.1,INSD:EL193960.1,INSD:EL094920.1,
FT                   INSD:BP609292.1,INSD:ES005914.1,INSD:DR368205.1,
FT                   INSD:AV814161.1,INSD:T22047.1,INSD:DR368203.1,
FT                   INSD:BP610212.1,INSD:EH990553.1,INSD:EH813189.1,
FT                   INSD:EL034993.1,INSD:BP790758.1,INSD:EL190564.1,
FT                   INSD:AI100146.1,INSD:AV809088.1,INSD:BP609155.1,
FT                   INSD:EL266690.1,INSD:BP595059.1,INSD:DR368202.1,
FT                   INSD:ES026826.1,INSD:EL192223.1,INSD:EL328428.1,
FT                   INSD:AV558035.1,INSD:EL235190.1,INSD:BP777866.1,
FT                   INSD:EH944542.1,INSD:BP785019.1,INSD:EL999041.1,
FT                   INSD:BP644323.1,INSD:BP608071.1,INSD:EL171487.1,
FT                   INSD:EL094093.1,INSD:DR384173.1,INSD:BP841745.1,
FT                   INSD:AV829883.1,INSD:BP586413.1,INSD:AV525710.1,
FT                   INSD:BP854873.1,INSD:EG499725.1,INSD:ES017014.1,
FT                   INSD:AV824271.1,INSD:BP617066.1,INSD:EH918707.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT000880.1,INSD:BX819763.1,INSD:BX820234.1,
FT                   INSD:AY090364.1,INSD:BX820469.1,INSD:AY125539.1,
FT                   INSD:AY035175.1"
FT   mRNA            join(139309..139940,140010..140102,140200..140381,
FT                   140546..140615,140712..140780,140861..140937,
FT                   141030..141171,141255..141295,141377..141523,
FT                   141608..142039,142126..142141)
FT                   /gene="QSOX2"
FT                   /gene_synonym="AtQSOX2"
FT                   /gene_synonym="F10A8.15"
FT                   /gene_synonym="F10A8_15"
FT                   /gene_synonym="quiescin-sulfhydryl oxidase 2"
FT                   /locus_tag="AT2G01270"
FT                   /product="quiescin-sulfhydryl oxidase 2"
FT   mRNA            join(139331..139620,139716..139940,140010..140102,
FT                   140200..140381,140546..140615,140712..140780,
FT                   140861..140937,141030..141171,141255..141295,
FT                   141377..141523,141608..142039,142126..142141)
FT                   /gene="QSOX2"
FT                   /gene_synonym="AtQSOX2"
FT                   /gene_synonym="F10A8.15"
FT                   /gene_synonym="F10A8_15"
FT                   /gene_synonym="quiescin-sulfhydryl oxidase 2"
FT                   /locus_tag="AT2G01270"
FT                   /product="quiescin-sulfhydryl oxidase 2"
FT   CDS_pept        join(139457..139650,139916..139940,140010..140102,
FT                   140200..140381,140546..140615,140712..140780,
FT                   140861..140937,141030..141171,141255..141295,
FT                   141377..141523,141608..142039,142126..142141)
FT                   /codon_start=1
FT                   /gene="QSOX2"
FT                   /gene_synonym="AtQSOX2"
FT                   /gene_synonym="F10A8.15"
FT                   /gene_synonym="F10A8_15"
FT                   /gene_synonym="quiescin-sulfhydryl oxidase 2"
FT                   /locus_tag="AT2G01270"
FT                   /product="quiescin-sulfhydryl oxidase 2"
FT                   /note="quiescin-sulfhydryl oxidase 2 (QSOX2); FUNCTIONS IN:
FT                   thiol oxidase activity; INVOLVED IN: oxidation reduction,
FT                   cell redox homeostasis; LOCATED IN: Golgi apparatus;
FT                   EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Thioredoxin fold
FT                   (InterPro:IPR012335), Erv1/Alr (InterPro:IPR006863),
FT                   Thioredoxin domain (InterPro:IPR013766), Thioredoxin,
FT                   conserved site (InterPro:IPR017937), ERV/ALR sulphydryl
FT                   oxidase (InterPro:IPR017905), Thioredoxin-like
FT                   (InterPro:IPR017936), Thioredoxin-like fold
FT                   (InterPro:IPR012336); BEST Arabidopsis thaliana protein
FT                   match is: quiescin-sulfhydryl oxidase 1 (TAIR:AT1G15020.1);
FT                   Has 2833 Blast hits to 2194 proteins in 312 species: Archae
FT                   - 22; Bacteria - 32; Metazoa - 1533; Fungi - 396; Plants -
FT                   476; Viruses - 0; Other Eukaryotes - 374 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01270"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01270.1"
FT                   /db_xref="GOA:Q9ZU40"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036774"
FT                   /db_xref="InterPro:IPR039798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU40"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP837884.1,INSD:EH900279.1,INSD:BP842318.1,
FT                   INSD:AV785491.1,INSD:EL320859.1,INSD:ES015387.1,
FT                   INSD:EL180207.1,INSD:ES155146.1,INSD:BP590799.1,
FT                   INSD:AV821521.1,INSD:H37164.1,INSD:DR368200.1,
FT                   INSD:EL075624.1,INSD:AV799849.1,INSD:BP813092.1,
FT                   INSD:EL176493.1,INSD:BP598538.1,INSD:AA720220.1,
FT                   INSD:DR368201.1,INSD:EL325189.1,INSD:BX834466.1,
FT                   INSD:BP662993.1,INSD:BP614997.1,INSD:EL181282.1,
FT                   INSD:BP608741.1,INSD:BP610453.1,INSD:BP583856.1,
FT                   INSD:EH939382.1,INSD:EH890826.1,INSD:EH870237.1,
FT                   INSD:BX836846.1,INSD:EL237773.1,INSD:BP850950.1,
FT                   INSD:EG499726.1,INSD:EL193960.1,INSD:EL094920.1,
FT                   INSD:BP609292.1,INSD:ES005914.1,INSD:DR368205.1,
FT                   INSD:AV814161.1,INSD:T22047.1,INSD:DR368203.1,
FT                   INSD:BP610212.1,INSD:EH990553.1,INSD:EH813189.1,
FT                   INSD:EL034993.1,INSD:BP790758.1,INSD:EL190564.1,
FT                   INSD:AI100146.1,INSD:AV809088.1,INSD:BP609155.1,
FT                   INSD:EL266690.1,INSD:BP595059.1,INSD:DR368202.1,
FT                   INSD:ES026826.1,INSD:EL192223.1,INSD:EL328428.1,
FT                   INSD:AV558035.1,INSD:EL235190.1,INSD:BP777866.1,
FT                   INSD:EH944542.1,INSD:BP785019.1,INSD:EL999041.1,
FT                   INSD:BP644323.1,INSD:BP608071.1,INSD:EL171487.1,
FT                   INSD:EL094093.1,INSD:DR384173.1,INSD:BP841745.1,
FT                   INSD:AV829883.1,INSD:BP586413.1,INSD:AV525710.1,
FT                   INSD:BP854873.1,INSD:EG499725.1,INSD:ES017014.1,
FT                   INSD:AV824271.1,INSD:BP617066.1,INSD:EH918707.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT000880.1,INSD:BX819763.1,INSD:BX820234.1,
FT                   INSD:AY090364.1,INSD:BX820469.1,INSD:AY125539.1,
FT                   INSD:AY035175.1"
FT                   /protein_id="AEC05425.1"
FT                   /translation="MSLVHLLLFAGLVIAASSSSPGSRLILREISDQKDKAVELNTTNF
FT                   DSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVARLFNGPDAIHPGIVLMTRVDCAMK
FT                   TNTKLCDKFSVSHYPMLFWGPPTKFVSGSWEPKKDKSEILVIDDGRTAERLLNWINKQI
FT                   GSSYGLDDQKFKNEHALSNLTDYNQISQAVYDVEEATAEAFDIILAHKAIKSSETSASF
FT                   IRFIQLLAAHHLSRRCRKGAAEILVNYDDLCPSGNCSYEKSGGNDTLGNFPICGKDVPR
FT                   GYYMFCRGSKNDTRGFSCGLWVLMHSLSVRIEDGESHFAFTTICDFVNNFFMCDECRLH
FT                   FNDMCLSVKTPFKKARDFVLWVWSTHNKVNERLLKDEASLGTGDPKFPKIIWPPKELCP
FT                   LCYLSSNQKSIEWDHEHVYKFLKNYYGPKLVSLYKEKSVSRSKEETVSATEDLTVATNA
FT                   LVVPIGAALAIAIASCAFGALACYWRTQQKNRKPRRR"
FT   CDS_pept        join(139887..139940,140010..140102,140200..140381,
FT                   140546..140615,140712..140780,140861..140937,
FT                   141030..141171,141255..141295,141377..141523,
FT                   141608..142039,142126..142141)
FT                   /codon_start=1
FT                   /gene="QSOX2"
FT                   /gene_synonym="AtQSOX2"
FT                   /gene_synonym="F10A8.15"
FT                   /gene_synonym="F10A8_15"
FT                   /gene_synonym="quiescin-sulfhydryl oxidase 2"
FT                   /locus_tag="AT2G01270"
FT                   /product="quiescin-sulfhydryl oxidase 2"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01270"
FT                   /db_xref="GOA:A0A1P8AZ38"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036774"
FT                   /db_xref="InterPro:IPR039798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AZ38"
FT                   /protein_id="ANM61904.1"
FT                   /translation="MRVSFSIDSRCPACRNYKPHYEKVARLFNGPDAIHPGIVLMTRVD
FT                   CAMKTNTKLCDKFSVSHYPMLFWGPPTKFVSGSWEPKKDKSEILVIDDGRTAERLLNWI
FT                   NKQIGSSYGLDDQKFKNEHALSNLTDYNQISQAVYDVEEATAEAFDIILAHKAIKSSET
FT                   SASFIRFIQLLAAHHLSRRCRKGAAEILVNYDDLCPSGNCSYEKSGGNDTLGNFPICGK
FT                   DVPRGYYMFCRGSKNDTRGFSCGLWVLMHSLSVRIEDGESHFAFTTICDFVNNFFMCDE
FT                   CRLHFNDMCLSVKTPFKKARDFVLWVWSTHNKVNERLLKDEASLGTGDPKFPKIIWPPK
FT                   ELCPLCYLSSNQKSIEWDHEHVYKFLKNYYGPKLVSLYKEKSVSRSKEETVSATEDLTV
FT                   ATNALVVPIGAALAIAIASCAFGALACYWRTQQKNRKPRRR"
FT   CDS_pept        join(139887..139940,140010..140102,140200..140381,
FT                   140546..140615,140712..140780,140861..140937,
FT                   141030..141171,141255..141295,141377..141523,
FT                   141608..142039,142126..142141)
FT                   /codon_start=1
FT                   /gene="QSOX2"
FT                   /gene_synonym="AtQSOX2"
FT                   /gene_synonym="F10A8.15"
FT                   /gene_synonym="F10A8_15"
FT                   /gene_synonym="quiescin-sulfhydryl oxidase 2"
FT                   /locus_tag="AT2G01270"
FT                   /product="quiescin-sulfhydryl oxidase 2"
FT                   /db_xref="GOA:A0A1P8AZ38"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036774"
FT                   /db_xref="InterPro:IPR039798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AZ38"
FT                   /protein_id="ANM61905.1"
FT                   /translation="MRVSFSIDSRCPACRNYKPHYEKVARLFNGPDAIHPGIVLMTRVD
FT                   CAMKTNTKLCDKFSVSHYPMLFWGPPTKFVSGSWEPKKDKSEILVIDDGRTAERLLNWI
FT                   NKQIGSSYGLDDQKFKNEHALSNLTDYNQISQAVYDVEEATAEAFDIILAHKAIKSSET
FT                   SASFIRFIQLLAAHHLSRRCRKGAAEILVNYDDLCPSGNCSYEKSGGNDTLGNFPICGK
FT                   DVPRGYYMFCRGSKNDTRGFSCGLWVLMHSLSVRIEDGESHFAFTTICDFVNNFFMCDE
FT                   CRLHFNDMCLSVKTPFKKARDFVLWVWSTHNKVNERLLKDEASLGTGDPKFPKIIWPPK
FT                   ELCPLCYLSSNQKSIEWDHEHVYKFLKNYYGPKLVSLYKEKSVSRSKEETVSATEDLTV
FT                   ATNALVVPIGAALAIAIASCAFGALACYWRTQQKNRKPRRR"
FT   gene            complement(142498..144524)
FT                   /locus_tag="AT2G01275"
FT   mRNA            complement(join(142498..142789,142874..142954,
FT                   143030..143230,143408..143479,143564..143845,
FT                   144373..144524))
FT                   /locus_tag="AT2G01275"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP790758.1,INSD:BP598538.1,INSD:BP617066.1,
FT                   INSD:AV814161.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT012639.1,INSD:BX819618.1"
FT   mRNA            complement(join(142499..142789,142874..142954,
FT                   143030..143230,143408..143479,143564..143845,
FT                   144217..144389))
FT                   /locus_tag="AT2G01275"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP790758.1,INSD:BP598538.1,INSD:BP617066.1,
FT                   INSD:CK118118.1,INSD:AV814161.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT012639.1"
FT   mRNA            complement(join(142610..142789,142874..142954,
FT                   143030..143230,143408..143479,143564..143845,
FT                   144070..144136,144217..144524))
FT                   /locus_tag="AT2G01275"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT   mRNA            complement(join(142610..142789,142874..142954,
FT                   143030..143230,143408..143479,143564..144136,
FT                   144217..144524))
FT                   /locus_tag="AT2G01275"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT   mRNA            complement(join(142610..142789,142874..142954,
FT                   143030..143230,143408..143479,143564..144038))
FT                   /locus_tag="AT2G01275"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT   CDS_pept        complement(join(142610..142789,142874..142954,
FT                   143030..143230,143408..143479,143564..143887))
FT                   /codon_start=1
FT                   /locus_tag="AT2G01275"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT                   /db_xref="GOA:A0A1P8AZ30"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR022143"
FT                   /db_xref="InterPro:IPR033275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AZ30"
FT                   /protein_id="ANM61906.1"
FT                   /translation="MQILTPTHYLSFLQLHVSFYTVRTENMGDHFVLLVDRLITESTIE
FT                   AAIQSRNQMLQANIPVEECTILDDKTLEMLRNGDLSMAECRICHDEDLDSNMETPCSCS
FT                   GSVKYAHRRCVQRWCNEKGDTTCEICHQEFKPDYTAPPPLLELGHVPLHFRGNWGISQR
FT                   EHRFITVVPADSTFIDQPYPLSSTTSFICCRSLVLIFMALLILRHTLPLVLTGSNLHVF
FT                   PLFTLLFLRILGIMLPIYVVTKAVATCRRHSRTLDTSPSDDSSDEETDSWRLPQTQSYI
FT                   IGVR"
FT   CDS_pept        complement(join(142610..142789,142874..142954,
FT                   143030..143230,143408..143479,143564..143887))
FT                   /codon_start=1
FT                   /locus_tag="AT2G01275"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01275"
FT                   /db_xref="GOA:A0A1P8AZ30"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR022143"
FT                   /db_xref="InterPro:IPR033275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AZ30"
FT                   /protein_id="ANM61908.1"
FT                   /translation="MQILTPTHYLSFLQLHVSFYTVRTENMGDHFVLLVDRLITESTIE
FT                   AAIQSRNQMLQANIPVEECTILDDKTLEMLRNGDLSMAECRICHDEDLDSNMETPCSCS
FT                   GSVKYAHRRCVQRWCNEKGDTTCEICHQEFKPDYTAPPPLLELGHVPLHFRGNWGISQR
FT                   EHRFITVVPADSTFIDQPYPLSSTTSFICCRSLVLIFMALLILRHTLPLVLTGSNLHVF
FT                   PLFTLLFLRILGIMLPIYVVTKAVATCRRHSRTLDTSPSDDSSDEETDSWRLPQTQSYI
FT                   IGVR"
FT   CDS_pept        complement(join(142610..142789,142874..142954,
FT                   143030..143230,143408..143479,143564..143809))
FT                   /codon_start=1
FT                   /locus_tag="AT2G01275"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT                   /db_xref="GOA:Q6NKQ5"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR022143"
FT                   /db_xref="InterPro:IPR033275"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKQ5"
FT                   /protein_id="ANM61907.1"
FT                   /translation="MGDHFVLLVDRLITESTIEAAIQSRNQMLQANIPVEECTILDDKT
FT                   LEMLRNGDLSMAECRICHDEDLDSNMETPCSCSGSVKYAHRRCVQRWCNEKGDTTCEIC
FT                   HQEFKPDYTAPPPLLELGHVPLHFRGNWGISQREHRFITVVPADSTFIDQPYPLSSTTS
FT                   FICCRSLVLIFMALLILRHTLPLVLTGSNLHVFPLFTLLFLRILGIMLPIYVVTKAVAT
FT                   CRRHSRTLDTSPSDDSSDEETDSWRLPQTQSYIIGVR"
FT   CDS_pept        complement(join(142610..142789,142874..142954,
FT                   143030..143230,143408..143479,143564..143809))
FT                   /codon_start=1
FT                   /locus_tag="AT2G01275"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT                   /note="RING/FYVE/PHD zinc finger superfamily protein;
FT                   FUNCTIONS IN: zinc ion binding; CONTAINS InterPro DOMAIN/s:
FT                   Protein of unknown function DUF3675 (InterPro:IPR022143),
FT                   Zinc finger, C3HC4 RING-type (InterPro:IPR018957), Zinc
FT                   finger, RING-CH-type (InterPro:IPR011016); BEST Arabidopsis
FT                   thaliana protein match is: RING/FYVE/PHD zinc finger
FT                   superfamily protein (TAIR:AT5G38070.1); Has 30201 Blast
FT                   hits to 17322 proteins in 780 species: Archae - 12;
FT                   Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants -
FT                   5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01275"
FT                   /db_xref="GOA:Q6NKQ5"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR022143"
FT                   /db_xref="InterPro:IPR033275"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKQ5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP790758.1,INSD:BP598538.1,INSD:BP617066.1,
FT                   INSD:AV814161.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT012639.1,INSD:BX819618.1"
FT                   /protein_id="AEC05426.1"
FT                   /translation="MGDHFVLLVDRLITESTIEAAIQSRNQMLQANIPVEECTILDDKT
FT                   LEMLRNGDLSMAECRICHDEDLDSNMETPCSCSGSVKYAHRRCVQRWCNEKGDTTCEIC
FT                   HQEFKPDYTAPPPLLELGHVPLHFRGNWGISQREHRFITVVPADSTFIDQPYPLSSTTS
FT                   FICCRSLVLIFMALLILRHTLPLVLTGSNLHVFPLFTLLFLRILGIMLPIYVVTKAVAT
FT                   CRRHSRTLDTSPSDDSSDEETDSWRLPQTQSYIIGVR"
FT   CDS_pept        complement(join(142610..142789,142874..142954,
FT                   143030..143230,143408..143479,143564..143809))
FT                   /codon_start=1
FT                   /locus_tag="AT2G01275"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT                   /note="RING/FYVE/PHD zinc finger superfamily protein;
FT                   FUNCTIONS IN: zinc ion binding; CONTAINS InterPro DOMAIN/s:
FT                   Protein of unknown function DUF3675 (InterPro:IPR022143),
FT                   Zinc finger, C3HC4 RING-type (InterPro:IPR018957), Zinc
FT                   finger, RING-CH-type (InterPro:IPR011016); BEST Arabidopsis
FT                   thaliana protein match is: RING/FYVE/PHD zinc finger
FT                   superfamily protein (TAIR:AT5G38070.1); Has 35333 Blast
FT                   hits to 34131 proteins in 2444 species: Archae - 798;
FT                   Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531;
FT                   Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01275.1"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01275.2"
FT                   /db_xref="GOA:Q6NKQ5"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR022143"
FT                   /db_xref="InterPro:IPR033275"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKQ5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP790758.1,INSD:BP598538.1,INSD:BP617066.1,
FT                   INSD:CK118118.1,INSD:AV814161.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT012639.1"
FT                   /protein_id="AEC05427.1"
FT                   /translation="MGDHFVLLVDRLITESTIEAAIQSRNQMLQANIPVEECTILDDKT
FT                   LEMLRNGDLSMAECRICHDEDLDSNMETPCSCSGSVKYAHRRCVQRWCNEKGDTTCEIC
FT                   HQEFKPDYTAPPPLLELGHVPLHFRGNWGISQREHRFITVVPADSTFIDQPYPLSSTTS
FT                   FICCRSLVLIFMALLILRHTLPLVLTGSNLHVFPLFTLLFLRILGIMLPIYVVTKAVAT
FT                   CRRHSRTLDTSPSDDSSDEETDSWRLPQTQSYIIGVR"
FT   gene            144551..145237
FT                   /locus_tag="AT2G00350"
FT   misc_RNA        144551..145237
FT                   /locus_tag="AT2G00350"
FT                   /note="novel transcribed region; AT2G00350.1"
FT   gene            145676..149394
FT                   /gene="MEE65"
FT                   /gene_synonym="F10A8.16"
FT                   /gene_synonym="F10A8_16"
FT                   /gene_synonym="maternal effect embryo arrest 65"
FT                   /locus_tag="AT2G01280"
FT   mRNA            join(145676..145737,145836..145921,145992..146048,
FT                   146117..146205,146277..146353,146472..146489,
FT                   146602..146714,146856..146944,147028..147114,
FT                   147208..147288,147370..147513,147612..147780,
FT                   147866..147954,148053..148133,148207..148374,
FT                   148454..148516,148611..149394)
FT                   /gene="MEE65"
FT                   /gene_synonym="F10A8.16"
FT                   /gene_synonym="F10A8_16"
FT                   /gene_synonym="maternal effect embryo arrest 65"
FT                   /locus_tag="AT2G01280"
FT                   /product="Cyclin/Brf1-like TBP-binding protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG420504.1,INSD:BP622580.1,INSD:AV800214.1,
FT                   INSD:EG425126.1,INSD:EL101808.1,INSD:EG420506.1,
FT                   INSD:EG430387.1,INSD:EL160680.1,INSD:BP787728.1,
FT                   INSD:EG453948.1,INSD:BP629667.1,INSD:EG453947.1,
FT                   INSD:EG465551.1,INSD:EL239483.1,INSD:EG465540.1,
FT                   INSD:BP624060.1,INSD:BP627195.1,INSD:EG425123.1,
FT                   INSD:EG421573.1,INSD:EG420502.1,INSD:EL977102.1,
FT                   INSD:EG420508.1,INSD:BP779941.1,INSD:EL274594.1,
FT                   INSD:BP595133.1,INSD:BP623556.1,INSD:BP595013.1,
FT                   INSD:EG465684.1,INSD:EG430388.1,INSD:EG465707.1,
FT                   INSD:BP649528.1,INSD:EL237455.1,INSD:BP648191.1,
FT                   INSD:ES026124.1,INSD:EG456712.1,INSD:BP791484.1,
FT                   INSD:EL101356.1,INSD:EH831873.1,INSD:BP649526.1,
FT                   INSD:EL335371.1,INSD:DR370611.1,INSD:EG425127.1,
FT                   INSD:EH810049.1"
FT   CDS_pept        join(145676..145737,145836..145921,145992..146048,
FT                   146117..146205,146277..146353,146472..146489,
FT                   146602..146714,146856..146944,147028..147114,
FT                   147208..147288,147370..147513,147612..147780,
FT                   147866..147954,148053..148133,148207..148374,
FT                   148454..148516,148611..148784)
FT                   /codon_start=1
FT                   /gene="MEE65"
FT                   /gene_synonym="F10A8.16"
FT                   /gene_synonym="F10A8_16"
FT                   /gene_synonym="maternal effect embryo arrest 65"
FT                   /locus_tag="AT2G01280"
FT                   /product="Cyclin/Brf1-like TBP-binding protein"
FT                   /note="maternal effect embryo arrest 65 (MEE65); FUNCTIONS
FT                   IN: RNA polymerase II transcription factor activity,
FT                   cation:chloride symporter activity; INVOLVED IN: embryo
FT                   development ending in seed dormancy; LOCATED IN: nucleus;
FT                   CONTAINS InterPro DOMAIN/s: Transcription factor TFIIB
FT                   related (InterPro:IPR000812), Transcription factor TFIIB,
FT                   cyclin-related (InterPro:IPR013150), Cyclin-like
FT                   (InterPro:IPR011028), Cyclin-related (InterPro:IPR013763),
FT                   Cyclin (InterPro:IPR006670), Brf1-like TBP-binding
FT                   (InterPro:IPR011665); BEST Arabidopsis thaliana protein
FT                   match is: Cyclin/Brf1-like TBP-binding protein
FT                   (TAIR:AT3G09360.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01280"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01280.1"
FT                   /db_xref="GOA:F4IN86"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR029529"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:F4IN86"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG420504.1,INSD:BP622580.1,INSD:AV800214.1,
FT                   INSD:EG425126.1,INSD:EL101808.1,INSD:EG420506.1,
FT                   INSD:EG430387.1,INSD:EL160680.1,INSD:BP787728.1,
FT                   INSD:EG453948.1,INSD:BP629667.1,INSD:EG453947.1,
FT                   INSD:EG465551.1,INSD:EL239483.1,INSD:EG465540.1,
FT                   INSD:BP624060.1,INSD:BP627195.1,INSD:EG425123.1,
FT                   INSD:EG421573.1,INSD:EG420502.1,INSD:EL977102.1,
FT                   INSD:EG420508.1,INSD:BP779941.1,INSD:EL274594.1,
FT                   INSD:BP595133.1,INSD:BP623556.1,INSD:BP595013.1,
FT                   INSD:EG465684.1,INSD:EG430388.1,INSD:EG465707.1,
FT                   INSD:BP649528.1,INSD:EL237455.1,INSD:BP648191.1,
FT                   INSD:ES026124.1,INSD:EG456712.1,INSD:BP791484.1,
FT                   INSD:EL101356.1,INSD:EH831873.1,INSD:BP649526.1,
FT                   INSD:EL335371.1,INSD:DR370611.1,INSD:EG425127.1,
FT                   INSD:EH810049.1"
FT                   /protein_id="AEC05428.1"
FT                   /translation="MVWCKHCAKNVPKIRPFDGGLACDLCGRILENFNFSTDVTFVKNA
FT                   AGQVCNIVTSVGNSSSRDRRRRKAIDELRNLKDALGIGDERDDVVDMAAVFYEAAMDQN
FT                   FTKGRRAELVQSSCLYLACSYLRVSVYELGSVYLQLCEMLYLVQNKNYEELVDPSIFIP
FT                   RFTNSLLKGAHAKAKDVANTAKNIISSMKRDWIQTGRKPSGICGAAIYMAALSHGIMYS
FT                   RADIAKVVHMCEATITKRLNEFANTEAGSLTVDELDESEEILRKETFTPRPNSDKGVVN
FT                   CKHKDLKRFGYGLCKSCHDDFIIISGGVVGGSDPPAYQRAEKERMEKAAREENEGGIGN
FT                   LNHDEQVNVSKRAKKCSEKGEGETYGGERHAEYSDESDICSDDDDSEVEHVLLGEDETR
FT                   LKTTAWNLQNKDYLEEQAEKEAALKAANCPEDARNLVEASKAAVANSRKEKRRKRAEEA
FT                   KNAPPSATATEASYTETQRVNQHHVLDELLDTSPTQKKPRTETVTEKKKEEHEIVEDEE
FT                   DEEDYAAPHADENFYEDEVEEEENGYDFGLY"
FT   mRNA            join(145676..145737,145836..145921,145992..146048,
FT                   146117..146205,146277..146353,146472..146489,
FT                   146602..146714,146856..146944,147028..147114,
FT                   147208..147288,147370..147513,147612..147780,
FT                   147866..147954,148053..148133,148207..148422)
FT                   /gene="MEE65"
FT                   /gene_synonym="F10A8.16"
FT                   /gene_synonym="F10A8_16"
FT                   /gene_synonym="maternal effect embryo arrest 65"
FT                   /locus_tag="AT2G01280"
FT                   /product="Cyclin/Brf1-like TBP-binding protein"
FT   CDS_pept        join(145676..145737,145836..145921,145992..146048,
FT                   146117..146205,146277..146353,146472..146489,
FT                   146602..146714,146856..146944,147028..147114,
FT                   147208..147288,147370..147513,147612..147780,
FT                   147866..147954,148053..148133,148207..148422)
FT                   /codon_start=1
FT                   /gene="MEE65"
FT                   /gene_synonym="F10A8.16"
FT                   /gene_synonym="F10A8_16"
FT                   /gene_synonym="maternal effect embryo arrest 65"
FT                   /locus_tag="AT2G01280"
FT                   /product="Cyclin/Brf1-like TBP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01280"
FT                   /db_xref="GOA:A0A1P8B2F1"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR029529"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B2F1"
FT                   /protein_id="ANM63084.1"
FT                   /translation="MVWCKHCAKNVPKIRPFDGGLACDLCGRILENFNFSTDVTFVKNA
FT                   AGQVCNIVTSVGNSSSRDRRRRKAIDELRNLKDALGIGDERDDVVDMAAVFYEAAMDQN
FT                   FTKGRRAELVQSSCLYLACSYLRVSVYELGSVYLQLCEMLYLVQNKNYEELVDPSIFIP
FT                   RFTNSLLKGAHAKAKDVANTAKNIISSMKRDWIQTGRKPSGICGAAIYMAALSHGIMYS
FT                   RADIAKVVHMCEATITKRLNEFANTEAGSLTVDELDESEEILRKETFTPRPNSDKGVVN
FT                   CKHKDLKRFGYGLCKSCHDDFIIISGGVVGGSDPPAYQRAEKERMEKAAREENEGGIGN
FT                   LNHDEQVNVSKRAKKCSEKGEGETYGGERHAEYSDESDICSDDDDSEVEHVLLGEDETR
FT                   LKTTAWNLQNKDYLEEQAEKEAALKAANCPEDARNLVEASKAAVANSRKEKRRKRAEEA
FT                   KNAPPSATATEAVCRTLERKIKIYSIF"
FT   mRNA            join(145676..145737,145836..145921,145992..146048,
FT                   146117..146205,146277..146353,146472..146489,
FT                   146602..146714,146856..146944,147028..147114,
FT                   147208..147288,147370..147513,147612..147780,
FT                   147866..147954,148053..148406)
FT                   /gene="MEE65"
FT                   /gene_synonym="F10A8.16"
FT                   /gene_synonym="F10A8_16"
FT                   /gene_synonym="maternal effect embryo arrest 65"
FT                   /locus_tag="AT2G01280"
FT                   /product="Cyclin/Brf1-like TBP-binding protein"
FT   CDS_pept        join(145676..145737,145836..145921,145992..146048,
FT                   146117..146205,146277..146353,146472..146489,
FT                   146602..146714,146856..146944,147028..147114,
FT                   147208..147288,147370..147513,147612..147780,
FT                   147866..147954,148053..148244)
FT                   /codon_start=1
FT                   /gene="MEE65"
FT                   /gene_synonym="F10A8.16"
FT                   /gene_synonym="F10A8_16"
FT                   /gene_synonym="maternal effect embryo arrest 65"
FT                   /locus_tag="AT2G01280"
FT                   /product="Cyclin/Brf1-like TBP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01280"
FT                   /db_xref="GOA:A0A1P8B2F7"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR029529"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B2F7"
FT                   /protein_id="ANM63083.1"
FT                   /translation="MVWCKHCAKNVPKIRPFDGGLACDLCGRILENFNFSTDVTFVKNA
FT                   AGQVCNIVTSVGNSSSRDRRRRKAIDELRNLKDALGIGDERDDVVDMAAVFYEAAMDQN
FT                   FTKGRRAELVQSSCLYLACSYLRVSVYELGSVYLQLCEMLYLVQNKNYEELVDPSIFIP
FT                   RFTNSLLKGAHAKAKDVANTAKNIISSMKRDWIQTGRKPSGICGAAIYMAALSHGIMYS
FT                   RADIAKVVHMCEATITKRLNEFANTEAGSLTVDELDESEEILRKETFTPRPNSDKGVVN
FT                   CKHKDLKRFGYGLCKSCHDDFIIISGGVVGGSDPPAYQRAEKERMEKAAREENEGGIGN
FT                   LNHDEQVNVSKRAKKCSEKGEGETYGGERHAEYSDESDICSDDDDSEVEHVLLGEDETR
FT                   LKTTAWNLQNKDYLEVIDRLYHLSSLGFGHSVKNLYCLVGASRKGSSSEGC"
FT   gene            148875..149493
FT                   /locus_tag="AT2G03925"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT2G01290"
FT   ncRNA           148875..149493
FT                   /locus_tag="AT2G03925"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(148919..150585)
FT                   /gene="RPI2"
FT                   /gene_synonym="F10A8.17"
FT                   /gene_synonym="F10A8_17"
FT                   /gene_synonym="ribose-5-phosphate isomerase 2"
FT                   /locus_tag="AT2G01290"
FT                   /note="Cytosolic ribose-5-phosphate isomerase. Knockout
FT                   mutation causes chloroplast dysfunction, late flowering and
FT                   premature cell death."
FT   mRNA            complement(148919..150382)
FT                   /gene="RPI2"
FT                   /gene_synonym="F10A8.17"
FT                   /gene_synonym="F10A8_17"
FT                   /gene_synonym="ribose-5-phosphate isomerase 2"
FT                   /locus_tag="AT2G01290"
FT                   /product="ribose-5-phosphate isomerase 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG420504.1,INSD:BP622580.1,INSD:EG430387.1,
FT                   INSD:EL160680.1,INSD:BP787728.1,INSD:EG423879.1,
FT                   INSD:EG423888.1,INSD:BP629667.1,INSD:EG453947.1,
FT                   INSD:EL155238.1,INSD:BP627195.1,INSD:EG421573.1,
FT                   INSD:EG420502.1,INSD:AV536641.1,INSD:EG420508.1,
FT                   INSD:EH971196.1,INSD:EH932054.1,INSD:BP595133.1,
FT                   INSD:BP595013.1,INSD:EG465684.1,INSD:EG465707.1,
FT                   INSD:BP648191.1,INSD:EG456712.1,INSD:EG423881.1,
FT                   INSD:EL101356.1,INSD:DR350289.1,INSD:BP649526.1,
FT                   INSD:EL335371.1,INSD:EG423894.1,INSD:EG425126.1,
FT                   INSD:EL101808.1,INSD:AV828033.1,INSD:AV800214.1,
FT                   INSD:EG423885.1,INSD:EG420506.1,INSD:EG423874.1,
FT                   INSD:DR350288.1,INSD:EG453948.1,INSD:EG423890.1,
FT                   INSD:EG465551.1,INSD:EL239483.1,INSD:EG465540.1,
FT                   INSD:BP624060.1,INSD:BP834709.1,INSD:BP830057.1,
FT                   INSD:EL977102.1,INSD:BP837557.1,INSD:BP779941.1,
FT                   INSD:EL274594.1,INSD:EG423877.1,INSD:BP623556.1,
FT                   INSD:EG430388.1,INSD:DR350292.1,INSD:BP649528.1,
FT                   INSD:DR350291.1,INSD:EL237455.1,INSD:ES026124.1,
FT                   INSD:BP812362.1,INSD:BP791484.1,INSD:EH831873.1,
FT                   INSD:EL101434.1,INSD:DR370611.1,INSD:EG425127.1,
FT                   INSD:EG423892.1,INSD:EG423883.1,INSD:EH810049.1,
FT                   INSD:DR350290.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY066038.1,INSD:AY054172.1,INSD:BX819220.1"
FT   CDS_pept        complement(149192..149989)
FT                   /codon_start=1
FT                   /gene="RPI2"
FT                   /gene_synonym="F10A8.17"
FT                   /gene_synonym="F10A8_17"
FT                   /gene_synonym="ribose-5-phosphate isomerase 2"
FT                   /locus_tag="AT2G01290"
FT                   /product="ribose-5-phosphate isomerase 2"
FT                   /note="ribose-5-phosphate isomerase 2 (RPI2); CONTAINS
FT                   InterPro DOMAIN/s: Ribose-5-phosphate isomerase, type A,
FT                   subgroup (InterPro:IPR020672), Ribose 5-phosphate
FT                   isomerase, type A (InterPro:IPR004788); BEST Arabidopsis
FT                   thaliana protein match is: Ribose 5-phosphate isomerase,
FT                   type A protein (TAIR:AT1G71100.1); Has 5035 Blast hits to
FT                   5035 proteins in 1937 species: Archae - 235; Bacteria -
FT                   3542; Metazoa - 112; Fungi - 145; Plants - 141; Viruses -
FT                   0; Other Eukaryotes - 860 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01290"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01290.1"
FT                   /db_xref="GOA:Q9ZU38"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU38"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG420504.1,INSD:BP622580.1,INSD:EG430387.1,
FT                   INSD:EL160680.1,INSD:BP787728.1,INSD:EG423879.1,
FT                   INSD:EG423888.1,INSD:BP629667.1,INSD:EG453947.1,
FT                   INSD:EL155238.1,INSD:BP627195.1,INSD:EG421573.1,
FT                   INSD:EG420502.1,INSD:AV536641.1,INSD:EG420508.1,
FT                   INSD:EH971196.1,INSD:EH932054.1,INSD:BP595133.1,
FT                   INSD:BP595013.1,INSD:EG465684.1,INSD:EG465707.1,
FT                   INSD:BP648191.1,INSD:EG456712.1,INSD:EG423881.1,
FT                   INSD:EL101356.1,INSD:DR350289.1,INSD:BP649526.1,
FT                   INSD:EL335371.1,INSD:EG423894.1,INSD:EG425126.1,
FT                   INSD:EL101808.1,INSD:AV828033.1,INSD:AV800214.1,
FT                   INSD:EG423885.1,INSD:EG420506.1,INSD:EG423874.1,
FT                   INSD:DR350288.1,INSD:EG453948.1,INSD:EG423890.1,
FT                   INSD:EG465551.1,INSD:EL239483.1,INSD:EG465540.1,
FT                   INSD:BP624060.1,INSD:BP834709.1,INSD:BP830057.1,
FT                   INSD:EL977102.1,INSD:BP837557.1,INSD:BP779941.1,
FT                   INSD:EL274594.1,INSD:EG423877.1,INSD:BP623556.1,
FT                   INSD:EG430388.1,INSD:DR350292.1,INSD:BP649528.1,
FT                   INSD:DR350291.1,INSD:EL237455.1,INSD:ES026124.1,
FT                   INSD:BP812362.1,INSD:BP791484.1,INSD:EH831873.1,
FT                   INSD:EL101434.1,INSD:DR370611.1,INSD:EG425127.1,
FT                   INSD:EG423892.1,INSD:EG423883.1,INSD:EH810049.1,
FT                   INSD:DR350290.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY066038.1,INSD:AY054172.1,INSD:BX819220.1"
FT                   /protein_id="AEC05429.1"
FT                   /translation="MALAYDPLFITSDKSLSAFDVASSPPQPMNLTQDELKRIAAYKAV
FT                   EFVESGMVLGLGTGSTAKHAVDRIGELLRQGKLENIVGIPTSKKTQEQALSLGIPLSDL
FT                   DAHPVIDLSIDGADEVDPFLNLVKGRGGSLLREKMIEGASKKFVVIVDDSKMVKHIGGS
FT                   KLALPVEIVPFCWKFTAEKLRSLLEGYGCEANLRLGEKGKAFVTDNGNYIVDMHVEEDM
FT                   GDLGAVSDAILRLPGVVEHGMFLDMASTVIIAGELGVKIKNKH"
FT   gene            complement(151057..151971)
FT                   /gene_synonym="F10A8.18"
FT                   /gene_synonym="F10A8_18"
FT                   /locus_tag="AT2G01300"
FT   mRNA            complement(151057..151971)
FT                   /gene_synonym="F10A8.18"
FT                   /gene_synonym="F10A8_18"
FT                   /locus_tag="AT2G01300"
FT                   /product="mediator of RNA polymerase II transcription
FT                   subunit"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG425134.1,INSD:EG420517.1,INSD:DR244509.1,
FT                   INSD:EG423896.1,INSD:EL276407.1,INSD:EG418946.1,
FT                   INSD:EG425136.1,INSD:EG423779.1,INSD:EG423763.1,
FT                   INSD:EG422056.1,INSD:EG425647.1,INSD:EG420543.1,
FT                   INSD:EG423761.1,INSD:DR287675.1,INSD:EG425648.1,
FT                   INSD:EH830587.1,INSD:EG420539.1,INSD:AV824533.1,
FT                   INSD:EG420535.1,INSD:EG420533.1,INSD:EL249419.1,
FT                   INSD:EG422059.1,INSD:EG423898.1,INSD:EG422062.1,
FT                   INSD:EG420541.1,INSD:EG420524.1,INSD:EG423759.1,
FT                   INSD:EG420518.1,INSD:EG425646.1,INSD:EG418940.1,
FT                   INSD:DR380231.1,INSD:EG418949.1,INSD:AV786536.1,
FT                   INSD:DR244508.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY065356.1,INSD:AY117184.1,INSD:AY600542.1,
FT                   INSD:AY084896.1"
FT   CDS_pept        complement(151221..151691)
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.18"
FT                   /gene_synonym="F10A8_18"
FT                   /locus_tag="AT2G01300"
FT                   /product="mediator of RNA polymerase II transcription
FT                   subunit"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT1G15010.1); Has 73 Blast
FT                   hits to 73 proteins in 12 species: Archae - 0; Bacteria -
FT                   0; Metazoa - 0; Fungi - 0; Plants - 73; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01300.1"
FT                   /db_xref="GOA:Q9ZU37"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZU37"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG425134.1,INSD:EG420517.1,INSD:DR244509.1,
FT                   INSD:EG423896.1,INSD:EL276407.1,INSD:EG418946.1,
FT                   INSD:EG425136.1,INSD:EG423779.1,INSD:EG423763.1,
FT                   INSD:EG422056.1,INSD:EG425647.1,INSD:EG420543.1,
FT                   INSD:EG423761.1,INSD:DR287675.1,INSD:EG425648.1,
FT                   INSD:EH830587.1,INSD:EG420539.1,INSD:AV824533.1,
FT                   INSD:EG420535.1,INSD:EG420533.1,INSD:EL249419.1,
FT                   INSD:EG422059.1,INSD:EG423898.1,INSD:EG422062.1,
FT                   INSD:EG420541.1,INSD:EG420524.1,INSD:EG423759.1,
FT                   INSD:EG420518.1,INSD:EG425646.1,INSD:EG418940.1,
FT                   INSD:DR380231.1,INSD:EG418949.1,INSD:AV786536.1,
FT                   INSD:DR244508.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY065356.1,INSD:AY117184.1,INSD:AY600542.1,
FT                   INSD:AY084896.1"
FT                   /protein_id="AEC05430.1"
FT                   /translation="MEATLFSSPPSISPLRFHPLVLSQRAIIPKKKKMTMRVSAAASSG
FT                   KDHYYGGGRLVDENMIVLRKRIHEMKMVERNYEPPSHWMDWEKRFYNSYDSVICDSVGL
FT                   LQSFLMNSRPTVAIATLLFLLVSVPVSSTVIAFRLIDLLHWLLAAATSAHVA"
FT   gene            complement(152298..152827)
FT                   /gene_synonym="F10A8.19"
FT                   /gene_synonym="F10A8_19"
FT                   /locus_tag="AT2G01310"
FT   mRNA            complement(152298..152827)
FT                   /gene_synonym="F10A8.19"
FT                   /gene_synonym="F10A8_19"
FT                   /locus_tag="AT2G01310"
FT                   /product="hypothetical protein"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT026002.1,INSD:AY261788.1"
FT   CDS_pept        complement(152481..152642)
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.19"
FT                   /gene_synonym="F10A8_19"
FT                   /locus_tag="AT2G01310"
FT                   /product="hypothetical protein"
FT                   /note="BEST Arabidopsis thaliana protein match is:
FT                   cyclin-dependent protein kinase 3;2 (TAIR:AT1G47210.1); Has
FT                   37 Blast hits to 37 proteins in 6 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 37; Viruses
FT                   - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01310"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01310.1"
FT                   /db_xref="GOA:Q9ZU36"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZU36"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT026002.1,INSD:AY261788.1"
FT                   /protein_id="AEC05431.1"
FT                   /translation="MMEQEIWVRVTRAAAKRKASTAMGIDEDRLNKKRVFLGELLNVSN
FT                   VNLLSNLN"
FT   gene            complement(154097..158204)
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT   mRNA            complement(join(154097..154500,154677..154983,
FT                   155061..155145,155240..155452,155621..155841,
FT                   155940..156071,156384..156660,156760..156961,
FT                   157050..157182,157279..157429,157509..157699,
FT                   157806..158182))
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES180379.1,INSD:EL289590.1,INSD:BP650518.1,
FT                   INSD:BP791746.1,INSD:BP817522.1,INSD:BE527126.1,
FT                   INSD:ES066750.1,INSD:ES038688.1,INSD:ES033925.1,
FT                   INSD:EL310129.1,INSD:BP821257.1,INSD:BX839593.1,
FT                   INSD:DR368588.1,INSD:ES011664.1,INSD:BP846491.1,
FT                   INSD:BX839207.1,INSD:BP649492.1,INSD:EL102054.1,
FT                   INSD:BX839737.1,INSD:ES066780.1,INSD:BP561220.2,
FT                   INSD:EL059766.1,INSD:EH812294.1,INSD:AA041094.1,
FT                   INSD:BP818375.1,INSD:BP648375.1,INSD:ES043701.1,
FT                   INSD:BP786331.1,INSD:BX839137.1,INSD:AV795192.1,
FT                   INSD:AV827197.1,INSD:BP783683.1,INSD:EH873395.1,
FT                   INSD:BP637095.1,INSD:BP780737.1,INSD:BP836965.1,
FT                   INSD:BP837562.1,INSD:BX839423.1,INSD:BP836008.1,
FT                   INSD:AV529792.1,INSD:AV523999.1,INSD:ES185869.1,
FT                   INSD:ES121515.1,INSD:AV792401.1"
FT   mRNA            complement(join(154131..154503,154677..154983,
FT                   155061..155145,155240..155452,155621..155841,
FT                   155940..156071,156384..156660,156760..156961,
FT                   157050..157182,157279..157429,157509..157699,
FT                   157806..158204))
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES180379.1,INSD:EL289590.1,INSD:AV801065.1,
FT                   INSD:BP652737.1,INSD:BP637501.1,INSD:AV793373.1,
FT                   INSD:BP817522.1,INSD:BE527126.1,INSD:ES038688.1,
FT                   INSD:ES066750.1,INSD:ES033925.1,INSD:EL310129.1,
FT                   INSD:BP638399.1,INSD:BP821257.1,INSD:BX839593.1,
FT                   INSD:DR368588.1,INSD:ES011664.1,INSD:BP846491.1,
FT                   INSD:BX839207.1,INSD:EL102054.1,INSD:BX839737.1,
FT                   INSD:BP782506.1,INSD:ES066780.1,INSD:BP561220.2,
FT                   INSD:EL059766.1,INSD:EH812294.1,INSD:AA041094.1,
FT                   INSD:BP818375.1,INSD:ES043701.1,INSD:BP649337.1,
FT                   INSD:BP646256.1,INSD:BP644731.1,INSD:BX839137.1,
FT                   INSD:AV827197.1,INSD:EH873395.1,INSD:BP836965.1,
FT                   INSD:BP837562.1,INSD:BX839423.1,INSD:BP641148.1,
FT                   INSD:AV791247.1,INSD:BP836008.1,INSD:AV529792.1,
FT                   INSD:AV785572.1,INSD:ES185869.1,INSD:ES121515.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX820795.1"
FT   mRNA            complement(join(154222..154983,155061..155145,
FT                   155240..155452,155621..155841,155940..156071,
FT                   156384..156660,156760..156961,157050..157182,
FT                   157279..157429,157509..157699,157806..158204))
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP788083.1,INSD:ES180379.1,INSD:EL289590.1,
FT                   INSD:BP817522.1,INSD:BE527126.1,INSD:ES066750.1,
FT                   INSD:EL310129.1,INSD:EL157613.1,INSD:BP821257.1,
FT                   INSD:BX839593.1,INSD:DR368588.1,INSD:BP846491.1,
FT                   INSD:BX839207.1,INSD:EL102054.1,INSD:BX839737.1,
FT                   INSD:ES066780.1,INSD:BP561220.2,INSD:EL059766.1,
FT                   INSD:BX835455.1,INSD:BP661581.1,INSD:EH812294.1,
FT                   INSD:AA041094.1,INSD:BP818375.1,INSD:EH988586.1,
FT                   INSD:AV797498.1,INSD:BX835762.1,INSD:BX839137.1,
FT                   INSD:AV827197.1,INSD:EH873395.1,INSD:BX835685.1,
FT                   INSD:BP836965.1,INSD:BP837562.1,INSD:BX839423.1,
FT                   INSD:BP836008.1,INSD:AV529792.1,INSD:ES185869.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF367318.1,INSD:AY133617.1"
FT   mRNA            complement(join(154414..154500,154677..155145,
FT                   155240..155452,155621..155841,155940..156071,
FT                   156384..156660,156760..156961,157050..157182,
FT                   157279..157429,157509..157699,157806..158182))
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT   mRNA            complement(join(154428..154500,154611..154983,
FT                   155061..155145,155240..155452,155621..155841,
FT                   155940..156071,156384..156660,156760..156961,
FT                   157050..157182,157279..157429,157509..157699,
FT                   157806..158182))
FT                   /gene="ABCG7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX836659.1,INSD:ES180379.1,INSD:EL289590.1,
FT                   INSD:BP817522.1,INSD:BE527126.1,INSD:ES038688.1,
FT                   INSD:ES066750.1,INSD:ES033925.1,INSD:EL310129.1,
FT                   INSD:EL157613.1,INSD:BP821257.1,INSD:BX839593.1,
FT                   INSD:DR368588.1,INSD:BP846491.1,INSD:BX839207.1,
FT                   INSD:EL102054.1,INSD:BX839737.1,INSD:ES066780.1,
FT                   INSD:EL059766.1,INSD:BP561220.2,INSD:EH812294.1,
FT                   INSD:AA041094.1,INSD:BP818375.1,INSD:EH988586.1,
FT                   INSD:BX839137.1,INSD:AV827197.1,INSD:EH873395.1,
FT                   INSD:BP836965.1,INSD:BP837562.1,INSD:BX839423.1,
FT                   INSD:BP836008.1,INSD:AV529792.1,INSD:ES185869.1,
FT                   INSD:ES121515.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY133617.1"
FT   CDS_pept        complement(join(154487..154500,154677..154983,
FT                   155061..155145,155240..155452,155621..155841,
FT                   155940..156071,156384..156660,156760..156961,
FT                   157050..157182,157279..157429,157509..157699,
FT                   157806..158063))
FT                   /codon_start=1
FT                   /gene="ABCG7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /note="ABC-2 type transporter family protein; FUNCTIONS IN:
FT                   ATPase activity, coupled to transmembrane movement of
FT                   substances; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: ATPase, AAA+ type, core
FT                   (InterPro:IPR003593), ABC transporter-like
FT                   (InterPro:IPR003439), ABC-2 type transporter
FT                   (InterPro:IPR013525), ABC transporter, conserved site
FT                   (InterPro:IPR017871); BEST Arabidopsis thaliana protein
FT                   match is: ABC-2 type transporter family protein
FT                   (TAIR:AT3G25620.2); Has 387358 Blast hits to 354249
FT                   proteins in 4108 species: Archae - 7085; Bacteria - 307995;
FT                   Metazoa - 8597; Fungi - 6708; Plants - 5391; Viruses - 19;
FT                   Other Eukaryotes - 51563 (source: NCBI BLink)."
FT                   /db_xref="GOA:A0NAA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0NAA8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES180379.1,INSD:EL289590.1,INSD:AV801065.1,
FT                   INSD:BP652737.1,INSD:BP637501.1,INSD:AV793373.1,
FT                   INSD:BP817522.1,INSD:BE527126.1,INSD:ES038688.1,
FT                   INSD:ES066750.1,INSD:ES033925.1,INSD:EL310129.1,
FT                   INSD:BP638399.1,INSD:BP821257.1,INSD:BX839593.1,
FT                   INSD:DR368588.1,INSD:ES011664.1,INSD:BP846491.1,
FT                   INSD:BX839207.1,INSD:EL102054.1,INSD:BX839737.1,
FT                   INSD:BP782506.1,INSD:ES066780.1,INSD:BP561220.2,
FT                   INSD:EL059766.1,INSD:EH812294.1,INSD:AA041094.1,
FT                   INSD:BP818375.1,INSD:ES043701.1,INSD:BP649337.1,
FT                   INSD:BP646256.1,INSD:BP644731.1,INSD:BX839137.1,
FT                   INSD:AV827197.1,INSD:EH873395.1,INSD:BP836965.1,
FT                   INSD:BP837562.1,INSD:BX839423.1,INSD:BP641148.1,
FT                   INSD:AV791247.1,INSD:BP836008.1,INSD:AV529792.1,
FT                   INSD:AV785572.1,INSD:ES185869.1,INSD:ES121515.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX820795.1"
FT                   /protein_id="AEC05432.1"
FT                   /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIALL
FT                   PEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGRLL
FT                   AIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLFFSQ
FT                   LTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISGGEKK
FT                   RLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPRGSVYA
FT                   KFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYSSSETVY
FT                   SSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWRQFFLLLK
FT                   RAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVAAINTAMAA
FT                   LTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGAVLYPMARLN
FT                   PTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFIVFGGYYVNAD
FT                   NTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQALERLSFGGRRIRE
FT                   TIAAQSRILMFWYSATYLLLEKNKPKYQKLELLVDNGETGNSGVQLDKAEVDQTEKPED
FT                   DDINQPLDDQNQTSDSDDELDEIRPFVLEGSKV"
FT   CDS_pept        complement(join(154487..154503,154677..154983,
FT                   155061..155145,155240..155452,155621..155841,
FT                   155940..156071,156384..156660,156760..156961,
FT                   157050..157182,157279..157429,157509..157699,
FT                   157806..158063))
FT                   /codon_start=1
FT                   /gene="ABCG7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /note="ABC-2 type transporter family protein; FUNCTIONS IN:
FT                   ATPase activity, coupled to transmembrane movement of
FT                   substances; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: ATPase, AAA+ type, core
FT                   (InterPro:IPR003593), ABC transporter-like
FT                   (InterPro:IPR003439), ABC-2 type transporter
FT                   (InterPro:IPR013525), ABC transporter, conserved site
FT                   (InterPro:IPR017871); BEST Arabidopsis thaliana protein
FT                   match is: ABC-2 type transporter family protein
FT                   (TAIR:AT3G25620.2); Has 387349 Blast hits to 354243
FT                   proteins in 4108 species: Archae - 7085; Bacteria - 307989;
FT                   Metazoa - 8597; Fungi - 6708; Plants - 5387; Viruses - 19;
FT                   Other Eukaryotes - 51564 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9ZU35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU35"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES180379.1,INSD:EL289590.1,INSD:BP650518.1,
FT                   INSD:BP791746.1,INSD:BP817522.1,INSD:BE527126.1,
FT                   INSD:ES066750.1,INSD:ES038688.1,INSD:ES033925.1,
FT                   INSD:EL310129.1,INSD:BP821257.1,INSD:BX839593.1,
FT                   INSD:DR368588.1,INSD:ES011664.1,INSD:BP846491.1,
FT                   INSD:BX839207.1,INSD:BP649492.1,INSD:EL102054.1,
FT                   INSD:BX839737.1,INSD:ES066780.1,INSD:BP561220.2,
FT                   INSD:EL059766.1,INSD:EH812294.1,INSD:AA041094.1,
FT                   INSD:BP818375.1,INSD:BP648375.1,INSD:ES043701.1,
FT                   INSD:BP786331.1,INSD:BX839137.1,INSD:AV795192.1,
FT                   INSD:AV827197.1,INSD:BP783683.1,INSD:EH873395.1,
FT                   INSD:BP637095.1,INSD:BP780737.1,INSD:BP836965.1,
FT                   INSD:BP837562.1,INSD:BX839423.1,INSD:BP836008.1,
FT                   INSD:AV529792.1,INSD:AV523999.1,INSD:ES185869.1,
FT                   INSD:ES121515.1,INSD:AV792401.1"
FT                   /protein_id="AEC05434.1"
FT                   /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIALL
FT                   PEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGRLL
FT                   AIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLFFSQ
FT                   LTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISGGEKK
FT                   RLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPRGSVYA
FT                   KFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYSSSETVY
FT                   SSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWRQFFLLLK
FT                   RAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVAAINTAMAA
FT                   LTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGAVLYPMARLN
FT                   PTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFIVFGGYYVNAD
FT                   NTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQALERLSFGGRRIRE
FT                   TIAAQSRILMFWYSATYLLLEKNKPKYQKLELLVDNGETGNSGVQLDKAEVDQTEKPED
FT                   DDINQPLDDQNQTSDSDDELDEIRPFVLEAGSKV"
FT   mRNA            complement(join(154504..154983,155061..155145,
FT                   155240..155841,155940..156071,156384..156660,
FT                   156760..156961,157050..157182,157279..157429,
FT                   157509..157699,157806..158182))
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT   mRNA            complement(join(154504..154983,155061..155841,
FT                   155940..156071,156384..156660,156760..156961,
FT                   157050..157182,157279..157429,157509..157699,
FT                   157806..158182))
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT   mRNA            complement(join(154533..155145,155240..155452,
FT                   155621..155841,155940..156071,156384..156660,
FT                   156760..156961,157050..157182,157279..157429,
FT                   157509..157699,157806..158182))
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT   CDS_pept        complement(join(154669..154983,155061..155145,
FT                   155240..155452,155621..155841,155940..156071,
FT                   156384..156660,156760..156961,157050..157182,
FT                   157279..157429,157509..157699,157806..158063))
FT                   /codon_start=1
FT                   /gene="ABCG7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /note="ABC-2 type transporter family protein; FUNCTIONS IN:
FT                   ATPase activity, coupled to transmembrane movement of
FT                   substances; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: ATPase, AAA+ type, core
FT                   (InterPro:IPR003593), ABC transporter-like
FT                   (InterPro:IPR003439), ABC-2 type transporter
FT                   (InterPro:IPR013525), ABC transporter, conserved site
FT                   (InterPro:IPR017871); BEST Arabidopsis thaliana protein
FT                   match is: ABC-2 type transporter family protein
FT                   (TAIR:AT3G25620.2); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9ZU35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU35"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX836659.1,INSD:ES180379.1,INSD:EL289590.1,
FT                   INSD:BP817522.1,INSD:BE527126.1,INSD:ES038688.1,
FT                   INSD:ES066750.1,INSD:ES033925.1,INSD:EL310129.1,
FT                   INSD:EL157613.1,INSD:BP821257.1,INSD:BX839593.1,
FT                   INSD:DR368588.1,INSD:BP846491.1,INSD:BX839207.1,
FT                   INSD:EL102054.1,INSD:BX839737.1,INSD:ES066780.1,
FT                   INSD:EL059766.1,INSD:BP561220.2,INSD:EH812294.1,
FT                   INSD:AA041094.1,INSD:BP818375.1,INSD:EH988586.1,
FT                   INSD:BX839137.1,INSD:AV827197.1,INSD:EH873395.1,
FT                   INSD:BP836965.1,INSD:BP837562.1,INSD:BX839423.1,
FT                   INSD:BP836008.1,INSD:AV529792.1,INSD:ES185869.1,
FT                   INSD:ES121515.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY133617.1"
FT                   /protein_id="AEC05433.1"
FT                   /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIALL
FT                   PEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGRLL
FT                   AIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLFFSQ
FT                   LTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISGGEKK
FT                   RLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPRGSVYA
FT                   KFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYSSSETVY
FT                   SSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWRQFFLLLK
FT                   RAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVAAINTAMAA
FT                   LTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGAVLYPMARLN
FT                   PTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFIVFGGYYVNAD
FT                   NTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQALERLSFGGRRIRE
FT                   TIAAQSRILMFWYSATYLLLEKNKPKYQKLELLVDNGETGNSGVQLDKAEVDQTEKPED
FT                   DDINQPLDDQNQTSDSDDELDEIRPFVLEGL"
FT   CDS_pept        complement(join(154669..154983,155061..155145,
FT                   155240..155452,155621..155841,155940..156071,
FT                   156384..156660,156760..156961,157050..157182,
FT                   157279..157429,157509..157699,157806..158063))
FT                   /codon_start=1
FT                   /gene="ABCG7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /note="ABC-2 type transporter family protein; FUNCTIONS IN:
FT                   ATPase activity, coupled to transmembrane movement of
FT                   substances; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: ATPase, AAA+ type, core
FT                   (InterPro:IPR003593), ABC transporter-like
FT                   (InterPro:IPR003439), ABC transporter, conserved site
FT                   (InterPro:IPR017871), ABC-2 type transporter
FT                   (InterPro:IPR013525); BEST Arabidopsis thaliana protein
FT                   match is: ABC-2 type transporter family protein
FT                   (TAIR:AT3G25620.2); Has 387535 Blast hits to 354405
FT                   proteins in 4108 species: Archae - 7090; Bacteria - 308145;
FT                   Metazoa - 8600; Fungi - 6710; Plants - 5407; Viruses - 19;
FT                   Other Eukaryotes - 51564 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01320"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01320.1"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01320.4"
FT                   /db_xref="GOA:Q9ZU35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU35"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP788083.1,INSD:ES180379.1,INSD:EL289590.1,
FT                   INSD:BP817522.1,INSD:BE527126.1,INSD:ES066750.1,
FT                   INSD:EL310129.1,INSD:EL157613.1,INSD:BP821257.1,
FT                   INSD:BX839593.1,INSD:DR368588.1,INSD:BP846491.1,
FT                   INSD:BX839207.1,INSD:EL102054.1,INSD:BX839737.1,
FT                   INSD:ES066780.1,INSD:BP561220.2,INSD:EL059766.1,
FT                   INSD:BX835455.1,INSD:BP661581.1,INSD:EH812294.1,
FT                   INSD:AA041094.1,INSD:BP818375.1,INSD:EH988586.1,
FT                   INSD:AV797498.1,INSD:BX835762.1,INSD:BX839137.1,
FT                   INSD:AV827197.1,INSD:EH873395.1,INSD:BX835685.1,
FT                   INSD:BP836965.1,INSD:BP837562.1,INSD:BX839423.1,
FT                   INSD:BP836008.1,INSD:AV529792.1,INSD:ES185869.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF367318.1,INSD:AY133617.1"
FT                   /protein_id="AEC05435.1"
FT                   /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIALL
FT                   PEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGRLL
FT                   AIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLFFSQ
FT                   LTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISGGEKK
FT                   RLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPRGSVYA
FT                   KFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYSSSETVY
FT                   SSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWRQFFLLLK
FT                   RAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVAAINTAMAA
FT                   LTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGAVLYPMARLN
FT                   PTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFIVFGGYYVNAD
FT                   NTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQALERLSFGGRRIRE
FT                   TIAAQSRILMFWYSATYLLLEKNKPKYQKLELLVDNGETGNSGVQLDKAEVDQTEKPED
FT                   DDINQPLDDQNQTSDSDDELDEIRPFVLEGL"
FT   CDS_pept        complement(join(154977..155145,155240..155452,
FT                   155621..155841,155940..156071,156384..156660,
FT                   156760..156961,157050..157182,157279..157429,
FT                   157509..157699,157806..158063))
FT                   /codon_start=1
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /db_xref="GOA:A0A1P8B1W8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B1W8"
FT                   /protein_id="ANM62898.1"
FT                   /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIALL
FT                   PEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGRLL
FT                   AIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLFFSQ
FT                   LTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISGGEKK
FT                   RLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPRGSVYA
FT                   KFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYSSSETVY
FT                   SSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWRQFFLLLK
FT                   RAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVAAINTAMAA
FT                   LTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGAVLYPMARLN
FT                   PTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFIVFGGYYVNAD
FT                   NTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQVTISSCQTPFIASV
FT                   YKVIGGYIMFGRR"
FT   CDS_pept        complement(join(154977..155145,155240..155452,
FT                   155621..155841,155940..156071,156384..156660,
FT                   156760..156961,157050..157182,157279..157429,
FT                   157509..157699,157806..158063))
FT                   /codon_start=1
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01320"
FT                   /db_xref="GOA:A0A1P8B1W8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B1W8"
FT                   /protein_id="ANM62899.1"
FT                   /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIALL
FT                   PEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGRLL
FT                   AIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLFFSQ
FT                   LTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISGGEKK
FT                   RLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPRGSVYA
FT                   KFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYSSSETVY
FT                   SSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWRQFFLLLK
FT                   RAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVAAINTAMAA
FT                   LTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGAVLYPMARLN
FT                   PTLSRFGKFCGIVTVESFAASAMGLTVGAMVPSTEAAMAVGPSLMTVFIVFGGYYVNAD
FT                   NTPIIFRWIPRASLIRWAFQGLCINEFSGLKFDHQNTFDVQTGEQVTISSCQTPFIASV
FT                   YKVIGGYIMFGRR"
FT   CDS_pept        complement(join(155617..155841,155940..156071,
FT                   156384..156660,156760..156961,157050..157182,
FT                   157279..157429,157509..157699,157806..158063))
FT                   /codon_start=1
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /db_xref="GOA:A0A1P8B1X3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B1X3"
FT                   /protein_id="ANM62900.1"
FT                   /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIALL
FT                   PEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGRLL
FT                   AIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLFFSQ
FT                   LTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISGGEKK
FT                   RLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPRGSVYA
FT                   KFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYSSSETVY
FT                   SSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWRQFFLLLK
FT                   RAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVAAINTAMAA
FT                   LTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGAVLYPMARLN
FT                   PTLSR"
FT   CDS_pept        complement(join(155617..155841,155940..156071,
FT                   156384..156660,156760..156961,157050..157182,
FT                   157279..157429,157509..157699,157806..158063))
FT                   /codon_start=1
FT                   /gene="ABCG7"
FT                   /gene_synonym="ATP-binding cassette G7"
FT                   /gene_synonym="F10A8.20"
FT                   /gene_synonym="F10A8_20"
FT                   /locus_tag="AT2G01320"
FT                   /product="ABC-2 type transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01320"
FT                   /db_xref="GOA:A0A1P8B1X3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B1X3"
FT                   /protein_id="ANM62901.1"
FT                   /translation="MAPFGGKSLADVVSGIGGNGVGGALAAVAAALLVRLFAGPGIALL
FT                   PEDEAEDDYAETEDGGGDSIRPVTIRWRNITCSLSDKSSKSVRFLLKNVSGEAKPGRLL
FT                   AIMGPSGSGKTTLLNVLAGQLSLSPRLHLSGLLEVNGKPSSSKAYKLAFVRQEDLFFSQ
FT                   LTVRETLSFAAELQLPEISSAEERDEYVNNLLLKLGLVSCADSCVGDAKVRGISGGEKK
FT                   RLSLACELIASPSVIFADEPTTGLDAFQAEKVMETLQKLAQDGHTVICSIHQPRGSVYA
FT                   KFDDIVLLTEGTLVYAGPAGKEPLTYFGNFGFLCPEHVNPAEFLADLISVDYSSSETVY
FT                   SSQKRVHALVDAFSQRSSSVLYATPLSMKEETKNGMRPRRKAIVERTDGWWRQFFLLLK
FT                   RAWMQASRDGPTNKVRARMSVASAVIFGSVFWRMGKSQTSIQDRMGLLQVAAINTAMAA
FT                   LTKTVGVFPKERAIVDRERSKGSYSLGPYLLSKTIAEIPIGAAFPLMFGAVLYPMARLN
FT                   PTLSR"
FT   gene            complement(158183..160870)
FT                   /gene_synonym="F10A8.21"
FT                   /gene_synonym="F10A8_21"
FT                   /locus_tag="AT2G01330"
FT   mRNA            complement(join(158183..158674,158761..159174,
FT                   159275..159697,159771..159957,160042..160203,
FT                   160364..160870))
FT                   /gene_synonym="F10A8.21"
FT                   /gene_synonym="F10A8_21"
FT                   /locus_tag="AT2G01330"
FT                   /product="nucleotide binding protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI995430.1,INSD:BX839321.1,INSD:BX835552.1"
FT   CDS_pept        complement(join(158417..158674,158761..159174,
FT                   159275..159697,159771..159957,160042..160203,
FT                   160364..160755))
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.21"
FT                   /gene_synonym="F10A8_21"
FT                   /locus_tag="AT2G01330"
FT                   /product="nucleotide binding protein"
FT                   /note="nucleotide binding; CONTAINS InterPro DOMAIN/s: WD40
FT                   repeat 2 (InterPro:IPR019782), WD40 repeat-like-containing
FT                   domain (InterPro:IPR011046), WD40 repeat, conserved site
FT                   (InterPro:IPR019775), WD40-repeat-containing domain
FT                   (InterPro:IPR017986), WD40/YVTN repeat-like-containing
FT                   domain (InterPro:IPR015943), WD40 repeat
FT                   (InterPro:IPR001680), WD40 repeat, subgroup
FT                   (InterPro:IPR019781); BEST Arabidopsis thaliana protein
FT                   match is: transducin family protein / WD-40 repeat family
FT                   protein (TAIR:AT3G18060.1); Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01330"
FT                   /db_xref="GOA:Q9ZU34"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU34"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI995430.1,INSD:BX839321.1,INSD:BX835552.1"
FT                   /protein_id="AEC05436.1"
FT                   /translation="MAKLLETFPCVPSTERGRGILISGDSKSDTILYCNGRSVFIRSLR
FT                   QLQDVQVYGEHGYAVTVARYSPNGEWIASADVSGTVRVWGTHNGFVLKNEFRVLAGRVD
FT                   DLQWSFDGLRIVASGDGKGKSLVRSFAWDSGNTMGDFDGHSRRVLSCAFKPTRPFRIAT
FT                   CGEDFLVNFYDGPPFKFHSSHREHSNFVNCIRYSPDGTKFITVSSDKKGMIYDGKTGDK
FT                   VGELASEDGHKGSIYAVSWSPDSKRVLTVSADKSAKVWEVAEDGTIGSVIKTLSFMESG
FT                   GAEDMLVGCLWQNDHLITVSLGGTMSLFSADDMDKPPLLLSGHIKNVTSLAVLGENQKT
FT                   ILSCSYDGLIVKWLKGVGYSCKLQMKDTKIKRLAATESSIFISGYDNMVWRIPLTDNGY
FT                   GAAEHVDIGHQPLDISIAVDSPEATALVSFDSGVVLLNGLNILSKIDLGFAVAASVISP
FT                   DGKEAIVGGQDGKLHIYSVSGDNNLKEEAVLEKHRGALTVIRYSPDLTMFASGDANREA
FT                   VVWDRETKQVKLNNMLFHTARINSLAWSPNNKMVATGSIDTCVIVYEVDKPASSRITAR
FT                   NAHLGGVNAVAFIDDCTVASSGEDASVRLWHIEPQ"
FT   gene            163954..165290
FT                   /gene="At17.1"
FT                   /gene_synonym="F10A8.22"
FT                   /gene_synonym="F10A8_22"
FT                   /locus_tag="AT2G01340"
FT                   /note="Encodes a protein whose expression is responsive to
FT                   nematode infection."
FT   mRNA            join(163954..164187,164293..164709,165012..165290)
FT                   /gene="At17.1"
FT                   /gene_synonym="F10A8.22"
FT                   /gene_synonym="F10A8_22"
FT                   /locus_tag="AT2G01340"
FT                   /product="plastid movement impaired protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH817971.1,INSD:AI998967.1,INSD:DR381991.1,
FT                   INSD:EG489968.1,INSD:EG489970.1,INSD:DR370452.1,
FT                   INSD:BP647323.1,INSD:DR195639.1,INSD:DR195637.1,
FT                   INSD:AV567706.1,INSD:F20095.1,INSD:EL063974.1,
FT                   INSD:EL116407.1,INSD:EG489951.1,INSD:EG489947.1,
FT                   INSD:BP625400.1,INSD:EG489975.1,INSD:BP828310.1,
FT                   INSD:EG489946.1,INSD:EL341023.1,INSD:EG489949.1,
FT                   INSD:AV552747.1,INSD:EG489976.1,INSD:EG489992.1,
FT                   INSD:ES133712.1,INSD:AA605560.1,INSD:BP640790.1,
FT                   INSD:EG489969.1,INSD:AV788779.1,INSD:ES203190.1,
FT                   INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
FT                   INSD:ES142510.1,INSD:AA597480.1,INSD:AV807584.1,
FT                   INSD:AU229941.1,INSD:AV824928.1,INSD:DR195635.1,
FT                   INSD:EG489994.1,INSD:EG489989.1,INSD:EH978378.1,
FT                   INSD:DR382969.1,INSD:BP654757.1,INSD:EL057912.1,
FT                   INSD:DR195638.1,INSD:DR376100.1,INSD:EG489995.1,
FT                   INSD:EG489997.1,INSD:EH796977.1,INSD:EG489990.1,
FT                   INSD:AV561135.1,INSD:EG489971.1,INSD:EG489948.1,
FT                   INSD:EH965219.1,INSD:AV544254.1,INSD:EH907781.1,
FT                   INSD:DR195636.1,INSD:H77204.1,INSD:AA597406.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK226497.1,INSD:BT025275.1,INSD:BT021987.1"
FT   CDS_pept        join(164014..164187,164293..164709,165012..165068)
FT                   /codon_start=1
FT                   /gene="At17.1"
FT                   /gene_synonym="F10A8.22"
FT                   /gene_synonym="F10A8_22"
FT                   /locus_tag="AT2G01340"
FT                   /product="plastid movement impaired protein"
FT                   /note="At17.1; FUNCTIONS IN: molecular_function unknown;
FT                   INVOLVED IN: N-terminal protein myristoylation, response to
FT                   nematode; LOCATED IN: plasma membrane; BEST Arabidopsis
FT                   thaliana protein match is: plastid movement impaired 2
FT                   (TAIR:AT1G66480.1); Has 110 Blast hits to 110 proteins in
FT                   13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 107; Viruses - 0; Other Eukaryotes - 3 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01340"
FT                   /db_xref="GOA:Q52K81"
FT                   /db_xref="InterPro:IPR025322"
FT                   /db_xref="UniProtKB/TrEMBL:Q52K81"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH817971.1,INSD:AI998967.1,INSD:DR381991.1,
FT                   INSD:EG489968.1,INSD:EG489970.1,INSD:DR370452.1,
FT                   INSD:BP647323.1,INSD:DR195639.1,INSD:DR195637.1,
FT                   INSD:AV567706.1,INSD:F20095.1,INSD:EL063974.1,
FT                   INSD:EL116407.1,INSD:EG489951.1,INSD:EG489947.1,
FT                   INSD:BP625400.1,INSD:EG489975.1,INSD:BP828310.1,
FT                   INSD:EG489946.1,INSD:EL341023.1,INSD:EG489949.1,
FT                   INSD:AV552747.1,INSD:EG489976.1,INSD:EG489992.1,
FT                   INSD:ES133712.1,INSD:AA605560.1,INSD:BP640790.1,
FT                   INSD:EG489969.1,INSD:AV788779.1,INSD:ES203190.1,
FT                   INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
FT                   INSD:ES142510.1,INSD:AA597480.1,INSD:AV807584.1,
FT                   INSD:AU229941.1,INSD:AV824928.1,INSD:DR195635.1,
FT                   INSD:EG489994.1,INSD:EG489989.1,INSD:EH978378.1,
FT                   INSD:DR382969.1,INSD:BP654757.1,INSD:EL057912.1,
FT                   INSD:DR195638.1,INSD:DR376100.1,INSD:EG489995.1,
FT                   INSD:EG489997.1,INSD:EH796977.1,INSD:EG489990.1,
FT                   INSD:AV561135.1,INSD:EG489971.1,INSD:EG489948.1,
FT                   INSD:EH965219.1,INSD:AV544254.1,INSD:EH907781.1,
FT                   INSD:DR195636.1,INSD:H77204.1,INSD:AA597406.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK226497.1,INSD:BT025275.1,INSD:BT021987.1"
FT                   /protein_id="AEC05438.1"
FT                   /translation="MGNSLGGKKTTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLDSE
FT                   SVKHYGARAKPLEAKQRLEAKRLYFVVEPVKECPPRRVRSGIHVSAKERLESLMLARRS
FT                   SSDLSILKPPGGWTTEEEEGAVRRVKVRIPKAELEKLVKEGATEAEATQKIAALFMAKQ
FT                   RQEEAYQNTRQDEPATTATATATTTATRGVKSRLKRVSFMAERGGGSEITVA"
FT   gene            complement(165141..167259)
FT                   /gene="QPT"
FT                   /gene_synonym="F10A8.23"
FT                   /gene_synonym="F10A8_23"
FT                   /gene_synonym="quinolinate phoshoribosyltransferase"
FT                   /locus_tag="AT2G01350"
FT                   /note="At2g01350 encodes quinolinate phosphoribosyl
FT                   transferase involved in NAD biosynthesis as shown by
FT                   heterologous expression in E. coli."
FT   mRNA            complement(join(165141..165428,165512..165579,
FT                   165652..165828,165915..166067,166200..166283,
FT                   166491..166637,166723..166856,166935..167071,
FT                   167160..167259))
FT                   /gene="QPT"
FT                   /gene_synonym="F10A8.23"
FT                   /gene_synonym="F10A8_23"
FT                   /gene_synonym="quinolinate phoshoribosyltransferase"
FT                   /locus_tag="AT2G01350"
FT                   /product="quinolinate phoshoribosyltransferase"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR227211.1,INSD:EH852095.1,INSD:DR253391.1,
FT                   INSD:ES050510.1,INSD:EG489968.1,INSD:EG489970.1,
FT                   INSD:ES091571.1,INSD:ES068432.1,INSD:DR370452.1,
FT                   INSD:EL043779.1,INSD:BP647323.1,INSD:EL339442.1,
FT                   INSD:EL060425.1,INSD:AV567706.1,INSD:ES200271.1,
FT                   INSD:F20095.1,INSD:EL063974.1,INSD:EH909870.1,
FT                   INSD:EL116407.1,INSD:ES042884.1,INSD:BP625400.1,
FT                   INSD:EG489951.1,INSD:EG489947.1,INSD:ES015962.1,
FT                   INSD:ES068020.1,INSD:EG489975.1,INSD:BP828310.1,
FT                   INSD:EG489946.1,INSD:ES185091.1,INSD:EL341023.1,
FT                   INSD:EG489949.1,INSD:EG489976.1,INSD:ES209928.1,
FT                   INSD:EG489992.1,INSD:AA605560.1,INSD:ES133712.1,
FT                   INSD:BP640790.1,INSD:EG489969.1,INSD:AV788779.1,
FT                   INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
FT                   INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
FT                   INSD:ES142510.1,INSD:EL090267.1,INSD:ES064918.1,
FT                   INSD:DR253404.1,INSD:DR356976.1,INSD:AU229941.1,
FT                   INSD:EG489994.1,INSD:DR227210.1,INSD:DR253408.1,
FT                   INSD:EG489989.1,INSD:EH978378.1,INSD:DR382969.1,
FT                   INSD:BP654757.1,INSD:ES023089.1,INSD:DR376100.1,
FT                   INSD:EG489995.1,INSD:ES074280.1,INSD:EG489997.1,
FT                   INSD:EH796977.1,INSD:EG489990.1,INSD:AV561135.1,
FT                   INSD:EG489971.1,INSD:EG489948.1,INSD:DR227209.1,
FT                   INSD:EH804801.1,INSD:EH965219.1,INSD:ES206307.1,
FT                   INSD:AV544254.1,INSD:ES108394.1,INSD:EL150270.1,
FT                   INSD:ES136762.1,INSD:ES097394.1,INSD:EH940894.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK222052.1"
FT   mRNA            complement(join(165141..165428,165512..165579,
FT                   165652..165828,165915..166067,166200..166283,
FT                   166491..166619,166723..166856,166935..167071,
FT                   167160..167253))
FT                   /gene="QPT"
FT                   /gene_synonym="F10A8.23"
FT                   /gene_synonym="F10A8_23"
FT                   /gene_synonym="quinolinate phoshoribosyltransferase"
FT                   /locus_tag="AT2G01350"
FT                   /product="quinolinate phoshoribosyltransferase"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH852095.1,INSD:AV829736.1,INSD:ES091571.1,
FT                   INSD:DR253410.1,INSD:BP647323.1,INSD:EL060425.1,
FT                   INSD:F20095.1,INSD:EL063974.1,INSD:EL116407.1,
FT                   INSD:EH909870.1,INSD:ES015962.1,INSD:EG489951.1,
FT                   INSD:DR253394.1,INSD:DR253402.1,INSD:ES209928.1,
FT                   INSD:DR253392.1,INSD:ES133712.1,INSD:AA605560.1,
FT                   INSD:EG489969.1,INSD:AV788779.1,INSD:ES203190.1,
FT                   INSD:ES199799.1,INSD:DR253398.1,INSD:DR253408.1,
FT                   INSD:EH978378.1,INSD:EG489989.1,INSD:DR376100.1,
FT                   INSD:DR253412.1,INSD:EG489997.1,INSD:EG489990.1,
FT                   INSD:AV561135.1,INSD:EG489971.1,INSD:DR253390.1,
FT                   INSD:EH804801.1,INSD:DR253393.1,INSD:ES037813.1,
FT                   INSD:ES108394.1,INSD:EL150270.1,INSD:ES136762.1,
FT                   INSD:EH940894.1,INSD:DR253396.1,INSD:DR253409.1,
FT                   INSD:BP802173.1,INSD:BP819756.1,INSD:ES050510.1,
FT                   INSD:DR253391.1,INSD:EG489968.1,INSD:DR253407.1,
FT                   INSD:EG489970.1,INSD:ES068432.1,INSD:DR370452.1,
FT                   INSD:EL043779.1,INSD:EL339442.1,INSD:BP830351.1,
FT                   INSD:DR253397.1,INSD:AV567706.1,INSD:ES200271.1,
FT                   INSD:DR253403.1,INSD:ES042884.1,INSD:EG489947.1,
FT                   INSD:BP625400.1,INSD:EG489975.1,INSD:ES068020.1,
FT                   INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
FT                   INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
FT                   INSD:DR253405.1,INSD:EG489992.1,INSD:ES051581.1,
FT                   INSD:BP640790.1,INSD:F20096.1,INSD:DR253411.1,
FT                   INSD:DR253406.1,INSD:EL298540.1,INSD:DR253401.1,
FT                   INSD:ES071276.1,INSD:EL263638.1,INSD:EG489993.1,
FT                   INSD:ES142510.1,INSD:ES064918.1,INSD:EL090267.1,
FT                   INSD:AU238711.1,INSD:DR253404.1,INSD:DR253400.1,
FT                   INSD:DR356976.1,INSD:AU229941.1,INSD:BP796261.1,
FT                   INSD:EG489994.1,INSD:DR253399.1,INSD:DR227210.1,
FT                   INSD:DR382969.1,INSD:BP654757.1,INSD:ES023089.1,
FT                   INSD:EG489995.1,INSD:ES074280.1,INSD:EH796977.1,
FT                   INSD:EG489948.1,INSD:EH965219.1,INSD:ES206307.1,
FT                   INSD:AV544254.1,INSD:ES097394.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY057685.1,INSD:AY116955.1,INSD:AK222052.1,
FT                   INSD:AY086867.1,INSD:AK117875.1"
FT   mRNA            complement(join(165141..165428,165512..165579,
FT                   165652..165828,165915..166067,166200..166283,
FT                   166491..166637,166723..167071,167160..167247))
FT                   /gene="QPT"
FT                   /gene_synonym="F10A8.23"
FT                   /gene_synonym="F10A8_23"
FT                   /gene_synonym="quinolinate phoshoribosyltransferase"
FT                   /locus_tag="AT2G01350"
FT                   /product="quinolinate phoshoribosyltransferase"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH852095.1,INSD:ES050510.1,INSD:EG489968.1,
FT                   INSD:EG489970.1,INSD:ES091571.1,INSD:ES068432.1,
FT                   INSD:DR370452.1,INSD:EL043779.1,INSD:BP647323.1,
FT                   INSD:EL339442.1,INSD:EL060425.1,INSD:AV567706.1,
FT                   INSD:ES200271.1,INSD:F20095.1,INSD:EL063974.1,
FT                   INSD:EH909870.1,INSD:EL116407.1,INSD:ES042884.1,
FT                   INSD:BP625400.1,INSD:EG489951.1,INSD:EG489947.1,
FT                   INSD:ES015962.1,INSD:ES068020.1,INSD:EG489975.1,
FT                   INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
FT                   INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
FT                   INSD:ES209928.1,INSD:ES051581.1,INSD:EG489992.1,
FT                   INSD:AA605560.1,INSD:ES133712.1,INSD:BP640790.1,
FT                   INSD:F20096.1,INSD:EG489969.1,INSD:AV788779.1,
FT                   INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
FT                   INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
FT                   INSD:ES142510.1,INSD:EL090267.1,INSD:ES064918.1,
FT                   INSD:AU229941.1,INSD:EG489994.1,INSD:EG489989.1,
FT                   INSD:EH978378.1,INSD:DR382969.1,INSD:BP654757.1,
FT                   INSD:ES023089.1,INSD:DR376100.1,INSD:EG489995.1,
FT                   INSD:ES074280.1,INSD:EG489997.1,INSD:EH796977.1,
FT                   INSD:EG489990.1,INSD:AV561135.1,INSD:EG489971.1,
FT                   INSD:EG489948.1,INSD:EH804801.1,INSD:EH965219.1,
FT                   INSD:ES206307.1,INSD:ES037813.1,INSD:AV544254.1,
FT                   INSD:ES108394.1,INSD:EL150270.1,INSD:DR288876.1,
FT                   INSD:ES136762.1,INSD:ES097394.1,INSD:EH940894.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK222052.1"
FT   mRNA            complement(join(165141..165428,165512..165579,
FT                   165652..165828,165915..166067,166200..166283,
FT                   166491..166637,166723..166856,166935..167247))
FT                   /gene="QPT"
FT                   /gene_synonym="F10A8.23"
FT                   /gene_synonym="F10A8_23"
FT                   /gene_synonym="quinolinate phoshoribosyltransferase"
FT                   /locus_tag="AT2G01350"
FT                   /product="quinolinate phoshoribosyltransferase"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH852095.1,INSD:DR253391.1,INSD:ES050510.1,
FT                   INSD:DR356975.1,INSD:EG489968.1,INSD:EG489970.1,
FT                   INSD:ES091571.1,INSD:ES068432.1,INSD:DR370452.1,
FT                   INSD:EL043779.1,INSD:BP647323.1,INSD:EL339442.1,
FT                   INSD:EH872393.1,INSD:EL060425.1,INSD:AV567706.1,
FT                   INSD:ES200271.1,INSD:F20095.1,INSD:EL063974.1,
FT                   INSD:EH909870.1,INSD:EL116407.1,INSD:ES042884.1,
FT                   INSD:BP625400.1,INSD:EG489951.1,INSD:EG489947.1,
FT                   INSD:ES015962.1,INSD:ES068020.1,INSD:EG489975.1,
FT                   INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
FT                   INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
FT                   INSD:ES209928.1,INSD:ES051581.1,INSD:EG489992.1,
FT                   INSD:AA605560.1,INSD:ES133712.1,INSD:BP640790.1,
FT                   INSD:F20096.1,INSD:EG489969.1,INSD:AV788779.1,
FT                   INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
FT                   INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
FT                   INSD:ES142510.1,INSD:DR356974.1,INSD:EL090267.1,
FT                   INSD:ES064918.1,INSD:DR356976.1,INSD:AU229941.1,
FT                   INSD:EL323396.1,INSD:EG489994.1,INSD:DR227210.1,
FT                   INSD:EG489989.1,INSD:EH978378.1,INSD:DR382969.1,
FT                   INSD:BP654757.1,INSD:ES023089.1,INSD:DR376100.1,
FT                   INSD:EG489995.1,INSD:ES074280.1,INSD:EG489997.1,
FT                   INSD:EH796977.1,INSD:EG489990.1,INSD:AV561135.1,
FT                   INSD:EG489971.1,INSD:EG489948.1,INSD:EH804801.1,
FT                   INSD:EH965219.1,INSD:ES206307.1,INSD:ES037813.1,
FT                   INSD:AV544254.1,INSD:ES108394.1,INSD:EL150270.1,
FT                   INSD:ES097394.1,INSD:ES136762.1,INSD:EH940894.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820514.1,INSD:AK222052.1"
FT   CDS_pept        complement(join(165332..165428,165512..165579,
FT                   165652..165828,165915..166067,166200..166283,
FT                   166491..166619,166723..166856,166935..167071,
FT                   167160..167209))
FT                   /codon_start=1
FT                   /gene="QPT"
FT                   /gene_synonym="F10A8.23"
FT                   /gene_synonym="F10A8_23"
FT                   /gene_synonym="quinolinate phoshoribosyltransferase"
FT                   /locus_tag="AT2G01350"
FT                   /product="quinolinate phoshoribosyltransferase"
FT                   /note="quinolinate phoshoribosyltransferase (QPT);
FT                   FUNCTIONS IN: nicotinate-nucleotide diphosphorylase
FT                   (carboxylating) activity; INVOLVED IN: NAD biosynthetic
FT                   process; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Aldolase-type TIM barrel
FT                   (InterPro:IPR013785), Nicotinate-nucleotide
FT                   pyrophosphorylase (InterPro:IPR004393), Quinolinate
FT                   phosphoribosyl transferase, N-terminal
FT                   (InterPro:IPR022412), Quinolinate phosphoribosyl
FT                   transferase, C-terminal domain (InterPro:IPR002638); Has
FT                   5825 Blast hits to 5825 proteins in 1916 species: Archae -
FT                   184; Bacteria - 3588; Metazoa - 59; Fungi - 124; Plants -
FT                   57; Viruses - 0; Other Eukaryotes - 1813 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01350"
FT                   /db_xref="GOA:A8MRX1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A8MRX1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR227211.1,INSD:EH852095.1,INSD:DR253391.1,
FT                   INSD:ES050510.1,INSD:EG489968.1,INSD:EG489970.1,
FT                   INSD:ES091571.1,INSD:ES068432.1,INSD:DR370452.1,
FT                   INSD:EL043779.1,INSD:BP647323.1,INSD:EL339442.1,
FT                   INSD:EL060425.1,INSD:AV567706.1,INSD:ES200271.1,
FT                   INSD:F20095.1,INSD:EL063974.1,INSD:EH909870.1,
FT                   INSD:EL116407.1,INSD:ES042884.1,INSD:BP625400.1,
FT                   INSD:EG489951.1,INSD:EG489947.1,INSD:ES015962.1,
FT                   INSD:ES068020.1,INSD:EG489975.1,INSD:BP828310.1,
FT                   INSD:EG489946.1,INSD:ES185091.1,INSD:EL341023.1,
FT                   INSD:EG489949.1,INSD:EG489976.1,INSD:ES209928.1,
FT                   INSD:EG489992.1,INSD:AA605560.1,INSD:ES133712.1,
FT                   INSD:BP640790.1,INSD:EG489969.1,INSD:AV788779.1,
FT                   INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
FT                   INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
FT                   INSD:ES142510.1,INSD:EL090267.1,INSD:ES064918.1,
FT                   INSD:DR253404.1,INSD:DR356976.1,INSD:AU229941.1,
FT                   INSD:EG489994.1,INSD:DR227210.1,INSD:DR253408.1,
FT                   INSD:EG489989.1,INSD:EH978378.1,INSD:DR382969.1,
FT                   INSD:BP654757.1,INSD:ES023089.1,INSD:DR376100.1,
FT                   INSD:EG489995.1,INSD:ES074280.1,INSD:EG489997.1,
FT                   INSD:EH796977.1,INSD:EG489990.1,INSD:AV561135.1,
FT                   INSD:EG489971.1,INSD:EG489948.1,INSD:DR227209.1,
FT                   INSD:EH804801.1,INSD:EH965219.1,INSD:ES206307.1,
FT                   INSD:AV544254.1,INSD:ES108394.1,INSD:EL150270.1,
FT                   INSD:ES136762.1,INSD:ES097394.1,INSD:EH940894.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK222052.1"
FT                   /protein_id="AEC05441.1"
FT                   /translation="MISVSRFLSPQFYAIPRSFVKMSASATQTAGEVSMGIKPPSHPTY
FT                   DLKAVIKLALAEDAGHTGDVTCMATIPFDMEVEAYFLAKEDGIVAGVALADMIFEHVDP
FT                   SLKDGDYVHKGLKFGKVSGNAHKIVVAERVLLNFMQRMSGIATLTKLMADAASPACILE
FT                   TRKTAPGLRLVDKWAVLIGGGRNHRMGLFDMVMIKDNHISAAGGIVNAVKSVDEYLKQK
FT                   NLEMDVEVETRTLEEVKEVLEYASGSETRLTRIMLDNMVVPLENGDVDVTMLKDAVELI
FT                   NGRFETEASGNVTLETVHKIGQSGVTFISSGALTHSVKALDISLKIDTELALEVGRRTK
FT                   RA"
FT   CDS_pept        complement(join(165332..165428,165512..165579,
FT                   165652..165828,165915..166067,166200..166283,
FT                   166491..166637,166723..166856,166935..167071,
FT                   167160..167209))
FT                   /codon_start=1
FT                   /gene="QPT"
FT                   /gene_synonym="F10A8.23"
FT                   /gene_synonym="F10A8_23"
FT                   /gene_synonym="quinolinate phoshoribosyltransferase"
FT                   /locus_tag="AT2G01350"
FT                   /product="quinolinate phoshoribosyltransferase"
FT                   /note="quinolinate phoshoribosyltransferase (QPT);
FT                   FUNCTIONS IN: nicotinate-nucleotide diphosphorylase
FT                   (carboxylating) activity; INVOLVED IN: NAD biosynthetic
FT                   process; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Aldolase-type TIM barrel
FT                   (InterPro:IPR013785), Nicotinate-nucleotide
FT                   pyrophosphorylase (InterPro:IPR004393), Quinolinate
FT                   phosphoribosyl transferase, N-terminal
FT                   (InterPro:IPR022412), Quinolinate phosphoribosyl
FT                   transferase, C-terminal domain (InterPro:IPR002638); Has
FT                   5853 Blast hits to 5853 proteins in 1914 species: Archae -
FT                   184; Bacteria - 3582; Metazoa - 59; Fungi - 129; Plants -
FT                   57; Viruses - 0; Other Eukaryotes - 1842 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9ZU32"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU32"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH852095.1,INSD:AV829736.1,INSD:ES091571.1,
FT                   INSD:DR253410.1,INSD:BP647323.1,INSD:EL060425.1,
FT                   INSD:F20095.1,INSD:EL063974.1,INSD:EL116407.1,
FT                   INSD:EH909870.1,INSD:ES015962.1,INSD:EG489951.1,
FT                   INSD:DR253394.1,INSD:DR253402.1,INSD:ES209928.1,
FT                   INSD:DR253392.1,INSD:ES133712.1,INSD:AA605560.1,
FT                   INSD:EG489969.1,INSD:AV788779.1,INSD:ES203190.1,
FT                   INSD:ES199799.1,INSD:DR253398.1,INSD:DR253408.1,
FT                   INSD:EH978378.1,INSD:EG489989.1,INSD:DR376100.1,
FT                   INSD:DR253412.1,INSD:EG489997.1,INSD:EG489990.1,
FT                   INSD:AV561135.1,INSD:EG489971.1,INSD:DR253390.1,
FT                   INSD:EH804801.1,INSD:DR253393.1,INSD:ES037813.1,
FT                   INSD:ES108394.1,INSD:EL150270.1,INSD:ES136762.1,
FT                   INSD:EH940894.1,INSD:DR253396.1,INSD:DR253409.1,
FT                   INSD:BP802173.1,INSD:BP819756.1,INSD:ES050510.1,
FT                   INSD:DR253391.1,INSD:EG489968.1,INSD:DR253407.1,
FT                   INSD:EG489970.1,INSD:ES068432.1,INSD:DR370452.1,
FT                   INSD:EL043779.1,INSD:EL339442.1,INSD:BP830351.1,
FT                   INSD:DR253397.1,INSD:AV567706.1,INSD:ES200271.1,
FT                   INSD:DR253403.1,INSD:ES042884.1,INSD:EG489947.1,
FT                   INSD:BP625400.1,INSD:EG489975.1,INSD:ES068020.1,
FT                   INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
FT                   INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
FT                   INSD:DR253405.1,INSD:EG489992.1,INSD:ES051581.1,
FT                   INSD:BP640790.1,INSD:F20096.1,INSD:DR253411.1,
FT                   INSD:DR253406.1,INSD:EL298540.1,INSD:DR253401.1,
FT                   INSD:ES071276.1,INSD:EL263638.1,INSD:EG489993.1,
FT                   INSD:ES142510.1,INSD:ES064918.1,INSD:EL090267.1,
FT                   INSD:AU238711.1,INSD:DR253404.1,INSD:DR253400.1,
FT                   INSD:DR356976.1,INSD:AU229941.1,INSD:BP796261.1,
FT                   INSD:EG489994.1,INSD:DR253399.1,INSD:DR227210.1,
FT                   INSD:DR382969.1,INSD:BP654757.1,INSD:ES023089.1,
FT                   INSD:EG489995.1,INSD:ES074280.1,INSD:EH796977.1,
FT                   INSD:EG489948.1,INSD:EH965219.1,INSD:ES206307.1,
FT                   INSD:AV544254.1,INSD:ES097394.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY057685.1,INSD:AY116955.1,INSD:AK222052.1,
FT                   INSD:AY086867.1,INSD:AK117875.1"
FT                   /protein_id="AEC05440.1"
FT                   /translation="MISVSRFLSPQFYAIPRSFVKMSASATQTAGEVSMGIKPPSHPTY
FT                   DLKAVIKLALAEDAGHTGDVTCMATIPFDMEVEAYFLAKEDGIVAGVALADMIFEHVDP
FT                   SLKVEWMRKDGDYVHKGLKFGKVSGNAHKIVVAERVLLNFMQRMSGIATLTKLMADAAS
FT                   PACILETRKTAPGLRLVDKWAVLIGGGRNHRMGLFDMVMIKDNHISAAGGIVNAVKSVD
FT                   EYLKQKNLEMDVEVETRTLEEVKEVLEYASGSETRLTRIMLDNMVVPLENGDVDVTMLK
FT                   DAVELINGRFETEASGNVTLETVHKIGQSGVTFISSGALTHSVKALDISLKIDTELALE
FT                   VGRRTKRA"
FT   CDS_pept        complement(join(165332..165428,165512..165579,
FT                   165652..165828,165915..166067,166200..166283,
FT                   166491..166637,166723..166856,166935..167058))
FT                   /codon_start=1
FT                   /gene="QPT"
FT                   /gene_synonym="F10A8.23"
FT                   /gene_synonym="F10A8_23"
FT                   /gene_synonym="quinolinate phoshoribosyltransferase"
FT                   /locus_tag="AT2G01350"
FT                   /product="quinolinate phoshoribosyltransferase"
FT                   /note="quinolinate phoshoribosyltransferase (QPT);
FT                   FUNCTIONS IN: nicotinate-nucleotide diphosphorylase
FT                   (carboxylating) activity; INVOLVED IN: NAD biosynthetic
FT                   process; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Aldolase-type TIM barrel
FT                   (InterPro:IPR013785), Nicotinate-nucleotide
FT                   pyrophosphorylase (InterPro:IPR004393), Quinolinate
FT                   phosphoribosyl transferase, N-terminal
FT                   (InterPro:IPR022412), Quinolinate phosphoribosyl
FT                   transferase, C-terminal domain (InterPro:IPR002638); Has
FT                   5862 Blast hits to 5862 proteins in 1918 species: Archae -
FT                   184; Bacteria - 3596; Metazoa - 59; Fungi - 124; Plants -
FT                   57; Viruses - 0; Other Eukaryotes - 1842 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01350"
FT                   /db_xref="GOA:A8MS71"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A8MS71"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH852095.1,INSD:ES050510.1,INSD:EG489968.1,
FT                   INSD:EG489970.1,INSD:ES091571.1,INSD:ES068432.1,
FT                   INSD:DR370452.1,INSD:EL043779.1,INSD:BP647323.1,
FT                   INSD:EL339442.1,INSD:EL060425.1,INSD:AV567706.1,
FT                   INSD:ES200271.1,INSD:F20095.1,INSD:EL063974.1,
FT                   INSD:EH909870.1,INSD:EL116407.1,INSD:ES042884.1,
FT                   INSD:BP625400.1,INSD:EG489951.1,INSD:EG489947.1,
FT                   INSD:ES015962.1,INSD:ES068020.1,INSD:EG489975.1,
FT                   INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
FT                   INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
FT                   INSD:ES209928.1,INSD:ES051581.1,INSD:EG489992.1,
FT                   INSD:AA605560.1,INSD:ES133712.1,INSD:BP640790.1,
FT                   INSD:F20096.1,INSD:EG489969.1,INSD:AV788779.1,
FT                   INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
FT                   INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
FT                   INSD:ES142510.1,INSD:EL090267.1,INSD:ES064918.1,
FT                   INSD:AU229941.1,INSD:EG489994.1,INSD:EG489989.1,
FT                   INSD:EH978378.1,INSD:DR382969.1,INSD:BP654757.1,
FT                   INSD:ES023089.1,INSD:DR376100.1,INSD:EG489995.1,
FT                   INSD:ES074280.1,INSD:EG489997.1,INSD:EH796977.1,
FT                   INSD:EG489990.1,INSD:AV561135.1,INSD:EG489971.1,
FT                   INSD:EG489948.1,INSD:EH804801.1,INSD:EH965219.1,
FT                   INSD:ES206307.1,INSD:ES037813.1,INSD:AV544254.1,
FT                   INSD:ES108394.1,INSD:EL150270.1,INSD:DR288876.1,
FT                   INSD:ES136762.1,INSD:ES097394.1,INSD:EH940894.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK222052.1"
FT                   /protein_id="AEC05442.1"
FT                   /translation="MSASATQTAGEVSMGIKPPSHPTYDLKAVIKLALAEDAGHTGDVT
FT                   CMATIPFDMEVEAYFLAKEDGIVAGVALADMIFEHVDPSLKVEWMRKDGDYVHKGLKFG
FT                   KVSGNAHKIVVAERVLLNFMQRMSGIATLTKLMADAASPACILETRKTAPGLRLVDKWA
FT                   VLIGGGRNHRMGLFDMVMIKDNHISAAGGIVNAVKSVDEYLKQKNLEMDVEVETRTLEE
FT                   VKEVLEYASGSETRLTRIMLDNMVVPLENGDVDVTMLKDAVELINGRFETEASGNVTLE
FT                   TVHKIGQSGVTFISSGALTHSVKALDISLKIDTELALEVGRRTKRA"
FT   CDS_pept        complement(join(165332..165428,165512..165579,
FT                   165652..165828,165915..166067,166200..166283,
FT                   166491..166637,166723..166842))
FT                   /codon_start=1
FT                   /gene="QPT"
FT                   /gene_synonym="F10A8.23"
FT                   /gene_synonym="F10A8_23"
FT                   /gene_synonym="quinolinate phoshoribosyltransferase"
FT                   /locus_tag="AT2G01350"
FT                   /product="quinolinate phoshoribosyltransferase"
FT                   /note="quinolinate phoshoribosyltransferase (QPT);
FT                   FUNCTIONS IN: nicotinate-nucleotide diphosphorylase
FT                   (carboxylating) activity; INVOLVED IN: NAD biosynthetic
FT                   process; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Aldolase-type TIM barrel
FT                   (InterPro:IPR013785), Nicotinate-nucleotide
FT                   pyrophosphorylase (InterPro:IPR004393), Quinolinate
FT                   phosphoribosyl transferase, N-terminal
FT                   (InterPro:IPR022412), Quinolinate phosphoribosyl
FT                   transferase, C-terminal domain (InterPro:IPR002638); Has
FT                   35333 Blast hits to 34131 proteins in 2444 species: Archae
FT                   - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
FT                   - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01350"
FT                   /db_xref="GOA:F4INA0"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:F4INA0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH852095.1,INSD:DR253391.1,INSD:ES050510.1,
FT                   INSD:DR356975.1,INSD:EG489968.1,INSD:EG489970.1,
FT                   INSD:ES091571.1,INSD:ES068432.1,INSD:DR370452.1,
FT                   INSD:EL043779.1,INSD:BP647323.1,INSD:EL339442.1,
FT                   INSD:EH872393.1,INSD:EL060425.1,INSD:AV567706.1,
FT                   INSD:ES200271.1,INSD:F20095.1,INSD:EL063974.1,
FT                   INSD:EH909870.1,INSD:EL116407.1,INSD:ES042884.1,
FT                   INSD:BP625400.1,INSD:EG489951.1,INSD:EG489947.1,
FT                   INSD:ES015962.1,INSD:ES068020.1,INSD:EG489975.1,
FT                   INSD:BP828310.1,INSD:EG489946.1,INSD:ES185091.1,
FT                   INSD:EL341023.1,INSD:EG489949.1,INSD:EG489976.1,
FT                   INSD:ES209928.1,INSD:ES051581.1,INSD:EG489992.1,
FT                   INSD:AA605560.1,INSD:ES133712.1,INSD:BP640790.1,
FT                   INSD:F20096.1,INSD:EG489969.1,INSD:AV788779.1,
FT                   INSD:ES203190.1,INSD:EL298540.1,INSD:ES071276.1,
FT                   INSD:EG489993.1,INSD:EL263638.1,INSD:ES199799.1,
FT                   INSD:ES142510.1,INSD:DR356974.1,INSD:EL090267.1,
FT                   INSD:ES064918.1,INSD:DR356976.1,INSD:AU229941.1,
FT                   INSD:EL323396.1,INSD:EG489994.1,INSD:DR227210.1,
FT                   INSD:EG489989.1,INSD:EH978378.1,INSD:DR382969.1,
FT                   INSD:BP654757.1,INSD:ES023089.1,INSD:DR376100.1,
FT                   INSD:EG489995.1,INSD:ES074280.1,INSD:EG489997.1,
FT                   INSD:EH796977.1,INSD:EG489990.1,INSD:AV561135.1,
FT                   INSD:EG489971.1,INSD:EG489948.1,INSD:EH804801.1,
FT                   INSD:EH965219.1,INSD:ES206307.1,INSD:ES037813.1,
FT                   INSD:AV544254.1,INSD:ES108394.1,INSD:EL150270.1,
FT                   INSD:ES097394.1,INSD:ES136762.1,INSD:EH940894.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820514.1,INSD:AK222052.1"
FT                   /protein_id="AEC05439.1"
FT                   /translation="MATIPFDMEVEAYFLAKEDGIVAGVALADMIFEHVDPSLKVEWMR
FT                   KDGDYVHKGLKFGKVSGNAHKIVVAERVLLNFMQRMSGIATLTKLMADAASPACILETR
FT                   KTAPGLRLVDKWAVLIGGGRNHRMGLFDMVMIKDNHISAAGGIVNAVKSVDEYLKQKNL
FT                   EMDVEVETRTLEEVKEVLEYASGSETRLTRIMLDNMVVPLENGDVDVTMLKDAVELING
FT                   RFETEASGNVTLETVHKIGQSGVTFISSGALTHSVKALDISLKIDTELALEVGRRTKRA
FT                   "
FT   gene            167931..168479
FT                   /gene_synonym="F10A8.24"
FT                   /gene_synonym="F10A8_24"
FT                   /locus_tag="AT2G01360"
FT   mRNA            167931..168479
FT                   /gene_synonym="F10A8.24"
FT                   /gene_synonym="F10A8_24"
FT                   /locus_tag="AT2G01360"
FT                   /product="pentatricopeptide (PPR) repeat protein"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT015631.1"
FT   CDS_pept        167931..168479
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.24"
FT                   /gene_synonym="F10A8_24"
FT                   /locus_tag="AT2G01360"
FT                   /product="pentatricopeptide (PPR) repeat protein"
FT                   /note="pentatricopeptide (PPR) repeat-containing protein;
FT                   CONTAINS InterPro DOMAIN/s: Pentatricopeptide repeat
FT                   (InterPro:IPR002885); BEST Arabidopsis thaliana protein
FT                   match is: Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein (TAIR:AT2G01390.1); Has 425 Blast hits to 414
FT                   proteins in 21 species: Archae - 0; Bacteria - 0; Metazoa -
FT                   0; Fungi - 0; Plants - 420; Viruses - 0; Other Eukaryotes -
FT                   5 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01360.1"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU31"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT015631.1"
FT                   /protein_id="AEC05443.2"
FT                   /translation="MTTNSWHSILVIYLASLALDWSLEMGIHLEKSAYLALAGNFLRSN
FT                   ELSKVIDVVKEMVKSQHSLGVYHGAMLIHMLGFGRRPSLAAEALDLLPDDQKGLSAYTA
FT                   LMDVYISAGSPEKAMKILGEMREREIMPSLGTYDVLLSGLEKTSDFQRETSSLRKEQKS
FT                   LVASTRFREIVHVEDKICM"
FT   gene            complement(168631..169642)
FT                   /gene_synonym="F10A8.25"
FT                   /gene_synonym="F10A8_25"
FT                   /locus_tag="AT2G01370"
FT   mRNA            complement(168631..169642)
FT                   /gene_synonym="F10A8.25"
FT                   /gene_synonym="F10A8_25"
FT                   /locus_tag="AT2G01370"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG434392.1,INSD:AY649247.1,INSD:EG434411.1,
FT                   INSD:EG434435.1,INSD:EG428775.1,INSD:EG428777.1,
FT                   INSD:EG434409.1,INSD:EG434412.1,INSD:EG428776.1,
FT                   INSD:EG434408.1,INSD:EG428772.1,INSD:EG428779.1,
FT                   INSD:EG434410.1,INSD:ES158940.1,INSD:EG434405.1,
FT                   INSD:EG428782.1,INSD:EG434406.1,INSD:EG428781.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY501359.1,INSD:AY464618.1"
FT   CDS_pept        complement(168791..169549)
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.25"
FT                   /gene_synonym="F10A8_25"
FT                   /locus_tag="AT2G01370"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /note="DNA-binding storekeeper protein-related
FT                   transcriptional regulator; CONTAINS InterPro DOMAIN/s:
FT                   Protein of unknown function DUF573 (InterPro:IPR007592);
FT                   BEST Arabidopsis thaliana protein match is: DNA-binding
FT                   storekeeper protein-related transcriptional regulator
FT                   (TAIR:AT1G55950.1); Has 264 Blast hits to 262 proteins in
FT                   14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   5; Plants - 259; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q9ZU30"
FT                   /db_xref="InterPro:IPR007592"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU30"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG434392.1,INSD:AY649247.1,INSD:EG434411.1,
FT                   INSD:EG434435.1,INSD:EG428775.1,INSD:EG428777.1,
FT                   INSD:EG434409.1,INSD:EG434412.1,INSD:EG428776.1,
FT                   INSD:EG434408.1,INSD:EG428772.1,INSD:EG428779.1,
FT                   INSD:EG434410.1,INSD:ES158940.1,INSD:EG434405.1,
FT                   INSD:EG428782.1,INSD:EG434406.1,INSD:EG428781.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY501359.1,INSD:AY464618.1"
FT                   /protein_id="AEC05444.1"
FT                   /translation="MKGITKKLLVSRSLKRLTAKKNRRKIHRETNKRLKPEEDPSMVKR
FT                   RQDSDSDSLEKEVSVVVTKTSDDEMVSTDTKKNYFQRIWSDDDEIVLLQGMVDFENDKG
FT                   KSPYDDMTGFIDTVKNFISFQANQHQFTTKIRRLKDKFLKKWNNGVDENSLVNAHDRKC
FT                   FQLSKVIWEPTTKVEEVGDWFVNSYLVGSIARLGVSEDVMKQSWSMVPIETKKEVEEKF
FT                   KLLKDEESENLRLKTSFLQKVNSMIIEATN"
FT   gene            complement(169967..170613)
FT                   /pseudo
FT                   /locus_tag="AT2G01372"
FT                   /note="Pseudogene of AT3G13062"
FT   misc_RNA        complement(169967..170613)
FT                   /pseudo
FT                   /locus_tag="AT2G01372"
FT                   /note="pseudogene of Polyketide cyclase/dehydrase and lipid
FT                   transport superfamily protein; AT2G01372.1"
FT   gene            171098..171472
FT                   /locus_tag="AT2G01379"
FT   mRNA            171098..171472
FT                   /locus_tag="AT2G01379"
FT                   /product="transmembrane protein"
FT   CDS_pept        171098..171343
FT                   /codon_start=1
FT                   /locus_tag="AT2G01379"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01379"
FT                   /db_xref="GOA:A0A1P8AY90"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AY90"
FT                   /protein_id="ANM61634.1"
FT                   /translation="MRIMWKFIIVMLCFIALVGSRGTSATSRLRMKKEDIGRRFALQNK
FT                   LQRGPVPPSQPSPCHNKLNPLSHSQVYSSHTYVTCP"
FT   gene            complement(171157..171433)
FT                   /locus_tag="AT2G03945"
FT   ncRNA           complement(171157..171433)
FT                   /locus_tag="AT2G03945"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            172176..174137
FT                   /gene="EMB3111"
FT                   /gene_synonym="EMBRYO DEFECTIVE 3111"
FT                   /gene_synonym="F10A8.29"
FT                   /locus_tag="AT2G01390"
FT   mRNA            join(172176..172976,173125..174137)
FT                   /gene="EMB3111"
FT                   /gene_synonym="EMBRYO DEFECTIVE 3111"
FT                   /gene_synonym="F10A8.29"
FT                   /locus_tag="AT2G01390"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT012081.1"
FT   CDS_pept        join(172256..172976,173125..174137)
FT                   /codon_start=1
FT                   /gene="EMB3111"
FT                   /gene_synonym="F10A8.29"
FT                   /gene_synonym="EMBRYO DEFECTIVE 3111"
FT                   /locus_tag="AT2G01390"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /note="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: chloroplast; CONTAINS InterPro DOMAIN/s:
FT                   Pentatricopeptide repeat (InterPro:IPR002885); BEST
FT                   Arabidopsis thaliana protein match is: pentatricopeptide
FT                   (PPR) repeat-containing protein (TAIR:AT2G01360.1); Has
FT                   35333 Blast hits to 34131 proteins in 2444 species: Archae
FT                   - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
FT                   - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01390.1"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU29"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT012081.1"
FT                   /protein_id="AEC05445.1"
FT                   /translation="MRFSSIFRNTPIQFSNRRSSVKLLHSLPRLKPTNSKRFSQKPKLV
FT                   KTQTLPDPSVYTRDIVSNIYNILKYSNWDSAQEQLPHLGVRWDSHIINRVLKAHPPMQK
FT                   AWLFFNWAAQIKGFKHDHFTYTTMLDIFGEAGRIQSMYSVFHLMKEKGVLIDTVTYTSL
FT                   IHWVSSSGDVDGAMRLWEEMRDNGCEPTVVSYTAYMKMLFADGRVEEATEVYKEMLRSR
FT                   VSPNCHTYTVLMEYLVATGKCEEALDIFFKMQEIGVQPDKAACNILIAKALKFGETSFM
FT                   TRVLVYMKENGVVLRYPIFVEALETLKAAGESDDLLREVNSHISVESLCSSDIDETPTA
FT                   EVNDTKNSDDSRVISSVLLMKQNLVAVDILLNQMRDRNIKLDSFVVSAIIETNCDRCRT
FT                   EGASLAFDYSLEMGIHLKKSAYLALIGNFLRSNELPKVIEVVKEMVKAQHSLGCYQGAM
FT                   LIHRLGFGRRPRLAADVFDLLPDDQKGVAAYTALMDVYISAGSPEKAMKILREMREREI
FT                   MPSLGTYDVLLSGLEKTSDFQKEVALLRKEKKSLVASARFRENVHVEDKICDLLFATNL
FT                   L"
FT   gene            174168..175617
FT                   /gene_synonym="F10A8.4"
FT                   /locus_tag="AT2G01400"
FT   mRNA            join(174168..174434,174760..175617)
FT                   /gene_synonym="F10A8.4"
FT                   /locus_tag="AT2G01400"
FT                   /product="hypothetical protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR316509.1,INSD:DR370358.1,INSD:EG503223.1,
FT                   INSD:EG420421.1,INSD:EH913036.1,INSD:ES139032.1,
FT                   INSD:EG512771.1,INSD:EL114840.1,INSD:EL206856.1,
FT                   INSD:AU229089.1,INSD:EG512761.1,INSD:EH915097.1,
FT                   INSD:ES047420.1,INSD:AU231107.1,INSD:EG425651.1,
FT                   INSD:CD533235.1,INSD:BP625867.1,INSD:DR316512.1,
FT                   INSD:CD530330.1,INSD:ES142449.1,INSD:BP787424.1,
FT                   INSD:EH901047.1,INSD:AI998222.1,INSD:DR316511.1,
FT                   INSD:DR378789.1,INSD:BP639670.1,INSD:EL020267.1,
FT                   INSD:EG512778.1,INSD:ES036621.1,INSD:ES123407.1,
FT                   INSD:EG503224.1,INSD:ES027931.1,INSD:ES078273.1,
FT                   INSD:EL250811.1,INSD:EH985658.1,INSD:DR316508.1,
FT                   INSD:CD533247.1,INSD:EG425656.1,INSD:EL013150.1,
FT                   INSD:EG420419.1,INSD:CD533145.1,INSD:EG496957.1,
FT                   INSD:EL088593.1,INSD:DR316510.1,INSD:EG425655.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY086346.1,INSD:BT004934.1,INSD:AK118883.1,
FT                   INSD:BX820561.1"
FT   mRNA            join(174168..174434,174760..174988,175158..175180)
FT                   /gene_synonym="F10A8.4"
FT                   /locus_tag="AT2G01400"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(174315..174434,174760..174988,175158..175180)
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.4"
FT                   /locus_tag="AT2G01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AYA3"
FT                   /protein_id="ANM61587.1"
FT                   /translation="MARSCSIWTPVLISLSPVTGESPKISRRRVILATSIGSPQPLLEA
FT                   KIKEPQKLQVLDSKDVSRRNTMLYLAAGFLGGINFLNGEAAEARVGRKENRKKALEKLR
FT                   AKAKESEPNNKSGFLLQNV"
FT   CDS_pept        join(174315..174434,174760..175080)
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.4"
FT                   /locus_tag="AT2G01400"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; Has 19 Blast hits to 19 proteins in
FT                   6 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 19; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01400"
FT                   /db_xref="GOA:Q9ZNU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZNU8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR316509.1,INSD:DR370358.1,INSD:EG503223.1,
FT                   INSD:EG420421.1,INSD:EH913036.1,INSD:ES139032.1,
FT                   INSD:EG512771.1,INSD:EL114840.1,INSD:EL206856.1,
FT                   INSD:AU229089.1,INSD:EG512761.1,INSD:EH915097.1,
FT                   INSD:ES047420.1,INSD:AU231107.1,INSD:EG425651.1,
FT                   INSD:CD533235.1,INSD:BP625867.1,INSD:DR316512.1,
FT                   INSD:CD530330.1,INSD:ES142449.1,INSD:BP787424.1,
FT                   INSD:EH901047.1,INSD:AI998222.1,INSD:DR316511.1,
FT                   INSD:DR378789.1,INSD:BP639670.1,INSD:EL020267.1,
FT                   INSD:EG512778.1,INSD:ES036621.1,INSD:ES123407.1,
FT                   INSD:EG503224.1,INSD:ES027931.1,INSD:ES078273.1,
FT                   INSD:EL250811.1,INSD:EH985658.1,INSD:DR316508.1,
FT                   INSD:CD533247.1,INSD:EG425656.1,INSD:EL013150.1,
FT                   INSD:EG420419.1,INSD:CD533145.1,INSD:EG496957.1,
FT                   INSD:EL088593.1,INSD:DR316510.1,INSD:EG425655.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY086346.1,INSD:BT004934.1,INSD:AK118883.1,
FT                   INSD:BX820561.1"
FT                   /protein_id="AEC05446.1"
FT                   /translation="MARSCSIWTPVLISLSPVTGESPKISRRRVILATSIGSPQPLLEA
FT                   KIKEPQKLQVLDSKDVSRRNTMLYLAAGFLGGINFLNGEAAEARVGRKENRKKALEKLR
FT                   AKAKESEPNNKSGNQKIEKELEKEEVFPLLPPPLVVEANLLQ"
FT   gene            complement(175040..176407)
FT                   /gene_synonym="F10A8.30"
FT                   /locus_tag="AT2G01410"
FT   mRNA            complement(175040..176407)
FT                   /gene_synonym="F10A8.30"
FT                   /locus_tag="AT2G01410"
FT                   /product="NHL domain-containing protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG422196.1,INSD:EH816157.1,INSD:DR370358.1,
FT                   INSD:DR285321.1,INSD:EG423273.1,INSD:EG503223.1,
FT                   INSD:EH888346.1,INSD:EG420421.1,INSD:EL167471.1,
FT                   INSD:EG423783.1,INSD:EG423272.1,INSD:EL146647.1,
FT                   INSD:EG423277.1,INSD:EL218394.1,INSD:DR285323.1,
FT                   INSD:EG512761.1,INSD:EL334008.1,INSD:EG498766.1,
FT                   INSD:AU231107.1,INSD:ES031473.1,INSD:CD533235.1,
FT                   INSD:BP625867.1,INSD:CD530330.1,INSD:ES142449.1,
FT                   INSD:AU237971.1,INSD:EG423780.1,INSD:EH901047.1,
FT                   INSD:AI998222.1,INSD:DR316511.1,INSD:EG423268.1,
FT                   INSD:EG423269.1,INSD:EH863480.1,INSD:EL164556.1,
FT                   INSD:EG512778.1,INSD:EL020267.1,INSD:EG423270.1,
FT                   INSD:EG512770.1,INSD:EG503224.1,INSD:EG422188.1,
FT                   INSD:ES052084.1,INSD:EG423276.1,INSD:EL330208.1,
FT                   INSD:EG422194.1,INSD:EH925840.1,INSD:CD533145.1,
FT                   INSD:EG496957.1,INSD:EL088593.1,INSD:EG425655.1,
FT                   INSD:EG423790.1,INSD:EG423785.1,INSD:EG423787.1,
FT                   INSD:EG498765.1,INSD:EH913036.1,INSD:DR285320.1,
FT                   INSD:EG496726.1,INSD:ES139032.1,INSD:EG512771.1,
FT                   INSD:EG423267.1,INSD:EG423781.1,INSD:DR285322.1,
FT                   INSD:EL114840.1,INSD:EG422185.1,INSD:EL206856.1,
FT                   INSD:AU229089.1,INSD:EG423791.1,INSD:EH915097.1,
FT                   INSD:ES047420.1,INSD:EG425651.1,INSD:EG509799.1,
FT                   INSD:DR316512.1,INSD:EG423796.1,INSD:BP787424.1,
FT                   INSD:EG496725.1,INSD:DR378789.1,INSD:EG422170.1,
FT                   INSD:BP639670.1,INSD:EG509815.1,INSD:EG423274.1,
FT                   INSD:ES036621.1,INSD:ES123407.1,INSD:EG423271.1,
FT                   INSD:EG423266.1,INSD:ES027931.1,INSD:EG512760.1,
FT                   INSD:EG423782.1,INSD:EL167417.1,INSD:ES078273.1,
FT                   INSD:EL250811.1,INSD:CD533247.1,INSD:EG425656.1,
FT                   INSD:EL013150.1,INSD:EG509806.1,INSD:EG420419.1,
FT                   INSD:EG512777.1,INSD:DR316510.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX818766.1,INSD:BX820148.1,INSD:BX819398.1,
FT                   INSD:AY735571.1,INSD:BX820492.1,INSD:AK117175.1"
FT   gene            175202..176330
FT                   /locus_tag="AT2G03975"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT2G01410"
FT   ncRNA           175202..176330
FT                   /locus_tag="AT2G03975"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   CDS_pept        complement(175209..176372)
FT                   /codon_start=1
FT                   /gene_synonym="F10A8.30"
FT                   /locus_tag="AT2G01410"
FT                   /product="NHL domain-containing protein"
FT                   /note="NHL domain-containing protein; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 26
FT                   plant structures; EXPRESSED DURING: 15 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Six-bladed beta-propeller,
FT                   TolB-like (InterPro:IPR011042); BEST Arabidopsis thaliana
FT                   protein match is: Calcium-dependent phosphotriesterase
FT                   superfamily protein (TAIR:AT2G16760.1); Has 137 Blast hits
FT                   to 137 proteins in 39 species: Archae - 0; Bacteria - 57;
FT                   Metazoa - 0; Fungi - 0; Plants - 76; Viruses - 0; Other
FT                   Eukaryotes - 4 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9ZNQ5"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZNQ5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG422196.1,INSD:EH816157.1,INSD:DR370358.1,
FT                   INSD:DR285321.1,INSD:EG423273.1,INSD:EG503223.1,
FT                   INSD:EH888346.1,INSD:EG420421.1,INSD:EL167471.1,
FT                   INSD:EG423783.1,INSD:EG423272.1,INSD:EL146647.1,
FT                   INSD:EG423277.1,INSD:EL218394.1,INSD:DR285323.1,
FT                   INSD:EG512761.1,INSD:EL334008.1,INSD:EG498766.1,
FT                   INSD:AU231107.1,INSD:ES031473.1,INSD:CD533235.1,
FT                   INSD:BP625867.1,INSD:CD530330.1,INSD:ES142449.1,
FT                   INSD:AU237971.1,INSD:EG423780.1,INSD:EH901047.1,
FT                   INSD:AI998222.1,INSD:DR316511.1,INSD:EG423268.1,
FT                   INSD:EG423269.1,INSD:EH863480.1,INSD:EL164556.1,
FT                   INSD:EG512778.1,INSD:EL020267.1,INSD:EG423270.1,
FT                   INSD:EG512770.1,INSD:EG503224.1,INSD:EG422188.1,
FT                   INSD:ES052084.1,INSD:EG423276.1,INSD:EL330208.1,
FT                   INSD:EG422194.1,INSD:EH925840.1,INSD:CD533145.1,
FT                   INSD:EG496957.1,INSD:EL088593.1,INSD:EG425655.1,
FT                   INSD:EG423790.1,INSD:EG423785.1,INSD:EG423787.1,
FT                   INSD:EG498765.1,INSD:EH913036.1,INSD:DR285320.1,
FT                   INSD:EG496726.1,INSD:ES139032.1,INSD:EG512771.1,
FT                   INSD:EG423267.1,INSD:EG423781.1,INSD:DR285322.1,
FT                   INSD:EL114840.1,INSD:EG422185.1,INSD:EL206856.1,
FT                   INSD:AU229089.1,INSD:EG423791.1,INSD:EH915097.1,
FT                   INSD:ES047420.1,INSD:EG425651.1,INSD:EG509799.1,
FT                   INSD:DR316512.1,INSD:EG423796.1,INSD:BP787424.1,
FT                   INSD:EG496725.1,INSD:DR378789.1,INSD:EG422170.1,
FT                   INSD:BP639670.1,INSD:EG509815.1,INSD:EG423274.1,
FT                   INSD:ES036621.1,INSD:ES123407.1,INSD:EG423271.1,
FT                   INSD:EG423266.1,INSD:ES027931.1,INSD:EG512760.1,
FT                   INSD:EG423782.1,INSD:EL167417.1,INSD:ES078273.1,
FT                   INSD:EL250811.1,INSD:CD533247.1,INSD:EG425656.1,
FT                   INSD:EL013150.1,INSD:EG509806.1,INSD:EG420419.1,
FT                   INSD:EG512777.1,INSD:DR316510.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX818766.1,INSD:BX820148.1,INSD:BX819398.1,
FT                   INSD:AY735571.1,INSD:BX820492.1,INSD:AK117175.1"
FT                   /protein_id="AEC05447.1"
FT                   /translation="MKANMSSSSSTRYRSFFVFPILFAVLFLGLLIPSSADNRHVINFR
FT                   SPGLYPEGLTWDPRDQHFLVGSLHSRTIHSVSDAGVIETLISDLDLPENSTILGLAVDS
FT                   TNRRLLACIQSLPPLPPFSALASYDLRSGGRRVFLSPLPSLPGDDEDIARDVANDVAVD
FT                   FKGNAYVTNSAKNFIWKVDRDGAASIFSKSPLFNSQPVAADADASFRDCGLNGIVYISK
FT                   GYLLVVQSNTGKVFKVDEDSGNARLVLLNGDLIAADGMTRRRRDGTVMVVSQKKLWLLK
FT                   SQDSWSEGVVYDEIDLDIEGFPTAVTVAGRDRIYVLYGRVMEGIMGSSYKEEGAREWFG
FT                   IEEVWSEKEGGEDKIWLYVLIGFGFAYFCFWRFQMKKLITNMDKKIT"
FT   gene            complement(178960..179203)
FT                   /locus_tag="AT2G03985"
FT   ncRNA           complement(178960..179203)
FT                   /locus_tag="AT2G03985"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(180033..183764)
FT                   /gene="PIN4"
FT                   /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
FT                   /gene_synonym="ATPIN4"
FT                   /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
FT                   /gene_synonym="F10A8.27"
FT                   /gene_synonym="PIN-FORMED 4"
FT                   /locus_tag="AT2G01420"
FT                   /note="Encodes a putative auxin efflux carrier that is
FT                   localized in developing and mature root meristems. It is
FT                   involved in the maintenance of embryonic auxin gradients. A
FT                   role for AtPIN4 in generating a sink for auxin below the
FT                   quiescent center of the root meristem that is essential for
FT                   auxin distribution and patterning is proposed. In the root,
FT                   PIN4 is detected around the quiescent center and cells
FT                   surrounding it, and localizes basally in provascular cells.
FT                   PIN4 expression is upregulated in
FT                   brassinosteroid-insensitive mutant (PMID 16141452)."
FT   mRNA            complement(join(180033..180544,180649..180725,
FT                   180820..180977,181355..181440,181580..181847,
FT                   182017..183764))
FT                   /gene="PIN4"
FT                   /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
FT                   /gene_synonym="ATPIN4"
FT                   /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
FT                   /gene_synonym="F10A8.27"
FT                   /gene_synonym="PIN-FORMED 4"
FT                   /locus_tag="AT2G01420"
FT                   /product="Auxin efflux carrier family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP590224.1,INSD:AV803269.1,INSD:EH863822.1,
FT                   INSD:BP593323.1,INSD:AV830715.1,INSD:EG524029.1,
FT                   INSD:EH918999.1,INSD:AV816911.1,INSD:EL298344.1,
FT                   INSD:EH795608.1,INSD:BX836105.1,INSD:AV805675.1,
FT                   INSD:EH864106.1,INSD:BP636712.1,INSD:EL156998.1,
FT                   INSD:EL176190.1,INSD:BP620481.1,INSD:EL165806.1,
FT                   INSD:AV795593.1,INSD:EL186934.1,INSD:BP864386.1,
FT                   INSD:EL228275.1,INSD:BE526564.1,INSD:EH933837.1,
FT                   INSD:EL232807.1,INSD:T43636.1,INSD:R84151.1,
FT                   INSD:EH817095.1,INSD:EL255235.1,INSD:BX840155.1,
FT                   INSD:EH941408.1,INSD:AV812593.1,INSD:DR354068.1,
FT                   INSD:AV811044.1,INSD:EH822472.1,INSD:AV829212.1,
FT                   INSD:Z46533.1,INSD:EL175307.1,INSD:EL005739.1,
FT                   INSD:EH810878.1,INSD:EL217865.1,INSD:EH975337.1,
FT                   INSD:EL309524.1,INSD:EG524031.1,INSD:EL162185.1,
FT                   INSD:EH943014.1,INSD:AI099739.1,INSD:BX839961.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF087016.1,INSD:AK221116.1,INSD:BX820960.1"
FT   mRNA            complement(join(180033..180544,180649..180725,
FT                   180820..180977,181355..181440,181580..181847,
FT                   182005..183764))
FT                   /gene="PIN4"
FT                   /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
FT                   /gene_synonym="ATPIN4"
FT                   /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
FT                   /gene_synonym="F10A8.27"
FT                   /gene_synonym="PIN-FORMED 4"
FT                   /locus_tag="AT2G01420"
FT                   /product="Auxin efflux carrier family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP590224.1,INSD:AV803269.1,INSD:EH863822.1,
FT                   INSD:BP593323.1,INSD:AV830715.1,INSD:EG524029.1,
FT                   INSD:EH918999.1,INSD:AV816911.1,INSD:EL298344.1,
FT                   INSD:EH795608.1,INSD:BX836105.1,INSD:AV805675.1,
FT                   INSD:EH864106.1,INSD:BP636712.1,INSD:EL156998.1,
FT                   INSD:EL176190.1,INSD:BP620481.1,INSD:EL165806.1,
FT                   INSD:AV795593.1,INSD:EL186934.1,INSD:BP864386.1,
FT                   INSD:EL228275.1,INSD:BE526564.1,INSD:Z38079.1,
FT                   INSD:EH933837.1,INSD:EL232807.1,INSD:T43636.1,
FT                   INSD:R84151.1,INSD:EH817095.1,INSD:EL255235.1,
FT                   INSD:BX840155.1,INSD:EH941408.1,INSD:DR354068.1,
FT                   INSD:AV812593.1,INSD:AV811044.1,INSD:EH822472.1,
FT                   INSD:AV829212.1,INSD:Z46533.1,INSD:EL175307.1,
FT                   INSD:EL005739.1,INSD:EH810878.1,INSD:EL217865.1,
FT                   INSD:EH975337.1,INSD:EL309524.1,INSD:EG524031.1,
FT                   INSD:EL162185.1,INSD:EH943014.1,INSD:AI099739.1,
FT                   INSD:BX839961.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY091009.1,INSD:AK221116.1,INSD:BT008691.1"
FT   mRNA            complement(join(180068..180544,180649..180725,
FT                   180820..181440,181580..181847,182005..183639))
FT                   /gene="PIN4"
FT                   /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
FT                   /gene_synonym="ATPIN4"
FT                   /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
FT                   /gene_synonym="F10A8.27"
FT                   /gene_synonym="PIN-FORMED 4"
FT                   /locus_tag="AT2G01420"
FT                   /product="Auxin efflux carrier family protein"
FT   CDS_pept        complement(join(180478..180544,180649..180725,
FT                   180820..180977,181355..181440,181580..181847,
FT                   182017..183199))
FT                   /codon_start=1
FT                   /gene="PIN4"
FT                   /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
FT                   /gene_synonym="ATPIN4"
FT                   /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
FT                   /gene_synonym="F10A8.27"
FT                   /gene_synonym="PIN-FORMED 4"
FT                   /locus_tag="AT2G01420"
FT                   /product="Auxin efflux carrier family protein"
FT                   /note="PIN-FORMED 4 (PIN4); FUNCTIONS IN: auxin:hydrogen
FT                   symporter activity, transporter activity; INVOLVED IN: root
FT                   development, pattern specification process, auxin polar
FT                   transport; LOCATED IN: endomembrane system, integral to
FT                   membrane; EXPRESSED IN: 27 plant structures; EXPRESSED
FT                   DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Auxin
FT                   efflux carrier, subgroup (InterPro:IPR014024), Auxin efflux
FT                   carrier (InterPro:IPR004776); BEST Arabidopsis thaliana
FT                   protein match is: Auxin efflux carrier family protein
FT                   (TAIR:AT1G70940.1); Has 1811 Blast hits to 1602 proteins in
FT                   498 species: Archae - 31; Bacteria - 1046; Metazoa - 12;
FT                   Fungi - 10; Plants - 485; Viruses - 0; Other Eukaryotes -
FT                   227 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8RWZ6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR014024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RWZ6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP590224.1,INSD:AV803269.1,INSD:EH863822.1,
FT                   INSD:BP593323.1,INSD:AV830715.1,INSD:EG524029.1,
FT                   INSD:EH918999.1,INSD:AV816911.1,INSD:EL298344.1,
FT                   INSD:EH795608.1,INSD:BX836105.1,INSD:AV805675.1,
FT                   INSD:EH864106.1,INSD:BP636712.1,INSD:EL156998.1,
FT                   INSD:EL176190.1,INSD:BP620481.1,INSD:EL165806.1,
FT                   INSD:AV795593.1,INSD:EL186934.1,INSD:BP864386.1,
FT                   INSD:EL228275.1,INSD:BE526564.1,INSD:EH933837.1,
FT                   INSD:EL232807.1,INSD:T43636.1,INSD:R84151.1,
FT                   INSD:EH817095.1,INSD:EL255235.1,INSD:BX840155.1,
FT                   INSD:EH941408.1,INSD:AV812593.1,INSD:DR354068.1,
FT                   INSD:AV811044.1,INSD:EH822472.1,INSD:AV829212.1,
FT                   INSD:Z46533.1,INSD:EL175307.1,INSD:EL005739.1,
FT                   INSD:EH810878.1,INSD:EL217865.1,INSD:EH975337.1,
FT                   INSD:EL309524.1,INSD:EG524031.1,INSD:EL162185.1,
FT                   INSD:EH943014.1,INSD:AI099739.1,INSD:BX839961.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF087016.1,INSD:AK221116.1,INSD:BX820960.1"
FT                   /protein_id="AEC05448.1"
FT                   /translation="MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRF
FT                   VAIFAVPLLSFHFISTNDPYAMNFRFVAADTLQKIIMLVLLALWANLTKNGSLEWMITI
FT                   FSLSTLPNTLVMGIPLLIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIME
FT                   QFPETGASIVSFKVESDVVSLDGHDFLETDAEIGNDGKLHVTVRKSNASRRSLMMTPRP
FT                   SNLTGAEIYSLSSTPRGSNFNHSDFYSVMGFPGGRLSNFGPADLYSVQSSRGPTPRPSN
FT                   FEENNAVKYGFYNNTNSSVPAAGSYPAPNPEFSTGTGVSTKPNKIPKENQQQLQEKDSK
FT                   ASHDAKELHMFVWSSSASPVSDVFGGGAGDNVATEQSEQGAKEIRMVVSDQPRKSGGDD
FT                   IGGLDSGEGEREIEKATAGLNKMGSNSTAELEAAGGDGGGNNGTHMPPTSVMTRLILIM
FT                   VWRKLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAGLGMAMFSLGLFMA
FT                   LQPKIIACGNSVATFAMAVRFITGPAIMAVAGIAIGLHGDLLRIAIVQAALPQGIVPFV
FT                   FAKEYNVHPTILSTGVIFGMLIALPITLVYYILLGL"
FT   CDS_pept        complement(join(180478..180544,180649..180725,
FT                   180820..180977,181355..181440,181580..181847,
FT                   182005..183199))
FT                   /codon_start=1
FT                   /gene="PIN4"
FT                   /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
FT                   /gene_synonym="ATPIN4"
FT                   /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
FT                   /gene_synonym="F10A8.27"
FT                   /gene_synonym="PIN-FORMED 4"
FT                   /locus_tag="AT2G01420"
FT                   /product="Auxin efflux carrier family protein"
FT                   /note="PIN-FORMED 4 (PIN4); FUNCTIONS IN: auxin:hydrogen
FT                   symporter activity, transporter activity; INVOLVED IN: root
FT                   development, pattern specification process, auxin polar
FT                   transport; LOCATED IN: endomembrane system, integral to
FT                   membrane; EXPRESSED IN: 27 plant structures; EXPRESSED
FT                   DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Auxin
FT                   efflux carrier, subgroup (InterPro:IPR014024), Auxin efflux
FT                   carrier (InterPro:IPR004776); BEST Arabidopsis thaliana
FT                   protein match is: Auxin efflux carrier family protein
FT                   (TAIR:AT1G70940.1); Has 1823 Blast hits to 1616 proteins in
FT                   502 species: Archae - 31; Bacteria - 1046; Metazoa - 18;
FT                   Fungi - 10; Plants - 487; Viruses - 2; Other Eukaryotes -
FT                   229 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01420"
FT                   /db_xref="GOA:Q8RWZ6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR014024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RWZ6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP590224.1,INSD:AV803269.1,INSD:EH863822.1,
FT                   INSD:BP593323.1,INSD:AV830715.1,INSD:EG524029.1,
FT                   INSD:EH918999.1,INSD:AV816911.1,INSD:EL298344.1,
FT                   INSD:EH795608.1,INSD:BX836105.1,INSD:AV805675.1,
FT                   INSD:EH864106.1,INSD:BP636712.1,INSD:EL156998.1,
FT                   INSD:EL176190.1,INSD:BP620481.1,INSD:EL165806.1,
FT                   INSD:AV795593.1,INSD:EL186934.1,INSD:BP864386.1,
FT                   INSD:EL228275.1,INSD:BE526564.1,INSD:Z38079.1,
FT                   INSD:EH933837.1,INSD:EL232807.1,INSD:T43636.1,
FT                   INSD:R84151.1,INSD:EH817095.1,INSD:EL255235.1,
FT                   INSD:BX840155.1,INSD:EH941408.1,INSD:DR354068.1,
FT                   INSD:AV812593.1,INSD:AV811044.1,INSD:EH822472.1,
FT                   INSD:AV829212.1,INSD:Z46533.1,INSD:EL175307.1,
FT                   INSD:EL005739.1,INSD:EH810878.1,INSD:EL217865.1,
FT                   INSD:EH975337.1,INSD:EL309524.1,INSD:EG524031.1,
FT                   INSD:EL162185.1,INSD:EH943014.1,INSD:AI099739.1,
FT                   INSD:BX839961.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY091009.1,INSD:AK221116.1,INSD:BT008691.1"
FT                   /protein_id="AEC05449.1"
FT                   /translation="MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRF
FT                   VAIFAVPLLSFHFISTNDPYAMNFRFVAADTLQKIIMLVLLALWANLTKNGSLEWMITI
FT                   FSLSTLPNTLVMGIPLLIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIME
FT                   QFPETGASIVSFKVESDVVSLDGHDFLETDAEIGNDGKLHVTVRKSNASRRSLMMTPRP
FT                   SNLTGAEIYSLSSTPRGSNFNHSDFYSVMGFPGGRLSNFGPADLYSVQSSRGPTPRPSN
FT                   FEENNAVKYGFYNNTNSSVPAAGSYPAPNPEFSTGTGVSTKPNKIPKENQQQLQEKDSK
FT                   ASHDAKELHMFVWSSSASPVSDVFGGGAGDNVATEQSEQGAKEIRMVVSDQPRKSNARG
FT                   GGDDIGGLDSGEGEREIEKATAGLNKMGSNSTAELEAAGGDGGGNNGTHMPPTSVMTRL
FT                   ILIMVWRKLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAGLGMAMFSLG
FT                   LFMALQPKIIACGNSVATFAMAVRFITGPAIMAVAGIAIGLHGDLLRIAIVQAALPQGI
FT                   VPFVFAKEYNVHPTILSTGVIFGMLIALPITLVYYILLGL"
FT   CDS_pept        complement(join(181344..181440,181580..181847,
FT                   182005..183199))
FT                   /codon_start=1
FT                   /gene="PIN4"
FT                   /gene_synonym="ARABIDOPSIS PIN-FORMED 4"
FT                   /gene_synonym="ATPIN4"
FT                   /gene_synonym="AUXIN TRANSPORTER SPLICE VARIANT B"
FT                   /gene_synonym="F10A8.27"
FT                   /gene_synonym="PIN-FORMED 4"
FT                   /locus_tag="AT2G01420"
FT                   /product="Auxin efflux carrier family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01420"
FT                   /db_xref="GOA:A0A1P8AY30"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR014024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AY30"
FT                   /protein_id="ANM61517.1"
FT                   /translation="MITWHDLYTVLTAVVPLYVAMILAYGSVQWWKIFSPDQCSGINRF
FT                   VAIFAVPLLSFHFISTNDPYAMNFRFVAADTLQKIIMLVLLALWANLTKNGSLEWMITI
FT                   FSLSTLPNTLVMGIPLLIAMYGTYAGSLMVQVVVLQCIIWYTLLLFLFEYRGAKLLIME
FT                   QFPETGASIVSFKVESDVVSLDGHDFLETDAEIGNDGKLHVTVRKSNASRRSLMMTPRP
FT                   SNLTGAEIYSLSSTPRGSNFNHSDFYSVMGFPGGRLSNFGPADLYSVQSSRGPTPRPSN
FT                   FEENNAVKYGFYNNTNSSVPAAGSYPAPNPEFSTGTGVSTKPNKIPKENQQQLQEKDSK
FT                   ASHDAKELHMFVWSSSASPVSDVFGGGAGDNVATEQSEQGAKEIRMVVSDQPRKSNARG
FT                   GGDDIGGLDSGEGEREIEKATAGLNKMGSNSTAELEAAGGDGGGNNGTHMPPTSVMTRL
FT                   ILIMVWRKLIRNPNTYSSLIGLIWALVAYRWHVAMPKILQQSISILSDAGLGMAMFSLG
FT                   KH"
FT   gene            183940..184734
FT                   /locus_tag="AT2G01422"
FT   ncRNA           183940..184734
FT                   /locus_tag="AT2G01422"
FT                   /product="other RNA"
FT                   /ncRNA_class="other"
FT   ncRNA           join(183940..184205,184468..184734)
FT                   /locus_tag="AT2G01422"
FT                   /product="other RNA"
FT                   /ncRNA_class="other"
FT   gene            complement(187608..190369)
FT                   /gene="HB17"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER
FT                   PROTEIN 17"
FT                   /gene_synonym="ATHB-17"
FT                   /gene_synonym="ATHB17"
FT                   /gene_synonym="F2I9.5"
FT                   /gene_synonym="F2I9_5"
FT                   /gene_synonym="homeobox-leucine zipper protein 17"
FT                   /locus_tag="AT2G01430"
FT   mRNA            complement(join(187608..188056,189398..189477,
FT                   189598..189788,190072..190369))
FT                   /gene="HB17"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER
FT                   PROTEIN 17"
FT                   /gene_synonym="ATHB-17"
FT                   /gene_synonym="ATHB17"
FT                   /gene_synonym="F2I9.5"
FT                   /gene_synonym="F2I9_5"
FT                   /gene_synonym="homeobox-leucine zipper protein 17"
FT                   /locus_tag="AT2G01430"
FT                   /product="homeobox-leucine zipper protein 17"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1,
FT                   INSD:DR751539.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1"
FT   mRNA            complement(join(187608..189477,189598..189788,
FT                   190072..190369))
FT                   /gene="HB17"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER
FT                   PROTEIN 17"
FT                   /gene_synonym="ATHB-17"
FT                   /gene_synonym="ATHB17"
FT                   /gene_synonym="F2I9.5"
FT                   /gene_synonym="F2I9_5"
FT                   /gene_synonym="homeobox-leucine zipper protein 17"
FT                   /locus_tag="AT2G01430"
FT                   /product="homeobox-leucine zipper protein 17"
FT   CDS_pept        complement(join(187798..188056,189398..189477,
FT                   189598..189788,190072..190369))
FT                   /codon_start=1
FT                   /gene="HB17"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER
FT                   PROTEIN 17"
FT                   /gene_synonym="ATHB-17"
FT                   /gene_synonym="ATHB17"
FT                   /gene_synonym="F2I9.5"
FT                   /gene_synonym="F2I9_5"
FT                   /gene_synonym="homeobox-leucine zipper protein 17"
FT                   /locus_tag="AT2G01430"
FT                   /product="homeobox-leucine zipper protein 17"
FT                   /note="homeobox-leucine zipper protein 17 (HB17); FUNCTIONS
FT                   IN: sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: regulation of transcription,
FT                   DNA-dependent, regulation of transcription; LOCATED IN:
FT                   nucleus; CONTAINS InterPro DOMAIN/s: Homeobox, conserved
FT                   site (InterPro:IPR017970), Homeobox (InterPro:IPR001356),
FT                   Homeodomain-like (InterPro:IPR009057), Leucine zipper,
FT                   homeobox-associated (InterPro:IPR003106),
FT                   Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis
FT                   thaliana protein match is: homeobox-leucine zipper protein
FT                   18 (TAIR:AT1G70920.1); Has 8030 Blast hits to 8017 proteins
FT                   in 519 species: Archae - 0; Bacteria - 0; Metazoa - 5631;
FT                   Fungi - 276; Plants - 1985; Viruses - 4; Other Eukaryotes -
FT                   134 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01430"
FT                   /db_xref="GOA:Q8S9N6"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR003106"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8S9N6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1,
FT                   INSD:DR751539.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1"
FT                   /protein_id="AEC05450.1"
FT                   /translation="MIKLLFTYICTYTYKLYALYHMDYACVCMYKYKGIVTLQVCLFYI
FT                   KLRVFLSNFTFSSSILALKNPNNSLIKIMAILPENSSNLDLTISVPGFSSSPLSDEGSG
FT                   GGRDQLRLDMNRLPSSEDGDDEEFSHDDGSAPPRKKLRLTREQSRLLEDSFRQNHTLNP
FT                   KQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEENHRLHREVE
FT                   ELRAMKVGPTTVNSASSLTMCPRCERVTPAASPSRAVVPVPAKKTFPPQERDR"
FT   CDS_pept        complement(join(189325..189477,189598..189788,
FT                   190072..190369))
FT                   /codon_start=1
FT                   /gene="HB17"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER
FT                   PROTEIN 17"
FT                   /gene_synonym="ATHB-17"
FT                   /gene_synonym="ATHB17"
FT                   /gene_synonym="F2I9.5"
FT                   /gene_synonym="F2I9_5"
FT                   /gene_synonym="homeobox-leucine zipper protein 17"
FT                   /locus_tag="AT2G01430"
FT                   /product="homeobox-leucine zipper protein 17"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01430"
FT                   /db_xref="GOA:A0A1P8B175"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B175"
FT                   /protein_id="ANM62612.1"
FT                   /translation="MIKLLFTYICTYTYKLYALYHMDYACVCMYKYKGIVTLQVCLFYI
FT                   KLRVFLSNFTFSSSILALKNPNNSLIKIMAILPENSSNLDLTISVPGFSSSPLSDEGSG
FT                   GGRDQLRLDMNRLPSSEDGDDEEFSHDDGSAPPRKKLRLTREQSRLLEDSFRQNHTLNP
FT                   KQKEVLAKHLMLRPRQIEVWFQNRRARYGFIFLFVSFLRDFCFLTSLVGG"
FT   gene            complement(193164..199280)
FT                   /gene_synonym="F2I9.6"
FT                   /gene_synonym="F2I9_6"
FT                   /locus_tag="AT2G01440"
FT   mRNA            complement(join(193164..194042,194127..194699,
FT                   194820..194903,195009..195167,195374..195517,
FT                   195594..195746,195882..195953,196157..196390,
FT                   196492..196581,196699..196780,197046..197209,
FT                   197448..197682,197886..197998,198082..198567,
FT                   198643..198778,198856..198926,199024..199280))
FT                   /gene_synonym="F2I9.6"
FT                   /gene_synonym="F2I9_6"
FT                   /locus_tag="AT2G01440"
FT                   /product="DEAD/DEAH box RNA helicase family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV547326.1,INSD:EH883228.1,INSD:DR357248.1,
FT                   INSD:ES189725.1,INSD:EG467201.1,INSD:EL092459.1,
FT                   INSD:EH920858.1,INSD:DR357247.1,INSD:EH928275.1,
FT                   INSD:ES157722.1,INSD:EG478873.1,INSD:EH796379.1,
FT                   INSD:EG467202.1,INSD:ES153997.1,INSD:ES121121.1"
FT   gene            193294..193673
FT                   /locus_tag="AT2G03995"
FT   ncRNA           193294..193673
FT                   /locus_tag="AT2G03995"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   CDS_pept        complement(join(193950..194042,194127..194699,
FT                   194820..194903,195009..195167,195374..195517,
FT                   195594..195746,195882..195953,196157..196390,
FT                   196492..196581,196699..196780,197046..197209,
FT                   197448..197682,197886..197998,198082..198567,
FT                   198643..198778,198856..198926,199024..199056))
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.6"
FT                   /gene_synonym="F2I9_6"
FT                   /locus_tag="AT2G01440"
FT                   /product="DEAD/DEAH box RNA helicase family protein"
FT                   /note="DEAD/DEAH box RNA helicase family protein; FUNCTIONS
FT                   IN: ATP-dependent DNA helicase activity, helicase activity,
FT                   nucleic acid binding, ATP-dependent helicase activity, ATP
FT                   binding; INVOLVED IN: DNA repair, DNA recombination;
FT                   EXPRESSED IN: 12 plant structures; EXPRESSED DURING: 6
FT                   growth stages; CONTAINS InterPro DOMAIN/s: DNA/RNA
FT                   helicase, DEAD/DEAH box type, N-terminal
FT                   (InterPro:IPR011545), Nucleic acid-binding, OB-fold-like
FT                   (InterPro:IPR016027), DNA helicase, ATP-dependent, RecG
FT                   (InterPro:IPR004609), DEAD-like helicase, N-terminal
FT                   (InterPro:IPR014001), DNA/RNA helicase, C-terminal
FT                   (InterPro:IPR001650), Helicase, superfamily 1/2,
FT                   ATP-binding domain (InterPro:IPR014021); BEST Arabidopsis
FT                   thaliana protein match is: DEAD/DEAH box helicase, putative
FT                   (TAIR:AT3G02060.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01440"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01440.1"
FT                   /db_xref="GOA:F4INA9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4INA9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV547326.1,INSD:EH883228.1,INSD:DR357248.1,
FT                   INSD:ES189725.1,INSD:EG467201.1,INSD:EL092459.1,
FT                   INSD:EH920858.1,INSD:DR357247.1,INSD:EH928275.1,
FT                   INSD:ES157722.1,INSD:EG478873.1,INSD:EH796379.1,
FT                   INSD:EG467202.1,INSD:ES153997.1,INSD:ES121121.1"
FT                   /protein_id="AEC05451.1"
FT                   /translation="MAAVTLSPCSMCCGSRRLRSVIVIQAQRGNWNRIRLSNFFFSKVW
FT                   NISYRSKHKYSDNLLEQVEKYASARLENQSKLITKVAALMECDNVDDFIDKKSDEQVKK
FT                   DLVLACKRFPSIILGDSRPVELYSNSKSYGESSSILKTPTDNSFLPTPMHGGWFDPDNL
FT                   SRTLSSFCPELLQNDDSSDPREDILDDGSSFTSKTATSEVEATSDDVFAAQRFLATSID
FT                   SMPGLSKRHSNQLDSCGFHTMKKLLHHFPRTYADLQNAQVDIEDGQYLIFVGKVLSSKG
FT                   VRASSSFSFLEVIVSCEVSGRDRTPEDLSHNAEDKAGKSIFLHLKKFFRGTRFTWQPFL
FT                   NSIQEKHKVGDLVCISGKVKSLRAEDHFEMREYNIDVLKDEEESSHRAQGRPYPIYPSK
FT                   GGLNPKFLSDVISRALRVLPANMDPIPKEITKVFGLPSLNDAYVGIHEPKTLDEADLAR
FT                   KRLIFDEFFYLQLARLYQMLQSLGTKIEKDVLLEKFRKPVLNSVYIEEWSTLTKSFLKA
FT                   LPYSLTPSQLSAVSEIIWDLKRPVPMNRLLQGDVGCGKTVVAFLACMEVIGSGYQAAFM
FT                   APTELLAIQHYEQCRDLLENMEGVSSKPTIGLLTGSTPAKQSRMIRQDLQSGAISFIIG
FT                   THSLIAEKIEYSALRIAVVDEQQRFGVIQRGKFNSKLYGTSMISKSGSSDSDDTSKADL
FT                   SMAPHVLAMSATPIPRSLALALYGDISLTQITGMPLGRIPVETHIFEGNETGIKEVYSM
FT                   MLEDLKSGGRVYVVYPVIDQSEQLPQLRAASAELEIVTKKFPKYNCGLLHGRMKSDDKE
FT                   EALNKFRSGETQILLSTQVIEIGVDVPDASMMVVMNAERFGIAQLHQLRGRVGRGTRKS
FT                   KCLLVGSSTNSLKRLNMLGKSSDGFYLANIDLLLRGPGDLLGKKQSGHLPEFPVARLEI
FT                   DGNMLQEAHIAALNVLGDSHDLEKFPALKAELSMRQPLCLLGD"
FT   gene            complement(199491..203126)
FT                   /gene="MPK17"
FT                   /gene_synonym="ATMPK17"
FT                   /gene_synonym="F2I9.7"
FT                   /gene_synonym="F2I9_7"
FT                   /gene_synonym="MAP kinase 17"
FT                   /locus_tag="AT2G01450"
FT                   /note="member of MAP Kinase"
FT   mRNA            complement(join(199491..199956,200039..200146,
FT                   200229..200308,200411..200548,200637..200792,
FT                   200948..201097,201184..201243,201361..201488,
FT                   201605..202025,202227..202397))
FT                   /gene="MPK17"
FT                   /gene_synonym="ATMPK17"
FT                   /gene_synonym="F2I9.7"
FT                   /gene_synonym="F2I9_7"
FT                   /gene_synonym="MAP kinase 17"
FT                   /locus_tag="AT2G01450"
FT                   /product="MAP kinase 17"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
FT                   INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
FT                   INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
FT                   INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
FT                   INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
FT                   INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
FT                   INSD:AV550338.1,INSD:BP610323.1,INSD:BP613733.1,
FT                   INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
FT                   INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
FT                   INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
FT                   INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
FT                   INSD:AV527795.1,INSD:BP621466.1,INSD:AV531369.1,
FT                   INSD:EL263671.1,INSD:AV547858.1,INSD:BU636240.1,
FT                   INSD:EG502926.1,INSD:ES029766.1,INSD:AV535563.1,
FT                   INSD:AV539430.1,INSD:EG450332.1,INSD:AV543235.1,
FT                   INSD:EL121448.1,INSD:BP609911.1,INSD:AU226975.1,
FT                   INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
FT                   INSD:Z18452.1,INSD:BP607130.1,INSD:BP863455.1,
FT                   INSD:BP640028.1,INSD:EL215606.1,INSD:EH924751.1,
FT                   INSD:AV521125.1,INSD:BP616037.1,INSD:ES082550.1,
FT                   INSD:BP670334.1,INSD:AV547086.1,INSD:BP615091.1,
FT                   INSD:EL044033.1,INSD:BP602328.1,INSD:EH969793.1,
FT                   INSD:BP795275.1,INSD:BP622662.1,INSD:ES121867.1,
FT                   INSD:ES085636.1,INSD:ES194436.1,INSD:BP651132.1,
FT                   INSD:ES163215.1,INSD:BP613398.1,INSD:EH840807.1,
FT                   INSD:EL177567.1,INSD:DR262105.1,INSD:EL199024.1,
FT                   INSD:BP613900.1,INSD:DR382927.1,INSD:ES130266.1,
FT                   INSD:EH836418.1,INSD:BP615084.1,INSD:BP645024.1,
FT                   INSD:DR262106.1,INSD:BP621415.1,INSD:ES054765.1,
FT                   INSD:BP783482.1,INSD:EL089391.1,INSD:EL169981.1,
FT                   INSD:AV532356.1,INSD:BP612094.1,INSD:BP780121.1,
FT                   INSD:BP614879.1,INSD:BP632966.1,INSD:ES114201.1,
FT                   INSD:EH973899.1,INSD:DR379452.1,INSD:EL181715.1,
FT                   INSD:BP620091.1,INSD:BP625712.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
FT   mRNA            complement(join(199511..199956,200039..200146,
FT                   200229..200308,200411..200548,200637..200792,
FT                   200948..201097,201184..201243,201361..201488,
FT                   201605..202025,203031..203126))
FT                   /gene="MPK17"
FT                   /gene_synonym="ATMPK17"
FT                   /gene_synonym="F2I9.7"
FT                   /gene_synonym="F2I9_7"
FT                   /gene_synonym="MAP kinase 17"
FT                   /locus_tag="AT2G01450"
FT                   /product="MAP kinase 17"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG450996.1,INSD:BP844824.1,INSD:BP808830.2,
FT                   INSD:EG476771.1,INSD:EL224734.1,INSD:AV551027.1,
FT                   INSD:BP617107.1,INSD:CD534431.1,INSD:BP614449.1,
FT                   INSD:EG425080.1,INSD:BP612876.1,INSD:EH890182.1,
FT                   INSD:AV542811.1,INSD:BP645298.1,INSD:EL320294.1,
FT                   INSD:DR382275.1,INSD:BP614693.1,INSD:BP808420.2,
FT                   INSD:DR262107.1,INSD:EL987631.1,INSD:EL160723.1,
FT                   INSD:AV550338.1,INSD:BP610323.1,INSD:EH863420.1,
FT                   INSD:BP867324.1,INSD:BP613733.1,INSD:BP856857.2,
FT                   INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
FT                   INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
FT                   INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
FT                   INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
FT                   INSD:BP822958.1,INSD:AV527795.1,INSD:AV531369.1,
FT                   INSD:BP621466.1,INSD:EL263671.1,INSD:AV526002.1,
FT                   INSD:AV547858.1,INSD:BU636240.1,INSD:BP819615.1,
FT                   INSD:EG502926.1,INSD:DR362450.1,INSD:ES029766.1,
FT                   INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
FT                   INSD:AV543235.1,INSD:EL121448.1,INSD:BP609911.1,
FT                   INSD:AU226975.1,INSD:BP808098.1,INSD:BE521000.1,
FT                   INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
FT                   INSD:Z18452.1,INSD:N96333.1,INSD:BP607130.1,
FT                   INSD:BP640028.1,INSD:EL215606.1,INSD:AV521125.1,
FT                   INSD:EH924751.1,INSD:BP616037.1,INSD:AV547086.1,
FT                   INSD:DR275775.1,INSD:ES082550.1,INSD:BP670334.1,
FT                   INSD:BP615091.1,INSD:BP840986.2,INSD:EL044033.1,
FT                   INSD:BP852028.1,INSD:AU236153.1,INSD:BP602328.1,
FT                   INSD:EH969793.1,INSD:BP805575.1,INSD:BP795275.1,
FT                   INSD:BP622662.1,INSD:BP850276.1,INSD:ES121867.1,
FT                   INSD:ES085636.1,INSD:ES194436.1,INSD:BP651132.1,
FT                   INSD:ES163215.1,INSD:BP807795.1,INSD:BP613398.1,
FT                   INSD:EL177567.1,INSD:EH840807.1,INSD:DR262105.1,
FT                   INSD:EL199024.1,INSD:BP613900.1,INSD:DR382927.1,
FT                   INSD:ES130266.1,INSD:EH836418.1,INSD:BP615084.1,
FT                   INSD:EG450995.1,INSD:BP645024.1,INSD:DR262106.1,
FT                   INSD:BP621415.1,INSD:ES054765.1,INSD:BP783482.1,
FT                   INSD:EL089391.1,INSD:EH940989.1,INSD:EL169981.1,
FT                   INSD:AV532356.1,INSD:EH816349.1,INSD:BP612094.1,
FT                   INSD:BP780121.1,INSD:BP614879.1,INSD:BP851693.1,
FT                   INSD:BP632966.1,INSD:BP807998.1,INSD:BP810358.1,
FT                   INSD:DR379452.1,INSD:ES114201.1,INSD:EH973899.1,
FT                   INSD:EL181715.1,INSD:BP620091.1,INSD:BP625712.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK228266.1,INSD:BX820037.1,INSD:BT006469.1"
FT   mRNA            complement(join(199511..199956,200039..200146,
FT                   200229..200308,200411..200548,200637..200792,
FT                   200948..201097,201184..201243,201361..201488,
FT                   201605..202110,202227..202292))
FT                   /gene="MPK17"
FT                   /gene_synonym="ATMPK17"
FT                   /gene_synonym="F2I9.7"
FT                   /gene_synonym="F2I9_7"
FT                   /gene_synonym="MAP kinase 17"
FT                   /locus_tag="AT2G01450"
FT                   /product="MAP kinase 17"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
FT                   INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
FT                   INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
FT                   INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
FT                   INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
FT                   INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
FT                   INSD:AV550338.1,INSD:BP610323.1,INSD:BP613733.1,
FT                   INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
FT                   INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
FT                   INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
FT                   INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
FT                   INSD:AV527795.1,INSD:BP621466.1,INSD:AV531369.1,
FT                   INSD:EL263671.1,INSD:BP805944.1,INSD:AV547858.1,
FT                   INSD:BU636240.1,INSD:EG502926.1,INSD:ES029766.1,
FT                   INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
FT                   INSD:AV543235.1,INSD:EL121448.1,INSD:BP851684.1,
FT                   INSD:BP609911.1,INSD:AU226975.1,INSD:AI997494.1,
FT                   INSD:ES172967.1,INSD:BP609017.1,INSD:Z18452.1,
FT                   INSD:BP846533.1,INSD:BP607130.1,INSD:BP640028.1,
FT                   INSD:EL215606.1,INSD:EH924751.1,INSD:AV521125.1,
FT                   INSD:BP616037.1,INSD:AV547086.1,INSD:ES082550.1,
FT                   INSD:BP670334.1,INSD:BP615091.1,INSD:EL044033.1,
FT                   INSD:BP602328.1,INSD:EH969793.1,INSD:BP795275.1,
FT                   INSD:BP622662.1,INSD:ES121867.1,INSD:ES085636.1,
FT                   INSD:ES194436.1,INSD:BP651132.1,INSD:ES163215.1,
FT                   INSD:BP613398.1,INSD:EH840807.1,INSD:EL177567.1,
FT                   INSD:DR262105.1,INSD:EL199024.1,INSD:BP613900.1,
FT                   INSD:DR382927.1,INSD:ES130266.1,INSD:EH836418.1,
FT                   INSD:BP615084.1,INSD:BP645024.1,INSD:DR262106.1,
FT                   INSD:BP621415.1,INSD:ES054765.1,INSD:BP783482.1,
FT                   INSD:EL089391.1,INSD:EL169981.1,INSD:AV532356.1,
FT                   INSD:BP612094.1,INSD:BP780121.1,INSD:BP614879.1,
FT                   INSD:BP632966.1,INSD:ES114201.1,INSD:EH973899.1,
FT                   INSD:DR379452.1,INSD:EL181715.1,INSD:BP620091.1,
FT                   INSD:BP625712.1"
FT   mRNA            complement(join(199511..199956,200039..200146,
FT                   200229..200308,200411..200548,200637..200792,
FT                   200948..201097,201184..201243,201361..201488,
FT                   201605..202025,202130..202198))
FT                   /gene="MPK17"
FT                   /gene_synonym="ATMPK17"
FT                   /gene_synonym="F2I9.7"
FT                   /gene_synonym="F2I9_7"
FT                   /gene_synonym="MAP kinase 17"
FT                   /locus_tag="AT2G01450"
FT                   /product="MAP kinase 17"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
FT                   INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
FT                   INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
FT                   INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
FT                   INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
FT                   INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
FT                   INSD:AV550338.1,INSD:BP610323.1,INSD:EH863420.1,
FT                   INSD:BP613733.1,INSD:EG450334.1,INSD:BP621076.1,
FT                   INSD:BP609184.1,INSD:EG450353.1,INSD:BP600289.1,
FT                   INSD:BP605409.1,INSD:EL987647.1,INSD:DR262108.1,
FT                   INSD:BP669583.1,INSD:BP657041.1,INSD:BP649376.1,
FT                   INSD:ES096991.1,INSD:AV527795.1,INSD:BP621466.1,
FT                   INSD:AV531369.1,INSD:EL263671.1,INSD:AV547858.1,
FT                   INSD:BU636240.1,INSD:EG502926.1,INSD:ES029766.1,
FT                   INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
FT                   INSD:EG476975.1,INSD:AV543235.1,INSD:EL121448.1,
FT                   INSD:AA713093.1,INSD:BP609911.1,INSD:AU226975.1,
FT                   INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
FT                   INSD:Z18452.1,INSD:BP607130.1,INSD:BP640028.1,
FT                   INSD:EL215606.1,INSD:EH924751.1,INSD:AV521125.1,
FT                   INSD:BP616037.1,INSD:AV547086.1,INSD:ES082550.1,
FT                   INSD:BP670334.1,INSD:BP615091.1,INSD:EL044033.1,
FT                   INSD:BP602328.1,INSD:EH969793.1,INSD:BP795275.1,
FT                   INSD:BP622662.1,INSD:ES121867.1,INSD:ES085636.1,
FT                   INSD:ES194436.1,INSD:BP651132.1,INSD:ES163215.1,
FT                   INSD:BP809391.1,INSD:BP613398.1,INSD:EH840807.1,
FT                   INSD:EL177567.1,INSD:DR262105.1,INSD:EL199024.1,
FT                   INSD:BP613900.1,INSD:DR382927.1,INSD:ES130266.1,
FT                   INSD:EH836418.1,INSD:BP615084.1,INSD:BP645024.1,
FT                   INSD:DR262106.1,INSD:BP621415.1,INSD:ES054765.1,
FT                   INSD:BP783482.1,INSD:EL089391.1,INSD:EH940989.1,
FT                   INSD:EL169981.1,INSD:AV532356.1,INSD:BP612094.1,
FT                   INSD:BP780121.1,INSD:AI993802.1,INSD:BP614879.1,
FT                   INSD:BP632966.1,INSD:EL967069.1,INSD:ES114201.1,
FT                   INSD:EH973899.1,INSD:DR379452.1,INSD:EL181715.1,
FT                   INSD:BP620091.1,INSD:BP625712.1"
FT   CDS_pept        complement(join(199722..199956,200039..200146,
FT                   200229..200308,200411..200548,200637..200792,
FT                   200948..201097,201184..201243,201361..201488,
FT                   201605..202010))
FT                   /codon_start=1
FT                   /gene="MPK17"
FT                   /gene_synonym="ATMPK17"
FT                   /gene_synonym="F2I9.7"
FT                   /gene_synonym="F2I9_7"
FT                   /gene_synonym="MAP kinase 17"
FT                   /locus_tag="AT2G01450"
FT                   /product="MAP kinase 17"
FT                   /note="MAP kinase 17 (MPK17); CONTAINS InterPro DOMAIN/s:
FT                   MAP kinase, conserved site (InterPro:IPR003527), Protein
FT                   kinase, ATP binding site (InterPro:IPR017441), Protein
FT                   kinase, catalytic domain (InterPro:IPR000719),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Tyrosine-protein kinase, catalytic
FT                   domain (InterPro:IPR020635), Serine/threonine-protein
FT                   kinase-like domain (InterPro:IPR017442), Protein
FT                   kinase-like domain (InterPro:IPR011009); BEST Arabidopsis
FT                   thaliana protein match is: MAP kinase 9 (TAIR:AT3G18040.1);
FT                   Has 113085 Blast hits to 112072 proteins in 3455 species:
FT                   Archae - 88; Bacteria - 12258; Metazoa - 41885; Fungi -
FT                   11781; Plants - 27798; Viruses - 485; Other Eukaryotes -
FT                   18790 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q84M93"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84M93"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG450996.1,INSD:BP844824.1,INSD:BP808830.2,
FT                   INSD:EG476771.1,INSD:EL224734.1,INSD:AV551027.1,
FT                   INSD:BP617107.1,INSD:CD534431.1,INSD:BP614449.1,
FT                   INSD:EG425080.1,INSD:BP612876.1,INSD:EH890182.1,
FT                   INSD:AV542811.1,INSD:BP645298.1,INSD:EL320294.1,
FT                   INSD:DR382275.1,INSD:BP614693.1,INSD:BP808420.2,
FT                   INSD:DR262107.1,INSD:EL987631.1,INSD:EL160723.1,
FT                   INSD:AV550338.1,INSD:BP610323.1,INSD:EH863420.1,
FT                   INSD:BP867324.1,INSD:BP613733.1,INSD:BP856857.2,
FT                   INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
FT                   INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
FT                   INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
FT                   INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
FT                   INSD:BP822958.1,INSD:AV527795.1,INSD:AV531369.1,
FT                   INSD:BP621466.1,INSD:EL263671.1,INSD:AV526002.1,
FT                   INSD:AV547858.1,INSD:BU636240.1,INSD:BP819615.1,
FT                   INSD:EG502926.1,INSD:DR362450.1,INSD:ES029766.1,
FT                   INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
FT                   INSD:AV543235.1,INSD:EL121448.1,INSD:BP609911.1,
FT                   INSD:AU226975.1,INSD:BP808098.1,INSD:BE521000.1,
FT                   INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
FT                   INSD:Z18452.1,INSD:N96333.1,INSD:BP607130.1,
FT                   INSD:BP640028.1,INSD:EL215606.1,INSD:AV521125.1,
FT                   INSD:EH924751.1,INSD:BP616037.1,INSD:AV547086.1,
FT                   INSD:DR275775.1,INSD:ES082550.1,INSD:BP670334.1,
FT                   INSD:BP615091.1,INSD:BP840986.2,INSD:EL044033.1,
FT                   INSD:BP852028.1,INSD:AU236153.1,INSD:BP602328.1,
FT                   INSD:EH969793.1,INSD:BP805575.1,INSD:BP795275.1,
FT                   INSD:BP622662.1,INSD:BP850276.1,INSD:ES121867.1,
FT                   INSD:ES085636.1,INSD:ES194436.1,INSD:BP651132.1,
FT                   INSD:ES163215.1,INSD:BP807795.1,INSD:BP613398.1,
FT                   INSD:EL177567.1,INSD:EH840807.1,INSD:DR262105.1,
FT                   INSD:EL199024.1,INSD:BP613900.1,INSD:DR382927.1,
FT                   INSD:ES130266.1,INSD:EH836418.1,INSD:BP615084.1,
FT                   INSD:EG450995.1,INSD:BP645024.1,INSD:DR262106.1,
FT                   INSD:BP621415.1,INSD:ES054765.1,INSD:BP783482.1,
FT                   INSD:EL089391.1,INSD:EH940989.1,INSD:EL169981.1,
FT                   INSD:AV532356.1,INSD:EH816349.1,INSD:BP612094.1,
FT                   INSD:BP780121.1,INSD:BP614879.1,INSD:BP851693.1,
FT                   INSD:BP632966.1,INSD:BP807998.1,INSD:BP810358.1,
FT                   INSD:DR379452.1,INSD:ES114201.1,INSD:EH973899.1,
FT                   INSD:EL181715.1,INSD:BP620091.1,INSD:BP625712.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK228266.1,INSD:BX820037.1,INSD:BT006469.1"
FT                   /protein_id="AEC05452.1"
FT                   /translation="MLEKEFFTEYGEASQYQIQEVVGKGSYGVVASAECPHTGGKVAIK
FT                   KMTNVFEHVSDAIRILREIKLLRLLRHPDIVEIKHIMLPPCRKEFKDIYVVFELMESDL
FT                   HHVLKVNDDLTPQHHQFFLYQLLRGLKFMHSAHVFHRDLKPKNILANADCKIKICDLGL
FT                   ARVSFTDSPSAVFWTDYVATRWYRAPELCGSFYSNYTPAIDMWSVGCIFAEMLTGKPLF
FT                   PGKNVVHQLELVTDLLGTPSPITLSRIRNEKARKYLGNMRRKDPVPFTHKFPNIDPVAL
FT                   KLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYEPSRQPISKLEFEFERRKLTRDDVR
FT                   ELMYREILEYHPQMLQEYLQGEENINSHFLYPSGVDQFKQEFARLEEHNDDEEEHNSPP
FT                   HQRKYTSLPRERVCSSEDEGSDSVHAQSSSASVVFTPPQTPNTATGLSSQKASQVDKAA
FT                   TPVKRSACLMRSDSICASRCVGVSSAVS"
FT   CDS_pept        complement(join(199722..199956,200039..200146,
FT                   200229..200308,200411..200548,200637..200792,
FT                   200948..201097,201184..201243,201361..201488,
FT                   201605..202010))
FT                   /codon_start=1
FT                   /gene="MPK17"
FT                   /gene_synonym="ATMPK17"
FT                   /gene_synonym="F2I9.7"
FT                   /gene_synonym="F2I9_7"
FT                   /gene_synonym="MAP kinase 17"
FT                   /locus_tag="AT2G01450"
FT                   /product="MAP kinase 17"
FT                   /note="MAP kinase 17 (MPK17); CONTAINS InterPro DOMAIN/s:
FT                   Protein kinase, ATP binding site (InterPro:IPR017441),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), MAP kinase, conserved site
FT                   (InterPro:IPR003527), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Tyrosine-protein kinase, catalytic
FT                   domain (InterPro:IPR020635); BEST Arabidopsis thaliana
FT                   protein match is: MAP kinase 9 (TAIR:AT3G18040.1); Has
FT                   35333 Blast hits to 34131 proteins in 2444 species: Archae
FT                   - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
FT                   - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q84M93"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84M93"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
FT                   INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
FT                   INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
FT                   INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
FT                   INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
FT                   INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
FT                   INSD:AV550338.1,INSD:BP610323.1,INSD:BP613733.1,
FT                   INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
FT                   INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
FT                   INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
FT                   INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
FT                   INSD:AV527795.1,INSD:BP621466.1,INSD:AV531369.1,
FT                   INSD:EL263671.1,INSD:BP805944.1,INSD:AV547858.1,
FT                   INSD:BU636240.1,INSD:EG502926.1,INSD:ES029766.1,
FT                   INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
FT                   INSD:AV543235.1,INSD:EL121448.1,INSD:BP851684.1,
FT                   INSD:BP609911.1,INSD:AU226975.1,INSD:AI997494.1,
FT                   INSD:ES172967.1,INSD:BP609017.1,INSD:Z18452.1,
FT                   INSD:BP846533.1,INSD:BP607130.1,INSD:BP640028.1,
FT                   INSD:EL215606.1,INSD:EH924751.1,INSD:AV521125.1,
FT                   INSD:BP616037.1,INSD:AV547086.1,INSD:ES082550.1,
FT                   INSD:BP670334.1,INSD:BP615091.1,INSD:EL044033.1,
FT                   INSD:BP602328.1,INSD:EH969793.1,INSD:BP795275.1,
FT                   INSD:BP622662.1,INSD:ES121867.1,INSD:ES085636.1,
FT                   INSD:ES194436.1,INSD:BP651132.1,INSD:ES163215.1,
FT                   INSD:BP613398.1,INSD:EH840807.1,INSD:EL177567.1,
FT                   INSD:DR262105.1,INSD:EL199024.1,INSD:BP613900.1,
FT                   INSD:DR382927.1,INSD:ES130266.1,INSD:EH836418.1,
FT                   INSD:BP615084.1,INSD:BP645024.1,INSD:DR262106.1,
FT                   INSD:BP621415.1,INSD:ES054765.1,INSD:BP783482.1,
FT                   INSD:EL089391.1,INSD:EL169981.1,INSD:AV532356.1,
FT                   INSD:BP612094.1,INSD:BP780121.1,INSD:BP614879.1,
FT                   INSD:BP632966.1,INSD:ES114201.1,INSD:EH973899.1,
FT                   INSD:DR379452.1,INSD:EL181715.1,INSD:BP620091.1,
FT                   INSD:BP625712.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
FT                   /protein_id="AEC05453.1"
FT                   /translation="MLEKEFFTEYGEASQYQIQEVVGKGSYGVVASAECPHTGGKVAIK
FT                   KMTNVFEHVSDAIRILREIKLLRLLRHPDIVEIKHIMLPPCRKEFKDIYVVFELMESDL
FT                   HHVLKVNDDLTPQHHQFFLYQLLRGLKFMHSAHVFHRDLKPKNILANADCKIKICDLGL
FT                   ARVSFTDSPSAVFWTDYVATRWYRAPELCGSFYSNYTPAIDMWSVGCIFAEMLTGKPLF
FT                   PGKNVVHQLELVTDLLGTPSPITLSRIRNEKARKYLGNMRRKDPVPFTHKFPNIDPVAL
FT                   KLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYEPSRQPISKLEFEFERRKLTRDDVR
FT                   ELMYREILEYHPQMLQEYLQGEENINSHFLYPSGVDQFKQEFARLEEHNDDEEEHNSPP
FT                   HQRKYTSLPRERVCSSEDEGSDSVHAQSSSASVVFTPPQTPNTATGLSSQKASQVDKAA
FT                   TPVKRSACLMRSDSICASRCVGVSSAVS"
FT   CDS_pept        complement(join(199722..199956,200039..200146,
FT                   200229..200308,200411..200548,200637..200792,
FT                   200948..201097,201184..201243,201361..201488,
FT                   201605..202010))
FT                   /codon_start=1
FT                   /gene="MPK17"
FT                   /gene_synonym="ATMPK17"
FT                   /gene_synonym="F2I9.7"
FT                   /gene_synonym="F2I9_7"
FT                   /gene_synonym="MAP kinase 17"
FT                   /locus_tag="AT2G01450"
FT                   /product="MAP kinase 17"
FT                   /note="MAP kinase 17 (MPK17); CONTAINS InterPro DOMAIN/s:
FT                   Protein kinase, ATP binding site (InterPro:IPR017441),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), MAP kinase, conserved site
FT                   (InterPro:IPR003527), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Tyrosine-protein kinase, catalytic
FT                   domain (InterPro:IPR020635); BEST Arabidopsis thaliana
FT                   protein match is: MAP kinase 9 (TAIR:AT3G18040.1); Has
FT                   35333 Blast hits to 34131 proteins in 2444 species: Archae
FT                   - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
FT                   - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q84M93"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84M93"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
FT                   INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
FT                   INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
FT                   INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
FT                   INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
FT                   INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
FT                   INSD:AV550338.1,INSD:BP610323.1,INSD:EH863420.1,
FT                   INSD:BP613733.1,INSD:EG450334.1,INSD:BP621076.1,
FT                   INSD:BP609184.1,INSD:EG450353.1,INSD:BP600289.1,
FT                   INSD:BP605409.1,INSD:EL987647.1,INSD:DR262108.1,
FT                   INSD:BP669583.1,INSD:BP657041.1,INSD:BP649376.1,
FT                   INSD:ES096991.1,INSD:AV527795.1,INSD:BP621466.1,
FT                   INSD:AV531369.1,INSD:EL263671.1,INSD:AV547858.1,
FT                   INSD:BU636240.1,INSD:EG502926.1,INSD:ES029766.1,
FT                   INSD:AV535563.1,INSD:AV539430.1,INSD:EG450332.1,
FT                   INSD:EG476975.1,INSD:AV543235.1,INSD:EL121448.1,
FT                   INSD:AA713093.1,INSD:BP609911.1,INSD:AU226975.1,
FT                   INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
FT                   INSD:Z18452.1,INSD:BP607130.1,INSD:BP640028.1,
FT                   INSD:EL215606.1,INSD:EH924751.1,INSD:AV521125.1,
FT                   INSD:BP616037.1,INSD:AV547086.1,INSD:ES082550.1,
FT                   INSD:BP670334.1,INSD:BP615091.1,INSD:EL044033.1,
FT                   INSD:BP602328.1,INSD:EH969793.1,INSD:BP795275.1,
FT                   INSD:BP622662.1,INSD:ES121867.1,INSD:ES085636.1,
FT                   INSD:ES194436.1,INSD:BP651132.1,INSD:ES163215.1,
FT                   INSD:BP809391.1,INSD:BP613398.1,INSD:EH840807.1,
FT                   INSD:EL177567.1,INSD:DR262105.1,INSD:EL199024.1,
FT                   INSD:BP613900.1,INSD:DR382927.1,INSD:ES130266.1,
FT                   INSD:EH836418.1,INSD:BP615084.1,INSD:BP645024.1,
FT                   INSD:DR262106.1,INSD:BP621415.1,INSD:ES054765.1,
FT                   INSD:BP783482.1,INSD:EL089391.1,INSD:EH940989.1,
FT                   INSD:EL169981.1,INSD:AV532356.1,INSD:BP612094.1,
FT                   INSD:BP780121.1,INSD:AI993802.1,INSD:BP614879.1,
FT                   INSD:BP632966.1,INSD:EL967069.1,INSD:ES114201.1,
FT                   INSD:EH973899.1,INSD:DR379452.1,INSD:EL181715.1,
FT                   INSD:BP620091.1,INSD:BP625712.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
FT                   /protein_id="AEC05454.1"
FT                   /translation="MLEKEFFTEYGEASQYQIQEVVGKGSYGVVASAECPHTGGKVAIK
FT                   KMTNVFEHVSDAIRILREIKLLRLLRHPDIVEIKHIMLPPCRKEFKDIYVVFELMESDL
FT                   HHVLKVNDDLTPQHHQFFLYQLLRGLKFMHSAHVFHRDLKPKNILANADCKIKICDLGL
FT                   ARVSFTDSPSAVFWTDYVATRWYRAPELCGSFYSNYTPAIDMWSVGCIFAEMLTGKPLF
FT                   PGKNVVHQLELVTDLLGTPSPITLSRIRNEKARKYLGNMRRKDPVPFTHKFPNIDPVAL
FT                   KLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYEPSRQPISKLEFEFERRKLTRDDVR
FT                   ELMYREILEYHPQMLQEYLQGEENINSHFLYPSGVDQFKQEFARLEEHNDDEEEHNSPP
FT                   HQRKYTSLPRERVCSSEDEGSDSVHAQSSSASVVFTPPQTPNTATGLSSQKASQVDKAA
FT                   TPVKRSACLMRSDSICASRCVGVSSAVS"
FT   CDS_pept        complement(join(199722..199956,200039..200146,
FT                   200229..200308,200411..200548,200637..200792,
FT                   200948..201097,201184..201243,201361..201488,
FT                   201605..202010))
FT                   /codon_start=1
FT                   /gene="MPK17"
FT                   /gene_synonym="ATMPK17"
FT                   /gene_synonym="F2I9.7"
FT                   /gene_synonym="F2I9_7"
FT                   /gene_synonym="MAP kinase 17"
FT                   /locus_tag="AT2G01450"
FT                   /product="MAP kinase 17"
FT                   /note="MAP kinase 17 (MPK17); CONTAINS InterPro DOMAIN/s:
FT                   MAP kinase, conserved site (InterPro:IPR003527), Protein
FT                   kinase, ATP binding site (InterPro:IPR017441), Protein
FT                   kinase, catalytic domain (InterPro:IPR000719),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Tyrosine-protein kinase, catalytic
FT                   domain (InterPro:IPR020635), Serine/threonine-protein
FT                   kinase-like domain (InterPro:IPR017442), Protein
FT                   kinase-like domain (InterPro:IPR011009); BEST Arabidopsis
FT                   thaliana protein match is: MAP kinase 9 (TAIR:AT3G18040.1);
FT                   Has 35333 Blast hits to 34131 proteins in 2444 species:
FT                   Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991;
FT                   Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q84M93"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84M93"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG450996.1,INSD:BP808830.2,INSD:EG476771.1,
FT                   INSD:EL224734.1,INSD:AV551027.1,INSD:BP617107.1,
FT                   INSD:CD534431.1,INSD:BP614449.1,INSD:EG425080.1,
FT                   INSD:BP612876.1,INSD:EH890182.1,INSD:AV542811.1,
FT                   INSD:BP645298.1,INSD:EL320294.1,INSD:DR382275.1,
FT                   INSD:BP614693.1,INSD:DR262107.1,INSD:EL160723.1,
FT                   INSD:AV550338.1,INSD:BP610323.1,INSD:BP613733.1,
FT                   INSD:EG450334.1,INSD:BP621076.1,INSD:BP609184.1,
FT                   INSD:EG450353.1,INSD:BP600289.1,INSD:BP605409.1,
FT                   INSD:EL987647.1,INSD:DR262108.1,INSD:BP669583.1,
FT                   INSD:BP657041.1,INSD:BP649376.1,INSD:ES096991.1,
FT                   INSD:AV527795.1,INSD:BP621466.1,INSD:AV531369.1,
FT                   INSD:EL263671.1,INSD:AV547858.1,INSD:BU636240.1,
FT                   INSD:EG502926.1,INSD:ES029766.1,INSD:AV535563.1,
FT                   INSD:AV539430.1,INSD:EG450332.1,INSD:AV543235.1,
FT                   INSD:EL121448.1,INSD:BP609911.1,INSD:AU226975.1,
FT                   INSD:AI997494.1,INSD:ES172967.1,INSD:BP609017.1,
FT                   INSD:Z18452.1,INSD:BP607130.1,INSD:BP863455.1,
FT                   INSD:BP640028.1,INSD:EL215606.1,INSD:EH924751.1,
FT                   INSD:AV521125.1,INSD:BP616037.1,INSD:ES082550.1,
FT                   INSD:BP670334.1,INSD:AV547086.1,INSD:BP615091.1,
FT                   INSD:EL044033.1,INSD:BP602328.1,INSD:EH969793.1,
FT                   INSD:BP795275.1,INSD:BP622662.1,INSD:ES121867.1,
FT                   INSD:ES085636.1,INSD:ES194436.1,INSD:BP651132.1,
FT                   INSD:ES163215.1,INSD:BP613398.1,INSD:EH840807.1,
FT                   INSD:EL177567.1,INSD:DR262105.1,INSD:EL199024.1,
FT                   INSD:BP613900.1,INSD:DR382927.1,INSD:ES130266.1,
FT                   INSD:EH836418.1,INSD:BP615084.1,INSD:BP645024.1,
FT                   INSD:DR262106.1,INSD:BP621415.1,INSD:ES054765.1,
FT                   INSD:BP783482.1,INSD:EL089391.1,INSD:EL169981.1,
FT                   INSD:AV532356.1,INSD:BP612094.1,INSD:BP780121.1,
FT                   INSD:BP614879.1,INSD:BP632966.1,INSD:ES114201.1,
FT                   INSD:EH973899.1,INSD:DR379452.1,INSD:EL181715.1,
FT                   INSD:BP620091.1,INSD:BP625712.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT006469.1"
FT                   /protein_id="AEC05455.1"
FT                   /translation="MLEKEFFTEYGEASQYQIQEVVGKGSYGVVASAECPHTGGKVAIK
FT                   KMTNVFEHVSDAIRILREIKLLRLLRHPDIVEIKHIMLPPCRKEFKDIYVVFELMESDL
FT                   HHVLKVNDDLTPQHHQFFLYQLLRGLKFMHSAHVFHRDLKPKNILANADCKIKICDLGL
FT                   ARVSFTDSPSAVFWTDYVATRWYRAPELCGSFYSNYTPAIDMWSVGCIFAEMLTGKPLF
FT                   PGKNVVHQLELVTDLLGTPSPITLSRIRNEKARKYLGNMRRKDPVPFTHKFPNIDPVAL
FT                   KLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYEPSRQPISKLEFEFERRKLTRDDVR
FT                   ELMYREILEYHPQMLQEYLQGEENINSHFLYPSGVDQFKQEFARLEEHNDDEEEHNSPP
FT                   HQRKYTSLPRERVCSSEDEGSDSVHAQSSSASVVFTPPQTPNTATGLSSQKASQVDKAA
FT                   TPVKRSACLMRSDSICASRCVGVSSAVS"
FT   gene            205775..211963
FT                   /gene_synonym="F2I9.8"
FT                   /gene_synonym="F2I9_8"
FT                   /locus_tag="AT2G01460"
FT   mRNA            join(205775..206252,206329..206441,206522..206648,
FT                   206736..206831,206904..206972,207052..207186,
FT                   207259..207327,207404..207447,207536..207695,
FT                   208034..208198,208436..208520,208623..208856,
FT                   208994..209085,209200..209242,209336..209493,
FT                   209591..209701,209791..209859,209959..210102,
FT                   210302..210376,210455..210631,210728..210813,
FT                   210917..210971,211065..211190,211289..211402,
FT                   211492..211611,211700..211963)
FT                   /gene_synonym="F2I9.8"
FT                   /gene_synonym="F2I9_8"
FT                   /locus_tag="AT2G01460"
FT                   /product="P-loop containing nucleoside triphosphate
FT                   hydrolases superfamily protein"
FT   mRNA            join(205841..206252,206329..206441,206522..206648,
FT                   206736..206831,206904..206972,207052..207186,
FT                   207259..207327,207404..207447,207536..207695,
FT                   208034..208198,208436..208520,208581..208856,
FT                   208994..209085,209200..209242,209336..209493,
FT                   209591..209732,209825..209859,209959..210102,
FT                   210302..210376,210455..210631,210728..210813,
FT                   210917..210975,211093..211190,211289..211402,
FT                   211492..211611,211700..211919)
FT                   /gene_synonym="F2I9.8"
FT                   /gene_synonym="F2I9_8"
FT                   /locus_tag="AT2G01460"
FT                   /product="P-loop containing nucleoside triphosphate
FT                   hydrolases superfamily protein"
FT   mRNA            join(206136..206252,206329..206441,206522..206648,
FT                   206736..206831,206904..206972,207052..207186,
FT                   207259..207327,207404..207447,207536..207695,
FT                   208034..208198,208436..208520,208581..208856,
FT                   208994..209085,209200..209242,209336..209493,
FT                   209591..209701,209791..209859,209959..210102,
FT                   210302..210376,210455..210631,210728..210813,
FT                   210917..210975,211093..211190,211289..211402,
FT                   211492..211611,211700..211919)
FT                   /gene_synonym="F2I9.8"
FT                   /gene_synonym="F2I9_8"
FT                   /locus_tag="AT2G01460"
FT                   /product="P-loop containing nucleoside triphosphate
FT                   hydrolases superfamily protein"
FT                   /inference="similar to RNA sequence, EST:INSD:ES015702.1"
FT   CDS_pept        join(206136..206252,206329..206441,206522..206648,
FT                   206736..206831,206904..206972,207052..207186,
FT                   207259..207327,207404..207447,207536..207695,
FT                   208034..208198,208436..208520,208581..208856,
FT                   208994..209085,209200..209242,209336..209493,
FT                   209591..209732,209825..209859,209959..210102,
FT                   210302..210376,210455..210631,210728..210813,
FT                   210917..210975,211093..211190,211289..211402,
FT                   211492..211611,211700..211765)
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.8"
FT                   /gene_synonym="F2I9_8"
FT                   /locus_tag="AT2G01460"
FT                   /product="P-loop containing nucleoside triphosphate
FT                   hydrolases superfamily protein"
FT                   /note="P-loop containing nucleoside triphosphate hydrolases
FT                   superfamily protein; FUNCTIONS IN:
FT                   nucleoside-triphosphatase activity, nucleotide binding,
FT                   kinase activity, phosphotransferase activity, alcohol group
FT                   as acceptor, ATP binding; INVOLVED IN: biosynthetic
FT                   process, metabolic process; LOCATED IN: cellular_component
FT                   unknown; EXPRESSED IN: 6 plant structures; EXPRESSED
FT                   DURING: 4 anthesis; CONTAINS InterPro DOMAIN/s: ATPase,
FT                   AAA+ type, core (InterPro:IPR003593),
FT                   Phosphoribulokinase/uridine kinase (InterPro:IPR006083),
FT                   Uridine kinase (InterPro:IPR000764); BEST Arabidopsis
FT                   thaliana protein match is: Phosphoribulokinase / Uridine
FT                   kinase family (TAIR:AT1G26190.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01460"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01460.2"
FT                   /db_xref="GOA:F4INB4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F4INB4"
FT                   /protein_id="AEC05457.1"
FT                   /translation="MDDEVVQRVFQEGGRDFFQQQPSTSSSSSSILQSLPLHVAFDHGY
FT                   YLLVKSIQELREKKDGIVTVGIGGPSGSGKSSLAEKVASVIGCTVIAMEDYRDSLDDGN
FT                   ELETLDFDALVQNLEDLINGKDTLAPVFDFQQKKRVDSKMVKTSSGVVIVDGTYALHAR
FT                   LRSLLDIRVAVVGGVHFSLLSKVRYDIGDSCSLDYLIDSIFPLFRKHIEPDLHHAQIRI
FT                   NNSFVSSFREAIYKLKCKTEIVTSFPQESDVQKDNFIEMYLRPPSASEEARINDWIKVR
FT                   QAGIRYYLSLGDQRIVDKHFIIRPKAEFEVGRMTLGGLLALGYNVVVSYKRASTAVSYG
FT                   NLSLSRETIDTLGETFLVLRGTDRKSVGAEALRMGITGPWITKSYLELILESKVQQNLN
FT                   FCKLTHFAGVPRLNTPPLLQPSPVITNQEKQIVAPKPIRTTPNIVTRLEDLSQPWTRSP
FT                   TKSQMEPMVATWHFTSYDPPHSVSSVVDSSFRDNMRLVPMPDSYDLDRGLLLSVQAIQA
FT                   LLENKGPPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKHDDFSSL
FT                   DLPLLSKNISDITNSRRTKLPIFDLETGTRCGFKELEVPEECGVVSDHSLHISYEIRQS
FT                   LDLWVAVVGGVHSHLISRVQRDKSRIGCFMSQNEIMMTVFPMFQQHIEPHLVHAHVKIR
FT                   NDFDPVLSPESSLFVLKSNKQVPYQDILSILDSTKFCSSVQNFIDIYFRLSGLPANGQL
FT                   SDSDCIRVRICEGRFAVLIREPIREGNFIIQPKVDFDISVSTVAGLLNLGYQAVAYIEA
FT                   SAFIYQDGKVNVPSPYIQIKGANKEAVTAAGSALKLDGSYTTKSYLQIVLERLPPVQRS
FT                   SSGIHTQQAARLQELVEFIQSQGSSNSVSESSPRRDGSSIDNVLEDMQSRIKRLERWHT
FT                   INTVLWTFLMSALVGYSLYQRKRQ"
FT   CDS_pept        join(206136..206252,206329..206441,206522..206648,
FT                   206736..206831,206904..206972,207052..207186,
FT                   207259..207327,207404..207447,207536..207695,
FT                   208034..208198,208436..208520,208581..208856,
FT                   208994..209085,209200..209242,209336..209493,
FT                   209591..209701,209791..209859,209959..210102,
FT                   210302..210376,210455..210631,210728..210813,
FT                   210917..210975,211093..211190,211289..211402,
FT                   211492..211611,211700..211765)
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.8"
FT                   /gene_synonym="F2I9_8"
FT                   /locus_tag="AT2G01460"
FT                   /product="P-loop containing nucleoside triphosphate
FT                   hydrolases superfamily protein"
FT                   /note="P-loop containing nucleoside triphosphate hydrolases
FT                   superfamily protein; FUNCTIONS IN:
FT                   nucleoside-triphosphatase activity, kinase activity,
FT                   nucleotide binding, phosphotransferase activity, alcohol
FT                   group as acceptor, ATP binding; INVOLVED IN: biosynthetic
FT                   process, metabolic process; LOCATED IN: cellular_component
FT                   unknown; EXPRESSED IN: 6 plant structures; EXPRESSED
FT                   DURING: 4 anthesis; CONTAINS InterPro DOMAIN/s:
FT                   Phosphoribulokinase/uridine kinase (InterPro:IPR006083),
FT                   ATPase, AAA+ type, core (InterPro:IPR003593), Uridine
FT                   kinase (InterPro:IPR000764); BEST Arabidopsis thaliana
FT                   protein match is: Phosphoribulokinase / Uridine kinase
FT                   family (TAIR:AT1G26190.1); Has 3953 Blast hits to 3156
FT                   proteins in 1342 species: Archae - 38; Bacteria - 3073;
FT                   Metazoa - 244; Fungi - 122; Plants - 227; Viruses - 4;
FT                   Other Eukaryotes - 245 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01460"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01460.1"
FT                   /db_xref="GOA:F4INB5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F4INB5"
FT                   /inference="similar to RNA sequence, EST:INSD:ES015702.1"
FT                   /protein_id="AEC05456.1"
FT                   /translation="MDDEVVQRVFQEGGRDFFQQQPSTSSSSSSILQSLPLHVAFDHGY
FT                   YLLVKSIQELREKKDGIVTVGIGGPSGSGKSSLAEKVASVIGCTVIAMEDYRDSLDDGN
FT                   ELETLDFDALVQNLEDLINGKDTLAPVFDFQQKKRVDSKMVKTSSGVVIVDGTYALHAR
FT                   LRSLLDIRVAVVGGVHFSLLSKVRYDIGDSCSLDYLIDSIFPLFRKHIEPDLHHAQIRI
FT                   NNSFVSSFREAIYKLKCKTEIVTSFPQESDVQKDNFIEMYLRPPSASEEARINDWIKVR
FT                   QAGIRYYLSLGDQRIVDKHFIIRPKAEFEVGRMTLGGLLALGYNVVVSYKRASTAVSYG
FT                   NLSLSRETIDTLGETFLVLRGTDRKSVGAEALRMGITGPWITKSYLELILESKVQQNLN
FT                   FCKLTHFAGVPRLNTPPLLQPSPVITNQEKQIVAPKPIRTTPNIVTRLEDLSQPWTRSP
FT                   TKSQMEPMVATWHFTSYDPPHSVSSVVDSSFRDNMRLVPMPDSYDLDRGLLLSVQAIQA
FT                   LLENKGPPVIVGIGGPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKHDDFSSL
FT                   DLPLLSKNISDITNSRRTKLPIFDLETGTRCGFKELEVPEECGVIIFEGVYALHPEIRQ
FT                   SLDLWVAVVGGVHSHLISRVQRDKSRIGCFMSQNEIMMTVFPMFQQHIEPHLVHAHVKI
FT                   RNDFDPVLSPESSLFVLKSNKQVPYQDILSILDSTKFCSSVQNFIDIYFRLSGLPANGQ
FT                   LSDSDCIRVRICEGRFAVLIREPIREGNFIIQPKVDFDISVSTVAGLLNLGYQAVAYIE
FT                   ASAFIYQDGKVNVPSPYIQIKGANKEAVTAAGSALKLDGSYTTKSYLQIVLERLPPVQR
FT                   SSSGIHTQQAARLQELVEFIQSQGSSNSVSESSPRRDGSSIDNVLEDMQSRIKRLERWH
FT                   TINTVLWTFLMSALVGYSLYQRKRQ"
FT   CDS_pept        join(206136..206252,206329..206441,206522..206648,
FT                   206736..206831,206904..206972,207052..207186,
FT                   207259..207327,207404..207447,207536..207695,
FT                   208034..208198,208436..208520,208623..208856,
FT                   208994..209085,209200..209242,209336..209493,
FT                   209591..209701,209791..209859,209959..210102,
FT                   210302..210376,210455..210631,210728..210813,
FT                   210917..210971,211065..211190,211289..211402,
FT                   211492..211611,211700..211765)
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.8"
FT                   /gene_synonym="F2I9_8"
FT                   /locus_tag="AT2G01460"
FT                   /product="P-loop containing nucleoside triphosphate
FT                   hydrolases superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01460"
FT                   /db_xref="GOA:A0A178VWR3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178VWR3"
FT                   /protein_id="ANM61396.1"
FT                   /translation="MDDEVVQRVFQEGGRDFFQQQPSTSSSSSSILQSLPLHVAFDHGY
FT                   YLLVKSIQELREKKDGIVTVGIGGPSGSGKSSLAEKVASVIGCTVIAMEDYRDSLDDGN
FT                   ELETLDFDALVQNLEDLINGKDTLAPVFDFQQKKRVDSKMVKTSSGVVIVDGTYALHAR
FT                   LRSLLDIRVAVVGGVHFSLLSKVRYDIGDSCSLDYLIDSIFPLFRKHIEPDLHHAQIRI
FT                   NNSFVSSFREAIYKLKCKTEIVTSFPQESDVQKDNFIEMYLRPPSASEEARINDWIKVR
FT                   QAGIRYYLSLGDQRIVDKHFIIRPKAEFEVGRMTLGGLLALGYNVVVSYKRASTAVSYG
FT                   NLSLSRETIDTLGETFLVLRGTDRKSVGAEALRMGITGPWITKSYLELILESKGVPRLN
FT                   TPPLLQPSPVITNQEKQIVAPKPIRTTPNIVTRLEDLSQPWTRSPTKSQMEPMVATWHF
FT                   TSYDPPHSVSSVVDSSFRDNMRLVPMPDSYDLDRGLLLSVQAIQALLENKGPPVIVGIG
FT                   GPSGSGKTSLAHKMANIVGCEVVSLESYFKSEQVKDFKHDDFSSLDLPLLSKNISDITN
FT                   SRRTKLPIFDLETGTRCGFKELEVPEECGVIIFEGVYALHPEIRQSLDLWVAVVGGVHS
FT                   HLISRVQRDKSRIGCFMSQNEIMMTVFPMFQQHIEPHLVHAHVKIRNDFDPVLSPESSL
FT                   FVLKSNKQVPYQDILSILDSTKFCSSVQNFIDIYFRLSGLPANGQLSDSDCIRVRICEG
FT                   RFAVLIREPIREGNFIIQPKVDFDISVSTVAGLLNLGYQAVAYIEASAFIYQDGKILIE
FT                   VDHLQDVPSPYIQIKGANKEAVTAAGSALKLDGSYTTKSYLQIVLERLPPVQRSSSGIH
FT                   TQQAARLQELVEFIQSQGSSNSVSESSPRRDGSSIDNVLEDMQSRIKRLERWHTINTVL
FT                   WTFLMSALVGYSLYQRKRQ"
FT   gene            complement(211913..214473)
FT                   /gene="STL2P"
FT                   /gene_synonym="ATSEC12"
FT                   /gene_synonym="F2I9.9"
FT                   /gene_synonym="F2I9_9"
FT                   /gene_synonym="SEC12P-like 2 protein"
FT                   /locus_tag="AT2G01470"
FT                   /note="Sec12p-like protein (GTP exchange protein) that
FT                   functionally complements yeast sec12 null mutant. Protein
FT                   is localized to the ER."
FT   mRNA            complement(join(211913..212306,212411..212478,
FT                   212640..212756,212841..212961,213054..213129,
FT                   213225..213321,213455..213546,213639..213783,
FT                   213952..214046,214157..214473))
FT                   /gene="STL2P"
FT                   /gene_synonym="ATSEC12"
FT                   /gene_synonym="F2I9.9"
FT                   /gene_synonym="F2I9_9"
FT                   /gene_synonym="SEC12P-like 2 protein"
FT                   /locus_tag="AT2G01470"
FT                   /product="SEC12P-like 2 protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES030263.1,INSD:DR213257.1,INSD:DR213258.1,
FT                   INSD:ES008562.1,INSD:EG512388.1,INSD:BP562342.2,
FT                   INSD:CD531610.1,INSD:CF652185.1,INSD:CD532155.1,
FT                   INSD:EL157178.1,INSD:EL979856.1,INSD:EH903967.1,
FT                   INSD:EL007760.1,INSD:ES053844.1,INSD:ES005893.1,
FT                   INSD:DR213259.1,INSD:ES012673.1,INSD:EL251228.1,
FT                   INSD:CD532145.1,INSD:BP560897.1,INSD:EL148539.1,
FT                   INSD:BP854449.1,INSD:EH875262.1,INSD:DR213260.1,
FT                   INSD:EL048908.1,INSD:ES099438.1,INSD:AV783710.1,
FT                   INSD:ES212187.1,INSD:ES026475.1,INSD:EL217298.1,
FT                   INSD:ES003456.1,INSD:DR379550.1,INSD:EL281828.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY123030.1,INSD:M95796.1,INSD:BX820002.1,
FT                   INSD:AY074332.1,INSD:AY065198.1"
FT   CDS_pept        complement(join(212215..212306,212411..212478,
FT                   212640..212756,212841..212961,213054..213129,
FT                   213225..213321,213455..213546,213639..213783,
FT                   213952..214046,214157..214435))
FT                   /codon_start=1
FT                   /gene="STL2P"
FT                   /gene_synonym="ATSEC12"
FT                   /gene_synonym="F2I9.9"
FT                   /gene_synonym="F2I9_9"
FT                   /gene_synonym="SEC12P-like 2 protein"
FT                   /locus_tag="AT2G01470"
FT                   /product="SEC12P-like 2 protein"
FT                   /note="SEC12P-like 2 protein (STL2P); FUNCTIONS IN:
FT                   nucleotide binding; INVOLVED IN: ER to Golgi
FT                   vesicle-mediated transport; LOCATED IN: integral to
FT                   endoplasmic reticulum membrane, endoplasmic reticulum,
FT                   plasma membrane, membrane; EXPRESSED IN: 25 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: WD40 repeat-like-containing domain
FT                   (InterPro:IPR011046), WD40-repeat-containing domain
FT                   (InterPro:IPR017986), WD40 repeat (InterPro:IPR001680),
FT                   WD40/YVTN repeat-like-containing domain
FT                   (InterPro:IPR015943), WD40 repeat, subgroup
FT                   (InterPro:IPR019781); BEST Arabidopsis thaliana protein
FT                   match is: Transducin/WD40 repeat-like superfamily protein
FT                   (TAIR:AT5G50550.1); Has 6374 Blast hits to 3814 proteins in
FT                   364 species: Archae - 22; Bacteria - 2789; Metazoa - 1016;
FT                   Fungi - 1422; Plants - 400; Viruses - 0; Other Eukaryotes -
FT                   725 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01470.1"
FT                   /db_xref="GOA:Q39221"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39221"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES030263.1,INSD:DR213257.1,INSD:DR213258.1,
FT                   INSD:ES008562.1,INSD:EG512388.1,INSD:BP562342.2,
FT                   INSD:CD531610.1,INSD:CF652185.1,INSD:CD532155.1,
FT                   INSD:EL157178.1,INSD:EL979856.1,INSD:EH903967.1,
FT                   INSD:EL007760.1,INSD:ES053844.1,INSD:ES005893.1,
FT                   INSD:DR213259.1,INSD:ES012673.1,INSD:EL251228.1,
FT                   INSD:CD532145.1,INSD:BP560897.1,INSD:EL148539.1,
FT                   INSD:BP854449.1,INSD:EH875262.1,INSD:DR213260.1,
FT                   INSD:EL048908.1,INSD:ES099438.1,INSD:AV783710.1,
FT                   INSD:ES212187.1,INSD:ES026475.1,INSD:EL217298.1,
FT                   INSD:ES003456.1,INSD:DR379550.1,INSD:EL281828.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY123030.1,INSD:M95796.1,INSD:BX820002.1,
FT                   INSD:AY074332.1,INSD:AY065198.1"
FT                   /protein_id="AEC05458.1"
FT                   /translation="MANQSTETNQPSNMQTYGVPIYAADWIPEVDVRSKIIMDPEKSED
FT                   DDESSSSSSSSRSCIVLSGGGGEGRSGISNVILICRVDLNTNSLSEQPLGRLVVGSDLP
FT                   YRMAVHPREGGLICALPNSCKLFHWEDIMSREDNQAGESEEVIKELRDVGQQLALAFNP
FT                   EGSVLAAGAEDGTLRVFKWPSMNTLLNESQAHSSVKCLTFSESGQFLVSLGGPVCRVWD
FT                   VNASAAVASLSKEKDEMFASCRFSVDSAGNEVLYIAANTERGGSIITCDTKLWKRKWSK
FT                   PIKKNSISAFNVSADGKLLAIGTLEGDVLILESTRMQTIQVVKKAHLGLVTALTFSPDS
FT                   RGLVSVSFDSRARLTMIEQKGDKPGVRWWLLVLLIVLLYVVAYYYMKAKGIIP"
FT   gene            216605..221002
FT                   /gene_synonym="F2I9.10"
FT                   /gene_synonym="F2I9_10"
FT                   /locus_tag="AT2G01480"
FT   mRNA            join(216605..217357,217925..217994,218196..218263,
FT                   218376..218464,218554..218751,218926..219130,
FT                   219258..219425,219564..219731,219812..220002,
FT                   220173..220989)
FT                   /gene_synonym="F2I9.10"
FT                   /gene_synonym="F2I9_10"
FT                   /locus_tag="AT2G01480"
FT                   /product="O-fucosyltransferase family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP599385.1,INSD:BX837171.1,INSD:EL980113.1,
FT                   INSD:AV801148.1,INSD:DR364627.1,INSD:DR364630.1,
FT                   INSD:DR364621.1,INSD:DR364628.1,INSD:DR364632.1,
FT                   INSD:DR364622.1,INSD:BP601713.1,INSD:DR364625.1,
FT                   INSD:EH923819.1,INSD:BP807993.1,INSD:DR364629.1,
FT                   INSD:AV828350.1,INSD:DR364631.1,INSD:DR364624.1,
FT                   INSD:DR364626.1,INSD:AV813743.1,INSD:DR364623.1,
FT                   INSD:EH965250.1,INSD:ES147210.1,INSD:BP805071.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK227124.1,INSD:AY128818.1,INSD:AY093109.1,
FT                   INSD:BX818819.1"
FT   mRNA            join(216695..217357,217925..217994,218196..218263,
FT                   218376..218464,218554..218751,218926..219130,
FT                   219258..219425,219564..219731,219812..221002)
FT                   /gene_synonym="F2I9.10"
FT                   /gene_synonym="F2I9_10"
FT                   /locus_tag="AT2G01480"
FT                   /product="O-fucosyltransferase family protein"
FT   CDS_pept        join(216980..217357,217925..217994,218196..218263,
FT                   218376..218464,218554..218751,218926..219130,
FT                   219258..219425,219564..219731,219812..220002,
FT                   220173..220341)
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.10"
FT                   /gene_synonym="F2I9_10"
FT                   /locus_tag="AT2G01480"
FT                   /product="O-fucosyltransferase family protein"
FT                   /note="O-fucosyltransferase family protein; LOCATED IN:
FT                   chloroplast; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   GDP-fucose protein O-fucosyltransferase
FT                   (InterPro:IPR019378); BEST Arabidopsis thaliana protein
FT                   match is: O-fucosyltransferase family protein
FT                   (TAIR:AT1G14970.1); Has 836 Blast hits to 825 proteins in
FT                   29 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 836; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01480"
FT                   /db_xref="GOA:Q9ZVF7"
FT                   /db_xref="InterPro:IPR019378"
FT                   /db_xref="InterPro:IPR024709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZVF7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP599385.1,INSD:BX837171.1,INSD:EL980113.1,
FT                   INSD:AV801148.1,INSD:DR364627.1,INSD:DR364630.1,
FT                   INSD:DR364621.1,INSD:DR364628.1,INSD:DR364632.1,
FT                   INSD:DR364622.1,INSD:BP601713.1,INSD:DR364625.1,
FT                   INSD:EH923819.1,INSD:BP807993.1,INSD:DR364629.1,
FT                   INSD:AV828350.1,INSD:DR364631.1,INSD:DR364624.1,
FT                   INSD:DR364626.1,INSD:AV813743.1,INSD:DR364623.1,
FT                   INSD:EH965250.1,INSD:ES147210.1,INSD:BP805071.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK227124.1,INSD:AY128818.1,INSD:AY093109.1,
FT                   INSD:BX818819.1"
FT                   /protein_id="AEC05459.1"
FT                   /translation="MLAKNRLPGSGHTTPSPPASPRRSPRYRHGRSKAAAGSRFPTVQP
FT                   SRTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGSVY
FT                   KSPQVYAKLRPEMDADNSTADAITTIWKHSYKGGEWKPYVNKSTGDLPESNGYIYVEAN
FT                   GGLNQQRTSICNAVAVAGYLNATLVIPNFHYHSIWRDPSKFGDIYDEEFFVSTLSNDVR
FT                   VVDTIPEYLMERFDHNMTNVYNFRVKAWSPIQYYRDSILPKLLEEKIIRISPFANRLSF
FT                   DAPQAVQRLRCLANYEALKFSKTILTLGETLVKRMKEQSANHGAKYVSVHLRFEEDMVA
FT                   FSCCIFDGGNQEKQDMIAARERGWKGKFTKPGRVIRPGAIRQNGKCPLTPLEVGLMLRG
FT                   MGFNKSTYIFLASGEIYDANRTMAPLLEMFPNLQTKEMLASEEELAPYKNFSSRMAAID
FT                   YTVCLHSEVFVTTQGGNFPHFLMGHRRYMFGGHSKTIRPDKRKLAILFDNPNIGWRSFK
FT                   RQMLNMRSHSDSKGFELKRPNDSIYTFPCPDCMSRRNKTTTPESRPPPAT"
FT   CDS_pept        join(216980..217357,217925..217994,218196..218263,
FT                   218376..218464,218554..218751,218926..219130,
FT                   219258..219425,219564..219731,219812..220057)
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.10"
FT                   /gene_synonym="F2I9_10"
FT                   /locus_tag="AT2G01480"
FT                   /product="O-fucosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01480"
FT                   /db_xref="GOA:A0A1P8AZ80"
FT                   /db_xref="InterPro:IPR019378"
FT                   /db_xref="InterPro:IPR024709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AZ80"
FT                   /protein_id="ANM61935.1"
FT                   /translation="MLAKNRLPGSGHTTPSPPASPRRSPRYRHGRSKAAAGSRFPTVQP
FT                   SRTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGSVY
FT                   KSPQVYAKLRPEMDADNSTADAITTIWKHSYKGGEWKPYVNKSTGDLPESNGYIYVEAN
FT                   GGLNQQRTSICNAVAVAGYLNATLVIPNFHYHSIWRDPSKFGDIYDEEFFVSTLSNDVR
FT                   VVDTIPEYLMERFDHNMTNVYNFRVKAWSPIQYYRDSILPKLLEEKIIRISPFANRLSF
FT                   DAPQAVQRLRCLANYEALKFSKTILTLGETLVKRMKEQSANHGAKYVSVHLRFEEDMVA
FT                   FSCCIFDGGNQEKQDMIAARERGWKGKFTKPGRVIRPGAIRQNGKCPLTPLEVGLMLRG
FT                   MGFNKSTYIFLASGEIYDANRTMAPLLEMFPNLQTKEMLASEEELAPYKNFSSRMAAID
FT                   YTVCLHSEVFVTTQGGNFPHFLMGHRRYMFGGHSKTIRPDKRKLAILFDNPNIGYSLLL
FT                   LFVFDKPYQIST"
FT   gene            221013..223809
FT                   /gene="PAHX"
FT                   /gene_synonym="F2I9.11"
FT                   /gene_synonym="F2I9_11"
FT                   /gene_synonym="phytanoyl-CoA 2-hydroxylase"
FT                   /locus_tag="AT2G01490"
FT                   /note="Encodes a phytanoyl-CoA 2-hydroxylase (PAHX)."
FT   mRNA            join(221013..221370,221466..221587,221667..221727,
FT                   222077..222145,222225..222343,222466..222613,
FT                   222711..222855,222954..223040,223142..223809)
FT                   /gene="PAHX"
FT                   /gene_synonym="F2I9.11"
FT                   /gene_synonym="F2I9_11"
FT                   /gene_synonym="phytanoyl-CoA 2-hydroxylase"
FT                   /locus_tag="AT2G01490"
FT                   /product="phytanoyl-CoA dioxygenase (PhyH) family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH809619.1,INSD:BP585151.1,INSD:ES174519.1,
FT                   INSD:EL291262.1,INSD:EL015122.1,INSD:AV522193.1,
FT                   INSD:DR376769.1,INSD:AV811699.1,INSD:EG445698.1,
FT                   INSD:EG500619.1,INSD:EL305536.1,INSD:EL138551.1,
FT                   INSD:BP864505.1,INSD:EL216351.1,INSD:CB264431.1,
FT                   INSD:BP583686.1,INSD:EH808145.1,INSD:EH962219.1,
FT                   INSD:BP579035.1,INSD:EL969847.1,INSD:EL291711.1,
FT                   INSD:AV537561.1,INSD:EL165464.1,INSD:EL243889.1,
FT                   INSD:BP581271.1,INSD:DR202255.1,INSD:EG451518.1,
FT                   INSD:EG501335.1,INSD:DR202258.1,INSD:AV814392.1,
FT                   INSD:EH931517.1,INSD:EL191015.1,INSD:EL173731.1,
FT                   INSD:EH796194.1,INSD:EL131928.1,INSD:EG501334.1,
FT                   INSD:EL171984.1,INSD:EL201225.1,INSD:EG445699.1,
FT                   INSD:EL265385.1,INSD:EL009991.1,INSD:EH950669.1,
FT                   INSD:EH912110.1,INSD:EL313370.1,INSD:BP574694.1,
FT                   INSD:BP665839.1,INSD:AV540795.1,INSD:DR202256.1,
FT                   INSD:CK118570.1,INSD:DR202259.1,INSD:EL247618.1,
FT                   INSD:BP577227.1,INSD:EL337313.1,INSD:BP628510.1,
FT                   INSD:EH911644.1,INSD:EG451519.1,INSD:EL122579.1,
FT                   INSD:AV559846.1,INSD:EH931683.1,INSD:EL129716.1,
FT                   INSD:BP590608.1,INSD:EH914640.1,INSD:EL186293.1,
FT                   INSD:R90632.1,INSD:EL321054.1,INSD:EL144460.1,
FT                   INSD:EL095907.1,INSD:EL265585.1,INSD:BP634017.1,
FT                   INSD:DR202257.1,INSD:EH970143.1,INSD:EL299877.1,
FT                   INSD:BP801863.1,INSD:T46060.1,INSD:EL075492.1,
FT                   INSD:N37203.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY057710.1,INSD:AY088080.1,INSD:AY116965.1"
FT   mRNA            join(221020..221370,221466..221587,221667..221727,
FT                   222077..222145,222225..222343,222466..222613,
FT                   222711..222855,222954..223040,223142..223212,
FT                   223428..223795)
FT                   /gene="PAHX"
FT                   /gene_synonym="F2I9.11"
FT                   /gene_synonym="F2I9_11"
FT                   /gene_synonym="phytanoyl-CoA 2-hydroxylase"
FT                   /locus_tag="AT2G01490"
FT                   /product="phytanoyl-CoA dioxygenase (PhyH) family protein"
FT   CDS_pept        join(221316..221370,221466..221587,221667..221727,
FT                   222077..222145,222225..222343,222466..222613,
FT                   222711..222855,222954..223040,223142..223187)
FT                   /codon_start=1
FT                   /gene="PAHX"
FT                   /gene_synonym="F2I9.11"
FT                   /gene_synonym="F2I9_11"
FT                   /gene_synonym="phytanoyl-CoA 2-hydroxylase"
FT                   /locus_tag="AT2G01490"
FT                   /product="phytanoyl-CoA dioxygenase (PhyH) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01490"
FT                   /db_xref="GOA:Q9ZVF6"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZVF6"
FT                   /protein_id="ANM62973.1"
FT                   /translation="MGITGSLTPDQLDFFHSQGYLVIESFASEDEIRGLRKRMDELLNQ
FT                   FDCSVSSIFSTKNQKHTTDNYFFESAEKISFFFEEKAFGDDGKLKQPKQLSINKVGHAL
FT                   HELDPLYKDFTYSSKFSSLASSLGYRRPVVMQSMYIFKQPGIGGEVVPHQDNSFVYTDP
FT                   QSCTGLWIALEDSTLVNGCLWAIPGSHKNGLVRRFIRGDNGITFDQPSPSYEQKDFVSI
FT                   EMKAGSLIAIHGDLIHQSFENLSSKSRHAYSLHVVESDGCKWAKDNWIQRAKMPEPLYV
FT                   LP"
FT   CDS_pept        join(221316..221370,221466..221587,221667..221727,
FT                   222077..222145,222225..222343,222466..222613,
FT                   222711..222855,222954..223040,223142..223187)
FT                   /codon_start=1
FT                   /gene="PAHX"
FT                   /gene_synonym="F2I9.11"
FT                   /gene_synonym="F2I9_11"
FT                   /gene_synonym="phytanoyl-CoA 2-hydroxylase"
FT                   /locus_tag="AT2G01490"
FT                   /product="phytanoyl-CoA dioxygenase (PhyH) family protein"
FT                   /note="phytanoyl-CoA dioxygenase (PhyH) family protein;
FT                   FUNCTIONS IN: phytanoyl-CoA dioxygenase activity; INVOLVED
FT                   IN: N-terminal protein myristoylation; LOCATED IN: plasma
FT                   membrane; EXPRESSED IN: 25 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Phytanoyl-CoA dioxygenase (InterPro:IPR008775); Has 2926
FT                   Blast hits to 2921 proteins in 334 species: Archae - 4;
FT                   Bacteria - 485; Metazoa - 347; Fungi - 101; Plants - 64;
FT                   Viruses - 0; Other Eukaryotes - 1925 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01490.1"
FT                   /db_xref="GOA:Q9ZVF6"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZVF6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH809619.1,INSD:BP585151.1,INSD:ES174519.1,
FT                   INSD:EL291262.1,INSD:EL015122.1,INSD:AV522193.1,
FT                   INSD:DR376769.1,INSD:AV811699.1,INSD:EG445698.1,
FT                   INSD:EG500619.1,INSD:EL305536.1,INSD:EL138551.1,
FT                   INSD:BP864505.1,INSD:EL216351.1,INSD:CB264431.1,
FT                   INSD:BP583686.1,INSD:EH808145.1,INSD:EH962219.1,
FT                   INSD:BP579035.1,INSD:EL969847.1,INSD:EL291711.1,
FT                   INSD:AV537561.1,INSD:EL165464.1,INSD:EL243889.1,
FT                   INSD:BP581271.1,INSD:DR202255.1,INSD:EG451518.1,
FT                   INSD:EG501335.1,INSD:DR202258.1,INSD:AV814392.1,
FT                   INSD:EH931517.1,INSD:EL191015.1,INSD:EL173731.1,
FT                   INSD:EH796194.1,INSD:EL131928.1,INSD:EG501334.1,
FT                   INSD:EL171984.1,INSD:EL201225.1,INSD:EG445699.1,
FT                   INSD:EL265385.1,INSD:EL009991.1,INSD:EH950669.1,
FT                   INSD:EH912110.1,INSD:EL313370.1,INSD:BP574694.1,
FT                   INSD:BP665839.1,INSD:AV540795.1,INSD:DR202256.1,
FT                   INSD:CK118570.1,INSD:DR202259.1,INSD:EL247618.1,
FT                   INSD:BP577227.1,INSD:EL337313.1,INSD:BP628510.1,
FT                   INSD:EH911644.1,INSD:EG451519.1,INSD:EL122579.1,
FT                   INSD:AV559846.1,INSD:EH931683.1,INSD:EL129716.1,
FT                   INSD:BP590608.1,INSD:EH914640.1,INSD:EL186293.1,
FT                   INSD:R90632.1,INSD:EL321054.1,INSD:EL144460.1,
FT                   INSD:EL095907.1,INSD:EL265585.1,INSD:BP634017.1,
FT                   INSD:DR202257.1,INSD:EH970143.1,INSD:EL299877.1,
FT                   INSD:BP801863.1,INSD:T46060.1,INSD:EL075492.1,
FT                   INSD:N37203.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY057710.1,INSD:AY088080.1,INSD:AY116965.1"
FT                   /protein_id="AEC05460.1"
FT                   /translation="MGITGSLTPDQLDFFHSQGYLVIESFASEDEIRGLRKRMDELLNQ
FT                   FDCSVSSIFSTKNQKHTTDNYFFESAEKISFFFEEKAFGDDGKLKQPKQLSINKVGHAL
FT                   HELDPLYKDFTYSSKFSSLASSLGYRRPVVMQSMYIFKQPGIGGEVVPHQDNSFVYTDP
FT                   QSCTGLWIALEDSTLVNGCLWAIPGSHKNGLVRRFIRGDNGITFDQPSPSYEQKDFVSI
FT                   EMKAGSLIAIHGDLIHQSFENLSSKSRHAYSLHVVESDGCKWAKDNWIQRAKMPEPLYV
FT                   LP"
FT   gene            complement(224156..226234)
FT                   /gene="PFS2"
FT                   /gene_synonym="F2I9.12"
FT                   /gene_synonym="F2I9_12"
FT                   /gene_synonym="HIGH EXPRESSION OF OSMOTICALLY RESPONSIVE
FT                   GENE 9"
FT                   /gene_synonym="HOS9"
FT                   /gene_synonym="PRETTY FEW SEEDS 2"
FT                   /gene_synonym="WOX6"
FT                   /gene_synonym="WUSCHEL RELATED HOMEOBOX 6"
FT                   /locus_tag="AT2G01500"
FT                   /note="PFS2 encodes a homeodomain gene that is a member of
FT                   the WUS clade of transcription factors. It delays
FT                   differentiation and maturation of primordia and regulates
FT                   ovule patterning. The pfs2 mutant exhibits developmental
FT                   defects in the maternal integuments and gametophyte,
FT                   specifically, the boundary between the chalaza and the
FT                   nucellus shifted towards the distal end of pfs2 ovule
FT                   primordia. In addition, leaves displayed curling and petals
FT                   were wavy and crenulated. Overexpression of PFS2 affects
FT                   floral organ and leaf development. Single- and
FT                   double-mutant analyses reveal that PFS2 activity represses
FT                   AGAMOUS expression in young floral primordia. Also involved
FT                   in regulation of response to low temperature."
FT   mRNA            complement(join(224156..224793,225226..225293,
FT                   225502..225846,225919..226234))
FT                   /gene="PFS2"
FT                   /gene_synonym="F2I9.12"
FT                   /gene_synonym="F2I9_12"
FT                   /gene_synonym="HIGH EXPRESSION OF OSMOTICALLY RESPONSIVE
FT                   GENE 9"
FT                   /gene_synonym="HOS9"
FT                   /gene_synonym="PRETTY FEW SEEDS 2"
FT                   /gene_synonym="WOX6"
FT                   /gene_synonym="WUSCHEL RELATED HOMEOBOX 6"
FT                   /locus_tag="AT2G01500"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR249923.1,INSD:DR249928.1,INSD:DR372931.1,
FT                   INSD:DR249927.1,INSD:DR751194.1,INSD:DR249925.1,
FT                   INSD:DR751195.1,INSD:DR249926.1,INSD:DR249924.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ652945.1,INSD:AY085832.1,INSD:AY885222.1,
FT                   INSD:AY251399.2,INSD:DQ446451.1"
FT   CDS_pept        complement(join(224470..224793,225226..225293,
FT                   225502..225846,225919..225997))
FT                   /codon_start=1
FT                   /gene="PFS2"
FT                   /gene_synonym="F2I9.12"
FT                   /gene_synonym="F2I9_12"
FT                   /gene_synonym="HIGH EXPRESSION OF OSMOTICALLY RESPONSIVE
FT                   GENE 9"
FT                   /gene_synonym="HOS9"
FT                   /gene_synonym="PRETTY FEW SEEDS 2"
FT                   /gene_synonym="WOX6"
FT                   /gene_synonym="WUSCHEL RELATED HOMEOBOX 6"
FT                   /locus_tag="AT2G01500"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /note="PRETTY FEW SEEDS 2 (PFS2); FUNCTIONS IN:
FT                   sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: in 9 processes; LOCATED IN: primary
FT                   endosperm nucleus, nucleus; EXPRESSED IN: 12 plant
FT                   structures; CONTAINS InterPro DOMAIN/s: Homeobox
FT                   (InterPro:IPR001356), Homeodomain-like
FT                   (InterPro:IPR009057); BEST Arabidopsis thaliana protein
FT                   match is: WUSCHEL related homeobox 1 (TAIR:AT3G18010.1);
FT                   Has 564 Blast hits to 564 proteins in 49 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 0; Fungi - 4; Plants - 560;
FT                   Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01500"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01500.1"
FT                   /db_xref="GOA:Q9ZVF5"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZVF5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR249923.1,INSD:DR249928.1,INSD:DR372931.1,
FT                   INSD:DR249927.1,INSD:DR751194.1,INSD:DR249925.1,
FT                   INSD:DR751195.1,INSD:DR249926.1,INSD:DR249924.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ652945.1,INSD:AY085832.1,INSD:AY885222.1,
FT                   INSD:AY251399.2,INSD:DQ446451.1"
FT                   /protein_id="AEC05461.1"
FT                   /translation="MGYISNNNLINYLPLSTTQPPLLLTHCDINGNDHHQLITASSGEH
FT                   DIDERKNNIPAAATLRWNPTPEQITTLEELYRSGTRTPTTEQIQQIASKLRKYGRIEGK
FT                   NVFYWFQNHKARERLKRRRREGGAIIKPHKDVKDSSSGGHRVDQTKLCPSFPHTNRPQP
FT                   QHELDPASYNKDNNANNEDHGTTEESDQRASEVGKYATWRNLVTWSITQQPEEINIDEN
FT                   VNGEEEETRDNRTLNLFPVREYQEKTGRLIEKTKACNYCYYYEFMPLKN"
FT   gene            complement(228577..229899)
FT                   /gene="CLE16"
FT                   /gene_synonym="CLAVATA3/ESR-RELATED 16"
FT                   /locus_tag="AT2G01505"
FT                   /note="Member of a large family of putative ligands
FT                   homologous to the Clavata3 gene. Consists of a single
FT                   exon."
FT   mRNA            complement(228577..229899)
FT                   /gene="CLE16"
FT                   /gene_synonym="CLAVATA3/ESR-RELATED 16"
FT                   /locus_tag="AT2G01505"
FT                   /product="CLAVATA3/ESR-RELATED 16"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI993471.1,INSD:EL096784.1,INSD:EG445747.1,
FT                   INSD:DR334152.1,INSD:EG445748.1,INSD:EG445745.1,
FT                   INSD:DR334151.1,INSD:EH822104.1,INSD:EL039731.1,
FT                   INSD:DR371877.1,INSD:DR334150.1,INSD:BP851261.1,
FT                   INSD:R30249.1,INSD:EL023545.1,INSD:EL169038.1,
FT                   INSD:EG445746.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT011705.1"
FT   CDS_pept        complement(228926..229237)
FT                   /codon_start=1
FT                   /gene="CLE16"
FT                   /gene_synonym="CLAVATA3/ESR-RELATED 16"
FT                   /locus_tag="AT2G01505"
FT                   /product="CLAVATA3/ESR-RELATED 16"
FT                   /note="CLAVATA3/ESR-RELATED 16 (CLE16); Has 30201 Blast
FT                   hits to 17322 proteins in 780 species: Archae - 12;
FT                   Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants -
FT                   5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01505"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01505.1"
FT                   /db_xref="GOA:Q8S8M2"
FT                   /db_xref="InterPro:IPR033249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8S8M2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI993471.1,INSD:EL096784.1,INSD:EG445747.1,
FT                   INSD:DR334152.1,INSD:EG445748.1,INSD:EG445745.1,
FT                   INSD:DR334151.1,INSD:EH822104.1,INSD:EL039731.1,
FT                   INSD:DR371877.1,INSD:DR334150.1,INSD:BP851261.1,
FT                   INSD:R30249.1,INSD:EL023545.1,INSD:EL169038.1,
FT                   INSD:EG445746.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT011705.1"
FT                   /protein_id="AEC05462.1"
FT                   /translation="MEACSRKRRRRRAYTTSTTGYAAVFFCGIFVFAQFGISSSALFAP
FT                   DHYPSLPRKAGHFHEMASFQAPKATVSFTGQRREEENRDEVYKDDKRLVHTGPNPLHN"
FT   gene            complement(229567..232540)
FT                   /gene_synonym="F2I9.13"
FT                   /gene_synonym="F2I9_13"
FT                   /locus_tag="AT2G01510"
FT   mRNA            complement(229567..232518)
FT                   /gene_synonym="F2I9.13"
FT                   /gene_synonym="F2I9_13"
FT                   /locus_tag="AT2G01510"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /inference="similar to RNA sequence, EST:INSD:EH915509.1"
FT   mRNA            complement(join(229928..230345,230553..232540))
FT                   /gene_synonym="F2I9.13"
FT                   /gene_synonym="F2I9_13"
FT                   /locus_tag="AT2G01510"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT   CDS_pept        complement(230752..232506)
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.13"
FT                   /gene_synonym="F2I9_13"
FT                   /locus_tag="AT2G01510"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /db_xref="GOA:Q9ZVF4"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZVF4"
FT                   /protein_id="ANM62267.1"
FT                   /translation="MLAKQTPLTKQMLSELLRASSSKPKQLKKIHAIVLRTGFSEKNSL
FT                   LTQLLENLVVIGDMCYARQVFDEMHKPRIFLWNTLFKGYVRNQLPFESLLLYKKMRDLG
FT                   VRPDEFTYPFVVKAISQLGDFSCGFALHAHVVKYGFGCLGIVATELVMMYMKFGELSSA
FT                   EFLFESMQVKDLVAWNAFLAVCVQTGNSAIALEYFNKMCADAVQFDSFTVVSMLSACGQ
FT                   LGSLEIGEEIYDRARKEEIDCNIIVENARLDMHLKCGNTEAARVLFEEMKQRNVVSWST
FT                   MIVGYAMNGDSREALTLFTTMQNEGLRPNYVTFLGVLSACSHAGLVNEGKRYFSLMVQS
FT                   NDKNLEPRKEHYACMVDLLGRSGLLEEAYEFIKKMPVEPDTGIWGALLGACAVHRDMIL
FT                   GQKVADVLVETAPDIGSYHVLLSNIYAAAGKWDCVDKVRSKMRKLGTKKVAAYSSVEFE
FT                   GKIHFFNRGDKSHPQSKAIYEKLDEILKKIRKMGYVPDTCSVFHDVEMEEKECSLSHHS
FT                   EKLAIAFGLIKGRPGHPIRVMKNLRTCDDCHAFSKFVSSLTSTEIIMRDKNRFHHFRNG
FT                   VCSCKEFW"
FT   CDS_pept        complement(230752..232506)
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.13"
FT                   /gene_synonym="F2I9_13"
FT                   /locus_tag="AT2G01510"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /note="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein; CONTAINS InterPro DOMAIN/s: Pentatricopeptide
FT                   repeat (InterPro:IPR002885); BEST Arabidopsis thaliana
FT                   protein match is: Tetratricopeptide repeat (TPR)-like
FT                   superfamily protein (TAIR:AT4G21065.1); Has 35573 Blast
FT                   hits to 13630 proteins in 255 species: Archae - 0; Bacteria
FT                   - 7; Metazoa - 76; Fungi - 94; Plants - 34882; Viruses - 0;
FT                   Other Eukaryotes - 514 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01510"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01510.1"
FT                   /db_xref="GOA:Q9ZVF4"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032867"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZVF4"
FT                   /inference="similar to RNA sequence, EST:INSD:EH915509.1"
FT                   /protein_id="AEC05463.1"
FT                   /translation="MLAKQTPLTKQMLSELLRASSSKPKQLKKIHAIVLRTGFSEKNSL
FT                   LTQLLENLVVIGDMCYARQVFDEMHKPRIFLWNTLFKGYVRNQLPFESLLLYKKMRDLG
FT                   VRPDEFTYPFVVKAISQLGDFSCGFALHAHVVKYGFGCLGIVATELVMMYMKFGELSSA
FT                   EFLFESMQVKDLVAWNAFLAVCVQTGNSAIALEYFNKMCADAVQFDSFTVVSMLSACGQ
FT                   LGSLEIGEEIYDRARKEEIDCNIIVENARLDMHLKCGNTEAARVLFEEMKQRNVVSWST
FT                   MIVGYAMNGDSREALTLFTTMQNEGLRPNYVTFLGVLSACSHAGLVNEGKRYFSLMVQS
FT                   NDKNLEPRKEHYACMVDLLGRSGLLEEAYEFIKKMPVEPDTGIWGALLGACAVHRDMIL
FT                   GQKVADVLVETAPDIGSYHVLLSNIYAAAGKWDCVDKVRSKMRKLGTKKVAAYSSVEFE
FT                   GKIHFFNRGDKSHPQSKAIYEKLDEILKKIRKMGYVPDTCSVFHDVEMEEKECSLSHHS
FT                   EKLAIAFGLIKGRPGHPIRVMKNLRTCDDCHAFSKFVSSLTSTEIIMRDKNRFHHFRNG
FT                   VCSCKEFW"
FT   gene            235925..237253
FT                   /gene="MLP328"
FT                   /gene_synonym="(Zusammen-CA)-enhanced 1"
FT                   /gene_synonym="F2I9.14"
FT                   /gene_synonym="F2I9_14"
FT                   /gene_synonym="MLP-like protein 328"
FT                   /gene_synonym="ZCE1"
FT                   /locus_tag="AT2G01520"
FT                   /note="Encodes a cis-cinnamic acid responsive gene that is
FT                   a member of the major latex protein-like gene family and
FT                   plays a role in promoting vegetative growth and delaying
FT                   flowering."
FT   mRNA            join(235925..236178,236613..237253)
FT                   /gene="MLP328"
FT                   /gene_synonym="(Zusammen-CA)-enhanced 1"
FT                   /gene_synonym="F2I9.14"
FT                   /gene_synonym="F2I9_14"
FT                   /gene_synonym="MLP-like protein 328"
FT                   /gene_synonym="ZCE1"
FT                   /locus_tag="AT2G01520"
FT                   /product="MLP-like protein 328"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR317371.1,INSD:BP581179.1,INSD:DR317385.1,
FT                   INSD:DR317378.1,INSD:DR317327.1,INSD:BP801185.1,
FT                   INSD:DR317290.1,INSD:DR317237.1,INSD:BP582932.1,
FT                   INSD:DR317286.1,INSD:DR317325.1,INSD:EG446276.1,
FT                   INSD:DR317387.1,INSD:DR317278.1,INSD:BP579431.1,
FT                   INSD:DR317293.1,INSD:DR317354.1,INSD:DR317272.1,
FT                   INSD:DR317222.1,INSD:DR317309.1,INSD:DR317233.1,
FT                   INSD:DR317342.1,INSD:DR317358.1,INSD:DR317396.1,
FT                   INSD:DR317346.1,INSD:T43905.1,INSD:DR317285.1,
FT                   INSD:EG506584.1,INSD:BP781515.1,INSD:DR317219.1,
FT                   INSD:DR317259.1,INSD:DR317283.1,INSD:DR317262.1,
FT                   INSD:BP570794.1,INSD:DR317235.1,INSD:DR317294.1,
FT                   INSD:BP581160.1,INSD:DR317345.1,INSD:BP563471.1,
FT                   INSD:EH966307.1,INSD:EL167651.1,INSD:DR317248.1,
FT                   INSD:DR317257.1,INSD:DR317318.1,INSD:BP567681.1,
FT                   INSD:DR317232.1,INSD:DR317255.1,INSD:DR317264.1,
FT                   INSD:DR317304.1,INSD:DR317303.1,INSD:BP571179.1,
FT                   INSD:H36765.1,INSD:DR317273.1,INSD:DR317239.1,
FT                   INSD:EL273628.1,INSD:DR317284.1,INSD:R90142.1,
FT                   INSD:BP567730.1,INSD:DR317274.1,INSD:DR317249.1,
FT                   INSD:DR317302.1,INSD:EG506582.1,INSD:DR317343.1,
FT                   INSD:DR317231.1,INSD:DR317298.1,INSD:DR317267.1,
FT                   INSD:DR317256.1,INSD:DR317216.1,INSD:DR317236.1,
FT                   INSD:DR317312.1,INSD:DR377723.1,INSD:DR317271.1,
FT                   INSD:DR317317.1,INSD:DR317247.1,INSD:DR317282.1,
FT                   INSD:AV549086.1,INSD:BP586457.1,INSD:DR317215.1,
FT                   INSD:DR317340.1,INSD:DR317209.1,INSD:DR317360.1,
FT                   INSD:DR317348.1,INSD:DR317206.1,INSD:BP572115.1,
FT                   INSD:DR317337.1,INSD:DR317329.1,INSD:DR317307.1,
FT                   INSD:DR317211.1,INSD:DR317398.1,INSD:DR317335.1,
FT                   INSD:BP577079.1,INSD:DR317224.1,INSD:DR317289.1,
FT                   INSD:BP567703.1,INSD:DR317362.1,INSD:EG528650.1,
FT                   INSD:DR317394.1,INSD:DR317276.1,INSD:DR317323.1,
FT                   INSD:DR317244.1,INSD:DR243246.1,INSD:DR317217.1,
FT                   INSD:EG528651.1,INSD:DR317364.1,INSD:DR317392.1,
FT                   INSD:DR317322.1,INSD:DR317383.1,INSD:DR317287.1,
FT                   INSD:EG440929.1,INSD:DR317300.1,INSD:DR317229.1,
FT                   INSD:BP567604.1,INSD:DR317297.1,INSD:DR317241.1,
FT                   INSD:DR317384.1,INSD:BP581039.1,INSD:DR317334.1,
FT                   INSD:AV816654.1,INSD:DR317234.1,INSD:DR317391.1,
FT                   INSD:R29829.1,INSD:DR317359.1,INSD:DR317266.1,
FT                   INSD:DR317386.1,INSD:DR317355.1,INSD:DR317373.1,
FT                   INSD:DR317361.1,INSD:EG446265.1,INSD:DR317226.1,
FT                   INSD:DR317288.1,INSD:DR317374.1,INSD:EL163623.1,
FT                   INSD:EG440928.1,INSD:DR317332.1,INSD:DR317375.1,
FT                   INSD:ES199994.1,INSD:DR317366.1,INSD:DR317242.1,
FT                   INSD:BP579716.1,INSD:DR317296.1,INSD:DR317221.1,
FT                   INSD:DR317353.1,INSD:DR317305.1,INSD:DR317228.1,
FT                   INSD:ES153399.1,INSD:DR205656.1,INSD:DR317326.1,
FT                   INSD:DR317314.1,INSD:DR317280.1,INSD:DR317310.1,
FT                   INSD:DR317372.1,INSD:DR317313.1,INSD:DR372753.1,
FT                   INSD:DR317330.1,INSD:DR317380.1,INSD:T21300.1,
FT                   INSD:DR317254.1,INSD:DR317218.1,INSD:DR317205.1,
FT                   INSD:DR317252.1,INSD:DR317397.1,INSD:DR317265.1,
FT                   INSD:BP583496.1,INSD:T22170.1,INSD:EG480605.1,
FT                   INSD:DR317268.1,INSD:DR317395.1,INSD:DR317349.1,
FT                   INSD:BP798756.1,INSD:DR317295.1,INSD:DR317208.1,
FT                   INSD:BP797003.1,INSD:DR317277.1,INSD:DR317243.1,
FT                   INSD:DR317291.1,INSD:DR317260.1,INSD:BP563939.1,
FT                   INSD:DR317367.1,INSD:DR377095.1,INSD:AV553971.1,
FT                   INSD:DR317331.1,INSD:BP570278.1,INSD:DR317227.1,
FT                   INSD:DR317270.1,INSD:DR317363.1,INSD:DR317269.1,
FT                   INSD:T22625.1,INSD:DR317347.1,INSD:CF652448.1,
FT                   INSD:DR375628.1,INSD:DR317316.1,INSD:EG505336.1,
FT                   INSD:DR317311.1,INSD:DR317306.1,INSD:DR317341.1,
FT                   INSD:BP576259.1,INSD:DR317333.1,INSD:DR317328.1,
FT                   INSD:DR317240.1,INSD:BP586965.1,INSD:EG505335.1,
FT                   INSD:DR317389.1,INSD:DR317338.1,INSD:DR317279.1,
FT                   INSD:DR317212.1,INSD:DR317336.1,INSD:DR317379.1,
FT                   INSD:DR317315.1,INSD:EL045155.1,INSD:DR317365.1,
FT                   INSD:BP567320.1,INSD:DR317207.1,INSD:DR317253.1,
FT                   INSD:DR317320.1,INSD:DR317238.1,INSD:DR317393.1,
FT                   INSD:DR317245.1,INSD:AV545261.1,INSD:DR317213.1,
FT                   INSD:EL014939.1,INSD:DR317223.1,INSD:DR317352.1,
FT                   INSD:DR317281.1,INSD:DR317250.1,INSD:DR317261.1,
FT                   INSD:DR317388.1,INSD:BP571831.1,INSD:DR317382.1,
FT                   INSD:AV552425.1,INSD:DR317376.1,INSD:DR317246.1,
FT                   INSD:DR317230.1,INSD:DR317377.1,INSD:EG440930.1,
FT                   INSD:DR317210.1,INSD:DR317319.1,INSD:ES137213.1,
FT                   INSD:DR317275.1,INSD:DR317251.1,INSD:DR317214.1,
FT                   INSD:DR205657.1,INSD:AV799348.1,INSD:DR317225.1,
FT                   INSD:DR317220.1,INSD:BP571338.1,INSD:DR317263.1,
FT                   INSD:EG439492.1,INSD:T41926.1,INSD:DR317258.1,
FT                   INSD:BP803027.1,INSD:W43041.1,INSD:DR317321.1,
FT                   INSD:DR317308.1,INSD:DR317390.1,INSD:DR317344.1,
FT                   INSD:DR317381.1,INSD:DR317292.1,INSD:DR317356.1,
FT                   INSD:DR317339.1,INSD:DR317357.1,INSD:EH875902.1,
FT                   INSD:DR317351.1,INSD:DR317368.1,INSD:DR317204.1,
FT                   INSD:DR317350.1,INSD:DR317324.1,INSD:DR377641.1,
FT                   INSD:EG470171.1,INSD:BP574665.1,INSD:DR317301.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY085745.1,INSD:AF458339.1,INSD:BX821361.1,
FT                   INSD:AY054247.1"
FT   CDS_pept        join(235992..236178,236613..236881)
FT                   /codon_start=1
FT                   /gene="MLP328"
FT                   /gene_synonym="F2I9.14"
FT                   /gene_synonym="F2I9_14"
FT                   /gene_synonym="MLP-like protein 328"
FT                   /gene_synonym="(Zusammen-CA)-enhanced 1"
FT                   /gene_synonym="ZCE1"
FT                   /locus_tag="AT2G01520"
FT                   /product="MLP-like protein 328"
FT                   /note="MLP-like protein 328 (MLP328); FUNCTIONS IN: copper
FT                   ion binding; INVOLVED IN: response to zinc ion; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 13 plant
FT                   structures; EXPRESSED DURING: 7 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Bet v I allergen (InterPro:IPR000916);
FT                   BEST Arabidopsis thaliana protein match is: Polyketide
FT                   cyclase/dehydrase and lipid transport superfamily protein
FT                   (TAIR:AT4G14060.1); Has 369 Blast hits to 340 proteins in
FT                   40 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 369; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q9ZVF3"
FT                   /db_xref="InterPro:IPR000916"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZVF3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR317371.1,INSD:BP581179.1,INSD:DR317385.1,
FT                   INSD:DR317378.1,INSD:DR317327.1,INSD:BP801185.1,
FT                   INSD:DR317290.1,INSD:DR317237.1,INSD:BP582932.1,
FT                   INSD:DR317286.1,INSD:DR317325.1,INSD:EG446276.1,
FT                   INSD:DR317387.1,INSD:DR317278.1,INSD:BP579431.1,
FT                   INSD:DR317293.1,INSD:DR317354.1,INSD:DR317272.1,
FT                   INSD:DR317222.1,INSD:DR317309.1,INSD:DR317233.1,
FT                   INSD:DR317342.1,INSD:DR317358.1,INSD:DR317396.1,
FT                   INSD:DR317346.1,INSD:T43905.1,INSD:DR317285.1,
FT                   INSD:EG506584.1,INSD:BP781515.1,INSD:DR317219.1,
FT                   INSD:DR317259.1,INSD:DR317283.1,INSD:DR317262.1,
FT                   INSD:BP570794.1,INSD:DR317235.1,INSD:DR317294.1,
FT                   INSD:BP581160.1,INSD:DR317345.1,INSD:BP563471.1,
FT                   INSD:EH966307.1,INSD:EL167651.1,INSD:DR317248.1,
FT                   INSD:DR317257.1,INSD:DR317318.1,INSD:BP567681.1,
FT                   INSD:DR317232.1,INSD:DR317255.1,INSD:DR317264.1,
FT                   INSD:DR317304.1,INSD:DR317303.1,INSD:BP571179.1,
FT                   INSD:H36765.1,INSD:DR317273.1,INSD:DR317239.1,
FT                   INSD:EL273628.1,INSD:DR317284.1,INSD:R90142.1,
FT                   INSD:BP567730.1,INSD:DR317274.1,INSD:DR317249.1,
FT                   INSD:DR317302.1,INSD:EG506582.1,INSD:DR317343.1,
FT                   INSD:DR317231.1,INSD:DR317298.1,INSD:DR317267.1,
FT                   INSD:DR317256.1,INSD:DR317216.1,INSD:DR317236.1,
FT                   INSD:DR317312.1,INSD:DR377723.1,INSD:DR317271.1,
FT                   INSD:DR317317.1,INSD:DR317247.1,INSD:DR317282.1,
FT                   INSD:AV549086.1,INSD:BP586457.1,INSD:DR317215.1,
FT                   INSD:DR317340.1,INSD:DR317209.1,INSD:DR317360.1,
FT                   INSD:DR317348.1,INSD:DR317206.1,INSD:BP572115.1,
FT                   INSD:DR317337.1,INSD:DR317329.1,INSD:DR317307.1,
FT                   INSD:DR317211.1,INSD:DR317398.1,INSD:DR317335.1,
FT                   INSD:BP577079.1,INSD:DR317224.1,INSD:DR317289.1,
FT                   INSD:BP567703.1,INSD:DR317362.1,INSD:EG528650.1,
FT                   INSD:DR317394.1,INSD:DR317276.1,INSD:DR317323.1,
FT                   INSD:DR317244.1,INSD:DR243246.1,INSD:DR317217.1,
FT                   INSD:EG528651.1,INSD:DR317364.1,INSD:DR317392.1,
FT                   INSD:DR317322.1,INSD:DR317383.1,INSD:DR317287.1,
FT                   INSD:EG440929.1,INSD:DR317300.1,INSD:DR317229.1,
FT                   INSD:BP567604.1,INSD:DR317297.1,INSD:DR317241.1,
FT                   INSD:DR317384.1,INSD:BP581039.1,INSD:DR317334.1,
FT                   INSD:AV816654.1,INSD:DR317234.1,INSD:DR317391.1,
FT                   INSD:R29829.1,INSD:DR317359.1,INSD:DR317266.1,
FT                   INSD:DR317386.1,INSD:DR317355.1,INSD:DR317373.1,
FT                   INSD:DR317361.1,INSD:EG446265.1,INSD:DR317226.1,
FT                   INSD:DR317288.1,INSD:DR317374.1,INSD:EL163623.1,
FT                   INSD:EG440928.1,INSD:DR317332.1,INSD:DR317375.1,
FT                   INSD:ES199994.1,INSD:DR317366.1,INSD:DR317242.1,
FT                   INSD:BP579716.1,INSD:DR317296.1,INSD:DR317221.1,
FT                   INSD:DR317353.1,INSD:DR317305.1,INSD:DR317228.1,
FT                   INSD:ES153399.1,INSD:DR205656.1,INSD:DR317326.1,
FT                   INSD:DR317314.1,INSD:DR317280.1,INSD:DR317310.1,
FT                   INSD:DR317372.1,INSD:DR317313.1,INSD:DR372753.1,
FT                   INSD:DR317330.1,INSD:DR317380.1,INSD:T21300.1,
FT                   INSD:DR317254.1,INSD:DR317218.1,INSD:DR317205.1,
FT                   INSD:DR317252.1,INSD:DR317397.1,INSD:DR317265.1,
FT                   INSD:BP583496.1,INSD:T22170.1,INSD:EG480605.1,
FT                   INSD:DR317268.1,INSD:DR317395.1,INSD:DR317349.1,
FT                   INSD:BP798756.1,INSD:DR317295.1,INSD:DR317208.1,
FT                   INSD:BP797003.1,INSD:DR317277.1,INSD:DR317243.1,
FT                   INSD:DR317291.1,INSD:DR317260.1,INSD:BP563939.1,
FT                   INSD:DR317367.1,INSD:DR377095.1,INSD:AV553971.1,
FT                   INSD:DR317331.1,INSD:BP570278.1,INSD:DR317227.1,
FT                   INSD:DR317270.1,INSD:DR317363.1,INSD:DR317269.1,
FT                   INSD:T22625.1,INSD:DR317347.1,INSD:CF652448.1,
FT                   INSD:DR375628.1,INSD:DR317316.1,INSD:EG505336.1,
FT                   INSD:DR317311.1,INSD:DR317306.1,INSD:DR317341.1,
FT                   INSD:BP576259.1,INSD:DR317333.1,INSD:DR317328.1,
FT                   INSD:DR317240.1,INSD:BP586965.1,INSD:EG505335.1,
FT                   INSD:DR317389.1,INSD:DR317338.1,INSD:DR317279.1,
FT                   INSD:DR317212.1,INSD:DR317336.1,INSD:DR317379.1,
FT                   INSD:DR317315.1,INSD:EL045155.1,INSD:DR317365.1,
FT                   INSD:BP567320.1,INSD:DR317207.1,INSD:DR317253.1,
FT                   INSD:DR317320.1,INSD:DR317238.1,INSD:DR317393.1,
FT                   INSD:DR317245.1,INSD:AV545261.1,INSD:DR317213.1,
FT                   INSD:EL014939.1,INSD:DR317223.1,INSD:DR317352.1,
FT                   INSD:DR317281.1,INSD:DR317250.1,INSD:DR317261.1,
FT                   INSD:DR317388.1,INSD:BP571831.1,INSD:DR317382.1,
FT                   INSD:AV552425.1,INSD:DR317376.1,INSD:DR317246.1,
FT                   INSD:DR317230.1,INSD:DR317377.1,INSD:EG440930.1,
FT                   INSD:DR317210.1,INSD:DR317319.1,INSD:ES137213.1,
FT                   INSD:DR317275.1,INSD:DR317251.1,INSD:DR317214.1,
FT                   INSD:DR205657.1,INSD:AV799348.1,INSD:DR317225.1,
FT                   INSD:DR317220.1,INSD:BP571338.1,INSD:DR317263.1,
FT                   INSD:EG439492.1,INSD:T41926.1,INSD:DR317258.1,
FT                   INSD:BP803027.1,INSD:W43041.1,INSD:DR317321.1,
FT                   INSD:DR317308.1,INSD:DR317390.1,INSD:DR317344.1,
FT                   INSD:DR317381.1,INSD:DR317292.1,INSD:DR317356.1,
FT                   INSD:DR317339.1,INSD:DR317357.1,INSD:EH875902.1,
FT                   INSD:DR317351.1,INSD:DR317368.1,INSD:DR317204.1,
FT                   INSD:DR317350.1,INSD:DR317324.1,INSD:DR377641.1,
FT                   INSD:EG470171.1,INSD:BP574665.1,INSD:DR317301.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY085745.1,INSD:AF458339.1,INSD:BX821361.1,
FT                   INSD:AY054247.1"
FT                   /protein_id="AEC05464.1"
FT                   /translation="MATSGTYVTEVPLKGSAEKHYKRWRSENHLFPDAIGHHIQGVTIH
FT                   DGEWDSHGAIKIWNYTCDGKPEVFKERREIDDENMAVTFRGLEGHVMEQLKVYDVIFQF
FT                   IQKSPDDIICKITMIWEKQNDDMPEPSNYMKFVKSLAADMDDHVLKA"
FT   gene            complement(238681..239055)
FT                   /locus_tag="AT2G04005"
FT   ncRNA           complement(238681..239055)
FT                   /locus_tag="AT2G04005"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            239669..240687
FT                   /gene="MLP329"
FT                   /gene_synonym="(Zusammen-CA)-enhanced 2"
FT                   /gene_synonym="F2I9.15"
FT                   /gene_synonym="F2I9_15"
FT                   /gene_synonym="MLP-like protein 329"
FT                   /gene_synonym="ZCE2"
FT                   /locus_tag="AT2G01530"
FT   mRNA            join(239669..240001,240081..240687)
FT                   /gene="MLP329"
FT                   /gene_synonym="(Zusammen-CA)-enhanced 2"
FT                   /gene_synonym="F2I9.15"
FT                   /gene_synonym="F2I9_15"
FT                   /gene_synonym="MLP-like protein 329"
FT                   /gene_synonym="ZCE2"
FT                   /locus_tag="AT2G01530"
FT                   /product="MLP-like protein 329"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG441698.1,INSD:BP806116.1,INSD:DR322388.1,
FT                   INSD:EG515655.1,INSD:AV548979.1,INSD:BP811544.1,
FT                   INSD:DR322386.1,INSD:EG513835.1,INSD:DR322396.1,
FT                   INSD:AV824624.1,INSD:R30617.1,INSD:BP798308.2,
FT                   INSD:BP568926.1,INSD:N65702.1,INSD:EL092174.1,
FT                   INSD:DR322392.1,INSD:DR322381.1,INSD:DR322387.1,
FT                   INSD:AV554525.1,INSD:BP574821.1,INSD:BP574250.1,
FT                   INSD:BP564339.1,INSD:BP575598.1,INSD:T75987.1,
FT                   INSD:BP582690.1,INSD:H37454.1,INSD:BP810399.1,
FT                   INSD:DR322384.1,INSD:DR322400.1,INSD:DR322399.1,
FT                   INSD:BP570402.1,INSD:BP577791.1,INSD:BP864645.1,
FT                   INSD:BP611307.1,INSD:BP582573.1,INSD:BP581074.1,
FT                   INSD:BP571946.1,INSD:EL144290.1,INSD:EH960834.1,
FT                   INSD:T04583.1,INSD:AV787025.1,INSD:DR322382.1,
FT                   INSD:BP563126.1,INSD:BP632194.1,INSD:BP808855.1,
FT                   INSD:EL173782.1,INSD:AV540434.1,INSD:AV537519.1,
FT                   INSD:DR322389.1,INSD:BP581720.1,INSD:EH973601.1,
FT                   INSD:BP809162.1,INSD:BP616869.1,INSD:DR322401.1,
FT                   INSD:BP630081.1,INSD:BP568283.1,INSD:N37670.1,
FT                   INSD:AV540454.1,INSD:BP863207.1,INSD:DR322391.1,
FT                   INSD:DR322383.1,INSD:DR322385.1,INSD:DR322393.1,
FT                   INSD:BP801994.1,INSD:DR322398.1,INSD:BP597982.1,
FT                   INSD:AV544066.1,INSD:DR322394.1,INSD:BP579444.1,
FT                   INSD:DR322380.1,INSD:H76182.1,INSD:DR322390.1,
FT                   INSD:BP670644.1,INSD:DR322395.1,INSD:BP568451.1,
FT                   INSD:AA067384.1,INSD:DR322402.1,INSD:BP565884.1,
FT                   INSD:DR373167.1,INSD:EG441710.1,INSD:EG514536.1,
FT                   INSD:AV549451.1,INSD:BP802834.1,INSD:DR322397.1,
FT                   INSD:AV537275.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY061925.1,INSD:AY052300.1,INSD:BX820427.1"
FT   CDS_pept        join(239815..240001,240081..240349)
FT                   /codon_start=1
FT                   /gene="MLP329"
FT                   /gene_synonym="F2I9.15"
FT                   /gene_synonym="F2I9_15"
FT                   /gene_synonym="MLP-like protein 329"
FT                   /gene_synonym="(Zusammen-CA)-enhanced 2"
FT                   /gene_synonym="ZCE2"
FT                   /locus_tag="AT2G01530"
FT                   /product="MLP-like protein 329"
FT                   /note="MLP-like protein 329 (MLP329); FUNCTIONS IN: copper
FT                   ion binding; INVOLVED IN: response to biotic stimulus,
FT                   defense response; LOCATED IN: cellular_component unknown;
FT                   EXPRESSED IN: hypocotyl, root; CONTAINS InterPro DOMAIN/s:
FT                   Bet v I allergen (InterPro:IPR000916); BEST Arabidopsis
FT                   thaliana protein match is: MLP-like protein 328
FT                   (TAIR:AT2G01520.1); Has 358 Blast hits to 331 proteins in
FT                   39 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 358; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q9ZVF2"
FT                   /db_xref="InterPro:IPR000916"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZVF2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG441698.1,INSD:BP806116.1,INSD:DR322388.1,
FT                   INSD:EG515655.1,INSD:AV548979.1,INSD:BP811544.1,
FT                   INSD:DR322386.1,INSD:EG513835.1,INSD:DR322396.1,
FT                   INSD:AV824624.1,INSD:R30617.1,INSD:BP798308.2,
FT                   INSD:BP568926.1,INSD:N65702.1,INSD:EL092174.1,
FT                   INSD:DR322392.1,INSD:DR322381.1,INSD:DR322387.1,
FT                   INSD:AV554525.1,INSD:BP574821.1,INSD:BP574250.1,
FT                   INSD:BP564339.1,INSD:BP575598.1,INSD:T75987.1,
FT                   INSD:BP582690.1,INSD:H37454.1,INSD:BP810399.1,
FT                   INSD:DR322384.1,INSD:DR322400.1,INSD:DR322399.1,
FT                   INSD:BP570402.1,INSD:BP577791.1,INSD:BP864645.1,
FT                   INSD:BP611307.1,INSD:BP582573.1,INSD:BP581074.1,
FT                   INSD:BP571946.1,INSD:EL144290.1,INSD:EH960834.1,
FT                   INSD:T04583.1,INSD:AV787025.1,INSD:DR322382.1,
FT                   INSD:BP563126.1,INSD:BP632194.1,INSD:BP808855.1,
FT                   INSD:EL173782.1,INSD:AV540434.1,INSD:AV537519.1,
FT                   INSD:DR322389.1,INSD:BP581720.1,INSD:EH973601.1,
FT                   INSD:BP809162.1,INSD:BP616869.1,INSD:DR322401.1,
FT                   INSD:BP630081.1,INSD:BP568283.1,INSD:N37670.1,
FT                   INSD:AV540454.1,INSD:BP863207.1,INSD:DR322391.1,
FT                   INSD:DR322383.1,INSD:DR322385.1,INSD:DR322393.1,
FT                   INSD:BP801994.1,INSD:DR322398.1,INSD:BP597982.1,
FT                   INSD:AV544066.1,INSD:DR322394.1,INSD:BP579444.1,
FT                   INSD:DR322380.1,INSD:H76182.1,INSD:DR322390.1,
FT                   INSD:BP670644.1,INSD:DR322395.1,INSD:BP568451.1,
FT                   INSD:AA067384.1,INSD:DR322402.1,INSD:BP565884.1,
FT                   INSD:DR373167.1,INSD:EG441710.1,INSD:EG514536.1,
FT                   INSD:AV549451.1,INSD:BP802834.1,INSD:DR322397.1,
FT                   INSD:AV537275.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY061925.1,INSD:AY052300.1,INSD:BX820427.1"
FT                   /protein_id="AEC05465.1"
FT                   /translation="MATSGTYVTEVPLKGSADKHYKRWRDENHLFPDAIGHHIQGVTVH
FT                   DGEWDSHEAIKIWNYTCDGKPEVFKERKEIDDENMVITFRGLEGHVMEQLKVYDLIYQF
FT                   SQKSPDDIVCKITMIWEKRTDDSPEPSNYMKFLKSVVADMDEHVLKA"
FT   gene            complement(242041..243649)
FT                   /gene_synonym="F2I9.16"
FT                   /gene_synonym="F2I9_16"
FT                   /locus_tag="AT2G01540"
FT   mRNA            complement(join(242041..242629,242733..242828,
FT                   243120..243649))
FT                   /gene_synonym="F2I9.16"
FT                   /gene_synonym="F2I9_16"
FT                   /locus_tag="AT2G01540"
FT                   /product="Calcium-dependent lipid-binding (CaLB domain)
FT                   family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR211765.1,INSD:BU635837.1,INSD:EH868531.1,
FT                   INSD:AV520999.1,INSD:EL230272.1,INSD:BP666488.1,
FT                   INSD:EL012404.1,INSD:BP857145.1,INSD:AV795909.1,
FT                   INSD:AV826633.1,INSD:EH961005.1,INSD:EL268675.1,
FT                   INSD:EG492727.1,INSD:DR211767.1,INSD:AI995971.1,
FT                   INSD:EL016005.1,INSD:EL003277.1,INSD:DR211766.1,
FT                   INSD:EH929027.1,INSD:EH937257.1,INSD:EH891705.1,
FT                   INSD:BP868183.1,INSD:BP856974.1,INSD:AV527581.1,
FT                   INSD:EG492726.1,INSD:DR211764.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062604.1,INSD:AY093363.1"
FT   CDS_pept        complement(join(242297..242629,242733..242828,
FT                   243120..243233))
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.16"
FT                   /gene_synonym="F2I9_16"
FT                   /locus_tag="AT2G01540"
FT                   /product="Calcium-dependent lipid-binding (CaLB domain)
FT                   family protein"
FT                   /note="Calcium-dependent lipid-binding (CaLB domain) family
FT                   protein; FUNCTIONS IN: molecular_function unknown; INVOLVED
FT                   IN: biological_process unknown; LOCATED IN: plasma
FT                   membrane, vacuole; EXPRESSED IN: 25 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: C2 membrane targeting protein
FT                   (InterPro:IPR018029), C2 calcium/lipid-binding domain, CaLB
FT                   (InterPro:IPR008973), C2 calcium-dependent membrane
FT                   targeting (InterPro:IPR000008); BEST Arabidopsis thaliana
FT                   protein match is: Calcium-dependent lipid-binding (CaLB
FT                   domain) family protein (TAIR:AT1G70790.1); Has 3447 Blast
FT                   hits to 2959 proteins in 238 species: Archae - 0; Bacteria
FT                   - 0; Metazoa - 1768; Fungi - 600; Plants - 764; Viruses -
FT                   0; Other Eukaryotes - 315 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01540"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01540.1"
FT                   /db_xref="GOA:Q9ZVF1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZVF1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR211765.1,INSD:BU635837.1,INSD:EH868531.1,
FT                   INSD:AV520999.1,INSD:EL230272.1,INSD:BP666488.1,
FT                   INSD:EL012404.1,INSD:BP857145.1,INSD:AV795909.1,
FT                   INSD:AV826633.1,INSD:EH961005.1,INSD:EL268675.1,
FT                   INSD:EG492727.1,INSD:DR211767.1,INSD:AI995971.1,
FT                   INSD:EL016005.1,INSD:EL003277.1,INSD:DR211766.1,
FT                   INSD:EH929027.1,INSD:EH937257.1,INSD:EH891705.1,
FT                   INSD:BP868183.1,INSD:BP856974.1,INSD:AV527581.1,
FT                   INSD:EG492726.1,INSD:DR211764.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062604.1,INSD:AY093363.1"
FT                   /protein_id="AEC05466.1"
FT                   /translation="MDQKPLGLLTIHVKRGINLAIRDHRSSDPYIVLNVADQTLKTRVV
FT                   KKNCNPVWNEEMTVAIKDPNVPIRLTVFDWDKFTGDDKMGDANIDIQPYLEALKMGMEL
FT                   LRLPNGCAIKRVQPSRHNCLSDESSIVWNNGKITQDLILRLNNVECGEIEIMLEWHEGA
FT                   GCRGITSSSKGGGSSST"
FT   gene            complement(243918..249049)
FT                   /pseudo
FT                   /gene_synonym="F2I9.17"
FT                   /gene_synonym="F2I9_17"
FT                   /locus_tag="AT2G01550"
FT   mRNA            complement(<243918..>249049)
FT                   /pseudo
FT                   /gene_synonym="F2I9.17"
FT                   /gene_synonym="F2I9_17"
FT                   /locus_tag="AT2G01550"
FT                   /product="hypothetical protein"
FT   gene            249687..250181
FT                   /locus_tag="AT2G01554"
FT   mRNA            join(249687..249774,249860..249924,250017..250181)
FT                   /locus_tag="AT2G01554"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(249687..249774,249860..249924,250017..250181)
FT                   /codon_start=1
FT                   /locus_tag="AT2G01554"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; BEST Arabidopsis thaliana
FT                   protein match is: unknown protein (TAIR:AT1G70780.1); Has
FT                   30201 Blast hits to 17322 proteins in 780 species: Archae -
FT                   12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants
FT                   - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01554"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01554.1"
FT                   /db_xref="GOA:B3H6Q9"
FT                   /db_xref="InterPro:IPR040358"
FT                   /db_xref="UniProtKB/TrEMBL:B3H6Q9"
FT                   /protein_id="AEC05467.1"
FT                   /translation="MLYNNKHQRNQKSKTTNRFLVSINVLGSAGFHFSDQIPAFSDFIA
FT                   LTVPLKGKIGSTGSRNFVLSNKLETQNLEDSMMTTTTTRKTSGRWKAWLNKSFGLMVPS
FT                   H"
FT   gene            complement(250245..251806)
FT                   /gene_synonym="F2I9.18"
FT                   /gene_synonym="F2I9_18"
FT                   /locus_tag="AT2G01560"
FT   mRNA            complement(join(250245..250720,250806..250976,
FT                   251060..251179,251255..251290,251371..251451,
FT                   251544..251649,251744..251806))
FT                   /gene_synonym="F2I9.18"
FT                   /gene_synonym="F2I9_18"
FT                   /locus_tag="AT2G01560"
FT                   /product="Plant protein 1589 of unknown function"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG439001.1,INSD:EG439015.1,INSD:EG439019.1,
FT                   INSD:EG439000.1,INSD:EG439012.1,INSD:EG439004.1,
FT                   INSD:EG439018.1,INSD:EG439011.1,INSD:EG495651.1,
FT                   INSD:EG439003.1,INSD:EG495640.1,INSD:EG439020.1,
FT                   INSD:EG439013.1,INSD:EG439005.1,INSD:EG495584.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ652946.1,INSD:DQ446452.1"
FT   CDS_pept        complement(join(250392..250720,250806..250976,
FT                   251060..251179,251255..251290,251371..251451,
FT                   251544..251649,251744..251806))
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.18"
FT                   /gene_synonym="F2I9_18"
FT                   /locus_tag="AT2G01560"
FT                   /product="Plant protein 1589 of unknown function"
FT                   /note="Plant protein 1589 of unknown function; CONTAINS
FT                   InterPro DOMAIN/s: Conserved hypothetical protein CHP01589,
FT                   plant (InterPro:IPR006476); Has 88 Blast hits to 88
FT                   proteins in 31 species: Archae - 0; Bacteria - 9; Metazoa -
FT                   4; Fungi - 11; Plants - 55; Viruses - 0; Other Eukaryotes -
FT                   9 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01560"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01560.1"
FT                   /db_xref="InterPro:IPR006476"
FT                   /db_xref="UniProtKB/TrEMBL:Q1PFB1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG439001.1,INSD:EG439015.1,INSD:EG439019.1,
FT                   INSD:EG439000.1,INSD:EG439012.1,INSD:EG439004.1,
FT                   INSD:EG439018.1,INSD:EG439011.1,INSD:EG495651.1,
FT                   INSD:EG439003.1,INSD:EG495640.1,INSD:EG439020.1,
FT                   INSD:EG439013.1,INSD:EG439005.1,INSD:EG495584.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ652946.1,INSD:DQ446452.1"
FT                   /protein_id="AEC05468.1"
FT                   /translation="MSPHVLDLPKGCEISNDLTDFVHYRVEECIQGYMSKEETASFIFD
FT                   TFGVSLKFTRFVWYLLEKANPDFFRCFKTHCENIQNAPSEEVTSNVEIENSFEDLAEAS
FT                   TSFTKPDNKPRAKRSKGKNKQKQHPISPIHSLIETAPNDASSQVPQEAATANSSDTPIP
FT                   VEKVSSKARRFRARKKAKQEKSQQAPCSPSRGTSADVERAEVPIADAEIILKQISTRMR
FT                   LLESIIEQVHKLLSNVLGPPPSAAKALKKQRSWKQVRGDYEQAEMLHDLNQQVQQEMPR
FT                   MDIPGNQASDNSNEEDTLYD"
FT   gene            complement(255247..257568)
FT                   /gene="RGA1"
FT                   /gene_synonym="F2I9.19"
FT                   /gene_synonym="F2I9_19"
FT                   /gene_synonym="REPRESSOR OF GA"
FT                   /gene_synonym="REPRESSOR OF GA1-3 1"
FT                   /gene_synonym="RGA"
FT                   /locus_tag="AT2G01570"
FT                   /note="Member of the VHIID/DELLA regulatory family.
FT                   Contains homopolymeric serine and threonine residues, a
FT                   putative nuclear localization signal, leucine heptad
FT                   repeats, and an LXXLL motif. Putative transcriptional
FT                   regulator repressing the gibberellin response and
FT                   integration of phytohormone signalling. DELLAs repress cell
FT                   proliferation and expansion that drives plant growth. The
FT                   protein undergoes degradation in response to GA via the 26S
FT                   proteasome. RGA1 binds to PIF3 and inhibits its DNA binding
FT                   activity and thus affects the expression of PIF3 regulated
FT                   genes. RGA may be involved in reducing ROS accumulation in
FT                   response to stress by up-regulating the transcription of
FT                   superoxide dismutases. Represses GA-induced vegetative
FT                   growth and floral initiation. Rapidly degraded in response
FT                   to GA. Involved in fruit and flower development."
FT   mRNA            complement(255247..257568)
FT                   /gene="RGA1"
FT                   /gene_synonym="F2I9.19"
FT                   /gene_synonym="F2I9_19"
FT                   /gene_synonym="REPRESSOR OF GA"
FT                   /gene_synonym="REPRESSOR OF GA1-3 1"
FT                   /gene_synonym="RGA"
FT                   /locus_tag="AT2G01570"
FT                   /product="GRAS family transcription factor family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR369791.1,INSD:EH916124.1,INSD:EH882892.1,
FT                   INSD:BP863879.1,INSD:BP597960.1,INSD:EH814024.1,
FT                   INSD:DR369792.1,INSD:T45793.1,INSD:ES112797.1,
FT                   INSD:BP807131.1,INSD:ES089846.1,INSD:BP614514.1,
FT                   INSD:DR369788.1,INSD:EL206189.1,INSD:EL307980.1,
FT                   INSD:BP848144.1,INSD:BP599239.1,INSD:ES199090.1,
FT                   INSD:EG450246.1,INSD:DR369794.1,INSD:ES091333.1,
FT                   INSD:BP789190.1,INSD:DR369787.1,INSD:EH887134.1,
FT                   INSD:ES197630.1,INSD:EH947530.1,INSD:ES213666.1,
FT                   INSD:AV830192.1,INSD:T46205.1,INSD:ES170310.1,
FT                   INSD:ES210919.1,INSD:ES022487.1,INSD:BP781366.1,
FT                   INSD:BP561805.1,INSD:EH901253.1,INSD:EG480589.1,
FT                   INSD:EL115972.1,INSD:BP605910.1,INSD:BP862306.1,
FT                   INSD:EL203328.1,INSD:EH888231.1,INSD:AV830188.1,
FT                   INSD:AV811805.1,INSD:BP596466.1,INSD:EH973482.1,
FT                   INSD:EG476836.1,INSD:BP585260.1,INSD:EH844531.1,
FT                   INSD:BP782620.1,INSD:EH948775.1,INSD:BP829897.1,
FT                   INSD:EL070679.1,INSD:DR369789.1,INSD:EH980954.1,
FT                   INSD:BP579443.1,INSD:EL999844.1,INSD:EL990705.1,
FT                   INSD:ES207359.1,INSD:BP601743.1,INSD:EL260176.1,
FT                   INSD:ES054413.1,INSD:AV562629.1,INSD:EL995916.1,
FT                   INSD:EL213442.1,INSD:EL168603.1,INSD:AV788178.1,
FT                   INSD:BP589619.1,INSD:AV530438.1,INSD:AV830440.1,
FT                   INSD:ES173121.1,INSD:ES093076.1,INSD:AV814953.1,
FT                   INSD:EL981857.1,INSD:EH851095.1,INSD:ES152435.1,
FT                   INSD:EL157996.1,INSD:EH866984.1,INSD:EL109376.1,
FT                   INSD:BP861541.1,INSD:EG476835.1,INSD:AI993756.1,
FT                   INSD:ES204171.1,INSD:AI996746.1,INSD:ES024338.1,
FT                   INSD:EL138163.1,INSD:BP805683.1,INSD:ES000591.1,
FT                   INSD:BP804414.1,INSD:EL303132.1,INSD:EL002950.1,
FT                   INSD:EH828797.1,INSD:EL256312.1,INSD:ES185443.1,
FT                   INSD:AV789779.1,INSD:EG501584.1,INSD:BP777904.1,
FT                   INSD:BP845909.1,INSD:ES144992.1,INSD:BP780504.1,
FT                   INSD:BP655803.1,INSD:EH808120.1,INSD:BP787675.1,
FT                   INSD:EL233888.1,INSD:EG480588.1,INSD:BP664625.1,
FT                   INSD:DR369790.1,INSD:ES067741.1,INSD:ES007403.1,
FT                   INSD:EL280532.1,INSD:ES158064.1,INSD:DR355202.1,
FT                   INSD:AV520438.1,INSD:ES033316.1,INSD:BP798551.1,
FT                   INSD:BP865787.1,INSD:AV810561.1,INSD:EL055644.1,
FT                   INSD:ES054945.1,INSD:EL019213.1,INSD:AV527188.1,
FT                   INSD:BP861094.1,INSD:DR369795.1,INSD:AV800083.1,
FT                   INSD:AA404754.1,INSD:EG480715.1,INSD:ES155940.1,
FT                   INSD:ES004922.1,INSD:EH936156.1,INSD:N96653.1,
FT                   INSD:EL032229.1,INSD:ES137099.1,INSD:BP782486.1,
FT                   INSD:BP619636.1,INSD:AV521557.1,INSD:EG480717.1,
FT                   INSD:ES000741.1,INSD:BP579062.1,INSD:DR384124.1,
FT                   INSD:EL163014.1,INSD:BP616051.1,INSD:ES018586.1,
FT                   INSD:EL992188.1,INSD:DR357310.1,INSD:EH815191.1,
FT                   INSD:BP610058.1,INSD:EH992783.1,INSD:BP594683.1,
FT                   INSD:EL025446.1,INSD:EH937303.1,INSD:DR369793.1,
FT                   INSD:ES153115.1,INSD:DR750690.1,INSD:CB256202.1,
FT                   INSD:CK117784.1,INSD:AV816415.1,INSD:BP609558.1,
FT                   INSD:BP611999.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY054160.1,INSD:BT010467.1,INSD:BX819848.1,
FT                   INSD:BX819972.1,INSD:AY052239.1,INSD:Y15194.1,
FT                   INSD:Y11336.1"
FT   CDS_pept        complement(255581..257344)
FT                   /codon_start=1
FT                   /gene="RGA1"
FT                   /gene_synonym="F2I9.19"
FT                   /gene_synonym="F2I9_19"
FT                   /gene_synonym="REPRESSOR OF GA"
FT                   /gene_synonym="REPRESSOR OF GA1-3 1"
FT                   /gene_synonym="RGA"
FT                   /locus_tag="AT2G01570"
FT                   /product="GRAS family transcription factor family protein"
FT                   /note="REPRESSOR OF GA1-3 1 (RGA1); CONTAINS InterPro
FT                   DOMAIN/s: Transcriptional factor DELLA, N-terminal
FT                   (InterPro:IPR021914), Transcription factor GRAS
FT                   (InterPro:IPR005202); BEST Arabidopsis thaliana protein
FT                   match is: GRAS family transcription factor family protein
FT                   (TAIR:AT1G14920.1); Has 2724 Blast hits to 2666 proteins in
FT                   317 species: Archae - 0; Bacteria - 6; Metazoa - 0; Fungi -
FT                   4; Plants - 2709; Viruses - 0; Other Eukaryotes - 5
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01570"
FT                   /db_xref="GOA:Q9SLH3"
FT                   /db_xref="InterPro:IPR005202"
FT                   /db_xref="InterPro:IPR021914"
FT                   /db_xref="InterPro:IPR030006"
FT                   /db_xref="InterPro:IPR038088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SLH3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR369791.1,INSD:EH916124.1,INSD:EH882892.1,
FT                   INSD:BP863879.1,INSD:BP597960.1,INSD:EH814024.1,
FT                   INSD:DR369792.1,INSD:T45793.1,INSD:ES112797.1,
FT                   INSD:BP807131.1,INSD:ES089846.1,INSD:BP614514.1,
FT                   INSD:DR369788.1,INSD:EL206189.1,INSD:EL307980.1,
FT                   INSD:BP848144.1,INSD:BP599239.1,INSD:ES199090.1,
FT                   INSD:EG450246.1,INSD:DR369794.1,INSD:ES091333.1,
FT                   INSD:BP789190.1,INSD:DR369787.1,INSD:EH887134.1,
FT                   INSD:ES197630.1,INSD:EH947530.1,INSD:ES213666.1,
FT                   INSD:AV830192.1,INSD:T46205.1,INSD:ES170310.1,
FT                   INSD:ES210919.1,INSD:ES022487.1,INSD:BP781366.1,
FT                   INSD:BP561805.1,INSD:EH901253.1,INSD:EG480589.1,
FT                   INSD:EL115972.1,INSD:BP605910.1,INSD:BP862306.1,
FT                   INSD:EL203328.1,INSD:EH888231.1,INSD:AV830188.1,
FT                   INSD:AV811805.1,INSD:BP596466.1,INSD:EH973482.1,
FT                   INSD:EG476836.1,INSD:BP585260.1,INSD:EH844531.1,
FT                   INSD:BP782620.1,INSD:EH948775.1,INSD:BP829897.1,
FT                   INSD:EL070679.1,INSD:DR369789.1,INSD:EH980954.1,
FT                   INSD:BP579443.1,INSD:EL999844.1,INSD:EL990705.1,
FT                   INSD:ES207359.1,INSD:BP601743.1,INSD:EL260176.1,
FT                   INSD:ES054413.1,INSD:AV562629.1,INSD:EL995916.1,
FT                   INSD:EL213442.1,INSD:EL168603.1,INSD:AV788178.1,
FT                   INSD:BP589619.1,INSD:AV530438.1,INSD:AV830440.1,
FT                   INSD:ES173121.1,INSD:ES093076.1,INSD:AV814953.1,
FT                   INSD:EL981857.1,INSD:EH851095.1,INSD:ES152435.1,
FT                   INSD:EL157996.1,INSD:EH866984.1,INSD:EL109376.1,
FT                   INSD:BP861541.1,INSD:EG476835.1,INSD:AI993756.1,
FT                   INSD:ES204171.1,INSD:AI996746.1,INSD:ES024338.1,
FT                   INSD:EL138163.1,INSD:BP805683.1,INSD:ES000591.1,
FT                   INSD:BP804414.1,INSD:EL303132.1,INSD:EL002950.1,
FT                   INSD:EH828797.1,INSD:EL256312.1,INSD:ES185443.1,
FT                   INSD:AV789779.1,INSD:EG501584.1,INSD:BP777904.1,
FT                   INSD:BP845909.1,INSD:ES144992.1,INSD:BP780504.1,
FT                   INSD:BP655803.1,INSD:EH808120.1,INSD:BP787675.1,
FT                   INSD:EL233888.1,INSD:EG480588.1,INSD:BP664625.1,
FT                   INSD:DR369790.1,INSD:ES067741.1,INSD:ES007403.1,
FT                   INSD:EL280532.1,INSD:ES158064.1,INSD:DR355202.1,
FT                   INSD:AV520438.1,INSD:ES033316.1,INSD:BP798551.1,
FT                   INSD:BP865787.1,INSD:AV810561.1,INSD:EL055644.1,
FT                   INSD:ES054945.1,INSD:EL019213.1,INSD:AV527188.1,
FT                   INSD:BP861094.1,INSD:DR369795.1,INSD:AV800083.1,
FT                   INSD:AA404754.1,INSD:EG480715.1,INSD:ES155940.1,
FT                   INSD:ES004922.1,INSD:EH936156.1,INSD:N96653.1,
FT                   INSD:EL032229.1,INSD:ES137099.1,INSD:BP782486.1,
FT                   INSD:BP619636.1,INSD:AV521557.1,INSD:EG480717.1,
FT                   INSD:ES000741.1,INSD:BP579062.1,INSD:DR384124.1,
FT                   INSD:EL163014.1,INSD:BP616051.1,INSD:ES018586.1,
FT                   INSD:EL992188.1,INSD:DR357310.1,INSD:EH815191.1,
FT                   INSD:BP610058.1,INSD:EH992783.1,INSD:BP594683.1,
FT                   INSD:EL025446.1,INSD:EH937303.1,INSD:DR369793.1,
FT                   INSD:ES153115.1,INSD:DR750690.1,INSD:CB256202.1,
FT                   INSD:CK117784.1,INSD:AV816415.1,INSD:BP609558.1,
FT                   INSD:BP611999.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY054160.1,INSD:BT010467.1,INSD:BX819848.1,
FT                   INSD:BX819972.1,INSD:AY052239.1,INSD:Y15194.1,
FT                   INSD:Y11336.1"
FT                   /protein_id="AEC05469.1"
FT                   /translation="MKRDHHQFQGRLSNHGTSSSSSSISKDKMMMVKKEEDGGGNMDDE
FT                   LLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLATDTVHYNPSELYSWLDNML
FT                   SELNPPPLPASSNGLDPVLPSPEICGFPASDYDLKVIPGNAIYQFPAIDSSSSSNNQNK
FT                   RLKSCSSPDSMVTSTSTGTQIGGVIGTTVTTTTTTTTAAGESTRSVILVDSQENGVRLV
FT                   HALMACAEAIQQNNLTLAEALVKQIGCLAVSQAGAMRKVATYFAEALARRIYRLSPPQN
FT                   QIDHCLSDTLQMHFYETCPYLKFAHFTANQAILEAFEGKKRVHVIDFSMNQGLQWPALM
FT                   QALALREGGPPTFRLTGIGPPAPDNSDHLHEVGCKLAQLAEAIHVEFEYRGFVANSLAD
FT                   LDASMLELRPSDTEAVAVNSVFELHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHN
FT                   GPVFLDRFTESLHYYSTLFDSLEGVPNSQDKVMSEVYLGKQICNLVACEGPDRVERHET
FT                   LSQWGNRFGSSGLAPAHLGSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLIT
FT                   TSAWKLSTAAY"
FT   gene            258998..259325
FT                   /locus_tag="AT2G04015"
FT   ncRNA           258998..259325
FT                   /locus_tag="AT2G04015"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(265022..265948)
FT                   /gene_synonym="F2I9.20"
FT                   /gene_synonym="F2I9_20"
FT                   /locus_tag="AT2G01580"
FT   mRNA            complement(265022..265948)
FT                   /gene_synonym="F2I9.20"
FT                   /gene_synonym="F2I9_20"
FT                   /locus_tag="AT2G01580"
FT                   /product="transmembrane protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV553648.1,INSD:AV545031.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT010851.1,INSD:BX821216.1,INSD:BX821201.1,
FT                   INSD:BT011322.1"
FT   CDS_pept        complement(265181..265756)
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.20"
FT                   /gene_synonym="F2I9_20"
FT                   /locus_tag="AT2G01580"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT3G07510.2); Has 129 Blast
FT                   hits to 129 proteins in 12 species: Archae - 0; Bacteria -
FT                   0; Metazoa - 0; Fungi - 0; Plants - 129; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01580"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01580.1"
FT                   /db_xref="GOA:Q9ZVE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZVE8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV553648.1,INSD:AV545031.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT010851.1,INSD:BX821216.1,INSD:BX821201.1,
FT                   INSD:BT011322.1"
FT                   /protein_id="AEC05470.1"
FT                   /translation="MADSDIETSSNQNSNSNTSHSTTSTTSVHVTALDGIVSANSLFTV
FT                   AVFVGISFDQPSDLTLTDRTECSAGRDVERDLVVFEVISFAFFLFSSLVAQGMKLAINL
FT                   LNSKETDEVFKANINRDVLRFGVVGAAGGSILGCVFLLLSIVDVIQLRLGLLSCGNALA
FT                   IHTVLVLVVLVSSALSVYIFTVFYSFRK"
FT   gene            266559..267926
FT                   /gene="CRR3"
FT                   /gene_synonym="CHLORORESPIRATORY REDUCTION 3"
FT                   /gene_synonym="F2I9.21"
FT                   /gene_synonym="F2I9_21"
FT                   /locus_tag="AT2G01590"
FT                   /note="Likely a subunit of the chloroplast NAD(P)H
FT                   dehydrogenase complex, involved in PSI cyclic electron
FT                   transport. Located in the membrane fraction of chloroplast.
FT                   Mutant has impaired NAD(P)H dehydrogenase activity."
FT   mRNA            join(266559..266937,267035..267171,267255..267926)
FT                   /gene="CRR3"
FT                   /gene_synonym="CHLORORESPIRATORY REDUCTION 3"
FT                   /gene_synonym="F2I9.21"
FT                   /gene_synonym="F2I9_21"
FT                   /locus_tag="AT2G01590"
FT                   /product="chlororespiratory reduction 3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH818958.1,INSD:DR279642.1,INSD:AV786527.1,
FT                   INSD:EL336160.1,INSD:EL294755.1,INSD:EL273132.1,
FT                   INSD:EL094840.1,INSD:EH917280.1,INSD:H76228.1,
FT                   INSD:EL288112.1,INSD:EL257567.1,INSD:AV531816.1,
FT                   INSD:EL134937.1,INSD:EL137025.1,INSD:EL118193.1,
FT                   INSD:AV821436.1,INSD:BP627168.1,INSD:EH857812.1,
FT                   INSD:EH872506.1,INSD:AI995767.1,INSD:EL006162.1,
FT                   INSD:DR279641.1,INSD:EL132797.1,INSD:EL052686.1,
FT                   INSD:H76227.1,INSD:EL132596.1,INSD:DR279640.1,
FT                   INSD:EH898156.1,INSD:EL059894.1,INSD:EH966826.1,
FT                   INSD:AV796278.1,INSD:CF773455.1,INSD:EL235997.1,
FT                   INSD:EH991524.1,INSD:EH904827.1,INSD:AV781884.1,
FT                   INSD:EL178187.1,INSD:EL238448.1,INSD:EL016723.1,
FT                   INSD:EH848597.1,INSD:EL164946.1,INSD:EL030049.1,
FT                   INSD:EH825538.1,INSD:EH946723.1,INSD:EL329436.1,
FT                   INSD:EH905503.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY113895.1,INSD:BX821127.1,INSD:BX821297.1,
FT                   INSD:AY035185.1"
FT   mRNA            join(266630..266937,267035..267171,267255..267375,
FT                   267480..267798)
FT                   /gene="CRR3"
FT                   /gene_synonym="CHLORORESPIRATORY REDUCTION 3"
FT                   /gene_synonym="F2I9.21"
FT                   /gene_synonym="F2I9_21"
FT                   /locus_tag="AT2G01590"
FT                   /product="chlororespiratory reduction 3"
FT   CDS_pept        join(266675..266937,267035..267171,267255..267375,
FT                   267480..267483)
FT                   /codon_start=1
FT                   /gene="CRR3"
FT                   /gene_synonym="CHLORORESPIRATORY REDUCTION 3"
FT                   /gene_synonym="F2I9.21"
FT                   /gene_synonym="F2I9_21"
FT                   /locus_tag="AT2G01590"
FT                   /product="chlororespiratory reduction 3"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01590"
FT                   /db_xref="GOA:A0A1P8B0Z4"
FT                   /db_xref="InterPro:IPR038931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B0Z4"
FT                   /protein_id="ANM62560.1"
FT                   /translation="MAVLSTIYSITRASTPTMASLTNDSPSPLPSSSPSKLPSPTSPSK
FT                   KPLKLRQVSKQMGSQNQQRRGNKPSIAQIERAFGSGSYRDSEGEMDMNTVFDELLLGHA
FT                   NKFESKIEKKLREIGEIFVARTEPKLRSSGKPVLMFTIQWILPIWIMSLLVACGVIKLP
FT                   FSIPFLDDLII"
FT   CDS_pept        join(266675..266937,267035..267171,267255..267379)
FT                   /codon_start=1
FT                   /gene="CRR3"
FT                   /gene_synonym="CHLORORESPIRATORY REDUCTION 3"
FT                   /gene_synonym="F2I9.21"
FT                   /gene_synonym="F2I9_21"
FT                   /locus_tag="AT2G01590"
FT                   /product="chlororespiratory reduction 3"
FT                   /note="CHLORORESPIRATORY REDUCTION 3 (CRR3); FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: photosynthetic
FT                   electron transport in photosystem I; LOCATED IN:
FT                   chloroplast, NAD(P)H dehydrogenase complex (plastoquinone),
FT                   membrane; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; Has 17 Blast hits to 17 proteins
FT                   in 8 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi
FT                   - 0; Plants - 17; Viruses - 0; Other Eukaryotes - 0
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01590"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01590.1"
FT                   /db_xref="GOA:Q9ZVE7"
FT                   /db_xref="InterPro:IPR038931"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZVE7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH818958.1,INSD:DR279642.1,INSD:AV786527.1,
FT                   INSD:EL336160.1,INSD:EL294755.1,INSD:EL273132.1,
FT                   INSD:EL094840.1,INSD:EH917280.1,INSD:H76228.1,
FT                   INSD:EL288112.1,INSD:EL257567.1,INSD:AV531816.1,
FT                   INSD:EL134937.1,INSD:EL137025.1,INSD:EL118193.1,
FT                   INSD:AV821436.1,INSD:BP627168.1,INSD:EH857812.1,
FT                   INSD:EH872506.1,INSD:AI995767.1,INSD:EL006162.1,
FT                   INSD:DR279641.1,INSD:EL132797.1,INSD:EL052686.1,
FT                   INSD:H76227.1,INSD:EL132596.1,INSD:DR279640.1,
FT                   INSD:EH898156.1,INSD:EL059894.1,INSD:EH966826.1,
FT                   INSD:AV796278.1,INSD:CF773455.1,INSD:EL235997.1,
FT                   INSD:EH991524.1,INSD:EH904827.1,INSD:AV781884.1,
FT                   INSD:EL178187.1,INSD:EL238448.1,INSD:EL016723.1,
FT                   INSD:EH848597.1,INSD:EL164946.1,INSD:EL030049.1,
FT                   INSD:EH825538.1,INSD:EH946723.1,INSD:EL329436.1,
FT                   INSD:EH905503.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY113895.1,INSD:BX821127.1,INSD:BX821297.1,
FT                   INSD:AY035185.1"
FT                   /protein_id="AEC05471.1"
FT                   /translation="MAVLSTIYSITRASTPTMASLTNDSPSPLPSSSPSKLPSPTSPSK
FT                   KPLKLRQVSKQMGSQNQQRRGNKPSIAQIERAFGSGSYRDSEGEMDMNTVFDELLLGHA
FT                   NKFESKIEKKLREIGEIFVARTEPKLRSSGKPVLMFTIQWILPIWIMSLLVACGVIKLP
FT                   FSIPFLDDLIM"
FT   gene            268714..272676
FT                   /gene_synonym="F2I9.22"
FT                   /gene_synonym="F2I9_22"
FT                   /locus_tag="AT2G01600"
FT   mRNA            join(268714..269064,269169..269238,269324..269421,
FT                   269500..269638,269745..269872,269969..270061,
FT                   270156..270206,270356..270421,270511..270576,
FT                   270662..270742,270834..270914,271007..271183,
FT                   271283..271361,271476..271591,271976..272676)
FT                   /gene_synonym="F2I9.22"
FT                   /gene_synonym="F2I9_22"
FT                   /locus_tag="AT2G01600"
FT                   /product="ENTH/ANTH/VHS superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AA712916.1,INSD:AV559234.1,INSD:BP781044.1,
FT                   INSD:BP829746.1,INSD:DR334476.1,INSD:DR375025.1,
FT                   INSD:EH975491.1,INSD:AV561993.1,INSD:EL210748.1,
FT                   INSD:EH952713.1,INSD:BP784487.1,INSD:EL086911.1,
FT                   INSD:EH925811.1,INSD:EL050488.1,INSD:ES041512.1,
FT                   INSD:EL095086.1,INSD:EL080508.1,INSD:ES097332.1,
FT                   INSD:BP836125.1,INSD:BP641390.1,INSD:EL179214.1,
FT                   INSD:ES173084.1,INSD:AV802940.1,INSD:EL041426.1,
FT                   INSD:BP836004.1,INSD:EH934580.1,INSD:ES008804.1,
FT                   INSD:EL297205.1,INSD:EL007177.1,INSD:BP598711.1,
FT                   INSD:AA395302.1,INSD:BP839781.1,INSD:EH939057.1,
FT                   INSD:AV555330.1,INSD:EH870220.1,INSD:ES118031.1,
FT                   INSD:DR334477.1,INSD:BP780346.1,INSD:BP651421.1,
FT                   INSD:EL146707.1,INSD:AV814682.1,INSD:EH872915.1,
FT                   INSD:R86989.1,INSD:BP619453.1,INSD:EL180839.1,
FT                   INSD:BP809976.1,INSD:EL321604.1,INSD:EL257993.1,
FT                   INSD:AV534763.1,INSD:EL216227.1,INSD:ES131582.1,
FT                   INSD:DR383651.1,INSD:AV559491.1,INSD:BP638064.1,
FT                   INSD:BP780310.1,INSD:EL190102.1,INSD:BP598356.1,
FT                   INSD:BP825746.1,INSD:ES174498.1,INSD:EH956383.1,
FT                   INSD:ES143826.1,INSD:BP814336.1,INSD:BP811092.1,
FT                   INSD:AV564952.1,INSD:EG499097.1,INSD:EL234008.1,
FT                   INSD:BP582564.1,INSD:EL197131.1,INSD:ES142926.1,
FT                   INSD:BP619594.1,INSD:ES080367.1,INSD:AV798468.1,
FT                   INSD:EL230407.1,INSD:ES072460.1,INSD:EL208025.1,
FT                   INSD:BP636214.1,INSD:AV801365.1,INSD:EH891195.1,
FT                   INSD:ES016242.1,INSD:AV558107.1,INSD:EL045728.1,
FT                   INSD:BP868547.1,INSD:ES093414.1,INSD:DR334478.1,
FT                   INSD:AV782259.1,INSD:BP864846.1,INSD:BP818586.1,
FT                   INSD:BP795088.1,INSD:ES066318.1,INSD:BX834190.1,
FT                   INSD:BP815045.1,INSD:AV828818.1,INSD:AV801660.1,
FT                   INSD:EH980769.1,INSD:EL016997.1,INSD:BX837018.1,
FT                   INSD:AV827514.1,INSD:BP781718.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX819725.1,INSD:BX820162.1,INSD:BX821731.1,
FT                   INSD:AY096639.1,INSD:AY133828.1,INSD:AF424593.1"
FT   CDS_pept        join(268975..269064,269169..269238,269324..269421,
FT                   269500..269638,269745..269872,269969..270061,
FT                   270156..270206,270356..270421,270511..270576,
FT                   270662..270742,270834..270914,271007..271183,
FT                   271283..271361,271476..271591,271976..272356)
FT                   /codon_start=1
FT                   /gene_synonym="F2I9.22"
FT                   /gene_synonym="F2I9_22"
FT                   /locus_tag="AT2G01600"
FT                   /product="ENTH/ANTH/VHS superfamily protein"
FT                   /note="ENTH/ANTH/VHS superfamily protein; FUNCTIONS IN:
FT                   phospholipid binding, clathrin binding, binding,
FT                   phosphatidylinositol binding; INVOLVED IN: N-terminal
FT                   protein myristoylation, clathrin coat assembly; LOCATED IN:
FT                   membrane; EXPRESSED IN: 24 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Epsin-like, N-terminal (InterPro:IPR013809), ANTH
FT                   (InterPro:IPR011417), ENTH/VHS (InterPro:IPR008942),
FT                   Clathrin adaptor, phosphoinositide-binding, GAT-like
FT                   (InterPro:IPR014712); BEST Arabidopsis thaliana protein
FT                   match is: ENTH/ANTH/VHS superfamily protein
FT                   (TAIR:AT1G14910.1); Has 1020 Blast hits to 994 proteins in
FT                   190 species: Archae - 0; Bacteria - 14; Metazoa - 316;
FT                   Fungi - 202; Plants - 440; Viruses - 0; Other Eukaryotes -
FT                   48 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01600.1"
FT                   /db_xref="GOA:Q8LBH2"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR014712"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LBH2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AA712916.1,INSD:AV559234.1,INSD:BP781044.1,
FT                   INSD:BP829746.1,INSD:DR334476.1,INSD:DR375025.1,
FT                   INSD:EH975491.1,INSD:AV561993.1,INSD:EL210748.1,
FT                   INSD:EH952713.1,INSD:BP784487.1,INSD:EL086911.1,
FT                   INSD:EH925811.1,INSD:EL050488.1,INSD:ES041512.1,
FT                   INSD:EL095086.1,INSD:EL080508.1,INSD:ES097332.1,
FT                   INSD:BP836125.1,INSD:BP641390.1,INSD:EL179214.1,
FT                   INSD:ES173084.1,INSD:AV802940.1,INSD:EL041426.1,
FT                   INSD:BP836004.1,INSD:EH934580.1,INSD:ES008804.1,
FT                   INSD:EL297205.1,INSD:EL007177.1,INSD:BP598711.1,
FT                   INSD:AA395302.1,INSD:BP839781.1,INSD:EH939057.1,
FT                   INSD:AV555330.1,INSD:EH870220.1,INSD:ES118031.1,
FT                   INSD:DR334477.1,INSD:BP780346.1,INSD:BP651421.1,
FT                   INSD:EL146707.1,INSD:AV814682.1,INSD:EH872915.1,
FT                   INSD:R86989.1,INSD:BP619453.1,INSD:EL180839.1,
FT                   INSD:BP809976.1,INSD:EL321604.1,INSD:EL257993.1,
FT                   INSD:AV534763.1,INSD:EL216227.1,INSD:ES131582.1,
FT                   INSD:DR383651.1,INSD:AV559491.1,INSD:BP638064.1,
FT                   INSD:BP780310.1,INSD:EL190102.1,INSD:BP598356.1,
FT                   INSD:BP825746.1,INSD:ES174498.1,INSD:EH956383.1,
FT                   INSD:ES143826.1,INSD:BP814336.1,INSD:BP811092.1,
FT                   INSD:AV564952.1,INSD:EG499097.1,INSD:EL234008.1,
FT                   INSD:BP582564.1,INSD:EL197131.1,INSD:ES142926.1,
FT                   INSD:BP619594.1,INSD:ES080367.1,INSD:AV798468.1,
FT                   INSD:EL230407.1,INSD:ES072460.1,INSD:EL208025.1,
FT                   INSD:BP636214.1,INSD:AV801365.1,INSD:EH891195.1,
FT                   INSD:ES016242.1,INSD:AV558107.1,INSD:EL045728.1,
FT                   INSD:BP868547.1,INSD:ES093414.1,INSD:DR334478.1,
FT                   INSD:AV782259.1,INSD:BP864846.1,INSD:BP818586.1,
FT                   INSD:BP795088.1,INSD:ES066318.1,INSD:BX834190.1,
FT                   INSD:BP815045.1,INSD:AV828818.1,INSD:AV801660.1,
FT                   INSD:EH980769.1,INSD:EL016997.1,INSD:BX837018.1,
FT                   INSD:AV827514.1,INSD:BP781718.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX819725.1,INSD:BX820162.1,INSD:BX821731.1,
FT                   INSD:AY096639.1,INSD:AY133828.1,INSD:AF424593.1"
FT                   /protein_id="AEC05472.1"
FT                   /translation="MGTLQSWRKAYGALKDSTKVGLVRVNSEYADLDVAIVKATNHVEC
FT                   PPKDRHLRKIFAATSVTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDP
FT                   TFREELLNFSQRGRILQLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDTEA
FT                   ERLPKSNPGQDKGYSRTRDLDGEELLEQLPALQQLLYRLIGCRPEGAANHNHVIQYALA
FT                   LVLKESFKVYCAINDGIINLIDKFFEMAKHEAITSLEIYKRAGQQARSLSDFYEACKGL
FT                   ELARNFQFPVLREPPQSFLTTMEEYIKEAPRVVDVPAEPLLLTYRPDDGLTTEDTEPSH
FT                   EEREMLPSDDVVVVSEETEPSPPPPPSANAQNFIDTDDLWGLNTGAPDTSVIEDQNALA
FT                   LAIVSTDADPPTPHFGQPNNYDPTGWELALVTAPSSDISASTERKLAGGLDTLTLSSLY
FT                   DDGAYIASQRPVYGAPAPNPFASHDPFASSNGTAPPPQQQAVNNPFGAYQQTYQHQPQP
FT                   TYQHQSNPPTNNSNPFGDFGEFPVNPVSQQPNTSGYGDFSVNQHNNPFRSTGLI"
FT   gene            complement(272679..273132)
FT                   /locus_tag="AT2G04055"
FT   misc_RNA        complement(join(272679..272872,272979..273132))
FT                   /locus_tag="AT2G04055"
FT                   /note="novel transcribed region; detected in carpel,
FT                   receptacle, leaf, dark-grown seedling, light-grown
FT                   seedling, flower; AT2G04055.1"
FT   gene            complement(273895..275002)
FT                   /gene_synonym="T8O11.22"
FT                   /gene_synonym="T8O11_22"
FT                   /locus_tag="AT2G01610"
FT   mRNA            complement(273895..275002)
FT                   /gene_synonym="T8O11.22"
FT                   /gene_synonym="T8O11_22"
FT                   /locus_tag="AT2G01610"
FT                   /product="Plant invertase/pectin methylesterase inhibitor
FT                   superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR285838.1,INSD:EH984274.1,INSD:EG474782.1,
FT                   INSD:EL084725.1,INSD:DR381754.1,INSD:EH886305.1,
FT                   INSD:EG475782.1,INSD:EL291955.1,INSD:DR285842.1,
FT                   INSD:DR285841.1,INSD:EG475784.1,INSD:EL978811.1,
FT                   INSD:BP788564.1,INSD:DR285839.1,INSD:CB258238.1,
FT                   INSD:BE528816.1,INSD:DR285840.1,INSD:BP788532.1,
FT                   INSD:BP813167.1,INSD:ES208725.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK175594.1,INSD:BT030064.1"
FT   CDS_pept        complement(274124..274792)
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.22"
FT                   /gene_synonym="T8O11_22"
FT                   /locus_tag="AT2G01610"
FT                   /product="Plant invertase/pectin methylesterase inhibitor
FT                   superfamily protein"
FT                   /note="Plant invertase/pectin methylesterase inhibitor
FT                   superfamily protein; FUNCTIONS IN: enzyme inhibitor
FT                   activity, pectinesterase inhibitor activity, pectinesterase
FT                   activity; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: endomembrane system; EXPRESSED IN: 22 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Pectinesterase inhibitor (InterPro:IPR006501);
FT                   BEST Arabidopsis thaliana protein match is: Plant
FT                   invertase/pectin methylesterase inhibitor superfamily
FT                   protein (TAIR:AT1G14890.1); Has 850 Blast hits to 843
FT                   proteins in 42 species: Archae - 0; Bacteria - 0; Metazoa -
FT                   0; Fungi - 0; Plants - 850; Viruses - 0; Other Eukaryotes -
FT                   0 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9ZNU5"
FT                   /db_xref="InterPro:IPR006501"
FT                   /db_xref="InterPro:IPR035513"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZNU5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR285838.1,INSD:EH984274.1,INSD:EG474782.1,
FT                   INSD:EL084725.1,INSD:DR381754.1,INSD:EH886305.1,
FT                   INSD:EG475782.1,INSD:EL291955.1,INSD:DR285842.1,
FT                   INSD:DR285841.1,INSD:EG475784.1,INSD:EL978811.1,
FT                   INSD:BP788564.1,INSD:DR285839.1,INSD:CB258238.1,
FT                   INSD:BE528816.1,INSD:DR285840.1,INSD:BP788532.1,
FT                   INSD:BP813167.1,INSD:ES208725.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK175594.1,INSD:BT030064.1"
FT                   /protein_id="AEC05473.1"
FT                   /translation="MVTVSQSHTTTFLFFTTFLLIFGSISAVRLLPRPNTTTTNDLDFI
FT                   RTSCNATLYPDVCFTSLSGYASAVQDSPARLAKLAIGVSLSQAKSTAAFLSKLSRSAAK
FT                   YSGDGHQTASAVIRDCVSNVEDAVDEMRGSLRQLRDMNGRGGGTAARRSVETFRFQMSN
FT                   VQTWMSAALTDEDTCTDGFEDMDEGGLIKTTVCDRLEEVKRLTSNALALVNTYANNGAP
FT                   "
FT   gene            278124..279296
FT                   /gene="MEE11"
FT                   /gene_synonym="maternal effect embryo arrest 11"
FT                   /gene_synonym="T8O11.21"
FT                   /gene_synonym="T8O11_21"
FT                   /locus_tag="AT2G01620"
FT   mRNA            join(278124..278536,278600..278836,278918..279296)
FT                   /gene="MEE11"
FT                   /gene_synonym="maternal effect embryo arrest 11"
FT                   /gene_synonym="T8O11.21"
FT                   /gene_synonym="T8O11_21"
FT                   /locus_tag="AT2G01620"
FT                   /product="RNI-like superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CB260499.1,INSD:ES144014.1,INSD:EL274766.1,
FT                   INSD:EL206683.1,INSD:DR276373.1,INSD:ES154548.1,
FT                   INSD:ES033634.1,INSD:EL059810.1,INSD:AI997687.1,
FT                   INSD:EG495896.1,INSD:EL085680.1,INSD:EL063914.1,
FT                   INSD:EL024764.1,INSD:DR276374.1,INSD:EL080607.1,
FT                   INSD:EH824602.1,INSD:EL212896.1,INSD:EL037925.1,
FT                   INSD:ES039151.1,INSD:EH874077.1,INSD:EL067654.1,
FT                   INSD:EG479807.1,INSD:DR276375.1,INSD:DR381142.1,
FT                   INSD:EH903255.1,INSD:AU238495.1,INSD:ES152197.1,
FT                   INSD:EH816480.1,INSD:EL058273.1,INSD:DR276372.1,
FT                   INSD:EL154959.1,INSD:EL123717.1,INSD:DR276371.1,
FT                   INSD:AU229687.1,INSD:EH959511.1,INSD:ES197691.1,
FT                   INSD:EL103506.1,INSD:EH994872.1,INSD:T46400.1,
FT                   INSD:EH942495.1,INSD:ES123739.1,INSD:EG495897.1,
FT                   INSD:EL150588.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT005175.1,INSD:AK117653.1,INSD:AY084339.1"
FT   CDS_pept        join(278204..278536,278600..278836,278918..279226)
FT                   /codon_start=1
FT                   /gene="MEE11"
FT                   /gene_synonym="maternal effect embryo arrest 11"
FT                   /gene_synonym="T8O11.21"
FT                   /gene_synonym="T8O11_21"
FT                   /locus_tag="AT2G01620"
FT                   /product="RNI-like superfamily protein"
FT                   /note="maternal effect embryo arrest 11 (MEE11); BEST
FT                   Arabidopsis thaliana protein match is: Ribonuclease
FT                   inhibitor (TAIR:AT3G26000.1); Has 234 Blast hits to 230
FT                   proteins in 61 species: Archae - 0; Bacteria - 0; Metazoa -
FT                   139; Fungi - 2; Plants - 81; Viruses - 0; Other Eukaryotes
FT                   - 12 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9ZU90"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU90"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CB260499.1,INSD:ES144014.1,INSD:EL274766.1,
FT                   INSD:EL206683.1,INSD:DR276373.1,INSD:ES154548.1,
FT                   INSD:ES033634.1,INSD:EL059810.1,INSD:AI997687.1,
FT                   INSD:EG495896.1,INSD:EL085680.1,INSD:EL063914.1,
FT                   INSD:EL024764.1,INSD:DR276374.1,INSD:EL080607.1,
FT                   INSD:EH824602.1,INSD:EL212896.1,INSD:EL037925.1,
FT                   INSD:ES039151.1,INSD:EH874077.1,INSD:EL067654.1,
FT                   INSD:EG479807.1,INSD:DR276375.1,INSD:DR381142.1,
FT                   INSD:EH903255.1,INSD:AU238495.1,INSD:ES152197.1,
FT                   INSD:EH816480.1,INSD:EL058273.1,INSD:DR276372.1,
FT                   INSD:EL154959.1,INSD:EL123717.1,INSD:DR276371.1,
FT                   INSD:AU229687.1,INSD:EH959511.1,INSD:ES197691.1,
FT                   INSD:EL103506.1,INSD:EH994872.1,INSD:T46400.1,
FT                   INSD:EH942495.1,INSD:ES123739.1,INSD:EG495897.1,
FT                   INSD:EL150588.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT005175.1,INSD:AK117653.1,INSD:AY084339.1"
FT                   /protein_id="AEC05474.1"
FT                   /translation="MKTELEEEEEEEWRSVHEVLLIVLPYLHSLFELLSMIRVSRSLRD
FT                   AIRDETALWTKLVIEPPLSSRLTDDILSEFSSKSAGKLKTLILRQCLMVTNKGLRRVVD
FT                   ANPLITKIIVPGCSGLTPEGIMECVESLSKNNHKLETLHINGVNGFTKQHLSALYTYLS
FT                   SEGTIDLEVCPKCDEVRMIPSCSRESCNQKQRKCRGCWLCIPRCAECAVCLVGSDTESQ
FT                   EAACGNDDVLCLECWLVLPKCRFCNKPYCTNHSSRRHEIAITDAASRPSFECEACYYRA
FT                   GTNPYEVDYQI"
FT   gene            complement(279282..282123)
FT                   /gene_synonym="T8O11.20"
FT                   /gene_synonym="T8O11_20"
FT                   /locus_tag="AT2G01630"
FT   mRNA            complement(join(279282..279706,279804..279831,
FT                   279936..281189,281898..282123))
FT                   /gene_synonym="T8O11.20"
FT                   /gene_synonym="T8O11_20"
FT                   /locus_tag="AT2G01630"
FT                   /product="O-Glycosyl hydrolases family 17 protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL274766.1,INSD:EL039359.1,INSD:ES162060.1,
FT                   INSD:ES154548.1,INSD:DR252557.1,INSD:EL059810.1,
FT                   INSD:DR379027.1,INSD:AI993072.1,INSD:EG495896.1,
FT                   INSD:EL065914.1,INSD:EL173184.1,INSD:BX835984.1,
FT                   INSD:DR252558.1,INSD:DR252556.1,INSD:T42658.1,
FT                   INSD:CB263219.1,INSD:ES039151.1,INSD:EG479807.1,
FT                   INSD:EL118534.1,INSD:DR381142.1,INSD:EH895545.1,
FT                   INSD:BX841121.1,INSD:T21851.1,INSD:AV533477.1,
FT                   INSD:EL057748.1,INSD:ES188148.1,INSD:AA585729.1,
FT                   INSD:AI100379.1,INSD:BX840014.1,INSD:AU229687.1,
FT                   INSD:EH930803.1,INSD:EG495897.1,INSD:EH928709.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX819571.1,INSD:AY085500.1,INSD:BX819636.1"
FT   mRNA            complement(join(279325..279583,280092..281189,
FT                   281898..282123))
FT                   /gene_synonym="T8O11.20"
FT                   /gene_synonym="T8O11_20"
FT                   /locus_tag="AT2G01630"
FT                   /product="O-Glycosyl hydrolases family 17 protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL039359.1,INSD:EL118534.1,INSD:ES154548.1,
FT                   INSD:DR252557.1,INSD:AI993072.1,INSD:EH895545.1,
FT                   INSD:BX841121.1,INSD:EG495896.1,INSD:T21851.1,
FT                   INSD:AV533477.1,INSD:EL065914.1,INSD:EL173184.1,
FT                   INSD:EL057748.1,INSD:DR252558.1,INSD:AA585729.1,
FT                   INSD:AI100379.1,INSD:BX840014.1,INSD:T42658.1,
FT                   INSD:CB263219.1,INSD:EH930803.1,INSD:EG495897.1,
FT                   INSD:ES039151.1,INSD:EH928709.1"
FT   mRNA            complement(join(279325..279706,279804..281189,
FT                   281898..282123))
FT                   /gene_synonym="T8O11.20"
FT                   /gene_synonym="T8O11_20"
FT                   /locus_tag="AT2G01630"
FT                   /product="O-Glycosyl hydrolases family 17 protein"
FT   CDS_pept        complement(join(279541..279706,279804..279831,
FT                   279936..281189,281898..281955))
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.20"
FT                   /gene_synonym="T8O11_20"
FT                   /locus_tag="AT2G01630"
FT                   /product="O-Glycosyl hydrolases family 17 protein"
FT                   /note="O-Glycosyl hydrolases family 17 protein; FUNCTIONS
FT                   IN: cation binding, hydrolase activity, hydrolyzing
FT                   O-glycosyl compounds, catalytic activity; INVOLVED IN:
FT                   carbohydrate metabolic process; LOCATED IN: anchored to
FT                   plasma membrane, plasma membrane, anchored to membrane;
FT                   EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: X8
FT                   (InterPro:IPR012946), Glycoside hydrolase, catalytic core
FT                   (InterPro:IPR017853), Glycoside hydrolase, family 17
FT                   (InterPro:IPR000490), Glycoside hydrolase, subgroup,
FT                   catalytic core (InterPro:IPR013781); BEST Arabidopsis
FT                   thaliana protein match is: O-Glycosyl hydrolases family 17
FT                   protein (TAIR:AT1G66250.1); Has 2926 Blast hits to 2856
FT                   proteins in 173 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 3; Fungi - 93; Plants - 2819; Viruses - 0; Other
FT                   Eukaryotes - 11 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01630.1"
FT                   /db_xref="GOA:Q9ZU91"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU91"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL274766.1,INSD:EL039359.1,INSD:ES162060.1,
FT                   INSD:ES154548.1,INSD:DR252557.1,INSD:EL059810.1,
FT                   INSD:DR379027.1,INSD:AI993072.1,INSD:EG495896.1,
FT                   INSD:EL065914.1,INSD:EL173184.1,INSD:BX835984.1,
FT                   INSD:DR252558.1,INSD:DR252556.1,INSD:T42658.1,
FT                   INSD:CB263219.1,INSD:ES039151.1,INSD:EG479807.1,
FT                   INSD:EL118534.1,INSD:DR381142.1,INSD:EH895545.1,
FT                   INSD:BX841121.1,INSD:T21851.1,INSD:AV533477.1,
FT                   INSD:EL057748.1,INSD:ES188148.1,INSD:AA585729.1,
FT                   INSD:AI100379.1,INSD:BX840014.1,INSD:AU229687.1,
FT                   INSD:EH930803.1,INSD:EG495897.1,INSD:EH928709.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX819571.1,INSD:AY085500.1,INSD:BX819636.1"
FT                   /protein_id="AEC05475.1"
FT                   /translation="MAALLLLFLFLFASSALSQDSLIGVNIGTEVTNMPSPTQVVALLK
FT                   SQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQLLGISQSNATAANWVTRNVAAYYP
FT                   ATNITTIAVGSEVLTSLTNAASVLVSALKYIQAALVTANLDRQIKVSTPHSSTIILDSF
FT                   PPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYPYFDYVQSNGVIPLDYALFQPLQAN
FT                   KEAVDANTLLHYTNVFDAIVDAAYFAMSYLNFTNIPIVVTESGWPSKGGPSEHDATVEN
FT                   ANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFYTNGTPVY
FT                   TLRLAGAGAILANDTTNQTFCIAKEKVDRKMLQAALDWACGPGKVDCSALMQGESCYEP
FT                   DDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVFPGSAKSNQTLGNNT
FT                   SALAPSANSTTSGCIPKYYHHPHASFGDLTLLSLLLIIALVFL"
FT   CDS_pept        complement(join(279564..279583,280092..281189,
FT                   281898..281955))
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.20"
FT                   /gene_synonym="T8O11_20"
FT                   /locus_tag="AT2G01630"
FT                   /product="O-Glycosyl hydrolases family 17 protein"
FT                   /note="O-Glycosyl hydrolases family 17 protein; FUNCTIONS
FT                   IN: cation binding, hydrolase activity, hydrolyzing
FT                   O-glycosyl compounds, catalytic activity; INVOLVED IN:
FT                   carbohydrate metabolic process; LOCATED IN: plasma
FT                   membrane, anchored to membrane; EXPRESSED IN: 21 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Glycoside hydrolase, catalytic core
FT                   (InterPro:IPR017853), Glycoside hydrolase, family 17
FT                   (InterPro:IPR000490), Glycoside hydrolase, subgroup,
FT                   catalytic core (InterPro:IPR013781); BEST Arabidopsis
FT                   thaliana protein match is: O-Glycosyl hydrolases family 17
FT                   protein (TAIR:AT1G66250.1); Has 2147 Blast hits to 2131
FT                   proteins in 127 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 3; Fungi - 5; Plants - 2133; Viruses - 0; Other
FT                   Eukaryotes - 6 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01630"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01630.2"
FT                   /db_xref="GOA:A8MRK0"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A8MRK0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL039359.1,INSD:EL118534.1,INSD:ES154548.1,
FT                   INSD:DR252557.1,INSD:AI993072.1,INSD:EH895545.1,
FT                   INSD:BX841121.1,INSD:EG495896.1,INSD:T21851.1,
FT                   INSD:AV533477.1,INSD:EL065914.1,INSD:EL173184.1,
FT                   INSD:EL057748.1,INSD:DR252558.1,INSD:AA585729.1,
FT                   INSD:AI100379.1,INSD:BX840014.1,INSD:T42658.1,
FT                   INSD:CB263219.1,INSD:EH930803.1,INSD:EG495897.1,
FT                   INSD:ES039151.1,INSD:EH928709.1"
FT                   /protein_id="AEC05476.1"
FT                   /translation="MAALLLLFLFLFASSALSQDSLIGVNIGTEVTNMPSPTQVVALLK
FT                   SQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQLLGISQSNATAANWVTRNVAAYYP
FT                   ATNITTIAVGSEVLTSLTNAASVLVSALKYIQAALVTANLDRQIKVSTPHSSTIILDSF
FT                   PPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYPYFDYVQSNGVIPLDYALFQPLQAN
FT                   KEAVDANTLLHYTNVFDAIVDAAYFAMSYLNFTNIPIVVTESGWPSKGGPSEHDATVEN
FT                   ANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFYTNGTPVY
FT                   TLRLAGAGAILANDTTNQTFCIAKEKVDRKMLQAALDWACGPGKVDYSPFY"
FT   CDS_pept        complement(join(279928..281189,281898..281955))
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.20"
FT                   /gene_synonym="T8O11_20"
FT                   /locus_tag="AT2G01630"
FT                   /product="O-Glycosyl hydrolases family 17 protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01630"
FT                   /db_xref="GOA:A0A1P8AXY5"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AXY5"
FT                   /protein_id="ANM61539.1"
FT                   /translation="MAALLLLFLFLFASSALSQDSLIGVNIGTEVTNMPSPTQVVALLK
FT                   SQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQLLGISQSNATAANWVTRNVAAYYP
FT                   ATNITTIAVGSEVLTSLTNAASVLVSALKYIQAALVTANLDRQIKVSTPHSSTIILDSF
FT                   PPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYPYFDYVQSNGVIPLDYALFQPLQAN
FT                   KEAVDANTLLHYTNVFDAIVDAAYFAMSYLNFTNIPIVVTESGWPSKGGPSEHDATVEN
FT                   ANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFYTNGTPVY
FT                   TLRLAGAGAILANDTTNQTFCIAKEKVDRKMLQAALDWACGPGKVDCSALMQGESCYEP
FT                   DDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTDPSM"
FT   gene            281598..281921
FT                   /locus_tag="AT2G04065"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT2G01630"
FT   ncRNA           281598..281921
FT                   /locus_tag="AT2G04065"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            282830..284598
FT                   /gene_synonym="T8O11.19"
FT                   /gene_synonym="T8O11_19"
FT                   /locus_tag="AT2G01640"
FT   mRNA            join(282830..283104,283212..283270,283360..283409,
FT                   283618..283766,283842..284311)
FT                   /gene_synonym="T8O11.19"
FT                   /gene_synonym="T8O11_19"
FT                   /locus_tag="AT2G01640"
FT                   /product="ribosome biogenesis protein"
FT   mRNA            join(282969..283104,283212..283270,283360..283409,
FT                   283618..283766,283842..284076,284449..284598)
FT                   /gene_synonym="T8O11.19"
FT                   /gene_synonym="T8O11_19"
FT                   /locus_tag="AT2G01640"
FT                   /product="ribosome biogenesis protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG430351.1,INSD:EG525420.1,INSD:DR319523.1,
FT                   INSD:EG521945.1,INSD:AU230474.1,INSD:EG525421.1,
FT                   INSD:BP563054.3,INSD:DR319520.1,INSD:BP657549.1,
FT                   INSD:ES001863.1,INSD:EG521612.1,INSD:DR371534.1,
FT                   INSD:DR319519.1,INSD:AI995483.1,INSD:DR319521.1,
FT                   INSD:EG430362.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY088767.1,INSD:AK118334.1,INSD:BT005605.1"
FT   CDS_pept        join(283085..283104,283212..283270,283360..283409,
FT                   283618..283766,283842..284034)
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.19"
FT                   /gene_synonym="T8O11_19"
FT                   /locus_tag="AT2G01640"
FT                   /product="ribosome biogenesis protein"
FT                   /note="unknown protein; Has 51 Blast hits to 51 proteins in
FT                   21 species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi -
FT                   2; Plants - 41; Viruses - 0; Other Eukaryotes - 7 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01640"
FT                   /db_xref="GOA:Q9ZU92"
FT                   /db_xref="InterPro:IPR028160"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZU92"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG430351.1,INSD:EG525420.1,INSD:DR319523.1,
FT                   INSD:EG521945.1,INSD:AU230474.1,INSD:EG525421.1,
FT                   INSD:BP563054.3,INSD:DR319520.1,INSD:BP657549.1,
FT                   INSD:ES001863.1,INSD:EG521612.1,INSD:DR371534.1,
FT                   INSD:DR319519.1,INSD:AI995483.1,INSD:DR319521.1,
FT                   INSD:EG430362.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY088767.1,INSD:AK118334.1,INSD:BT005605.1"
FT                   /protein_id="AEC05477.1"
FT                   /translation="MGKPSKGSEVTTKSDKKFEKKLQFYTKVKDTVTSLSVQKEIGKKK
FT                   KIRSRQKKLKAYDLTNLSEFLPEFNALQKSALPAPELKMNCKRRQKLVLTEGERLNKVL
FT                   DHPAFQADPVGSIFQHLLSQQPPVEEKPKKKTNTNGSKKRNKKKGKTDSMDF"
FT   CDS_pept        join(283085..283104,283212..283270,283360..283409,
FT                   283618..283766,283842..284034)
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.19"
FT                   /gene_synonym="T8O11_19"
FT                   /locus_tag="AT2G01640"
FT                   /product="ribosome biogenesis protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages."
FT                   /db_xref="GOA:Q9ZU92"
FT                   /db_xref="InterPro:IPR028160"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZU92"
FT                   /protein_id="AEC05478.1"
FT                   /translation="MGKPSKGSEVTTKSDKKFEKKLQFYTKVKDTVTSLSVQKEIGKKK
FT                   KIRSRQKKLKAYDLTNLSEFLPEFNALQKSALPAPELKMNCKRRQKLVLTEGERLNKVL
FT                   DHPAFQADPVGSIFQHLLSQQPPVEEKPKKKTNTNGSKKRNKKKGKTDSMDF"
FT   gene            complement(284509..286529)
FT                   /gene="PUX2"
FT                   /gene_synonym="plant UBX domain-containing protein 2"
FT                   /gene_synonym="T8O11.18"
FT                   /gene_synonym="T8O11_18"
FT                   /locus_tag="AT2G01650"
FT                   /note="encodes a peripheral membrane protein that contains
FT                   UBX domain and interacts with AtCDC48 in vitro and
FT                   co-fractionates with membrane-associated but not soluble
FT                   AtCDC48 in vivo."
FT   mRNA            complement(join(284509..284592,284676..285084,
FT                   285167..285445,285531..286515))
FT                   /gene="PUX2"
FT                   /gene_synonym="plant UBX domain-containing protein 2"
FT                   /gene_synonym="T8O11.18"
FT                   /gene_synonym="T8O11_18"
FT                   /locus_tag="AT2G01650"
FT                   /product="plant UBX domain-containing protein 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP804447.1,INSD:BP667235.1,INSD:DR292870.1,
FT                   INSD:EG473802.1,INSD:EL137284.1,INSD:EL258852.1,
FT                   INSD:EL186574.1,INSD:EH900865.1,INSD:EL091383.1,
FT                   INSD:DR292868.1,INSD:BX840502.1,INSD:EG509642.1,
FT                   INSD:N37890.1,INSD:EH810151.1,INSD:EG525487.1,
FT                   INSD:AA650852.1,INSD:EH873707.1,INSD:BP848912.1,
FT                   INSD:EG473803.1,INSD:BP846487.1,INSD:EL312932.1,
FT                   INSD:EH864920.1,INSD:CD530492.1,INSD:EH801016.1,
FT                   INSD:AU239794.1,INSD:EH972947.1,INSD:DR292869.1,
FT                   INSD:BU635942.1,INSD:EH917648.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX818883.1,INSD:AK118911.1,INSD:AY084317.1,
FT                   INSD:BT005408.1,INSD:AY572782.1,INSD:BX820565.1,
FT                   INSD:BX820882.1,INSD:BX820048.1"
FT   mRNA            complement(join(284597..285084,285167..285445,
FT                   285531..286529))
FT                   /gene="PUX2"
FT                   /gene_synonym="plant UBX domain-containing protein 2"
FT                   /gene_synonym="T8O11.18"
FT                   /gene_synonym="T8O11_18"
FT                   /locus_tag="AT2G01650"
FT                   /product="plant UBX domain-containing protein 2"
FT   mRNA            complement(join(284646..285445,285531..286515))
FT                   /gene="PUX2"
FT                   /gene_synonym="plant UBX domain-containing protein 2"
FT                   /gene_synonym="T8O11.18"
FT                   /gene_synonym="T8O11_18"
FT                   /locus_tag="AT2G01650"
FT                   /product="plant UBX domain-containing protein 2"
FT   CDS_pept        complement(join(284851..285084,285167..285445,
FT                   285531..286394))
FT                   /codon_start=1
FT                   /gene="PUX2"
FT                   /gene_synonym="plant UBX domain-containing protein 2"
FT                   /gene_synonym="T8O11.18"
FT                   /gene_synonym="T8O11_18"
FT                   /locus_tag="AT2G01650"
FT                   /product="plant UBX domain-containing protein 2"
FT                   /db_xref="GOA:Q9ZU93"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036339"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU93"
FT                   /protein_id="ANM61337.1"
FT                   /translation="MDDVKDKLKGFMKKVNLSSSSGKFKGQGRVLGSSSSSSAPPVNPI
FT                   QNRFNSSQAPNPTPRPKPNPNPLPEKPLSSSDQKISGSTRNPDHDPVRAPQDGFDPYGA
FT                   FITSSNRSQNGYSLSMFECPICKNPFTSEEEVSVHVESCLGDTNGDESSFEKDNNDNDK
FT                   SEMEKLVVVYLSGKPSESSIDVLLRLFKNIVKEPENAKFRKVRMSNAKIKEAIGDVAGG
FT                   VELLELVGFELKEENDEIWAVMDVPSEEQSILINKVVGYLEKRKTESSGSSAQVMEPVA
FT                   PKKIDREIRVFFSVSENVASRIEVPDSFYSLSADEIKREADLRRKKIAESQLLIPRSYK
FT                   EKQAKAARKRYKRSMIRVQFPDGVVLQGVFAPWEPTFALYEFVSSALKEPSLQFELLDP
FT                   VLVKRRVIPHTPAPGQKPITLEDEELVPSALIRFRPIETDSLVFTGLRNELLEISEPLS
FT                   "
FT   CDS_pept        complement(join(284851..285084,285167..285445,
FT                   285531..286394))
FT                   /codon_start=1
FT                   /gene="PUX2"
FT                   /gene_synonym="plant UBX domain-containing protein 2"
FT                   /gene_synonym="T8O11.18"
FT                   /gene_synonym="T8O11_18"
FT                   /locus_tag="AT2G01650"
FT                   /product="plant UBX domain-containing protein 2"
FT                   /note="plant UBX domain-containing protein 2 (PUX2);
FT                   CONTAINS InterPro DOMAIN/s: PUB domain
FT                   (InterPro:IPR018997), UBX (InterPro:IPR001012), PUG domain
FT                   (InterPro:IPR006567); BEST Arabidopsis thaliana protein
FT                   match is: ubiquitin-associated (UBA)/TS-N domain-containing
FT                   protein (TAIR:AT1G04850.1); Has 563 Blast hits to 563
FT                   proteins in 115 species: Archae - 0; Bacteria - 15; Metazoa
FT                   - 269; Fungi - 22; Plants - 176; Viruses - 0; Other
FT                   Eukaryotes - 81 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01650"
FT                   /db_xref="GOA:Q9ZU93"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036339"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU93"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP804447.1,INSD:BP667235.1,INSD:DR292870.1,
FT                   INSD:EG473802.1,INSD:EL137284.1,INSD:EL258852.1,
FT                   INSD:EL186574.1,INSD:EH900865.1,INSD:EL091383.1,
FT                   INSD:DR292868.1,INSD:BX840502.1,INSD:EG509642.1,
FT                   INSD:N37890.1,INSD:EH810151.1,INSD:EG525487.1,
FT                   INSD:AA650852.1,INSD:EH873707.1,INSD:BP848912.1,
FT                   INSD:EG473803.1,INSD:BP846487.1,INSD:EL312932.1,
FT                   INSD:EH864920.1,INSD:CD530492.1,INSD:EH801016.1,
FT                   INSD:AU239794.1,INSD:EH972947.1,INSD:DR292869.1,
FT                   INSD:BU635942.1,INSD:EH917648.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX818883.1,INSD:AK118911.1,INSD:AY084317.1,
FT                   INSD:BT005408.1,INSD:AY572782.1,INSD:BX820565.1,
FT                   INSD:BX820882.1,INSD:BX820048.1"
FT                   /protein_id="AEC05479.1"
FT                   /translation="MDDVKDKLKGFMKKVNLSSSSGKFKGQGRVLGSSSSSSAPPVNPI
FT                   QNRFNSSQAPNPTPRPKPNPNPLPEKPLSSSDQKISGSTRNPDHDPVRAPQDGFDPYGA
FT                   FITSSNRSQNGYSLSMFECPICKNPFTSEEEVSVHVESCLGDTNGDESSFEKDNNDNDK
FT                   SEMEKLVVVYLSGKPSESSIDVLLRLFKNIVKEPENAKFRKVRMSNAKIKEAIGDVAGG
FT                   VELLELVGFELKEENDEIWAVMDVPSEEQSILINKVVGYLEKRKTESSGSSAQVMEPVA
FT                   PKKIDREIRVFFSVSENVASRIEVPDSFYSLSADEIKREADLRRKKIAESQLLIPRSYK
FT                   EKQAKAARKRYKRSMIRVQFPDGVVLQGVFAPWEPTFALYEFVSSALKEPSLQFELLDP
FT                   VLVKRRVIPHTPAPGQKPITLEDEELVPSALIRFRPIETDSLVFTGLRNELLEISEPLS
FT                   "
FT   CDS_pept        complement(join(285155..285445,285531..286394))
FT                   /codon_start=1
FT                   /gene="PUX2"
FT                   /gene_synonym="plant UBX domain-containing protein 2"
FT                   /gene_synonym="T8O11.18"
FT                   /gene_synonym="T8O11_18"
FT                   /locus_tag="AT2G01650"
FT                   /product="plant UBX domain-containing protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01650"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AXE7"
FT                   /protein_id="ANM61338.1"
FT                   /translation="MDDVKDKLKGFMKKVNLSSSSGKFKGQGRVLGSSSSSSAPPVNPI
FT                   QNRFNSSQAPNPTPRPKPNPNPLPEKPLSSSDQKISGSTRNPDHDPVRAPQDGFDPYGA
FT                   FITSSNRSQNGYSLSMFECPICKNPFTSEEEVSVHVESCLGDTNGDESSFEKDNNDNDK
FT                   SEMEKLVVVYLSGKPSESSIDVLLRLFKNIVKEPENAKFRKVRMSNAKIKEAIGDVAGG
FT                   VELLELVGFELKEENDEIWAVMDVPSEEQSILINKVVGYLEKRKTESSGSSAQVMEPVA
FT                   PKKIDREIRVFFSVSENVASRIEVPDSFYSLSADEIKREADLRRKKIAESQLLIPRSYK
FT                   EKQAKAARKRYKRSMIRVQFPDGVVLQGVFAPWEPTFALYEVNI"
FT   gene            289115..289752
FT                   /locus_tag="AT2G04085"
FT   ncRNA           289115..289752
FT                   /locus_tag="AT2G04085"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(289115..289465)
FT                   /locus_tag="AT2G04075"
FT   ncRNA           complement(289115..289465)
FT                   /locus_tag="AT2G04075"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(290573..292688)
FT                   /gene="PDLP6"
FT                   /gene_synonym="plasmodesmata-located protein 6"
FT                   /gene_synonym="T8O11.17"
FT                   /gene_synonym="T8O11_17"
FT                   /locus_tag="AT2G01660"
FT                   /note="Encodes a plasmodesmal protein that may be involved
FT                   in the intercellular movement of molecules through the
FT                   plasmodesmata. The protein has two DUF26 domains and a
FT                   single transmembrane domain."
FT   mRNA            complement(join(290573..290983,291156..291287,
FT                   291773..292688))
FT                   /gene="PDLP6"
FT                   /gene_synonym="plasmodesmata-located protein 6"
FT                   /gene_synonym="T8O11.17"
FT                   /gene_synonym="T8O11_17"
FT                   /locus_tag="AT2G01660"
FT                   /product="plasmodesmata-located protein 6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU235552.1,INSD:DR297650.1,INSD:EL224162.1,
FT                   INSD:DR381480.1,INSD:AV545548.1,INSD:BP827352.1,
FT                   INSD:AV823917.1,INSD:AV803942.1,INSD:BP793350.1,
FT                   INSD:BP648890.1,INSD:AV554304.1,INSD:DR297651.1,
FT                   INSD:DR297649.1,INSD:AU226278.1,INSD:AV785002.1,
FT                   INSD:BP657339.1,INSD:EL235840.1,INSD:BP840362.1,
FT                   INSD:DR297648.1,INSD:EL341790.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062817.1,INSD:BX822025.1,INSD:AY086022.1,
FT                   INSD:BX821362.1,INSD:BX820238.1,INSD:AK227616.1"
FT   mRNA            complement(join(290573..291287,291773..292688))
FT                   /gene="PDLP6"
FT                   /gene_synonym="plasmodesmata-located protein 6"
FT                   /gene_synonym="T8O11.17"
FT                   /gene_synonym="T8O11_17"
FT                   /locus_tag="AT2G01660"
FT                   /product="plasmodesmata-located protein 6"
FT   mRNA            complement(join(290603..290983,291156..292624))
FT                   /gene="PDLP6"
FT                   /gene_synonym="plasmodesmata-located protein 6"
FT                   /gene_synonym="T8O11.17"
FT                   /gene_synonym="T8O11_17"
FT                   /locus_tag="AT2G01660"
FT                   /product="plasmodesmata-located protein 6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR297651.1,INSD:DR297649.1,INSD:EL996548.1,
FT                   INSD:DR297650.1,INSD:AU226278.1,INSD:ES017197.1,
FT                   INSD:EL224162.1,INSD:BP657339.1,INSD:EL235840.1,
FT                   INSD:AV545548.1,INSD:BP827352.1,INSD:AV823917.1,
FT                   INSD:DR297648.1,INSD:BP840362.1,INSD:EL341790.1,
FT                   INSD:AV803942.1,INSD:BP648890.1,INSD:AV554304.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX820946.1"
FT   CDS_pept        complement(join(290973..290983,291156..291287,
FT                   291773..292496))
FT                   /codon_start=1
FT                   /gene="PDLP6"
FT                   /gene_synonym="plasmodesmata-located protein 6"
FT                   /gene_synonym="T8O11.17"
FT                   /gene_synonym="T8O11_17"
FT                   /locus_tag="AT2G01660"
FT                   /product="plasmodesmata-located protein 6"
FT                   /note="plasmodesmata-located protein 6 (PDLP6); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF26
FT                   (InterPro:IPR002902); BEST Arabidopsis thaliana protein
FT                   match is: plasmodesmata-located protein 7
FT                   (TAIR:AT5G37660.2); Has 1458 Blast hits to 1310 proteins in
FT                   27 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 1458; Viruses - 0; Other Eukaryotes - 0
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9ZU94"
FT                   /db_xref="InterPro:IPR002902"
FT                   /db_xref="InterPro:IPR038408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU94"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU235552.1,INSD:DR297650.1,INSD:EL224162.1,
FT                   INSD:DR381480.1,INSD:AV545548.1,INSD:BP827352.1,
FT                   INSD:AV823917.1,INSD:AV803942.1,INSD:BP793350.1,
FT                   INSD:BP648890.1,INSD:AV554304.1,INSD:DR297651.1,
FT                   INSD:DR297649.1,INSD:AU226278.1,INSD:AV785002.1,
FT                   INSD:BP657339.1,INSD:EL235840.1,INSD:BP840362.1,
FT                   INSD:DR297648.1,INSD:EL341790.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062817.1,INSD:BX822025.1,INSD:AY086022.1,
FT                   INSD:BX821362.1,INSD:BX820238.1,INSD:AK227616.1"
FT                   /protein_id="AEC05480.1"
FT                   /translation="MFATKTVLFIAVVSLLGTFSSAAVDTFIYGGCSQEKYFPGSPYES
FT                   NVNSLLTSFVSSASLYTYNNFTTNGISGDSSSVYGLYQCRGDLSSGSGDCARCVARAVS
FT                   RLGSLCAMASGGALQLEGCFVKYDNTTFLGVEDKTVVVRRCGPPVGYNSDEMTRRDSVV
FT                   GSLAASSGGSYRVGVSGELQGVAQCTGDLSATECQDCLMEAIGRLRTDCGGAAWGDVYL
FT                   AKCYARYSARGGHSRANGYGGNRNNNDDDEIEKTLAIIVGLIAGVTLLVVFLSFMAKSC
FT                   ERGKGGK"
FT   CDS_pept        complement(join(291148..291287,291773..292496))
FT                   /codon_start=1
FT                   /gene="PDLP6"
FT                   /gene_synonym="plasmodesmata-located protein 6"
FT                   /gene_synonym="T8O11.17"
FT                   /gene_synonym="T8O11_17"
FT                   /locus_tag="AT2G01660"
FT                   /product="plasmodesmata-located protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01660"
FT                   /db_xref="InterPro:IPR002902"
FT                   /db_xref="InterPro:IPR038408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178VYC5"
FT                   /protein_id="ANM62558.1"
FT                   /translation="MFATKTVLFIAVVSLLGTFSSAAVDTFIYGGCSQEKYFPGSPYES
FT                   NVNSLLTSFVSSASLYTYNNFTTNGISGDSSSVYGLYQCRGDLSSGSGDCARCVARAVS
FT                   RLGSLCAMASGGALQLEGCFVKYDNTTFLGVEDKTVVVRRCGPPVGYNSDEMTRRDSVV
FT                   GSLAASSGGSYRVGVSGELQGVAQCTGDLSATECQDCLMEAIGRLRTDCGGAAWGDVYL
FT                   AKCYARYSARGGHSRANGYGGNRNNNDDDEIEKTLAIIVGLIAGVTLLVVFLSFMAKSC
FT                   ERGKGK"
FT   CDS_pept        complement(291717..292496)
FT                   /codon_start=1
FT                   /gene="PDLP6"
FT                   /gene_synonym="plasmodesmata-located protein 6"
FT                   /gene_synonym="T8O11.17"
FT                   /gene_synonym="T8O11_17"
FT                   /locus_tag="AT2G01660"
FT                   /product="plasmodesmata-located protein 6"
FT                   /note="plasmodesmata-located protein 6 (PDLP6); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF26
FT                   (InterPro:IPR002902); BEST Arabidopsis thaliana protein
FT                   match is: plasmodesmata-located protein 7
FT                   (TAIR:AT5G37660.2); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01660"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01660.2"
FT                   /db_xref="GOA:Q9ZU94"
FT                   /db_xref="InterPro:IPR002902"
FT                   /db_xref="InterPro:IPR038408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU94"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR297651.1,INSD:DR297649.1,INSD:EL996548.1,
FT                   INSD:DR297650.1,INSD:AU226278.1,INSD:ES017197.1,
FT                   INSD:EL224162.1,INSD:BP657339.1,INSD:EL235840.1,
FT                   INSD:AV545548.1,INSD:BP827352.1,INSD:AV823917.1,
FT                   INSD:DR297648.1,INSD:BP840362.1,INSD:EL341790.1,
FT                   INSD:AV803942.1,INSD:BP648890.1,INSD:AV554304.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX820946.1"
FT                   /protein_id="AEC05481.1"
FT                   /translation="MFATKTVLFIAVVSLLGTFSSAAVDTFIYGGCSQEKYFPGSPYES
FT                   NVNSLLTSFVSSASLYTYNNFTTNGISGDSSSVYGLYQCRGDLSSGSGDCARCVARAVS
FT                   RLGSLCAMASGGALQLEGCFVKYDNTTFLGVEDKTVVVRRCGPPVGYNSDEMTRRDSVV
FT                   GSLAASSGGSYRVGVSGELQGVAQCTGDLSATECQDCLMEAIGRLRTDCGGAAWGDVYL
FT                   AKCYARYSARGGHSRANGYGNVFFAPLLFISFIKIFI"
FT   gene            295455..295556
FT                   /locus_tag="AT2G01667"
FT   mRNA            295455..295556
FT                   /locus_tag="AT2G01667"
FT                   /product="hypothetical protein"
FT   CDS_pept        295455..295556
FT                   /codon_start=1
FT                   /locus_tag="AT2G01667"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01667"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01667.1"
FT                   /db_xref="UniProtKB/TrEMBL:B3H619"
FT                   /protein_id="AEC05482.1"
FT                   /translation="MYFGMEATVESINDSGPSHRGRGHDSPPANGIV"
FT   gene            complement(296365..298215)
FT                   /gene="NUDT17"
FT                   /gene_synonym="atnudt17"
FT                   /gene_synonym="nudix hydrolase homolog 17"
FT                   /gene_synonym="T8O11.16"
FT                   /gene_synonym="T8O11_16"
FT                   /locus_tag="AT2G01670"
FT   mRNA            complement(join(296365..297032,297124..297252,
FT                   297347..297430,297526..297631,297733..298215))
FT                   /gene="NUDT17"
FT                   /gene_synonym="atnudt17"
FT                   /gene_synonym="nudix hydrolase homolog 17"
FT                   /gene_synonym="T8O11.16"
FT                   /gene_synonym="T8O11_16"
FT                   /locus_tag="AT2G01670"
FT                   /product="nudix hydrolase homolog 17"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL023033.1,INSD:DR264557.1,INSD:EG522898.1,
FT                   INSD:EL001887.1,INSD:EL123415.1,INSD:AV798764.1,
FT                   INSD:DR264554.1,INSD:EL096954.1,INSD:AA586299.1,
FT                   INSD:BP561292.2,INSD:EG522904.1,INSD:EG522883.1,
FT                   INSD:EH820495.1,INSD:EG522891.1,INSD:EL130800.1,
FT                   INSD:AV789523.1,INSD:DR264553.1,INSD:EL222351.1,
FT                   INSD:EL246932.1,INSD:EG522910.1,INSD:EH832994.1,
FT                   INSD:BP790151.1,INSD:EG522908.1,INSD:BP778777.1,
FT                   INSD:EL090963.1,INSD:EH798170.1,INSD:EH827175.1,
FT                   INSD:EH960342.1,INSD:EL113582.1,INSD:DR264555.1,
FT                   INSD:BP571547.1,INSD:AV547666.1,INSD:DR371341.1,
FT                   INSD:EL267983.1,INSD:DR264558.1,INSD:DR264559.1,
FT                   INSD:EL992994.1,INSD:EG522882.1,INSD:EH993804.1,
FT                   INSD:EL064877.1,INSD:AV827603.1,INSD:EL131663.1,
FT                   INSD:EG522909.1,INSD:DR264562.1,INSD:BP780568.1,
FT                   INSD:EH880933.1,INSD:EH900454.1,INSD:DR264561.1,
FT                   INSD:EL132479.1,INSD:EH851306.1,INSD:DR264560.1,
FT                   INSD:ES213263.1,INSD:EL283026.1,INSD:EG522890.1,
FT                   INSD:EL273222.1,INSD:EG522903.1,INSD:BP650660.1,
FT                   INSD:EL243195.1,INSD:CB260990.1,INSD:BP819761.1,
FT                   INSD:EG522893.1,INSD:EG522879.1,INSD:DR264556.1,
FT                   INSD:BP839817.1,INSD:EH868512.1,INSD:EG522899.1,
FT                   INSD:EL039171.1,INSD:EH810332.1,INSD:BP839438.1,
FT                   INSD:EG522877.1,INSD:AV787610.1,INSD:EL330314.1,
FT                   INSD:EL298638.1,INSD:EL147390.1,INSD:EH857336.1,
FT                   INSD:EG522902.1,INSD:EL229142.1,INSD:EG522892.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF412103.1,INSD:AY088595.1,INSD:BX819722.1,
FT                   INSD:AY051030.1,INSD:AF360131.1,INSD:AF325062.1"
FT   CDS_pept        complement(join(296889..297032,297124..297252,
FT                   297347..297430,297526..297631,297733..297818))
FT                   /codon_start=1
FT                   /gene="NUDT17"
FT                   /gene_synonym="atnudt17"
FT                   /gene_synonym="nudix hydrolase homolog 17"
FT                   /gene_synonym="T8O11.16"
FT                   /gene_synonym="T8O11_16"
FT                   /locus_tag="AT2G01670"
FT                   /product="nudix hydrolase homolog 17"
FT                   /note="nudix hydrolase homolog 17 (NUDT17); FUNCTIONS IN:
FT                   hydrolase activity; INVOLVED IN: biological_process
FT                   unknown; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: NUDIX
FT                   hydrolase domain-like (InterPro:IPR015797), NUDIX hydrolase
FT                   domain (InterPro:IPR000086); BEST Arabidopsis thaliana
FT                   protein match is: nudix hydrolase homolog 18
FT                   (TAIR:AT1G14860.1); Has 1036 Blast hits to 1035 proteins in
FT                   308 species: Archae - 0; Bacteria - 361; Metazoa - 217;
FT                   Fungi - 119; Plants - 237; Viruses - 0; Other Eukaryotes -
FT                   102 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01670.1"
FT                   /db_xref="GOA:Q9ZU95"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU95"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL023033.1,INSD:DR264557.1,INSD:EG522898.1,
FT                   INSD:EL001887.1,INSD:EL123415.1,INSD:AV798764.1,
FT                   INSD:DR264554.1,INSD:EL096954.1,INSD:AA586299.1,
FT                   INSD:BP561292.2,INSD:EG522904.1,INSD:EG522883.1,
FT                   INSD:EH820495.1,INSD:EG522891.1,INSD:EL130800.1,
FT                   INSD:AV789523.1,INSD:DR264553.1,INSD:EL222351.1,
FT                   INSD:EL246932.1,INSD:EG522910.1,INSD:EH832994.1,
FT                   INSD:BP790151.1,INSD:EG522908.1,INSD:BP778777.1,
FT                   INSD:EL090963.1,INSD:EH798170.1,INSD:EH827175.1,
FT                   INSD:EH960342.1,INSD:EL113582.1,INSD:DR264555.1,
FT                   INSD:BP571547.1,INSD:AV547666.1,INSD:DR371341.1,
FT                   INSD:EL267983.1,INSD:DR264558.1,INSD:DR264559.1,
FT                   INSD:EL992994.1,INSD:EG522882.1,INSD:EH993804.1,
FT                   INSD:EL064877.1,INSD:AV827603.1,INSD:EL131663.1,
FT                   INSD:EG522909.1,INSD:DR264562.1,INSD:BP780568.1,
FT                   INSD:EH880933.1,INSD:EH900454.1,INSD:DR264561.1,
FT                   INSD:EL132479.1,INSD:EH851306.1,INSD:DR264560.1,
FT                   INSD:ES213263.1,INSD:EL283026.1,INSD:EG522890.1,
FT                   INSD:EL273222.1,INSD:EG522903.1,INSD:BP650660.1,
FT                   INSD:EL243195.1,INSD:CB260990.1,INSD:BP819761.1,
FT                   INSD:EG522893.1,INSD:EG522879.1,INSD:DR264556.1,
FT                   INSD:BP839817.1,INSD:EH868512.1,INSD:EG522899.1,
FT                   INSD:EL039171.1,INSD:EH810332.1,INSD:BP839438.1,
FT                   INSD:EG522877.1,INSD:AV787610.1,INSD:EL330314.1,
FT                   INSD:EL298638.1,INSD:EL147390.1,INSD:EH857336.1,
FT                   INSD:EG522902.1,INSD:EL229142.1,INSD:EG522892.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF412103.1,INSD:AY088595.1,INSD:BX819722.1,
FT                   INSD:AY051030.1,INSD:AF360131.1,INSD:AF325062.1"
FT                   /protein_id="AEC05483.1"
FT                   /translation="MGVEKMVCLASRTGRQFQRYNKGRRQVVGCVPYRFKLSNDGKISD
FT                   EVEVLVISSQKGHALMFPKGGWELDESVEEAASRECLEEAGVLGNVEHQLGKWDFLSKS
FT                   RGTYYEGLMFPMLVTEQLELWPEQHVRQRIWMNVTEAREACRDWWMKEALDVLVERLSS
FT                   PMNQPKEEKTMSISIETMC"
FT   gene            306251..309267
FT                   /gene_synonym="T8O11.15"
FT                   /gene_synonym="T8O11_15"
FT                   /locus_tag="AT2G01680"
FT   mRNA            join(306251..306918,307056..307465,307561..309267)
FT                   /gene_synonym="T8O11.15"
FT                   /gene_synonym="T8O11_15"
FT                   /locus_tag="AT2G01680"
FT                   /product="Ankyrin repeat family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL257768.1,INSD:EH809045.1,INSD:EH887419.1,
FT                   INSD:BP865586.1,INSD:DR352761.1,INSD:EH922934.1,
FT                   INSD:ES046165.1,INSD:EL152085.1,INSD:DR199184.1,
FT                   INSD:ES104100.1,INSD:EH881446.1,INSD:DR199182.1,
FT                   INSD:EL123701.1,INSD:AV441879.1,INSD:EH870840.1,
FT                   INSD:ES127164.1,INSD:AV439689.1,INSD:AV823873.1,
FT                   INSD:EL172753.1,INSD:AV561448.1,INSD:CD530898.1,
FT                   INSD:BP596360.1,INSD:EH925493.1,INSD:DR352760.1,
FT                   INSD:AV558991.1,INSD:EH952514.1,INSD:AA728512.1,
FT                   INSD:DR352759.1,INSD:EH919211.1,INSD:AI996553.1,
FT                   INSD:AV557218.1,INSD:ES206135.1,INSD:R64963.1,
FT                   INSD:EL178523.1,INSD:EH866452.1,INSD:BP813134.1,
FT                   INSD:EL038103.1,INSD:DR199180.1,INSD:BP866101.1,
FT                   INSD:EL042489.1,INSD:DR352757.1,INSD:EH986505.1,
FT                   INSD:BP846822.1,INSD:DR199186.1,INSD:DR352756.1,
FT                   INSD:DR199187.1,INSD:EL224858.1,INSD:T43424.1,
FT                   INSD:EH848357.1,INSD:EG466371.1,INSD:AV784945.1,
FT                   INSD:CB259678.1,INSD:AI993199.1,INSD:AV787218.1,
FT                   INSD:T46195.1,INSD:DR352758.1,INSD:DR380302.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK226418.1,INSD:AK220719.1,INSD:AY084921.1"
FT   CDS_pept        join(306597..306918,307056..307465,307561..308427)
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.15"
FT                   /gene_synonym="T8O11_15"
FT                   /locus_tag="AT2G01680"
FT                   /product="Ankyrin repeat family protein"
FT                   /note="Ankyrin repeat family protein; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: plasma membrane;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Ankyrin
FT                   repeat-containing domain (InterPro:IPR020683), Ankyrin
FT                   repeat (InterPro:IPR002110); BEST Arabidopsis thaliana
FT                   protein match is: Ankyrin repeat family protein
FT                   (TAIR:AT2G31820.1); Has 36872 Blast hits to 17947 proteins
FT                   in 711 species: Archae - 48; Bacteria - 2509; Metazoa -
FT                   18623; Fungi - 3211; Plants - 2983; Viruses - 164; Other
FT                   Eukaryotes - 9334 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01680"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01680.1"
FT                   /db_xref="GOA:Q9ZU96"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR026961"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU96"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL257768.1,INSD:EH809045.1,INSD:EH887419.1,
FT                   INSD:BP865586.1,INSD:DR352761.1,INSD:EH922934.1,
FT                   INSD:ES046165.1,INSD:EL152085.1,INSD:DR199184.1,
FT                   INSD:ES104100.1,INSD:EH881446.1,INSD:DR199182.1,
FT                   INSD:EL123701.1,INSD:AV441879.1,INSD:EH870840.1,
FT                   INSD:ES127164.1,INSD:AV439689.1,INSD:AV823873.1,
FT                   INSD:EL172753.1,INSD:AV561448.1,INSD:CD530898.1,
FT                   INSD:BP596360.1,INSD:EH925493.1,INSD:DR352760.1,
FT                   INSD:AV558991.1,INSD:EH952514.1,INSD:AA728512.1,
FT                   INSD:DR352759.1,INSD:EH919211.1,INSD:AI996553.1,
FT                   INSD:AV557218.1,INSD:ES206135.1,INSD:R64963.1,
FT                   INSD:EL178523.1,INSD:EH866452.1,INSD:BP813134.1,
FT                   INSD:EL038103.1,INSD:DR199180.1,INSD:BP866101.1,
FT                   INSD:EL042489.1,INSD:DR352757.1,INSD:EH986505.1,
FT                   INSD:BP846822.1,INSD:DR199186.1,INSD:DR352756.1,
FT                   INSD:DR199187.1,INSD:EL224858.1,INSD:T43424.1,
FT                   INSD:EH848357.1,INSD:EG466371.1,INSD:AV784945.1,
FT                   INSD:CB259678.1,INSD:AI993199.1,INSD:AV787218.1,
FT                   INSD:T46195.1,INSD:DR352758.1,INSD:DR380302.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK226418.1,INSD:AK220719.1,INSD:AY084921.1"
FT                   /protein_id="AEC05484.1"
FT                   /translation="MEMKQMKFLTHQAFFSSVRSGDLSQLQQLVDNLTGDELIDESSPC
FT                   SAVAELMSVQNDAGETAVYISAAENLEDIFRYLIRFSSLETVKIRSKSDMNAFHVAAKR
FT                   GHLGIVKELLRLWPELCRICDASNTSPLYAAAVQDHLEIVNAMLDVDPSCAMIVRKNGK
FT                   TSLHTAGRYGLLRIVKALIEKDAAIVGVKDKKGQTALHMAVKGRSLEVVEEILQADYTI
FT                   LNERDRKGNTALHIATRKARPQITSLLLTFTAIEVNAINNQKETAMDLADKLQYSESAL
FT                   EINEALVEAGAKHGRFIGREDEARALKRAVSDIKHEVQSQLLQNEKTNRRVSGIAKELR
FT                   KLHREAVQNTTNSITVVAVLFASIAFLAIFNLPGQYFTEGSHVGQANIAGRTGFRVFCL
FT                   LNATSLFISLAVVVVQITLVAWDTRAQKKVVSVVNKLMWAACACTFGAFLAIAFAVVGK
FT                   GNSWMAITITLLGAPILVGTLASMCYFVFRQRFRSGNDSQRRIRRGSSKSFSWSYSHHV
FT                   SDFEDESDFEKIIAL"
FT   gene            complement(308693..313805)
FT                   /gene_synonym="T8O11.14"
FT                   /gene_synonym="T8O11_14"
FT                   /locus_tag="AT2G01690"
FT   mRNA            complement(join(308693..309308,309472..309759,
FT                   309861..309929,310009..310137,310225..310386,
FT                   310564..310684,310766..310881,311007..311072,
FT                   311164..311245,311332..311423,311515..311622,
FT                   311740..311826,311992..312086,312184..312326,
FT                   312421..312449,312533..312652,312738..312827,
FT                   313014..313079,313197..313310,313410..313805))
FT                   /gene_synonym="T8O11.14"
FT                   /gene_synonym="T8O11_14"
FT                   /locus_tag="AT2G01690"
FT                   /product="ARM repeat superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV523421.1,INSD:EL300672.1,INSD:ES131909.1,
FT                   INSD:BE524151.1,INSD:BP782635.1,INSD:BP791717.1,
FT                   INSD:EH923294.1,INSD:AV826331.1,INSD:ES150598.1,
FT                   INSD:AV565750.1,INSD:EH935277.1,INSD:BP825429.1,
FT                   INSD:BP605189.1,INSD:EH799878.1,INSD:BP779287.1,
FT                   INSD:EH871951.1,INSD:AV548309.1,INSD:EG525643.1,
FT                   INSD:ES058430.1,INSD:EL001203.1,INSD:AV810768.1,
FT                   INSD:ES207052.1,INSD:AV795875.1,INSD:AV523475.1,
FT                   INSD:BP638946.1,INSD:EL014876.1,INSD:ES052702.1,
FT                   INSD:ES208105.1,INSD:EL993573.1,INSD:EL205158.1,
FT                   INSD:EL323105.1,INSD:ES091590.1,INSD:ES021353.1,
FT                   INSD:AA586280.1,INSD:AV560054.1,INSD:T20984.1,
FT                   INSD:ES108246.1,INSD:BP817129.1,INSD:BP780650.1,
FT                   INSD:AV790861.1,INSD:ES193167.1,INSD:AV529159.1,
FT                   INSD:BX841436.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY080803.1,INSD:AK226840.1,INSD:AY056142.1"
FT   mRNA            complement(join(308702..309308,309472..309759,
FT                   309861..309929,310009..310137,310225..310386,
FT                   310564..310684,310766..310881,311007..311072,
FT                   311164..311245,311332..311423,311515..311622,
FT                   311740..311826,311992..312086,312184..312326,
FT                   312421..312452,312533..312652,312738..312827,
FT                   313014..313079,313197..313310,313410..313805))
FT                   /gene_synonym="T8O11.14"
FT                   /gene_synonym="T8O11_14"
FT                   /locus_tag="AT2G01690"
FT                   /product="ARM repeat superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV523421.1,INSD:EL300672.1,INSD:ES131909.1,
FT                   INSD:BE524151.1,INSD:BP782635.1,INSD:BP791717.1,
FT                   INSD:EH923294.1,INSD:AV826331.1,INSD:ES150598.1,
FT                   INSD:AV565750.1,INSD:EH935277.1,INSD:BP825429.1,
FT                   INSD:BP605189.1,INSD:EH799878.1,INSD:BP779287.1,
FT                   INSD:EH871951.1,INSD:AV548309.1,INSD:ES058430.1,
FT                   INSD:EL001203.1,INSD:ES207052.1,INSD:AV810768.1,
FT                   INSD:AV795875.1,INSD:AV523475.1,INSD:BP638946.1,
FT                   INSD:EL014876.1,INSD:ES052702.1,INSD:ES208105.1,
FT                   INSD:EL993573.1,INSD:EL205158.1,INSD:EL323105.1,
FT                   INSD:ES091590.1,INSD:ES021353.1,INSD:AA586280.1,
FT                   INSD:AV560054.1,INSD:T20984.1,INSD:ES108246.1,
FT                   INSD:BP817129.1,INSD:BP780650.1,INSD:AV790861.1,
FT                   INSD:ES193167.1,INSD:AV529159.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY080803.1,INSD:AK226840.1"
FT   CDS_pept        complement(join(309144..309308,309472..309759,
FT                   309861..309929,310009..310137,310225..310386,
FT                   310564..310684,310766..310881,311007..311072,
FT                   311164..311245,311332..311423,311515..311622,
FT                   311740..311826,311992..312086,312184..312326,
FT                   312421..312449,312533..312652,312738..312827,
FT                   313014..313079,313197..313310,313410..313499))
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.14"
FT                   /gene_synonym="T8O11_14"
FT                   /locus_tag="AT2G01690"
FT                   /product="ARM repeat superfamily protein"
FT                   /note="ARM repeat superfamily protein; FUNCTIONS IN:
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: plasma membrane; EXPRESSED IN: 25 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: HEAT (InterPro:IPR000357), Armadillo-like helical
FT                   (InterPro:IPR011989), Protein of unknown function DUF3434
FT                   (InterPro:IPR021841), HEAT, type 2 (InterPro:IPR021133),
FT                   Armadillo-type fold (InterPro:IPR016024); Has 6269 Blast
FT                   hits to 4446 proteins in 336 species: Archae - 2; Bacteria
FT                   - 171; Metazoa - 2181; Fungi - 947; Plants - 235; Viruses -
FT                   11; Other Eukaryotes - 2722 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9ZU97"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR021841"
FT                   /db_xref="InterPro:IPR026825"
FT                   /db_xref="InterPro:IPR032878"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZU97"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV523421.1,INSD:EL300672.1,INSD:ES131909.1,
FT                   INSD:BE524151.1,INSD:BP782635.1,INSD:BP791717.1,
FT                   INSD:EH923294.1,INSD:AV826331.1,INSD:ES150598.1,
FT                   INSD:AV565750.1,INSD:EH935277.1,INSD:BP825429.1,
FT                   INSD:BP605189.1,INSD:EH799878.1,INSD:BP779287.1,
FT                   INSD:EH871951.1,INSD:AV548309.1,INSD:EG525643.1,
FT                   INSD:ES058430.1,INSD:EL001203.1,INSD:AV810768.1,
FT                   INSD:ES207052.1,INSD:AV795875.1,INSD:AV523475.1,
FT                   INSD:BP638946.1,INSD:EL014876.1,INSD:ES052702.1,
FT                   INSD:ES208105.1,INSD:EL993573.1,INSD:EL205158.1,
FT                   INSD:EL323105.1,INSD:ES091590.1,INSD:ES021353.1,
FT                   INSD:AA586280.1,INSD:AV560054.1,INSD:T20984.1,
FT                   INSD:ES108246.1,INSD:BP817129.1,INSD:BP780650.1,
FT                   INSD:AV790861.1,INSD:ES193167.1,INSD:AV529159.1,
FT                   INSD:BX841436.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY080803.1,INSD:AK226840.1,INSD:AY056142.1"
FT                   /protein_id="AEC05485.1"
FT                   /translation="MSDALSAIPAAVHRNLSDKLYEKRKNAALELENIVKNLTSSGDHD
FT                   KISKVIEMLIKEFAKSPQANHRKGGLIGLAAVTVGLSTEAAQYLEQIVPPVINSFSDQD
FT                   SRVRYYACEALYNIAKVVRGDFIIFFNKIFDALCKLSADSDANVQSAAHLLDRLVKDIV
FT                   TESDQFSIEEFIPLLKERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNM
FT                   LSDSSHEIRQQADSALSEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAITWINE
FT                   FVKLGGDQLVRYYADILGAILPCISDKEEKIRVVARETNEELRSIHVEPSDGFDVGAIL
FT                   SVARRQLSSEFEATRIEALNWISTLLNKHRTEVLCFLNDIFDTLLKALSDSSDDVVLLV
FT                   LEVHAGVAKDPQHFRQLIVFLVHNFRADNSLLERRGALIVRRMCVLLDAERVYRELSTI
FT                   LEGEDNLDFASTMVQALNLILLTSPELSKLRELLKGSLVNREGKELFVALYTSWCHSPM
FT                   AIISLCLLAQAYQHASVVIQSLVEEDINVKFLVQLDKLIRLLETPIFTYLRLQLLEPGR
FT                   YTWLLKTLYGLLMLLPQQSAAFKILRTRLKTVPTYSFSTGNQIGRATSGVPFSQYKHQN
FT                   EDGDLEDDNINSSHQGINFAVRLQQFENVQNLHRGQARTRVNYSYHSSSSSTSKEVRRS
FT                   EEQQQQQQQQQQQQQQQQRPPPSSTSSSVADNNRPPSRTSRKGPGQLQL"
FT   CDS_pept        complement(join(309144..309308,309472..309759,
FT                   309861..309929,310009..310137,310225..310386,
FT                   310564..310684,310766..310881,311007..311072,
FT                   311164..311245,311332..311423,311515..311622,
FT                   311740..311826,311992..312086,312184..312326,
FT                   312421..312452,312533..312652,312738..312827,
FT                   313014..313079,313197..313310,313410..313499))
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.14"
FT                   /gene_synonym="T8O11_14"
FT                   /locus_tag="AT2G01690"
FT                   /product="ARM repeat superfamily protein"
FT                   /note="ARM repeat superfamily protein; FUNCTIONS IN:
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: plasma membrane; EXPRESSED IN: 25 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: HEAT (InterPro:IPR000357), Armadillo-like helical
FT                   (InterPro:IPR011989), Protein of unknown function DUF3434
FT                   (InterPro:IPR021841), HEAT, type 2 (InterPro:IPR021133),
FT                   Armadillo-type fold (InterPro:IPR016024); Has 35333 Blast
FT                   hits to 34131 proteins in 2444 species: Archae - 798;
FT                   Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531;
FT                   Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01690"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01690.2"
FT                   /db_xref="GOA:F4IPA6"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR021841"
FT                   /db_xref="InterPro:IPR026825"
FT                   /db_xref="InterPro:IPR032878"
FT                   /db_xref="UniProtKB/TrEMBL:F4IPA6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV523421.1,INSD:EL300672.1,INSD:ES131909.1,
FT                   INSD:BE524151.1,INSD:BP782635.1,INSD:BP791717.1,
FT                   INSD:EH923294.1,INSD:AV826331.1,INSD:ES150598.1,
FT                   INSD:AV565750.1,INSD:EH935277.1,INSD:BP825429.1,
FT                   INSD:BP605189.1,INSD:EH799878.1,INSD:BP779287.1,
FT                   INSD:EH871951.1,INSD:AV548309.1,INSD:ES058430.1,
FT                   INSD:EL001203.1,INSD:ES207052.1,INSD:AV810768.1,
FT                   INSD:AV795875.1,INSD:AV523475.1,INSD:BP638946.1,
FT                   INSD:EL014876.1,INSD:ES052702.1,INSD:ES208105.1,
FT                   INSD:EL993573.1,INSD:EL205158.1,INSD:EL323105.1,
FT                   INSD:ES091590.1,INSD:ES021353.1,INSD:AA586280.1,
FT                   INSD:AV560054.1,INSD:T20984.1,INSD:ES108246.1,
FT                   INSD:BP817129.1,INSD:BP780650.1,INSD:AV790861.1,
FT                   INSD:ES193167.1,INSD:AV529159.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY080803.1,INSD:AK226840.1"
FT                   /protein_id="AEC05486.1"
FT                   /translation="MSDALSAIPAAVHRNLSDKLYEKRKNAALELENIVKNLTSSGDHD
FT                   KISKVIEMLIKEFAKSPQANHRKGGLIGLAAVTVGLSTEAAQYLEQIVPPVINSFSDQD
FT                   SRVRYYACEALYNIAKVVRGDFIIFFNKIFDALCKLSADSDANVQSAAHLLDRLVKQDI
FT                   VTESDQFSIEEFIPLLKERMNVLNPYVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFN
FT                   MLSDSSHEIRQQADSALSEFLQEIKNSPSVDYGRMAEILVQRAASPDEFTRLTAITWIN
FT                   EFVKLGGDQLVRYYADILGAILPCISDKEEKIRVVARETNEELRSIHVEPSDGFDVGAI
FT                   LSVARRQLSSEFEATRIEALNWISTLLNKHRTEVLCFLNDIFDTLLKALSDSSDDVVLL
FT                   VLEVHAGVAKDPQHFRQLIVFLVHNFRADNSLLERRGALIVRRMCVLLDAERVYRELST
FT                   ILEGEDNLDFASTMVQALNLILLTSPELSKLRELLKGSLVNREGKELFVALYTSWCHSP
FT                   MAIISLCLLAQAYQHASVVIQSLVEEDINVKFLVQLDKLIRLLETPIFTYLRLQLLEPG
FT                   RYTWLLKTLYGLLMLLPQQSAAFKILRTRLKTVPTYSFSTGNQIGRATSGVPFSQYKHQ
FT                   NEDGDLEDDNINSSHQGINFAVRLQQFENVQNLHRGQARTRVNYSYHSSSSSTSKEVRR
FT                   SEEQQQQQQQQQQQQQQQQRPPPSSTSSSVADNNRPPSRTSRKGPGQLQL"
FT   gene            complement(314844..315158)
FT                   /pseudo
FT                   /gene_synonym="T8O11.13"
FT                   /gene_synonym="T8O11_13"
FT                   /locus_tag="AT2G01700"
FT   mRNA            complement(<314844..>315158)
FT                   /pseudo
FT                   /gene_synonym="T8O11.13"
FT                   /gene_synonym="T8O11_13"
FT                   /locus_tag="AT2G01700"
FT                   /product="hypothetical protein"
FT   gene            315648..316993
FT                   /gene_synonym="T8O11.12"
FT                   /gene_synonym="T8O11_12"
FT                   /locus_tag="AT2G01710"
FT   mRNA            315648..316993
FT                   /gene_synonym="T8O11.12"
FT                   /gene_synonym="T8O11_12"
FT                   /locus_tag="AT2G01710"
FT                   /product="Chaperone DnaJ-domain superfamily protein"
FT   CDS_pept        315704..316771
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.12"
FT                   /gene_synonym="T8O11_12"
FT                   /locus_tag="AT2G01710"
FT                   /product="Chaperone DnaJ-domain superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01710"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B2U5"
FT                   /protein_id="ANM63225.1"
FT                   /translation="MLLFFFPRPFLHTANQSLVSSSLVEAIIFRSAHHFSAIADGRRKM
FT                   GDNNPNRSEAERLLGIAEKLLESRDLNGSKEFAILAQETEPLLEGTDQILAVVDVLLSS
FT                   APENRIKNQPNWYKILQIEDLTESSTDNDLIKKQYRRLALLLHPDKNRFPFADQAFRFV
FT                   LDAWEVLSTPTKKSQFDGDLNLIFTKVNLNTQKSKKKTTTNEKMSTFWTACPYCYSLHE
FT                   YPRVYQEYCIRCQNCQRAFHAASIPQLPPLIPGKDEYYCCWGFFPMGFVGGKGGEAAIA
FT                   NGVDAAKFPNWMPPVFSSGGVAAPPSGNGVSFDGWSGGAAKRDNEAVRSNNGVGVNSDG
FT                   TPKKRGRGRPKKNPV"
FT   mRNA            315712..316993
FT                   /gene_synonym="T8O11.12"
FT                   /gene_synonym="T8O11_12"
FT                   /locus_tag="AT2G01710"
FT                   /product="Chaperone DnaJ-domain superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL254229.1,INSD:EL991484.1,INSD:Z17511.1,
FT                   INSD:EH798726.1,INSD:AV566075.1,INSD:EH879403.1,
FT                   INSD:EL322522.1,INSD:AV522251.1,INSD:EH827186.1,
FT                   INSD:AI995302.1,INSD:ES066237.1,INSD:EG528254.1,
FT                   INSD:EL006107.1,INSD:ES182777.1,INSD:AV522252.1,
FT                   INSD:EG528281.1,INSD:EL217739.1,INSD:EL121895.1,
FT                   INSD:EL338883.1,INSD:BP567641.1,INSD:BE845353.1,
FT                   INSD:DR193061.1,INSD:DR193059.1,INSD:ES199727.1,
FT                   INSD:EH889164.1,INSD:EL262892.1,INSD:DR193062.1,
FT                   INSD:EH919059.1,INSD:DR193060.1,INSD:EG439613.1,
FT                   INSD:BP810428.1,INSD:ES058175.1,INSD:EH834885.1,
FT                   INSD:EG518512.1,INSD:BP615176.1,INSD:DR373956.1,
FT                   INSD:EH833155.1,INSD:AV788141.1,INSD:DR372997.1,
FT                   INSD:AV563900.1,INSD:EH846901.1,INSD:EH927186.1,
FT                   INSD:EH838199.1,INSD:BP868091.1,INSD:BP571454.1,
FT                   INSD:EG439612.1,INSD:EL308287.1,INSD:EH849390.1,
FT                   INSD:AV526978.1,INSD:EL309394.1,INSD:EL042094.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY085868.1,INSD:AJ276763.1,INSD:AY052228.1,
FT                   INSD:AY139811.1"
FT   CDS_pept        315836..316771
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.12"
FT                   /gene_synonym="T8O11_12"
FT                   /locus_tag="AT2G01710"
FT                   /product="Chaperone DnaJ-domain superfamily protein"
FT                   /note="Chaperone DnaJ-domain superfamily protein; FUNCTIONS
FT                   IN: unfolded protein binding, heat shock protein binding;
FT                   INVOLVED IN: protein folding; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Molecular chaperone, heat shock protein,
FT                   Hsp40, DnaJ (InterPro:IPR015609), Heat shock protein DnaJ,
FT                   N-terminal (InterPro:IPR001623), Heat shock protein DnaJ
FT                   (InterPro:IPR003095); BEST Arabidopsis thaliana protein
FT                   match is: Chaperone DnaJ-domain superfamily protein
FT                   (TAIR:AT5G64360.1); Has 8537 Blast hits to 8496 proteins in
FT                   1861 species: Archae - 67; Bacteria - 3520; Metazoa - 1920;
FT                   Fungi - 549; Plants - 1113; Viruses - 8; Other Eukaryotes -
FT                   1360 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01710.1"
FT                   /db_xref="GOA:Q9ZU99"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZU99"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL254229.1,INSD:EL991484.1,INSD:Z17511.1,
FT                   INSD:EH798726.1,INSD:AV566075.1,INSD:EH879403.1,
FT                   INSD:EL322522.1,INSD:AV522251.1,INSD:EH827186.1,
FT                   INSD:AI995302.1,INSD:ES066237.1,INSD:EG528254.1,
FT                   INSD:EL006107.1,INSD:ES182777.1,INSD:AV522252.1,
FT                   INSD:EG528281.1,INSD:EL217739.1,INSD:EL121895.1,
FT                   INSD:EL338883.1,INSD:BP567641.1,INSD:BE845353.1,
FT                   INSD:DR193061.1,INSD:DR193059.1,INSD:ES199727.1,
FT                   INSD:EH889164.1,INSD:EL262892.1,INSD:DR193062.1,
FT                   INSD:EH919059.1,INSD:DR193060.1,INSD:EG439613.1,
FT                   INSD:BP810428.1,INSD:ES058175.1,INSD:EH834885.1,
FT                   INSD:EG518512.1,INSD:BP615176.1,INSD:DR373956.1,
FT                   INSD:EH833155.1,INSD:AV788141.1,INSD:DR372997.1,
FT                   INSD:AV563900.1,INSD:EH846901.1,INSD:EH927186.1,
FT                   INSD:EH838199.1,INSD:BP868091.1,INSD:BP571454.1,
FT                   INSD:EG439612.1,INSD:EL308287.1,INSD:EH849390.1,
FT                   INSD:AV526978.1,INSD:EL309394.1,INSD:EL042094.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY085868.1,INSD:AJ276763.1,INSD:AY052228.1,
FT                   INSD:AY139811.1"
FT                   /protein_id="AEC05487.1"
FT                   /translation="MGDNNPNRSEAERLLGIAEKLLESRDLNGSKEFAILAQETEPLLE
FT                   GTDQILAVVDVLLSSAPENRIKNQPNWYKILQIEDLTESSTDNDLIKKQYRRLALLLHP
FT                   DKNRFPFADQAFRFVLDAWEVLSTPTKKSQFDGDLNLIFTKVNLNTQKSKKKTTTNEKM
FT                   STFWTACPYCYSLHEYPRVYQEYCIRCQNCQRAFHAASIPQLPPLIPGKDEYYCCWGFF
FT                   PMGFVGGKGGEAAIANGVDAAKFPNWMPPVFSSGGVAAPPSGNGVSFDGWSGGAAKRDN
FT                   EAVRSNNGVGVNSDGTPKKRGRGRPKKNPV"
FT   gene            complement(317030..320308)
FT                   /gene_synonym="T8O11.11"
FT                   /gene_synonym="T8O11_11"
FT                   /locus_tag="AT2G01720"
FT   mRNA            complement(join(317030..317318,317524..317613,
FT                   317701..317769,317856..318035,318185..318332,
FT                   318611..319242,319531..319575,319912..320024,
FT                   320112..320308))
FT                   /gene_synonym="T8O11.11"
FT                   /gene_synonym="T8O11_11"
FT                   /locus_tag="AT2G01720"
FT                   /product="Ribophorin I"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL002655.1,INSD:ES174632.1,INSD:AV822938.1,
FT                   INSD:ES151180.1,INSD:ES205659.1,INSD:ES112391.1,
FT                   INSD:EH849546.1,INSD:ES204377.1,INSD:ES205711.1,
FT                   INSD:BP611123.1,INSD:DR367976.1,INSD:EH984614.1,
FT                   INSD:ES116010.1,INSD:EH895597.1,INSD:BP819538.1,
FT                   INSD:EG478160.1,INSD:EL981167.1,INSD:EL122975.1,
FT                   INSD:AV541135.1,INSD:ES144135.1,INSD:BP645957.1,
FT                   INSD:EL975103.1,INSD:ES055903.1,INSD:ES128069.1,
FT                   INSD:EH903484.1,INSD:BP610859.1,INSD:EH985267.1,
FT                   INSD:EG505035.1,INSD:EH957047.1,INSD:EH935618.1,
FT                   INSD:EL120931.1,INSD:EH886744.1,INSD:BE524466.1,
FT                   INSD:AV811631.1,INSD:BP574693.1,INSD:DR367972.1,
FT                   INSD:EH948492.1,INSD:EL210484.1,INSD:ES203802.1,
FT                   INSD:EH937183.1,INSD:ES179571.1,INSD:ES037583.1,
FT                   INSD:EG478159.1,INSD:EH884377.1,INSD:EL989369.1,
FT                   INSD:EL979474.1,INSD:BP610115.1,INSD:EL277333.1,
FT                   INSD:EL113590.1,INSD:BP603082.1,INSD:ES062439.1,
FT                   INSD:EH921365.1,INSD:AI996175.1,INSD:AV567346.1,
FT                   INSD:T42928.1,INSD:ES177367.1,INSD:AV534511.1,
FT                   INSD:EL181802.1,INSD:EH858598.1,INSD:EL295552.1,
FT                   INSD:ES135897.1,INSD:BP798951.1,INSD:DR367974.1,
FT                   INSD:ES166845.1,INSD:EL274140.1,INSD:EL210338.1,
FT                   INSD:DR367975.1,INSD:AV556779.1,INSD:BP592422.1,
FT                   INSD:EL162660.1,INSD:DR367968.1,INSD:ES051148.1,
FT                   INSD:ES215195.1,INSD:BP570480.1,INSD:EL053416.1,
FT                   INSD:EH902732.1,INSD:ES186416.1,INSD:BP797641.1,
FT                   INSD:BP603109.1,INSD:ES177660.1,INSD:BX840713.1,
FT                   INSD:EL089176.1,INSD:EL061308.1,INSD:AV551932.1,
FT                   INSD:EL249666.1,INSD:ES128188.1,INSD:DR367969.1,
FT                   INSD:AV563598.1,INSD:EL127941.1,INSD:EL129419.1,
FT                   INSD:DR367973.1,INSD:ES161598.1,INSD:EL286327.1,
FT                   INSD:EH880768.1,INSD:EH893832.1,INSD:BP613967.1,
FT                   INSD:AV783815.1,INSD:ES145832.1,INSD:EL980349.1,
FT                   INSD:DR383180.1,INSD:BE526223.1,INSD:ES176925.1,
FT                   INSD:DR367970.1,INSD:AV532181.1,INSD:DR367971.1,
FT                   INSD:EH826684.1,INSD:BP804652.1,INSD:ES165925.1,
FT                   INSD:EL313580.1,INSD:EL146077.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820297.1,INSD:BX820629.1,INSD:BX819793.1,
FT                   INSD:BX820534.1,INSD:BT022017.1,INSD:AK226319.1"
FT   CDS_pept        complement(join(317193..317318,317524..317613,
FT                   317701..317769,317856..318035,318185..318332,
FT                   318611..319242,319531..319575,319912..320016))
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.11"
FT                   /gene_synonym="T8O11_11"
FT                   /locus_tag="AT2G01720"
FT                   /product="Ribophorin I"
FT                   /note="Ribophorin I; FUNCTIONS IN: oligosaccharyl
FT                   transferase activity,
FT                   dolichyl-diphosphooligosaccharide-protein glycotransferase
FT                   activity; INVOLVED IN: protein amino acid glycosylation;
FT                   LOCATED IN: endoplasmic reticulum, plasma membrane,
FT                   plant-type cell wall; EXPRESSED IN: 25 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Ribophorin I (InterPro:IPR007676); BEST
FT                   Arabidopsis thaliana protein match is: Ribophorin I
FT                   (TAIR:AT1G76400.1); Has 386 Blast hits to 386 proteins in
FT                   178 species: Archae - 0; Bacteria - 0; Metazoa - 143; Fungi
FT                   - 127; Plants - 63; Viruses - 0; Other Eukaryotes - 53
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01720"
FT                   /db_xref="GOA:Q9ZUA0"
FT                   /db_xref="InterPro:IPR007676"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZUA0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL002655.1,INSD:ES174632.1,INSD:AV822938.1,
FT                   INSD:ES151180.1,INSD:ES205659.1,INSD:ES112391.1,
FT                   INSD:EH849546.1,INSD:ES204377.1,INSD:ES205711.1,
FT                   INSD:BP611123.1,INSD:DR367976.1,INSD:EH984614.1,
FT                   INSD:ES116010.1,INSD:EH895597.1,INSD:BP819538.1,
FT                   INSD:EG478160.1,INSD:EL981167.1,INSD:EL122975.1,
FT                   INSD:AV541135.1,INSD:ES144135.1,INSD:BP645957.1,
FT                   INSD:EL975103.1,INSD:ES055903.1,INSD:ES128069.1,
FT                   INSD:EH903484.1,INSD:BP610859.1,INSD:EH985267.1,
FT                   INSD:EG505035.1,INSD:EH957047.1,INSD:EH935618.1,
FT                   INSD:EL120931.1,INSD:EH886744.1,INSD:BE524466.1,
FT                   INSD:AV811631.1,INSD:BP574693.1,INSD:DR367972.1,
FT                   INSD:EH948492.1,INSD:EL210484.1,INSD:ES203802.1,
FT                   INSD:EH937183.1,INSD:ES179571.1,INSD:ES037583.1,
FT                   INSD:EG478159.1,INSD:EH884377.1,INSD:EL989369.1,
FT                   INSD:EL979474.1,INSD:BP610115.1,INSD:EL277333.1,
FT                   INSD:EL113590.1,INSD:BP603082.1,INSD:ES062439.1,
FT                   INSD:EH921365.1,INSD:AI996175.1,INSD:AV567346.1,
FT                   INSD:T42928.1,INSD:ES177367.1,INSD:AV534511.1,
FT                   INSD:EL181802.1,INSD:EH858598.1,INSD:EL295552.1,
FT                   INSD:ES135897.1,INSD:BP798951.1,INSD:DR367974.1,
FT                   INSD:ES166845.1,INSD:EL274140.1,INSD:EL210338.1,
FT                   INSD:DR367975.1,INSD:AV556779.1,INSD:BP592422.1,
FT                   INSD:EL162660.1,INSD:DR367968.1,INSD:ES051148.1,
FT                   INSD:ES215195.1,INSD:BP570480.1,INSD:EL053416.1,
FT                   INSD:EH902732.1,INSD:ES186416.1,INSD:BP797641.1,
FT                   INSD:BP603109.1,INSD:ES177660.1,INSD:BX840713.1,
FT                   INSD:EL089176.1,INSD:EL061308.1,INSD:AV551932.1,
FT                   INSD:EL249666.1,INSD:ES128188.1,INSD:DR367969.1,
FT                   INSD:AV563598.1,INSD:EL127941.1,INSD:EL129419.1,
FT                   INSD:DR367973.1,INSD:ES161598.1,INSD:EL286327.1,
FT                   INSD:EH880768.1,INSD:EH893832.1,INSD:BP613967.1,
FT                   INSD:AV783815.1,INSD:ES145832.1,INSD:EL980349.1,
FT                   INSD:DR383180.1,INSD:BE526223.1,INSD:ES176925.1,
FT                   INSD:DR367970.1,INSD:AV532181.1,INSD:DR367971.1,
FT                   INSD:EH826684.1,INSD:BP804652.1,INSD:ES165925.1,
FT                   INSD:EL313580.1,INSD:EL146077.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX820297.1,INSD:BX820629.1,INSD:BX819793.1,
FT                   INSD:BX820534.1,INSD:BT022017.1,INSD:AK226319.1"
FT                   /protein_id="AEC05488.1"
FT                   /translation="MAARIGIFSVFVAVLLSISAFSSAQDLQIVNAERRIDLSSHIVKA
FT                   FLTLKVENIGKDPAAEMLLAFPPTQIKNLAMVQALATTGKKKKKTYLPLDVKPTEQPDA
FT                   PNDTGYYRVTFISPLGPGETVSLEVLYILTHSLEPFPVEITQSESQLVYYHDSAVILSP
FT                   YHVKQQTTFIKTPSTRVESFTSIEPANRAGKEIKYGPYENRASYSYTPVIIHFENNSPF
FT                   AVVEELVREIEISHWGSLQITENYRLTHGGARHKGVFSRVDYQSKRSVSGASSFNALLA
FT                   VLPPRVNSVYYRDEIGNISTSHLRTGFRKSELEFEPRYPLFGGWSATFIIGYRVPLEDY
FT                   LFEASDGRRYLNFTFGCPLVETIVNKLTIKVVLPEGSKDPSAVLPFTVNQELQVKYSYL
FT                   DIVGRTVVVLQKDNVVPTHNVPFQVYYTFKPIYMLAEPFMLVSAFFLVFVASLAYVHID
FT                   LNIVRK"
FT   gene            320433..323963
FT                   /gene="CPSF73-II"
FT                   /gene_synonym="ATCPSF73-II"
FT                   /gene_synonym="cleavage and polyadenylation specificity
FT                   factor 73 kDa subunit-II"
FT                   /gene_synonym="CLEAVAGE AND POLYADENYLATION SPECIFICITY
FT                   FACTOR 73 KDA SUBUNIT-II"
FT                   /gene_synonym="EDA26"
FT                   /gene_synonym="embryo sac development arrest 26"
FT                   /gene_synonym="T8O11.10"
FT                   /gene_synonym="T8O11_10"
FT                   /locus_tag="AT2G01730"
FT                   /note="a homolog of cleavage and polyadenylation
FT                   specificity factor that plays an essential role in the
FT                   development of female gametophyte and embryo"
FT   mRNA            join(320433..320621,320720..321056,321157..321274,
FT                   321371..321444,321541..321677,321773..321836,
FT                   322005..322070,322161..322230,322373..322477,
FT                   322681..322822,322934..323030,323153..323963)
FT                   /gene="CPSF73-II"
FT                   /gene_synonym="ATCPSF73-II"
FT                   /gene_synonym="cleavage and polyadenylation specificity
FT                   factor 73 kDa subunit-II"
FT                   /gene_synonym="CLEAVAGE AND POLYADENYLATION SPECIFICITY
FT                   FACTOR 73 KDA SUBUNIT-II"
FT                   /gene_synonym="EDA26"
FT                   /gene_synonym="embryo sac development arrest 26"
FT                   /gene_synonym="T8O11.10"
FT                   /gene_synonym="T8O11_10"
FT                   /locus_tag="AT2G01730"
FT                   /product="cleavage and polyadenylation specificity factor
FT                   73 kDa subunit-II"
FT   mRNA            join(320433..320621,320720..320897,320984..321056,
FT                   321157..321274,321371..321444,321541..321677,
FT                   321773..321836,322005..322070,322161..322230,
FT                   322373..322477,322681..322822,322934..323030,
FT                   323153..323963)
FT                   /gene="CPSF73-II"
FT                   /gene_synonym="ATCPSF73-II"
FT                   /gene_synonym="cleavage and polyadenylation specificity
FT                   factor 73 kDa subunit-II"
FT                   /gene_synonym="CLEAVAGE AND POLYADENYLATION SPECIFICITY
FT                   FACTOR 73 KDA SUBUNIT-II"
FT                   /gene_synonym="EDA26"
FT                   /gene_synonym="embryo sac development arrest 26"
FT                   /gene_synonym="T8O11.10"
FT                   /gene_synonym="T8O11_10"
FT                   /locus_tag="AT2G01730"
FT                   /product="cleavage and polyadenylation specificity factor
FT                   73 kDa subunit-II"
FT                   /inference="similar to RNA sequence, EST:INSD:BP781870.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY168923.1,INSD:AK221561.1"
FT   CDS_pept        join(320597..320621,320720..320897,320984..321056,
FT                   321157..321274,321371..321444,321541..321677,
FT                   321773..321836,322005..322070,322161..322230,
FT                   322373..322477,322681..322822,322934..323030,
FT                   323153..323845)
FT                   /codon_start=1
FT                   /gene="CPSF73-II"
FT                   /gene_synonym="ATCPSF73-II"
FT                   /gene_synonym="cleavage and polyadenylation specificity
FT                   factor 73 kDa subunit-II"
FT                   /gene_synonym="CLEAVAGE AND POLYADENYLATION SPECIFICITY
FT                   FACTOR 73 KDA SUBUNIT-II"
FT                   /gene_synonym="EDA26"
FT                   /gene_synonym="embryo sac development arrest 26"
FT                   /gene_synonym="T8O11.10"
FT                   /gene_synonym="T8O11_10"
FT                   /locus_tag="AT2G01730"
FT                   /product="cleavage and polyadenylation specificity factor
FT                   73 kDa subunit-II"
FT                   /note="cleavage and polyadenylation specificity factor 73
FT                   kDa subunit-II (CPSF73-II); CONTAINS InterPro DOMAIN/s:
FT                   RNA-metabolising metallo-beta-lactamase
FT                   (InterPro:IPR011108), Beta-Casp domain
FT                   (InterPro:IPR022712), Beta-lactamase-like
FT                   (InterPro:IPR001279); BEST Arabidopsis thaliana protein
FT                   match is: cleavage and polyadenylation specificity factor
FT                   73-I (TAIR:AT1G61010.3); Has 5072 Blast hits to 5039
FT                   proteins in 1435 species: Archae - 491; Bacteria - 2753;
FT                   Metazoa - 569; Fungi - 259; Plants - 193; Viruses - 0;
FT                   Other Eukaryotes - 807 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8GUU3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041897"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GUU3"
FT                   /inference="similar to RNA sequence, EST:INSD:BP781870.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY168923.1,INSD:AK221561.1"
FT                   /protein_id="AEC05489.1"
FT                   /translation="MAIDCLVLGAGQEIGKSCVVVTINGKKIMFDCGMHMGCDDHNRYP
FT                   NFSLISKSGDFDNAISCIIITHFHMDHVGALPYFTEVCGYNGPIYMSYPTKALSPLMLE
FT                   DYRRVMVDRRGEEELFTTTHIANCMKKVIAIDLKQTIQVDEDLQIRAYYAGHVLGAVMV
FT                   YAKMGDAAIVYTGDYNMTTDRHLGAAKIDRLQLDLLISESTYATTIRGSKYPREREFLQ
FT                   AVHKCVAGGGKALIPSFALGRAQELCMLLDDYWERMNIKVPIYFSSGLTIQANMYYKML
FT                   ISWTSQNVKEKHNTHNPFDFKNVKDFDRSLIHAPGPCVLFATPGMLCAGFSLEVFKHWA
FT                   PSPLNLVALPGYSVAGTVGHKLMAGKPTTVDLYNGTKVDVRCKVHQVAFSPHTDAKGIM
FT                   DLTKFLSPKNVVLVHGEKPSMMILKEKITSELDIPCFVPANGETVSFASTTYIKANASD
FT                   MFLKSCSNPNFKFSNSTQLRVTDHRTADGVLVIEKSKKAKIVHQDEISEVLHEKNHVVS
FT                   LAHCCPVKVKGESEDDDVDLIKQLSAKILKTVSGAQIHESENCLQVASFKGSLCLKDKC
FT                   MHRSSSSSSEAVFLCCNWSIADLELGWEIINAIKLNH"
FT   CDS_pept        join(320988..321056,321157..321274,321371..321444,
FT                   321541..321677,321773..321836,322005..322070,
FT                   322161..322230,322373..322477,322681..322822,
FT                   322934..323030,323153..323845)
FT                   /codon_start=1
FT                   /gene="CPSF73-II"
FT                   /gene_synonym="ATCPSF73-II"
FT                   /gene_synonym="cleavage and polyadenylation specificity
FT                   factor 73 kDa subunit-II"
FT                   /gene_synonym="CLEAVAGE AND POLYADENYLATION SPECIFICITY
FT                   FACTOR 73 KDA SUBUNIT-II"
FT                   /gene_synonym="EDA26"
FT                   /gene_synonym="embryo sac development arrest 26"
FT                   /gene_synonym="T8O11.10"
FT                   /gene_synonym="T8O11_10"
FT                   /locus_tag="AT2G01730"
FT                   /product="cleavage and polyadenylation specificity factor
FT                   73 kDa subunit-II"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01730"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B2N2"
FT                   /protein_id="ANM63148.1"
FT                   /translation="MDHVGALPYFTEVCGYNGPIYMSYPTKALSPLMLEDYRRVMVDRR
FT                   GEEELFTTTHIANCMKKVIAIDLKQTIQVDEDLQIRAYYAGHVLGAVMVYAKMGDAAIV
FT                   YTGDYNMTTDRHLGAAKIDRLQLDLLISESTYATTIRGSKYPREREFLQAVHKCVAGGG
FT                   KALIPSFALGRAQELCMLLDDYWERMNIKVPIYFSSGLTIQANMYYKMLISWTSQNVKE
FT                   KHNTHNPFDFKNVKDFDRSLIHAPGPCVLFATPGMLCAGFSLEVFKHWAPSPLNLVALP
FT                   GYSVAGTVGHKLMAGKPTTVDLYNGTKVDVRCKVHQVAFSPHTDAKGIMDLTKFLSPKN
FT                   VVLVHGEKPSMMILKEKITSELDIPCFVPANGETVSFASTTYIKANASDMFLKSCSNPN
FT                   FKFSNSTQLRVTDHRTADGVLVIEKSKKAKIVHQDEISEVLHEKNHVVSLAHCCPVKVK
FT                   GESEDDDVDLIKQLSAKILKTVSGAQIHESENCLQVASFKGSLCLKDKCMHRSSSSSSE
FT                   AVFLCCNWSIADLELGWEIINAIKLNH"
FT   gene            324365..326094
FT                   /gene="RIE1"
FT                   /gene_synonym="RING-finger protein for embryogenesis"
FT                   /locus_tag="AT2G01735"
FT                   /note="encodes a RING-H2 zinc finger protein essential for
FT                   seed development."
FT   mRNA            join(324365..325001,325071..325190,325265..325636,
FT                   325731..326094)
FT                   /gene="RIE1"
FT                   /gene_synonym="RING-finger protein for embryogenesis"
FT                   /locus_tag="AT2G01735"
FT                   /product="RING-finger protein for embryogenesi"
FT   mRNA            join(324365..325001,325071..325190,325265..325397,
FT                   325478..325636,325731..326094)
FT                   /gene="RIE1"
FT                   /gene_synonym="RING-finger protein for embryogenesis"
FT                   /locus_tag="AT2G01735"
FT                   /product="RING-finger protein for embryogenesi"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU226128.1,INSD:BX836564.1,INSD:BP582909.1,
FT                   INSD:ES098846.1,INSD:BP799808.1,INSD:BP800407.1,
FT                   INSD:BP577241.1,INSD:BP797753.1,INSD:BP803937.1,
FT                   INSD:DR363463.1,INSD:EL285040.1,INSD:EH888508.1,
FT                   INSD:DR363462.1,INSD:EG494820.1,INSD:BP783353.1,
FT                   INSD:EL994402.1,INSD:BP577064.1,INSD:AV555346.1,
FT                   INSD:EL100577.1,INSD:EH811939.1,INSD:CD534642.1,
FT                   INSD:EH919817.1,INSD:BX835615.1,INSD:ES189311.1,
FT                   INSD:AU235430.1,INSD:EL028745.1,INSD:EH948816.1,
FT                   INSD:EH839494.1,INSD:BP597210.1,INSD:EG494821.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY168924.1"
FT   CDS_pept        join(324499..325001,325071..325190,325265..325397,
FT                   325478..325636,325731..325895)
FT                   /codon_start=1
FT                   /gene="RIE1"
FT                   /gene_synonym="RING-finger protein for embryogenesis"
FT                   /locus_tag="AT2G01735"
FT                   /product="RING-finger protein for embryogenesi"
FT                   /note="RING-finger protein for embryogenesis (RIE1);
FT                   FUNCTIONS IN: zinc ion binding; LOCATED IN: chloroplast;
FT                   EXPRESSED IN: 14 plant structures; EXPRESSED DURING: 4
FT                   anthesis, C globular stage, petal differentiation and
FT                   expansion stage, E expanded cotyledon stage, D bilateral
FT                   stage; CONTAINS InterPro DOMAIN/s: Zinc finger, RING-type
FT                   (InterPro:IPR001841), Zinc finger, C3HC4 RING-type
FT                   (InterPro:IPR018957); BEST Arabidopsis thaliana protein
FT                   match is: Zinc finger, C3HC4 type (RING finger) family
FT                   protein (TAIR:AT1G68070.1); Has 9688 Blast hits to 9662
FT                   proteins in 283 species: Archae - 0; Bacteria - 6; Metazoa
FT                   - 2533; Fungi - 743; Plants - 5052; Viruses - 40; Other
FT                   Eukaryotes - 1314 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01735"
FT                   /db_xref="GOA:Q8GUU2"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GUU2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU226128.1,INSD:BX836564.1,INSD:BP582909.1,
FT                   INSD:ES098846.1,INSD:BP799808.1,INSD:BP800407.1,
FT                   INSD:BP577241.1,INSD:BP797753.1,INSD:BP803937.1,
FT                   INSD:DR363463.1,INSD:EL285040.1,INSD:EH888508.1,
FT                   INSD:DR363462.1,INSD:EG494820.1,INSD:BP783353.1,
FT                   INSD:EL994402.1,INSD:BP577064.1,INSD:AV555346.1,
FT                   INSD:EL100577.1,INSD:EH811939.1,INSD:CD534642.1,
FT                   INSD:EH919817.1,INSD:BX835615.1,INSD:ES189311.1,
FT                   INSD:AU235430.1,INSD:EL028745.1,INSD:EH948816.1,
FT                   INSD:EH839494.1,INSD:BP597210.1,INSD:EG494821.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY168924.1"
FT                   /protein_id="AEC05490.1"
FT                   /translation="MSSYSSDSTAARDQHAPLLRPRHDGSFSSSSSSARPTALAVLLGR
FT                   ITGHRAPSMLVRETAARALEERRIDWGYSKPVVAADILWNAALVLASAVMLVGTVEERP
FT                   NEPIRVWICVYGLQCLFHVVLVWSEYWRRNSTRRARDLESYDHEDYNIEYDYEQDSDDN
FT                   STTYSFVKRCESINTVISFIWWIIGFYWVVEGGDKLLGEAPNLYWLSVIFLAIDVFFAV
FT                   FCVVLACLVGIALCCCLPCIIALLYAVAGTEGVSEAELGVLPLYKFKAFHSNEKNITGP
FT                   GKMVPIPINGLCLATERTLLAEDADCCICLSSYEDGAELHALPCNHHFHSTCIVKWLKM
FT                   RATCPLCKYNILKGTTDQS"
FT   CDS_pept        join(324499..325001,325071..325190,325265..325403)
FT                   /codon_start=1
FT                   /gene="RIE1"
FT                   /gene_synonym="RING-finger protein for embryogenesis"
FT                   /locus_tag="AT2G01735"
FT                   /product="RING-finger protein for embryogenesi"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01735"
FT                   /db_xref="GOA:A0A1P8B2L5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B2L5"
FT                   /protein_id="ANM63149.1"
FT                   /translation="MSSYSSDSTAARDQHAPLLRPRHDGSFSSSSSSARPTALAVLLGR
FT                   ITGHRAPSMLVRETAARALEERRIDWGYSKPVVAADILWNAALVLASAVMLVGTVEERP
FT                   NEPIRVWICVYGLQCLFHVVLVWSEYWRRNSTRRARDLESYDHEDYNIEYDYEQDSDDN
FT                   STTYSFVKRCESINTVISFIWWIIGFYWVVEGGDKLLGEAPNLYWLSVIFLAIDVFFAV
FT                   FCVVLACLVGIALCCCLPCIIALLYAVAGTV"
FT   gene            complement(326136..327875)
FT                   /gene_synonym="T8O11.9"
FT                   /gene_synonym="T8O11_9"
FT                   /locus_tag="AT2G01740"
FT   mRNA            complement(326136..327875)
FT                   /gene_synonym="T8O11.9"
FT                   /gene_synonym="T8O11_9"
FT                   /locus_tag="AT2G01740"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX839445.1,INSD:ES196935.1,INSD:BX836564.1,
FT                   INSD:EG494820.1,INSD:BX835615.1,INSD:EG494821.1"
FT   CDS_pept        complement(326136..327815)
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.9"
FT                   /gene_synonym="T8O11_9"
FT                   /locus_tag="AT2G01740"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /note="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein; CONTAINS InterPro DOMAIN/s: Pentatricopeptide
FT                   repeat (InterPro:IPR002885); BEST Arabidopsis thaliana
FT                   protein match is: Tetratricopeptide repeat (TPR)-like
FT                   superfamily protein (TAIR:AT2G02150.1); Has 57588 Blast
FT                   hits to 14618 proteins in 307 species: Archae - 5; Bacteria
FT                   - 72; Metazoa - 670; Fungi - 805; Plants - 54302; Viruses -
FT                   0; Other Eukaryotes - 1734 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01740"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01740.1"
FT                   /db_xref="GOA:Q9ZUA2"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZUA2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX839445.1,INSD:ES196935.1,INSD:BX836564.1,
FT                   INSD:EG494820.1,INSD:BX835615.1,INSD:EG494821.1"
FT                   /protein_id="AEC05491.1"
FT                   /translation="MVREALQFLSRLRKSSNLPDPFTCNKHIHQLINSNCGILSLKFLA
FT                   YLVSRGYTPHRSSFNSVVSFVCKLGQVKFAEDIVHSMPRFGCEPDVISYNSLIDGHCRN
FT                   GDIRSASLVLESLRASHGFICKPDIVSFNSLFNGFSKMKMLDEVFVYMGVMLKCCSPNV
FT                   VTYSTWIDTFCKSGELQLALKSFHSMKRDALSPNVVTFTCLIDGYCKAGDLEVAVSLYK
FT                   EMRRVRMSLNVVTYTALIDGFCKKGEMQRAEEMYSRMVEDRVEPNSLVYTTIIDGFFQR
FT                   GDSDNAMKFLAKMLNQGMRLDITAYGVIISGLCGNGKLKEATEIVEDMEKSDLVPDMVI
FT                   FTTMMNAYFKSGRMKAAVNMYHKLIERGFEPDVVALSTMIDGIAKNGQLHEAIVYFCIE
FT                   KANDVMYTVLIDALCKEGDFIEVERLFSKISEAGLVPDKFMYTSWIAGLCKQGNLVDAF
FT                   KLKTRMVQEGLLLDLLAYTTLIYGLASKGLMVEARQVFDEMLNSGISPDSAVFDLLIRA
FT                   YEKEGNMAAASDLLLDMQRRGLVTAVSDADCSKQCGNEVNCS"
FT   gene            328025..332872
FT                   /gene="MAP70-3"
FT                   /gene_synonym="ATMAP70-3"
FT                   /gene_synonym="microtubule-associated proteins 70-3"
FT                   /gene_synonym="T8O11.8"
FT                   /gene_synonym="T8O11_8"
FT                   /locus_tag="AT2G01750"
FT                   /note="Encodes a microtubule associated protein (MAP70-3).
FT                   Expressed in all tissues."
FT   mRNA            join(328025..328234,328316..328612,328783..328868,
FT                   329491..329556,329649..329819,329918..330088,
FT                   330188..330343,330452..330598,330723..330794,
FT                   330891..331415,331509..331702,331809..332872)
FT                   /gene="MAP70-3"
FT                   /gene_synonym="ATMAP70-3"
FT                   /gene_synonym="microtubule-associated proteins 70-3"
FT                   /gene_synonym="T8O11.8"
FT                   /gene_synonym="T8O11_8"
FT                   /locus_tag="AT2G01750"
FT                   /product="microtubule-associated proteins 70-3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES155961.1,INSD:ES025260.1,INSD:AV562273.1,
FT                   INSD:AV556892.1,INSD:ES027603.1,INSD:ES019340.1,
FT                   INSD:BE530552.1,INSD:EG528190.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AM086440.1"
FT   mRNA            join(328089..328234,328316..328612,328783..328868,
FT                   329491..329556,329649..329819,329918..330088,
FT                   330188..330343,330452..330598,330723..330794,
FT                   330891..331415,331509..331702,331806..332113)
FT                   /gene="MAP70-3"
FT                   /gene_synonym="ATMAP70-3"
FT                   /gene_synonym="microtubule-associated proteins 70-3"
FT                   /gene_synonym="T8O11.8"
FT                   /gene_synonym="T8O11_8"
FT                   /locus_tag="AT2G01750"
FT                   /product="microtubule-associated proteins 70-3"
FT   CDS_pept        join(328351..328612,328783..328868,329491..329556,
FT                   329649..329819,329918..330088,330188..330343,
FT                   330452..330598,330723..330794,330891..331415,
FT                   331509..331702,331806..331848)
FT                   /codon_start=1
FT                   /gene="MAP70-3"
FT                   /gene_synonym="ATMAP70-3"
FT                   /gene_synonym="microtubule-associated proteins 70-3"
FT                   /gene_synonym="T8O11.8"
FT                   /gene_synonym="T8O11_8"
FT                   /locus_tag="AT2G01750"
FT                   /product="microtubule-associated proteins 70-3"
FT                   /note="microtubule-associated proteins 70-3 (MAP70-3);
FT                   FUNCTIONS IN: microtubule binding; INVOLVED IN:
FT                   cytoskeleton organization; LOCATED IN: microtubule;
FT                   EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 9
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Myosin II heavy
FT                   chain-like (InterPro:IPR009768); BEST Arabidopsis thaliana
FT                   protein match is: microtubule-associated proteins 70-4
FT                   (TAIR:AT1G14840.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01750"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01750.2"
FT                   /db_xref="GOA:F4IPB2"
FT                   /db_xref="InterPro:IPR009768"
FT                   /db_xref="UniProtKB/TrEMBL:F4IPB2"
FT                   /protein_id="AEC05493.1"
FT                   /translation="MEEGGYAFEVNNGRPTASEFGTTARISSPSLTMSSSFREGGGGGG
FT                   SKGLTRRRSMKPSFDADNEFITLLHGSDPVKVELNRLENDVRDKDRELSESQAEIKALR
FT                   LSERQREKAVEELTEELGKMSEKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAEATL
FT                   RRVHAAQKDDDMPPIEAILAPLEAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAER
FT                   TVQSALAKASMVDDLQNKNQELMKQIEICQEENRILDKLHRQKVAEVEKFTQTVRELEE
FT                   AVLAGGTAANAVRDYQRKFQEMNEERRILDRELARAKVSASRVATVVANEWKDGSDKVM
FT                   PVKQWLEERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFQLRLRVLEESLRGPSSSGN
FT                   RSTPEGRSMSNGPSRRQSLGGADIIPKLTSNGFFSKRSPSSQFRSLNASTSTILKHAKG
FT                   TSRSFDGGSRSLDRSKVLTNEPRSKFPLNQSSEGTSGGGSPNSTKQGDSEKAAGTNNDS
FT                   VPGVLHDLLQKEVITLRKAANDKDQSLRDKDEAIEMLAKKVETLTKAMEVEAKKMRREV
FT                   AAMEKEVSAMRVDNKGSDSRTRRHSTNSKGASTTAQLLSGSRGSGRMGMTRSTQ"
FT   CDS_pept        join(328351..328612,328783..328868,329491..329556,
FT                   329649..329819,329918..330088,330188..330343,
FT                   330452..330598,330723..330794,330891..331415,
FT                   331509..331702,331809..331848)
FT                   /codon_start=1
FT                   /gene="MAP70-3"
FT                   /gene_synonym="ATMAP70-3"
FT                   /gene_synonym="microtubule-associated proteins 70-3"
FT                   /gene_synonym="T8O11.8"
FT                   /gene_synonym="T8O11_8"
FT                   /locus_tag="AT2G01750"
FT                   /product="microtubule-associated proteins 70-3"
FT                   /note="microtubule-associated proteins 70-3 (MAP70-3);
FT                   FUNCTIONS IN: microtubule binding; INVOLVED IN:
FT                   cytoskeleton organization; LOCATED IN: microtubule, plasma
FT                   membrane; EXPRESSED IN: 17 plant structures; EXPRESSED
FT                   DURING: 9 growth stages; CONTAINS InterPro DOMAIN/s: Myosin
FT                   II heavy chain-like (InterPro:IPR009768); BEST Arabidopsis
FT                   thaliana protein match is: microtubule-associated proteins
FT                   70-4 (TAIR:AT1G14840.1); Has 32985 Blast hits to 20590
FT                   proteins in 1788 species: Archae - 429; Bacteria - 4222;
FT                   Metazoa - 17320; Fungi - 2752; Plants - 1806; Viruses -
FT                   150; Other Eukaryotes - 6306 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9ZUA3"
FT                   /db_xref="InterPro:IPR009768"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZUA3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES155961.1,INSD:ES025260.1,INSD:AV562273.1,
FT                   INSD:AV556892.1,INSD:ES027603.1,INSD:ES019340.1,
FT                   INSD:BE530552.1,INSD:EG528190.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AM086440.1"
FT                   /protein_id="AEC05492.1"
FT                   /translation="MEEGGYAFEVNNGRPTASEFGTTARISSPSLTMSSSFREGGGGGG
FT                   SKGLTRRRSMKPSFDADNEFITLLHGSDPVKVELNRLENDVRDKDRELSESQAEIKALR
FT                   LSERQREKAVEELTEELGKMSEKLKLTENLLDSKNLEIKKINEEKRASMAAQFAAEATL
FT                   RRVHAAQKDDDMPPIEAILAPLEAELKLARHEIVKLQDDNRALDRLTKSKEAALLDAER
FT                   TVQSALAKASMVDDLQNKNQELMKQIEICQEENRILDKLHRQKVAEVEKFTQTVRELEE
FT                   AVLAGGTAANAVRDYQRKFQEMNEERRILDRELARAKVSASRVATVVANEWKDGSDKVM
FT                   PVKQWLEERRFLQGEMQQLRDKLAIADRAAKSEAQLKEKFQLRLRVLEESLRGPSSSGN
FT                   RSTPEGRSMSNGPSRRQSLGGADIIPKLTSNGFFSKRSPSSQFRSLNASTSTILKHAKG
FT                   TSRSFDGGSRSLDRSKVLTNEPRSKFPLNQSSEGTSGGGSPNSTKQGDSEKAAGTNNDS
FT                   VPGVLHDLLQKEVITLRKAANDKDQSLRDKDEAIEMLAKKVETLTKAMEVEAKKMRREV
FT                   AAMEKEVSAMRVDNKGSDSRTRRHSTNSKGASTTAQLLSGRGSGRMGMTRSTQ"
FT   gene            complement(332188..332808)
FT                   /locus_tag="AT2G01755"
FT   mRNA            complement(332188..332808)
FT                   /locus_tag="AT2G01755"
FT                   /product="hypothetical protein"
FT   mRNA            complement(332194..332781)
FT                   /locus_tag="AT2G01755"
FT                   /product="hypothetical protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH820512.1,INSD:EL087193.1,INSD:EH831197.1,
FT                   INSD:EH841169.1,INSD:DR352199.1,INSD:BU634620.1,
FT                   INSD:BP812818.1,INSD:DR370095.1,INSD:EL208683.1,
FT                   INSD:EL250024.1,INSD:EH802200.1,INSD:EL279548.1,
FT                   INSD:EL177338.1,INSD:DR352198.1,INSD:DR352197.1,
FT                   INSD:EL059645.1,INSD:EL186900.1,INSD:EL230915.1,
FT                   INSD:EH949663.1,INSD:EH875024.1,INSD:EL217622.1,
FT                   INSD:EL259902.1,INSD:DR352196.1,INSD:EL076157.1,
FT                   INSD:EL115660.1,INSD:EL096303.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT011729.1,INSD:AK220713.1"
FT   CDS_pept        complement(332249..332788)
FT                   /codon_start=1
FT                   /locus_tag="AT2G01755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01755"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AX61"
FT                   /protein_id="ANM61223.1"
FT                   /translation="MHYNIRMLITPANLSGGIAGLFVFGQKDQMTKIPSLTNSYNYRKK
FT                   LFTVPPVAERRRALKMFWCGARRRVRDEGGGEDEDEMYGYNEEMAMLEIYSQSCREEAL
FT                   IVTAIVDDEEVEVVIFKGVSSCLSGETAVDPARSVLPERAVITKIDRVRGPFDPSQIHY
FT                   IQRDISFQAFKETRLN"
FT   CDS_pept        complement(332249..332770)
FT                   /codon_start=1
FT                   /locus_tag="AT2G01755"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: chloroplast; Has 120 Blast hits to 120 proteins in 52
FT                   species: Archae - 0; Bacteria - 80; Metazoa - 0; Fungi - 0;
FT                   Plants - 24; Viruses - 0; Other Eukaryotes - 16 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01755"
FT                   /db_xref="GOA:Q570J5"
FT                   /db_xref="UniProtKB/TrEMBL:Q570J5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH820512.1,INSD:EL087193.1,INSD:EH831197.1,
FT                   INSD:EH841169.1,INSD:DR352199.1,INSD:BU634620.1,
FT                   INSD:BP812818.1,INSD:DR370095.1,INSD:EL208683.1,
FT                   INSD:EL250024.1,INSD:EH802200.1,INSD:EL279548.1,
FT                   INSD:EL177338.1,INSD:DR352198.1,INSD:DR352197.1,
FT                   INSD:EL059645.1,INSD:EL186900.1,INSD:EL230915.1,
FT                   INSD:EH949663.1,INSD:EH875024.1,INSD:EL217622.1,
FT                   INSD:EL259902.1,INSD:DR352196.1,INSD:EL076157.1,
FT                   INSD:EL115660.1,INSD:EL096303.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT011729.1,INSD:AK220713.1"
FT                   /protein_id="AEC05494.1"
FT                   /translation="MLITPANLSGGIAGLFVFGQKDQMTKIPSLTNSYNYRKKLFTVPP
FT                   VAERRRALKMFWCGARRRVRDEGGGEDEDEMYGYNEEMAMLEIYSQSCREEALIVTAIV
FT                   DDEEVEVVIFKGVSSCLSGETAVDPARSVLPERAVITKIDRVRGPFDPSQIHYIQRDIS
FT                   FQAFKETRLN"
FT   gene            332902..334760
FT                   /gene="RR14"
FT                   /gene_synonym="ARR14"
FT                   /gene_synonym="response regulator 14"
FT                   /gene_synonym="T8O11.7"
FT                   /gene_synonym="T8O11_7"
FT                   /locus_tag="AT2G01760"
FT                   /note="member of Response Regulator: B- Type"
FT   mRNA            join(332902..333389,333468..333872,333956..334032,
FT                   334113..334696)
FT                   /gene="RR14"
FT                   /gene_synonym="ARR14"
FT                   /gene_synonym="response regulator 14"
FT                   /gene_synonym="T8O11.7"
FT                   /gene_synonym="T8O11_7"
FT                   /locus_tag="AT2G01760"
FT                   /product="response regulator 14"
FT   mRNA            join(332917..333149,333234..333389,333468..333872,
FT                   333956..334032,334113..334760)
FT                   /gene="RR14"
FT                   /gene_synonym="ARR14"
FT                   /gene_synonym="response regulator 14"
FT                   /gene_synonym="T8O11.7"
FT                   /gene_synonym="T8O11_7"
FT                   /locus_tag="AT2G01760"
FT                   /product="response regulator 14"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES210552.1,INSD:DR246968.1,INSD:AV814098.1,
FT                   INSD:DR246970.1,INSD:EL073162.1,INSD:ES106972.1,
FT                   INSD:DR246969.1,INSD:DR246967.1,INSD:DR246971.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY128887.1,INSD:BX821876.1,INSD:AY099726.1,
FT                   INSD:AY088149.1"
FT   CDS_pept        join(333041..333389,333468..333872,333956..334032,
FT                   334113..334514)
FT                   /codon_start=1
FT                   /gene="RR14"
FT                   /gene_synonym="ARR14"
FT                   /gene_synonym="response regulator 14"
FT                   /gene_synonym="T8O11.7"
FT                   /gene_synonym="T8O11_7"
FT                   /locus_tag="AT2G01760"
FT                   /product="response regulator 14"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01760"
FT                   /db_xref="GOA:A0A1P8AZZ3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR017053"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AZZ3"
FT                   /protein_id="ANM62227.1"
FT                   /translation="MPINDQFPSGLRILVVDDDTSCLFILEKMLLRLMYQGLILYQSSH
FT                   LLIDFLKKVLTFLFYLLFVVTICSQADVALTILRERKDSFDLVLSDVHMPGMNGYNLLQ
FT                   QVGLLEMDLPVIMMSVDGRTTTVMTGINHGACDYLIKPIRPEELKNIWQHVVRRKCVMK
FT                   KELRSSQALEDNKNSGSLETVVVSVSECSEESLMKCRNKKKKKKRSVDRDDNEDDLLLD
FT                   PGNSKKSRVVWSIELHQQFVNAVNKLGIDKAVPKRILELMNVPGLSRENVASHLQKFRL
FT                   YLKRLSGEASQSNDSESTKRYENIQALVSSGQLHPQTLAALFGQPIDNHHSASFGVWIP
FT                   NDNLGRSQNEHFSVDVSSASNRPVSVAVHGLSSSANFRQRGDVNNNRIRQGYGSNVNEE
FT                   SWILERSSRQR"
FT   CDS_pept        join(333041..333149,333234..333389,333468..333872,
FT                   333956..334032,334113..334514)
FT                   /codon_start=1
FT                   /gene="RR14"
FT                   /gene_synonym="ARR14"
FT                   /gene_synonym="response regulator 14"
FT                   /gene_synonym="T8O11.7"
FT                   /gene_synonym="T8O11_7"
FT                   /locus_tag="AT2G01760"
FT                   /product="response regulator 14"
FT                   /note="response regulator 14 (RR14); CONTAINS InterPro
FT                   DOMAIN/s: Response regulator, plant B-type
FT                   (InterPro:IPR017053), Myb-like DNA-binding domain, SHAQKYF
FT                   class (InterPro:IPR006447), CheY-like (InterPro:IPR011006),
FT                   Homeodomain-like (InterPro:IPR009057), Myb, DNA-binding
FT                   (InterPro:IPR014778), Signal transduction response
FT                   regulator, receiver domain (InterPro:IPR001789),
FT                   Homeodomain-related (InterPro:IPR012287), HTH
FT                   transcriptional regulator, Myb-type, DNA-binding
FT                   (InterPro:IPR017930); BEST Arabidopsis thaliana protein
FT                   match is: response regulator 2 (TAIR:AT4G16110.1); Has
FT                   95871 Blast hits to 95103 proteins in 2981 species: Archae
FT                   - 533; Bacteria - 85361; Metazoa - 37; Fungi - 351; Plants
FT                   - 2714; Viruses - 3; Other Eukaryotes - 6872 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01760.1"
FT                   /db_xref="GOA:Q8L9Y3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR017053"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L9Y3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES210552.1,INSD:DR246968.1,INSD:AV814098.1,
FT                   INSD:DR246970.1,INSD:EL073162.1,INSD:ES106972.1,
FT                   INSD:DR246969.1,INSD:DR246967.1,INSD:DR246971.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY128887.1,INSD:BX821876.1,INSD:AY099726.1,
FT                   INSD:AY088149.1"
FT                   /protein_id="AEC05495.1"
FT                   /translation="MPINDQFPSGLRILVVDDDTSCLFILEKMLLRLMYQVTICSQADV
FT                   ALTILRERKDSFDLVLSDVHMPGMNGYNLLQQVGLLEMDLPVIMMSVDGRTTTVMTGIN
FT                   HGACDYLIKPIRPEELKNIWQHVVRRKCVMKKELRSSQALEDNKNSGSLETVVVSVSEC
FT                   SEESLMKCRNKKKKKKRSVDRDDNEDDLLLDPGNSKKSRVVWSIELHQQFVNAVNKLGI
FT                   DKAVPKRILELMNVPGLSRENVASHLQKFRLYLKRLSGEASQSNDSESTKRYENIQALV
FT                   SSGQLHPQTLAALFGQPIDNHHSASFGVWIPNDNLGRSQNEHFSVDVSSASNRPVSVAV
FT                   HGLSSSANFRQRGDVNNNRIRQGYGSNVNEESWILERSSRQR"
FT   mRNA            join(333213..333389,333468..333872,333956..334032,
FT                   334113..334706)
FT                   /gene="RR14"
FT                   /gene_synonym="ARR14"
FT                   /gene_synonym="response regulator 14"
FT                   /gene_synonym="T8O11.7"
FT                   /gene_synonym="T8O11_7"
FT                   /locus_tag="AT2G01760"
FT                   /product="response regulator 14"
FT   CDS_pept        join(333320..333389,333468..333872,333956..334032,
FT                   334113..334514)
FT                   /codon_start=1
FT                   /gene="RR14"
FT                   /gene_synonym="ARR14"
FT                   /gene_synonym="response regulator 14"
FT                   /gene_synonym="T8O11.7"
FT                   /gene_synonym="T8O11_7"
FT                   /locus_tag="AT2G01760"
FT                   /product="response regulator 14"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01760"
FT                   /db_xref="GOA:A0A1P8B023"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B023"
FT                   /protein_id="ANM62226.1"
FT                   /translation="MPGMNGYNLLQQVGLLEMDLPVIMMSVDGRTTTVMTGINHGACDY
FT                   LIKPIRPEELKNIWQHVVRRKCVMKKELRSSQALEDNKNSGSLETVVVSVSECSEESLM
FT                   KCRNKKKKKKRSVDRDDNEDDLLLDPGNSKKSRVVWSIELHQQFVNAVNKLGIDKAVPK
FT                   RILELMNVPGLSRENVASHLQKFRLYLKRLSGEASQSNDSESTKRYENIQALVSSGQLH
FT                   PQTLAALFGQPIDNHHSASFGVWIPNDNLGRSQNEHFSVDVSSASNRPVSVAVHGLSSS
FT                   ANFRQRGDVNNNRIRQGYGSNVNEESWILERSSRQR"
FT   gene            complement(334663..336462)
FT                   /gene="VIT1"
FT                   /gene_synonym="ATVIT1"
FT                   /gene_synonym="T8O11.6"
FT                   /gene_synonym="T8O11_6"
FT                   /gene_synonym="vacuolar iron transporter 1"
FT                   /locus_tag="AT2G01770"
FT                   /note="Encodes an iron transporter required for iron
FT                   sequestration into vacuoles. Expressed in developing embryo
FT                   and seed. Localized in the vacuolar membrane."
FT   mRNA            complement(join(334663..335072,335448..335562,
FT                   335654..335739,336172..336462))
FT                   /gene="VIT1"
FT                   /gene_synonym="ATVIT1"
FT                   /gene_synonym="T8O11.6"
FT                   /gene_synonym="T8O11_6"
FT                   /gene_synonym="vacuolar iron transporter 1"
FT                   /locus_tag="AT2G01770"
FT                   /product="vacuolar iron transporter 1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT028987.1,INSD:AY316134.1"
FT   CDS_pept        complement(join(334775..335072,335448..335562,
FT                   335654..335739,336172..336425))
FT                   /codon_start=1
FT                   /gene="VIT1"
FT                   /gene_synonym="ATVIT1"
FT                   /gene_synonym="T8O11.6"
FT                   /gene_synonym="T8O11_6"
FT                   /gene_synonym="vacuolar iron transporter 1"
FT                   /locus_tag="AT2G01770"
FT                   /product="vacuolar iron transporter 1"
FT                   /note="vacuolar iron transporter 1 (VIT1); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF125,
FT                   transmembrane (InterPro:IPR008217); Has 1947 Blast hits to
FT                   1945 proteins in 688 species: Archae - 106; Bacteria -
FT                   1196; Metazoa - 0; Fungi - 163; Plants - 191; Viruses - 0;
FT                   Other Eukaryotes - 291 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01770"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01770.1"
FT                   /db_xref="GOA:Q9ZUA5"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZUA5"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT028987.1,INSD:AY316134.1"
FT                   /protein_id="AEC05496.1"
FT                   /translation="MSSEEDKITRISIEPEKQTLLDHHTEKHFTAGEIVRDIIIGVSDG
FT                   LTVPFALAAGLSGANASSSIVLTAGIAEVAAGAISMGLGGYLAAKSEEDHYAREMKREQ
FT                   EEIVAVPETEAAEVAEILAQYGIEPHEYSPVVNALRKNPQAWLDFMMRFELGLEKPDPK
FT                   RALQSAFTIAIAYVLGGFIPLLPYMLIPHAMDAVVASVVITLFALFIFGYAKGHFTGSK
FT                   PLRSAFETAFIGAIASAAAFCLAKVVQH"
FT   gene            complement(338024..339871)
FT                   /gene_synonym="T8O11.5"
FT                   /gene_synonym="T8O11_5"
FT                   /locus_tag="AT2G01780"
FT   mRNA            complement(join(338024..338229,338293..338364,
FT                   338398..338512,339354..339635,339719..339871))
FT                   /gene_synonym="T8O11.5"
FT                   /gene_synonym="T8O11_5"
FT                   /locus_tag="AT2G01780"
FT                   /product="Curculin-like (mannose-binding) lectin family
FT                   protein"
FT   CDS_pept        complement(join(338024..338229,338293..338364,
FT                   338398..338512,339354..339635,339719..339871))
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.5"
FT                   /gene_synonym="T8O11_5"
FT                   /locus_tag="AT2G01780"
FT                   /product="Curculin-like (mannose-binding) lectin family
FT                   protein"
FT                   /note="Curculin-like (mannose-binding) lectin family
FT                   protein; FUNCTIONS IN: sugar binding; LOCATED IN:
FT                   cellular_component unknown; CONTAINS InterPro DOMAIN/s:
FT                   Curculin-like (mannose-binding) lectin
FT                   (InterPro:IPR001480); BEST Arabidopsis thaliana protein
FT                   match is: receptor kinase 3 (TAIR:AT4G21380.1); Has 1787
FT                   Blast hits to 1759 proteins in 72 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 1787;
FT                   Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01780"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01780.1"
FT                   /db_xref="GOA:Q9ZUA6"
FT                   /db_xref="InterPro:IPR001480"
FT                   /db_xref="InterPro:IPR036426"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZUA6"
FT                   /protein_id="AEC05497.1"
FT                   /translation="MAPVRGCNDRDIKFSPKFVVYALRVSLFETVSGKKGIGLYDSSKA
FT                   SHWLGESSEPFNSFGTFKFSNNNLVLDDQAGIRVWGTNFMGVVGSSLVKEFLDDGNFVI
FT                   KNTWDNDTAGFLWQSFDFLTDTLLPGMALGWKFHRGINRYLLPFPDGYLLPKMALGWNF
FT                   HWGVNQYLVAWETPDNPSKSREEYVASSFPELFVSNYEGRLYGTGPLDDQKEQSLMDKT
FT                   FLSDKIYIADIQEVSFTAYNDSIFTRLNLSPPGILQRLTWNQTVERWIGSWHQ"
FT   gene            340771..341005
FT                   /locus_tag="AT2G04095"
FT   ncRNA           340771..341005
FT                   /locus_tag="AT2G04095"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(341322..342480)
FT                   /gene_synonym="T8O11.4"
FT                   /gene_synonym="T8O11_4"
FT                   /locus_tag="AT2G01790"
FT   mRNA            complement(join(341322..341642,341823..342037,
FT                   342123..342289,342374..342480))
FT                   /gene_synonym="T8O11.4"
FT                   /gene_synonym="T8O11_4"
FT                   /locus_tag="AT2G01790"
FT                   /product="TRAF-like family protein"
FT   CDS_pept        complement(join(341322..341642,341823..342037,
FT                   342123..342289,342374..342480))
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.4"
FT                   /gene_synonym="T8O11_4"
FT                   /locus_tag="AT2G01790"
FT                   /product="TRAF-like family protein"
FT                   /note="TRAF-like family protein; INVOLVED IN: N-terminal
FT                   protein myristoylation; LOCATED IN: endomembrane system;
FT                   EXPRESSED IN: sperm cell; CONTAINS InterPro DOMAIN/s:
FT                   TRAF-like (InterPro:IPR008974), MATH (InterPro:IPR002083);
FT                   BEST Arabidopsis thaliana protein match is: Meprin and TRAF
FT                   (MATH) homology domain-containing protein
FT                   (TAIR:AT3G27040.1); Has 829 Blast hits to 759 proteins in
FT                   82 species: Archae - 0; Bacteria - 0; Metazoa - 222; Fungi
FT                   - 6; Plants - 580; Viruses - 0; Other Eukaryotes - 21
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01790"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01790.1"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZUA7"
FT                   /protein_id="AEC05498.1"
FT                   /translation="MGNHQAVKKLWVINNFSFLDSDRVYSDIFVVGGCKWCLLALPEGN
FT                   NNYIYDYFSLYLCVPDSEYLPSGWRRRAKVSFTMVNQVTGELSQQQEGVYWFDEKNTTQ
FT                   GFGSMFRLLVFQSSYKGFLVNGEVDIVAEVDVVEVIGKLDVSEESESIDSNGFDVLASQ
FT                   VESVNSLFGKYPCFASKLCPKTPRLKKNVVQSLNEILCKSTKELSNGDLAEAYSALRFV
FT                   TKAGFKLDWLEKKLKETGKSRLQEIEEDLKDLKVKCADMDALLEFLR"
FT   gene            complement(343562..345254)
FT                   /gene_synonym="T8O11.3"
FT                   /gene_synonym="T8O11_3"
FT                   /locus_tag="AT2G01800"
FT   mRNA            complement(join(343562..343932,344397..344576,
FT                   344665..344896,344986..345053,345152..345254))
FT                   /gene_synonym="T8O11.3"
FT                   /gene_synonym="T8O11_3"
FT                   /locus_tag="AT2G01800"
FT                   /product="COP1-interacting protein-like protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG491505.1,INSD:EG491506.1,INSD:EG491495.1,
FT                   INSD:EG491501.1,INSD:EG491492.1,INSD:EG491511.1,
FT                   INSD:EG491512.1,INSD:EG491499.1,INSD:EG491502.1,
FT                   INSD:EG491493.1,INSD:EG491513.1,INSD:EG491500.1,
FT                   INSD:EG491514.1"
FT   mRNA            complement(join(343766..343932,344032..344127,
FT                   344397..344576,344665..344896,344986..345053,
FT                   345152..345254))
FT                   /gene_synonym="T8O11.3"
FT                   /gene_synonym="T8O11_3"
FT                   /locus_tag="AT2G01800"
FT                   /product="COP1-interacting protein-like protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG491507.1,INSD:EG491503.1,INSD:EG491495.1,
FT                   INSD:EG491504.1"
FT   mRNA            complement(join(343766..343932,344032..344127,
FT                   344248..344316,344397..344576,344665..344896,
FT                   344986..345053,345152..345254))
FT                   /gene_synonym="T8O11.3"
FT                   /gene_synonym="T8O11_3"
FT                   /locus_tag="AT2G01800"
FT                   /product="COP1-interacting protein-like protein"
FT                   /inference="similar to RNA sequence, EST:INSD:EG491495.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ056521.1"
FT   CDS_pept        complement(join(343766..343932,344397..344576,
FT                   344665..344896,344986..345053,345152..345254))
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.3"
FT                   /gene_synonym="T8O11_3"
FT                   /locus_tag="AT2G01800"
FT                   /product="COP1-interacting protein-like protein"
FT                   /note="COP1-interacting protein-related; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: cellular_component unknown; BEST
FT                   Arabidopsis thaliana protein match is: COP1-interacting
FT                   protein-related (TAIR:AT4G00580.1); Has 30201 Blast hits to
FT                   17322 proteins in 780 species: Archae - 12; Bacteria -
FT                   1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses
FT                   - 0; Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01800"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01800.2"
FT                   /db_xref="UniProtKB/TrEMBL:B3H6U0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG491505.1,INSD:EG491506.1,INSD:EG491495.1,
FT                   INSD:EG491501.1,INSD:EG491492.1,INSD:EG491511.1,
FT                   INSD:EG491512.1,INSD:EG491499.1,INSD:EG491502.1,
FT                   INSD:EG491493.1,INSD:EG491513.1,INSD:EG491500.1,
FT                   INSD:EG491514.1"
FT                   /protein_id="AEC05500.1"
FT                   /translation="MSGRNESQCVFVKTSIDTRLALLLDSDDSVYAFKEKICKEHEQCF
FT                   PSVGNITISALKVNLGGNDYHLSDCTILKTALQGLRNKDWFLSVDLVRVEEKGELQIGE
FT                   VVEKKARKRKSKSDNKSIKKPSIETPTEAKGLESGEGNVTKMGENQHICDADQEGPVNG
FT                   HTIDVEVKLDPVDGHTIDVEAKLDLSGTMEQETEMSAKEKDGDEEAKSEKPKKKKRAKK
FT                   VKTPTKEDGLVASSSRNAEEDGVARDP"
FT   CDS_pept        complement(join(343766..343932,344032..344127,
FT                   344397..344576,344665..344896,344986..345053,
FT                   345152..345254))
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.3"
FT                   /gene_synonym="T8O11_3"
FT                   /locus_tag="AT2G01800"
FT                   /product="COP1-interacting protein-like protein"
FT                   /note="COP1-interacting protein-related; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: cellular_component unknown; BEST
FT                   Arabidopsis thaliana protein match is: COP1-interacting
FT                   protein-related (TAIR:AT4G00580.1); Has 30201 Blast hits to
FT                   17322 proteins in 780 species: Archae - 12; Bacteria -
FT                   1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses
FT                   - 0; Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01800"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01800.3"
FT                   /db_xref="UniProtKB/TrEMBL:B3H4H7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG491507.1,INSD:EG491503.1,INSD:EG491495.1,
FT                   INSD:EG491504.1"
FT                   /protein_id="AEC05501.1"
FT                   /translation="MSGRNESQCVFVKTSIDTRLALLLDSDDSVYAFKEKICKEHEQCF
FT                   PSVGNITISALKVNLGGNDYHLSDCTILKTALQGLRNKDWFLSVDLVRVEEKGELQIGE
FT                   VVEKKARKRKSKSDNKSIKKPSIETPTEAKGLESGEGNVTKMGENQHICDADQEGPVNG
FT                   HTIDVEVKLDPVDGHTIDVEAKLDLSGTMEQDNLLAELHQTTDDAEKEEIIGLVNATPE
FT                   AIENETEMSAKEKDGDEEAKSEKPKKKKRAKKVKTPTKEDGLVASSSRNAEEDGVARDP
FT                   "
FT   CDS_pept        complement(join(343766..343932,344032..344127,
FT                   344248..344316,344397..344576,344665..344896,
FT                   344986..345053,345152..345254))
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.3"
FT                   /gene_synonym="T8O11_3"
FT                   /locus_tag="AT2G01800"
FT                   /product="COP1-interacting protein-like protein"
FT                   /note="COP1-interacting protein-related; BEST Arabidopsis
FT                   thaliana protein match is: COP1-interacting protein-related
FT                   (TAIR:AT4G00580.1); Has 777 Blast hits to 692 proteins in
FT                   155 species: Archae - 4; Bacteria - 61; Metazoa - 249;
FT                   Fungi - 76; Plants - 111; Viruses - 5; Other Eukaryotes -
FT                   271 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01800"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01800.1"
FT                   /db_xref="GOA:Q9ZUA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZUA8"
FT                   /inference="similar to RNA sequence, EST:INSD:EG491495.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ056521.1"
FT                   /protein_id="AEC05499.1"
FT                   /translation="MSGRNESQCVFVKTSIDTRLALLLDSDDSVYAFKEKICKEHEQCF
FT                   PSVGNITISALKVNLGGNDYHLSDCTILKTALQGLRNKDWFLSVDLVRVEEKGELQIGE
FT                   VVEKKARKRKSKSDNKSIKKPSIETPTEAKGLESGEGNVTKMGENQHICDADQEGPVNG
FT                   HTIDVEVKLDPVDGHTIDVEAKLDLSGTMEQDDLQKEVTNADLVMSDQDKDLEKDNLLA
FT                   ELHQTTDDAEKEEIIGLVNATPEAIENETEMSAKEKDGDEEAKSEKPKKKKRAKKVKTP
FT                   TKEDGLVASSSRNAEEDGVARDP"
FT   gene            347537..350179
FT                   /gene_synonym="T8O11.2"
FT                   /gene_synonym="T8O11_2"
FT                   /locus_tag="AT2G01810"
FT   mRNA            join(347537..347849,347936..348179,348416..350179)
FT                   /gene_synonym="T8O11.2"
FT                   /gene_synonym="T8O11_2"
FT                   /locus_tag="AT2G01810"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG436368.1,INSD:EG436503.1,INSD:EG436394.1,
FT                   INSD:EG436502.1,INSD:EG436499.1,INSD:EG436505.1,
FT                   INSD:EG436392.1,INSD:EG436393.1,INSD:EG436504.1,
FT                   INSD:EG436395.1,INSD:EG436389.1,INSD:EG436397.1,
FT                   INSD:EG436369.1,INSD:EG436391.1,INSD:EG436500.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY464577.1,INSD:AY464576.1"
FT   CDS_pept        join(347537..347849,347936..348179,348416..349952)
FT                   /codon_start=1
FT                   /gene_synonym="T8O11.2"
FT                   /gene_synonym="T8O11_2"
FT                   /locus_tag="AT2G01810"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT                   /note="RING/FYVE/PHD zinc finger superfamily protein;
FT                   FUNCTIONS IN: DNA binding, zinc ion binding; INVOLVED IN:
FT                   regulation of transcription, DNA-dependent; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: sperm cell, male
FT                   gametophyte, flower, pollen tube; EXPRESSED DURING: M
FT                   germinated pollen stage, 4 anthesis, petal differentiation
FT                   and expansion stage; CONTAINS InterPro DOMAIN/s: Zinc
FT                   finger, PHD-type, conserved site (InterPro:IPR019786), Zinc
FT                   finger, PHD-type (InterPro:IPR001965), Zinc finger,
FT                   FYVE/PHD-type (InterPro:IPR011011), Zinc finger, PHD-finger
FT                   (InterPro:IPR019787); BEST Arabidopsis thaliana protein
FT                   match is: RING/FYVE/PHD zinc finger superfamily protein
FT                   (TAIR:AT1G66170.1); Has 637 Blast hits to 622 proteins in
FT                   140 species: Archae - 0; Bacteria - 0; Metazoa - 159; Fungi
FT                   - 216; Plants - 250; Viruses - 0; Other Eukaryotes - 12
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01810.1"
FT                   /db_xref="GOA:Q9ZUA9"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZUA9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG436368.1,INSD:EG436503.1,INSD:EG436394.1,
FT                   INSD:EG436502.1,INSD:EG436499.1,INSD:EG436505.1,
FT                   INSD:EG436392.1,INSD:EG436393.1,INSD:EG436504.1,
FT                   INSD:EG436395.1,INSD:EG436389.1,INSD:EG436397.1,
FT                   INSD:EG436369.1,INSD:EG436391.1,INSD:EG436500.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY464577.1,INSD:AY464576.1"
FT                   /protein_id="AEC05502.1"
FT                   /translation="MAITAYDALTERQKAPKVLLINDFAISSSSSSPPFFNLAATFRDN
FT                   IRSFLREYAEIEDYTIDGATVSTIFLGSQANGVVFPLYIIEQQISDSSPNPLCDFCRCF
FT                   GWGHHYVTKRKYHMIIPNRDEWNEPLKRESLTLSSHLMHGLIHCNGFGHLLCINTDLDD
FT                   PNHLSGDQIMDFWDRLCSTLHTRKISLDDTSKKGAMDLRLLHGVAYGRPWFGKWDYMFS
FT                   HGSFGVKKDLYWRAILTLSSIEVDKILEELSGTSKGRVMKKIIDFYRGSTESPLATLSD
FT                   LLRFMLGFISKAPIERKTAMALVAMSLDHVSYPTLRADENSEVCTSPDQESDDNGYESG
FT                   RDTVLDDHNTTTSGIKPPQYYSFDDLSRREHSRWPGRRLNDAAQAVLKVFKERNSTISR
FT                   QDLREAVRSSIGDTGLIDFLLKHIDKVLIGDQIVQRSTNPKSRMLQFSLRTINSRVQEQ
FT                   KRKKKRKVKPQETSECTSTTPGLSPYDDILYLYQNLLLTYPDSDLYSEASQVILKCKSF
FT                   VKEWSYQEQNHLTVSCQVLPNHEELLRDFTRLLPPGDLVAVPENATIRELKSAAEKVLR
FT                   DTYCITETFEVLEIRNRYLEKLDDNVSLKSQGNTEFMVKGFGLDIGTELRYEGGFDDWT
FT                   VDCKCGARDDDGERMVACDACKVWHHTLCNSIEDDEAVPSVFLCNMCYGDSLRSKKRNL
FT                   SIR"
FT   gene            complement(353344..355594)
FT                   /locus_tag="AT2G01818"
FT   mRNA            complement(join(353344..353785,354355..354513,
FT                   354648..354914,355362..355594))
FT                   /locus_tag="AT2G01818"
FT                   /product="PLATZ transcription factor family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CF652495.1,INSD:ES104966.1,INSD:AU229737.1,
FT                   INSD:AU238545.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK229536.1"
FT   mRNA            complement(join(353457..353785,354355..354513,
FT                   354648..354722,355362..355560))
FT                   /locus_tag="AT2G01818"
FT                   /product="PLATZ transcription factor family protein"
FT   CDS_pept        complement(join(353552..353785,354355..354513,
FT                   354648..354722,355362..355370))
FT                   /codon_start=1
FT                   /locus_tag="AT2G01818"
FT                   /product="PLATZ transcription factor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01818"
FT                   /db_xref="InterPro:IPR006734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B1Z2"
FT                   /protein_id="ANM62911.1"
FT                   /translation="MNLICKYVYQDVIRLLEIQNYFDCSEIQTYKINGEKAIHLNSRPQ
FT                   AKDARPSTKAKNGASCVTCKRYIQDHPNLFCSISCKISTPSKKHKFCFSPKLEQSVLEK
FT                   EHSTQEGSLEEKKSCTSSLTDVSEDSEVLLSDFSFRPLLRILKRKGISRRSPFY"
FT   CDS_pept        complement(join(353552..353785,354355..354513,
FT                   354648..354914,355362..355370))
FT                   /codon_start=1
FT                   /locus_tag="AT2G01818"
FT                   /product="PLATZ transcription factor family protein"
FT                   /note="PLATZ transcription factor family protein; FUNCTIONS
FT                   IN: zinc ion binding; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: intracellular; CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF597
FT                   (InterPro:IPR006734), Zinc finger, B-box
FT                   (InterPro:IPR000315); BEST Arabidopsis thaliana protein
FT                   match is: PLATZ transcription factor family protein
FT                   (TAIR:AT3G60670.1); Has 397 Blast hits to 397 proteins in
FT                   26 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 397; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01818.1"
FT                   /db_xref="GOA:A8MQN6"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR006734"
FT                   /db_xref="UniProtKB/TrEMBL:A8MQN6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CF652495.1,INSD:ES104966.1,INSD:AU229737.1,
FT                   INSD:AU238545.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK229536.1"
FT                   /protein_id="AEC05503.1"
FT                   /translation="MNLSEKRRSEEVWIETLLNSEFFGICMNHKYLRKNEKNVFCIDCN
FT                   VEICRHCCNTVTDSHFLHRRLQICKYVYQDVIRLLEIQNYFDCSEIQTYKINGEKAIHL
FT                   NSRPQAKDARPSTKAKNGASCVTCKRYIQDHPNLFCSISCKISTPSKKHKFCFSPKLEQ
FT                   SVLEKEHSTQEGSLEEKKSCTSSLTDVSEDSEVLLSDFSFRPLLRILKRKGISRRSPFY
FT                   "
FT   gene            complement(357353..360924)
FT                   /gene_synonym="T23K3.1"
FT                   /gene_synonym="T23K3_1"
FT                   /locus_tag="AT2G01820"
FT   mRNA            complement(join(357353..358208,358395..360924))
FT                   /gene_synonym="T23K3.1"
FT                   /gene_synonym="T23K3_1"
FT                   /locus_tag="AT2G01820"
FT                   /product="Leucine-rich repeat protein kinase family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV532353.1,INSD:EH978751.1,INSD:EH858096.1,
FT                   INSD:ES106368.1,INSD:BE530003.1,INSD:AV442530.1,
FT                   INSD:ES149579.1,INSD:EL989898.1,INSD:EH947659.1,
FT                   INSD:AV559744.1,INSD:ES198859.1,INSD:EL127857.1,
FT                   INSD:ES007036.1,INSD:ES190153.1,INSD:DR383758.1,
FT                   INSD:ES104800.1,INSD:Z18436.1,INSD:EL295335.1,
FT                   INSD:EL291023.1,INSD:EL172031.1,INSD:AV535898.1,
FT                   INSD:EL147652.1,INSD:EL240608.1,INSD:BP831848.1,
FT                   INSD:ES142431.1,INSD:DR364045.1,INSD:ES109875.1,
FT                   INSD:ES125995.1,INSD:EL230017.1,INSD:ES099083.1,
FT                   INSD:BE523428.1,INSD:ES150265.1,INSD:ES064283.1,
FT                   INSD:ES173582.1,INSD:BP810028.1,INSD:EL276810.1,
FT                   INSD:BP653137.1,INSD:EH802023.1,INSD:AV539634.1,
FT                   INSD:ES062068.1,INSD:ES137782.1,INSD:ES094203.1,
FT                   INSD:AU227565.1,INSD:ES075156.1,INSD:AV561622.1,
FT                   INSD:EL105742.1,INSD:EL178105.1,INSD:BG459526.1,
FT                   INSD:EL154877.1,INSD:BE527822.1,INSD:AV538757.1,
FT                   INSD:EG473569.1,INSD:EL984731.1,INSD:ES146233.1,
FT                   INSD:EL208459.1,INSD:ES137045.1,INSD:BP812481.1,
FT                   INSD:BE524013.1,INSD:BG459566.1,INSD:AV520001.1,
FT                   INSD:EH958494.1,INSD:ES196245.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK222108.1,INSD:BX821443.1"
FT   CDS_pept        complement(join(357664..358208,358395..360681))
FT                   /codon_start=1
FT                   /gene_synonym="T23K3.1"
FT                   /gene_synonym="T23K3_1"
FT                   /locus_tag="AT2G01820"
FT                   /product="Leucine-rich repeat protein kinase family
FT                   protein"
FT                   /note="Leucine-rich repeat protein kinase family protein;
FT                   FUNCTIONS IN: protein serine/threonine kinase activity,
FT                   protein kinase activity, ATP binding; INVOLVED IN: pollen
FT                   development; LOCATED IN: plasma membrane, plant-type cell
FT                   wall; EXPRESSED IN: 23 plant structures; EXPRESSED DURING:
FT                   13 growth stages; CONTAINS InterPro DOMAIN/s: Protein
FT                   kinase, ATP binding site (InterPro:IPR017441), Protein
FT                   kinase, catalytic domain (InterPro:IPR000719), Leucine-rich
FT                   repeat, typical subtype (InterPro:IPR003591), Leucine-rich
FT                   repeat (InterPro:IPR001611), Serine/threonine-protein
FT                   kinase-like domain (InterPro:IPR017442), Protein
FT                   kinase-like domain (InterPro:IPR011009),
FT                   Serine/threonine-protein kinase, active site
FT                   (InterPro:IPR008271); BEST Arabidopsis thaliana protein
FT                   match is: transmembrane kinase 1 (TAIR:AT1G66150.1); Has
FT                   179395 Blast hits to 141441 proteins in 4928 species:
FT                   Archae - 173; Bacteria - 19044; Metazoa - 57542; Fungi -
FT                   11766; Plants - 68071; Viruses - 436; Other Eukaryotes -
FT                   22363 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9SIT1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SIT1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV532353.1,INSD:EH978751.1,INSD:EH858096.1,
FT                   INSD:ES106368.1,INSD:BE530003.1,INSD:AV442530.1,
FT                   INSD:ES149579.1,INSD:EL989898.1,INSD:EH947659.1,
FT                   INSD:AV559744.1,INSD:ES198859.1,INSD:EL127857.1,
FT                   INSD:ES007036.1,INSD:ES190153.1,INSD:DR383758.1,
FT                   INSD:ES104800.1,INSD:Z18436.1,INSD:EL295335.1,
FT                   INSD:EL291023.1,INSD:EL172031.1,INSD:AV535898.1,
FT                   INSD:EL147652.1,INSD:EL240608.1,INSD:BP831848.1,
FT                   INSD:ES142431.1,INSD:DR364045.1,INSD:ES109875.1,
FT                   INSD:ES125995.1,INSD:EL230017.1,INSD:ES099083.1,
FT                   INSD:BE523428.1,INSD:ES150265.1,INSD:ES064283.1,
FT                   INSD:ES173582.1,INSD:BP810028.1,INSD:EL276810.1,
FT                   INSD:BP653137.1,INSD:EH802023.1,INSD:AV539634.1,
FT                   INSD:ES062068.1,INSD:ES137782.1,INSD:ES094203.1,
FT                   INSD:AU227565.1,INSD:ES075156.1,INSD:AV561622.1,
FT                   INSD:EL105742.1,INSD:EL178105.1,INSD:BG459526.1,
FT                   INSD:EL154877.1,INSD:BE527822.1,INSD:AV538757.1,
FT                   INSD:EG473569.1,INSD:EL984731.1,INSD:ES146233.1,
FT                   INSD:EL208459.1,INSD:ES137045.1,INSD:BP812481.1,
FT                   INSD:BE524013.1,INSD:BG459566.1,INSD:AV520001.1,
FT                   INSD:EH958494.1,INSD:ES196245.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK222108.1,INSD:BX821443.1"
FT                   /protein_id="AEC05504.1"
FT                   /translation="MSNSHLGTLCFIISLLGLANFSLSQTGLDDSTMQSLKSSLNLTSD
FT                   VDWSNPNPCKWQSVQCDGSNRVTKIQLKQKGIRGTLPTNLQSLSELVILELFLNRISGP
FT                   IPDLSGLSRLQTLNLHDNLFTSVPKNLFSGMSSLQEMYLENNPFDPWVIPDTVKEATSL
FT                   QNLTLSNCSIIGKIPDFFGSQSLPSLTNLKLSQNGLEGELPMSFAGTSIQSLFLNGQKL
FT                   NGSISVLGNMTSLVEVSLQGNQFSGPIPDLSGLVSLRVFNVRENQLTGVVPQSLVSLSS
FT                   LTTVNLTNNYLQGPTPLFGKSVGVDIVNNMNSFCTNVAGEACDPRVDTLVSVAESFGYP
FT                   VKLAESWKGNNPCVNWVGITCSGGNITVVNMRKQDLSGTISPSLAKLTSLETINLADNK
FT                   LSGHIPDELTTLSKLRLLDVSNNDFYGIPPKFRDTVTLVTEGNANMGKNGPNKTSDAPG
FT                   ASPGSKPSGGSDGSETSKKSSNVKIIVPVVGGVVGALCLVGLGVCLYAKKRKRPARVQS
FT                   PSSNMVIHPHHSGDNDDIKLTVAASSLNSGGGSDSYSHSGSAASDIHVVEAGNLVISIQ
FT                   VLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMESSVVSDKGLTEFKSEITVL
FT                   TKMRHRHLVALLGYCLDGNERLLVYEYMPQGTLSQHLFHWKEEGRKPLDWTRRLAIALD
FT                   VARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPDGKYSIETRVAGT
FT                   FGYLAPEYAVTGRVTTKVDIFSLGVILMELITGRKALDETQPEDSVHLVTWFRRVAASK
FT                   DENAFKNAIDPNISLDDDTVASIEKVWELAGHCCAREPYQRPDMAHIVNVLSSLTVQWK
FT                   PTETDPDDVYGIDYDMPLPQVLKKWQAFEGLSQTADDSGSSSSAYGSKDNTQTSIPTRP
FT                   SGFADSFTSVDGR"
FT   gene            complement(362983..369707)
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /note="Histidine kinase: cytokinin-binding receptor that
FT                   transduces cytokinin signals across the plasma membrane"
FT   mRNA            complement(join(362983..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..367436,369450..369524,369659..369707))
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES206889.1,INSD:AV553937.1,INSD:EH946060.1,
FT                   INSD:BE528214.1,INSD:AV558986.1,INSD:BE520452.1,
FT                   INSD:EH814004.1,INSD:AV545228.1,INSD:BE520454.1,
FT                   INSD:EL060945.1,INSD:AI992824.1,INSD:BE520453.1,
FT                   INSD:AV559363.1,INSD:T20648.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AB049935.1,INSD:AB046871.1,INSD:AJ278529.1"
FT   mRNA            complement(join(362983..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..367431,367955..368357))
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT   mRNA            complement(join(362983..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..367436,367955..368357))
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES206889.1,INSD:AV553937.1,INSD:EH946060.1,
FT                   INSD:AV558986.1,INSD:BE528214.1,INSD:BE520452.1,
FT                   INSD:EH814004.1,INSD:AV545228.1,INSD:BE520454.1,
FT                   INSD:AI992824.1,INSD:BE520453.1,INSD:T20648.1,
FT                   INSD:AV559363.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AJ278530.1"
FT   mRNA            complement(join(362983..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..368357))
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT   mRNA            complement(join(362983..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..367431,367585..367696))
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT   mRNA            complement(join(362995..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..367436,367554..367977))
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES206889.1,INSD:AV553937.1,INSD:EH946060.1,
FT                   INSD:BE528214.1,INSD:AV558986.1,INSD:BE520452.1,
FT                   INSD:EH814004.1,INSD:AV545228.1,INSD:BE520454.1,
FT                   INSD:AI992824.1,INSD:BE520453.1,INSD:T20648.1,
FT                   INSD:AV559363.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AJ278528.1,INSD:AB049934.1"
FT   CDS_pept        complement(join(363332..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..367436,367955..368016))
FT                   /codon_start=1
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT                   /note="WOODEN LEG (WOL); FUNCTIONS IN: osmosensor activity,
FT                   cytokine binding, cytokinin receptor activity, protein
FT                   histidine kinase activity, phosphoprotein phosphatase
FT                   activity; INVOLVED IN: in 7 processes; LOCATED IN:
FT                   membrane; EXPRESSED IN: 30 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Signal transduction histidine kinase, homodimeric
FT                   (InterPro:IPR009082), CHASE (InterPro:IPR006189), Signal
FT                   transduction histidine kinase, core (InterPro:IPR005467),
FT                   ATPase-like, ATP-binding domain (InterPro:IPR003594),
FT                   CheY-like (InterPro:IPR011006), Signal transduction
FT                   response regulator, receiver domain (InterPro:IPR001789),
FT                   Signal transduction histidine kinase, subgroup 1,
FT                   dimerisation/phosphoacceptor domain (InterPro:IPR003661),
FT                   Signal transduction histidine kinase-related protein,
FT                   C-terminal (InterPro:IPR004358); BEST Arabidopsis thaliana
FT                   protein match is: histidine kinase 2 (TAIR:AT5G35750.1);
FT                   Has 134660 Blast hits to 108037 proteins in 2975 species:
FT                   Archae - 759; Bacteria - 119664; Metazoa - 32; Fungi -
FT                   2267; Plants - 2388; Viruses - 27; Other Eukaryotes - 9523
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9C5U0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="PDB:3T4J"
FT                   /db_xref="PDB:3T4K"
FT                   /db_xref="PDB:3T4L"
FT                   /db_xref="PDB:3T4O"
FT                   /db_xref="PDB:3T4Q"
FT                   /db_xref="PDB:3T4S"
FT                   /db_xref="PDB:3T4T"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5U0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES206889.1,INSD:AV553937.1,INSD:EH946060.1,
FT                   INSD:BE528214.1,INSD:AV558986.1,INSD:BE520452.1,
FT                   INSD:EH814004.1,INSD:AV545228.1,INSD:BE520454.1,
FT                   INSD:EL060945.1,INSD:AI992824.1,INSD:BE520453.1,
FT                   INSD:AV559363.1,INSD:T20648.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AB049935.1,INSD:AB046871.1,INSD:AJ278529.1"
FT                   /protein_id="AEC05505.1"
FT                   /translation="MRRDFVYNNNAMFNPLTTHYSSDMNWALNNHQEEEEEPRRIEISD
FT                   SESLENLKSSDFYQLGGGGALNSSEKPRKIDFWRSGLMGFAKMQQQQQLQHSVAVKMNN
FT                   NNNNDLMGNKKGSTFIQEHRALLPKALILWIIIVGFISSGIYQWMDDANKIRREEVLVS
FT                   MCDQRARMLQDQFSVSVNHVHALAILVSTFHYHKNPSAIDQETFAEYTARTAFERPLLS
FT                   GVAYAEKVVNFEREMFERQHNWVIKTMDRGEPSPVRDEYAPVIFSQDSVSYLESLDMMS
FT                   GEEDRENILRARETGKAVLTSPFRLLETHHLGVVLTFPVYKSSLPENPTVEERIAATAG
FT                   YLGGAFDVESLVENLLGQLAGNQAIVVHVYDITNASDPLVMYGNQDEEADRSLSHESKL
FT                   DFGDPFRKHKMICRYHQKAPIPLNVLTTVPLFFAIGFLVGYILYGAAMHIVKVEDDFHE
FT                   MQELKVRAEAADVAKSQFLATVSHEIRTPMNGILGMLAMLLDTELSSTQRDYAQTAQVC
FT                   GKALIALINEVLDRAKIEAGKLELESVPFDIRSILDDVLSLFSEESRNKSIELAVFVSD
FT                   KVPEIVKGDSGRFRQIIINLVGNSVKFTEKGHIFVKVHLAEQSKDESEPKNALNGGVSE
FT                   EMIVVSKQSSYNTLSGYEAADGRNSWDSFKHLVSEEQSLSEFDISSNVRLMVSIEDTGI
FT                   GIPLVAQGRVFMPFMQADSSTSRNYGGTGIGLSISKCLVELMRGQINFISRPHIGSTFW
FT                   FTAVLEKCDKCSAINHMKKPNVEHLPSTFKGMKAIVVDAKPVRAAVTRYHMKRLGINVD
FT                   VVTSLKTAVVAAAAFERNGSPLPTKPQLDMILVEKDSWISTEDNDSEIRLLNSRTNGNV
FT                   HHKSPKLALFATNITNSEFDRAKSAGFADTVIMKPLRASMIGACLQQVLELRKTRQQHP
FT                   EGSSPATLKSLLTGKKILVVDDNIVNRRVAAGALKKFGAEVVCAESGQVALGLLQIPHT
FT                   FDACFMDIQMPQMDGFEATRQIRMMEKETKEKTNLEWHLPILAMTADVIHATYEECLKS
FT                   GMDGYVSKPFEEENLYKSVAKSFKPNPISPSS"
FT   CDS_pept        complement(join(363332..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..367431,367955..367988))
FT                   /codon_start=1
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01830"
FT                   /db_xref="GOA:A0A1P8B026"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B026"
FT                   /protein_id="ANM62255.1"
FT                   /translation="MQCSILSQLITDMNWALNNHQEEEEEPRRIEISDSESLENLKSSD
FT                   FYQLGGGGALNSSEKPRKIDFWRSGLMGFAKMQQQQQLQHSVAVKMNNNNNNDLMGNKK
FT                   GSTFIQEHRALLPKALILWIIIVGFISSGIYQWMDDANKIRREEVLVSMCDQRARMLQD
FT                   QFSVSVNHVHALAILVSTFHYHKNPSAIDQETFAEYTARTAFERPLLSGVAYAEKVVNF
FT                   EREMFERQHNWVIKTMDRGEPSPVRDEYAPVIFSQDSVSYLESLDMMSGEEDRENILRA
FT                   RETGKAVLTSPFRLLETHHLGVVLTFPVYKSSLPENPTVEERIAATAGYLGGAFDVESL
FT                   VENLLGQLAGNQAIVVHVYDITNASDPLVMYGNQDEEADRSLSHESKLDFGDPFRKHKM
FT                   ICRYHQKAPIPLNVLTTVPLFFAIGFLVGYILYGAAMHIVKVEDDFHEMQELKVRAEAA
FT                   DVAKSQFLATVSHEIRTPMNGILGMLAMLLDTELSSTQRDYAQTAQVCGKALIALINEV
FT                   LDRAKIEAGKLELESVPFDIRSILDDVLSLFSEESRNKSIELAVFVSDKVPEIVKGDSG
FT                   RFRQIIINLVGNSVKFTEKGHIFVKVHLAEQSKDESEPKNALNGGVSEEMIVVSKQSSY
FT                   NTLSGYEAADGRNSWDSFKHLVSEEQSLSEFDISSNVRLMVSIEDTGIGIPLVAQGRVF
FT                   MPFMQADSSTSRNYGGTGIGLSISKCLVELMRGQINFISRPHIGSTFWFTAVLEKCDKC
FT                   SAINHMKKPNVEHLPSTFKGMKAIVVDAKPVRAAVTRYHMKRLGINVDVVTSLKTAVVA
FT                   AAAFERNGSPLPTKPQLDMILVEKDSWISTEDNDSEIRLLNSRTNGNVHHKSPKLALFA
FT                   TNITNSEFDRAKSAGFADTVIMKPLRASMIGACLQQVLELRKTRQQHPEGSSPATLKSL
FT                   LTGKKILVVDDNIVNRRVAAGALKKFGAEVVCAESGQVALGLLQIPHTFDACFMDIQMP
FT                   QMDGFEATRQIRMMEKETKEKTNLEWHLPILAMTADVIHATYEECLKSGMDGYVSKPFE
FT                   EENLYKSVAKSFKPNPISPSS"
FT   CDS_pept        complement(join(363332..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..367429))
FT                   /codon_start=1
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT                   /db_xref="GOA:Q9C5U0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="PDB:3T4J"
FT                   /db_xref="PDB:3T4K"
FT                   /db_xref="PDB:3T4L"
FT                   /db_xref="PDB:3T4O"
FT                   /db_xref="PDB:3T4Q"
FT                   /db_xref="PDB:3T4S"
FT                   /db_xref="PDB:3T4T"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5U0"
FT                   /protein_id="ANM62256.1"
FT                   /translation="MNWALNNHQEEEEEPRRIEISDSESLENLKSSDFYQLGGGGALNS
FT                   SEKPRKIDFWRSGLMGFAKMQQQQQLQHSVAVKMNNNNNNDLMGNKKGSTFIQEHRALL
FT                   PKALILWIIIVGFISSGIYQWMDDANKIRREEVLVSMCDQRARMLQDQFSVSVNHVHAL
FT                   AILVSTFHYHKNPSAIDQETFAEYTARTAFERPLLSGVAYAEKVVNFEREMFERQHNWV
FT                   IKTMDRGEPSPVRDEYAPVIFSQDSVSYLESLDMMSGEEDRENILRARETGKAVLTSPF
FT                   RLLETHHLGVVLTFPVYKSSLPENPTVEERIAATAGYLGGAFDVESLVENLLGQLAGNQ
FT                   AIVVHVYDITNASDPLVMYGNQDEEADRSLSHESKLDFGDPFRKHKMICRYHQKAPIPL
FT                   NVLTTVPLFFAIGFLVGYILYGAAMHIVKVEDDFHEMQELKVRAEAADVAKSQFLATVS
FT                   HEIRTPMNGILGMLAMLLDTELSSTQRDYAQTAQVCGKALIALINEVLDRAKIEAGKLE
FT                   LESVPFDIRSILDDVLSLFSEESRNKSIELAVFVSDKVPEIVKGDSGRFRQIIINLVGN
FT                   SVKFTEKGHIFVKVHLAEQSKDESEPKNALNGGVSEEMIVVSKQSSYNTLSGYEAADGR
FT                   NSWDSFKHLVSEEQSLSEFDISSNVRLMVSIEDTGIGIPLVAQGRVFMPFMQADSSTSR
FT                   NYGGTGIGLSISKCLVELMRGQINFISRPHIGSTFWFTAVLEKCDKCSAINHMKKPNVE
FT                   HLPSTFKGMKAIVVDAKPVRAAVTRYHMKRLGINVDVVTSLKTAVVAAAAFERNGSPLP
FT                   TKPQLDMILVEKDSWISTEDNDSEIRLLNSRTNGNVHHKSPKLALFATNITNSEFDRAK
FT                   SAGFADTVIMKPLRASMIGACLQQVLELRKTRQQHPEGSSPATLKSLLTGKKILVVDDN
FT                   IVNRRVAAGALKKFGAEVVCAESGQVALGLLQIPHTFDACFMDIQMPQMDGFEATRQIR
FT                   MMEKETKEKTNLEWHLPILAMTADVIHATYEECLKSGMDGYVSKPFEEENLYKSVAKSF
FT                   KPNPISPSS"
FT   CDS_pept        complement(join(363332..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..367429))
FT                   /codon_start=1
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT                   /db_xref="GOA:Q9C5U0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="PDB:3T4J"
FT                   /db_xref="PDB:3T4K"
FT                   /db_xref="PDB:3T4L"
FT                   /db_xref="PDB:3T4O"
FT                   /db_xref="PDB:3T4Q"
FT                   /db_xref="PDB:3T4S"
FT                   /db_xref="PDB:3T4T"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5U0"
FT                   /protein_id="ANM62257.1"
FT                   /translation="MNWALNNHQEEEEEPRRIEISDSESLENLKSSDFYQLGGGGALNS
FT                   SEKPRKIDFWRSGLMGFAKMQQQQQLQHSVAVKMNNNNNNDLMGNKKGSTFIQEHRALL
FT                   PKALILWIIIVGFISSGIYQWMDDANKIRREEVLVSMCDQRARMLQDQFSVSVNHVHAL
FT                   AILVSTFHYHKNPSAIDQETFAEYTARTAFERPLLSGVAYAEKVVNFEREMFERQHNWV
FT                   IKTMDRGEPSPVRDEYAPVIFSQDSVSYLESLDMMSGEEDRENILRARETGKAVLTSPF
FT                   RLLETHHLGVVLTFPVYKSSLPENPTVEERIAATAGYLGGAFDVESLVENLLGQLAGNQ
FT                   AIVVHVYDITNASDPLVMYGNQDEEADRSLSHESKLDFGDPFRKHKMICRYHQKAPIPL
FT                   NVLTTVPLFFAIGFLVGYILYGAAMHIVKVEDDFHEMQELKVRAEAADVAKSQFLATVS
FT                   HEIRTPMNGILGMLAMLLDTELSSTQRDYAQTAQVCGKALIALINEVLDRAKIEAGKLE
FT                   LESVPFDIRSILDDVLSLFSEESRNKSIELAVFVSDKVPEIVKGDSGRFRQIIINLVGN
FT                   SVKFTEKGHIFVKVHLAEQSKDESEPKNALNGGVSEEMIVVSKQSSYNTLSGYEAADGR
FT                   NSWDSFKHLVSEEQSLSEFDISSNVRLMVSIEDTGIGIPLVAQGRVFMPFMQADSSTSR
FT                   NYGGTGIGLSISKCLVELMRGQINFISRPHIGSTFWFTAVLEKCDKCSAINHMKKPNVE
FT                   HLPSTFKGMKAIVVDAKPVRAAVTRYHMKRLGINVDVVTSLKTAVVAAAAFERNGSPLP
FT                   TKPQLDMILVEKDSWISTEDNDSEIRLLNSRTNGNVHHKSPKLALFATNITNSEFDRAK
FT                   SAGFADTVIMKPLRASMIGACLQQVLELRKTRQQHPEGSSPATLKSLLTGKKILVVDDN
FT                   IVNRRVAAGALKKFGAEVVCAESGQVALGLLQIPHTFDACFMDIQMPQMDGFEATRQIR
FT                   MMEKETKEKTNLEWHLPILAMTADVIHATYEECLKSGMDGYVSKPFEEENLYKSVAKSF
FT                   KPNPISPSS"
FT   CDS_pept        complement(join(363332..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..367429))
FT                   /codon_start=1
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT                   /note="WOODEN LEG (WOL); FUNCTIONS IN: osmosensor activity,
FT                   cytokine binding, cytokinin receptor activity, protein
FT                   histidine kinase activity, phosphoprotein phosphatase
FT                   activity; INVOLVED IN: in 7 processes; LOCATED IN:
FT                   membrane; EXPRESSED IN: 30 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Signal transduction histidine kinase, homodimeric
FT                   (InterPro:IPR009082), CHASE (InterPro:IPR006189), Signal
FT                   transduction histidine kinase, core (InterPro:IPR005467),
FT                   ATPase-like, ATP-binding domain (InterPro:IPR003594),
FT                   CheY-like (InterPro:IPR011006), Signal transduction
FT                   response regulator, receiver domain (InterPro:IPR001789),
FT                   Signal transduction histidine kinase, subgroup 1,
FT                   dimerisation/phosphoacceptor domain (InterPro:IPR003661),
FT                   Signal transduction histidine kinase-related protein,
FT                   C-terminal (InterPro:IPR004358); BEST Arabidopsis thaliana
FT                   protein match is: histidine kinase 2 (TAIR:AT5G35750.1);
FT                   Has 35333 Blast hits to 34131 proteins in 2444 species:
FT                   Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991;
FT                   Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q9C5U0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="PDB:3T4J"
FT                   /db_xref="PDB:3T4K"
FT                   /db_xref="PDB:3T4L"
FT                   /db_xref="PDB:3T4O"
FT                   /db_xref="PDB:3T4Q"
FT                   /db_xref="PDB:3T4S"
FT                   /db_xref="PDB:3T4T"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5U0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES206889.1,INSD:AV553937.1,INSD:EH946060.1,
FT                   INSD:AV558986.1,INSD:BE528214.1,INSD:BE520452.1,
FT                   INSD:EH814004.1,INSD:AV545228.1,INSD:BE520454.1,
FT                   INSD:AI992824.1,INSD:BE520453.1,INSD:T20648.1,
FT                   INSD:AV559363.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AJ278530.1"
FT                   /protein_id="AEC05506.1"
FT                   /translation="MNWALNNHQEEEEEPRRIEISDSESLENLKSSDFYQLGGGGALNS
FT                   SEKPRKIDFWRSGLMGFAKMQQQQQLQHSVAVKMNNNNNNDLMGNKKGSTFIQEHRALL
FT                   PKALILWIIIVGFISSGIYQWMDDANKIRREEVLVSMCDQRARMLQDQFSVSVNHVHAL
FT                   AILVSTFHYHKNPSAIDQETFAEYTARTAFERPLLSGVAYAEKVVNFEREMFERQHNWV
FT                   IKTMDRGEPSPVRDEYAPVIFSQDSVSYLESLDMMSGEEDRENILRARETGKAVLTSPF
FT                   RLLETHHLGVVLTFPVYKSSLPENPTVEERIAATAGYLGGAFDVESLVENLLGQLAGNQ
FT                   AIVVHVYDITNASDPLVMYGNQDEEADRSLSHESKLDFGDPFRKHKMICRYHQKAPIPL
FT                   NVLTTVPLFFAIGFLVGYILYGAAMHIVKVEDDFHEMQELKVRAEAADVAKSQFLATVS
FT                   HEIRTPMNGILGMLAMLLDTELSSTQRDYAQTAQVCGKALIALINEVLDRAKIEAGKLE
FT                   LESVPFDIRSILDDVLSLFSEESRNKSIELAVFVSDKVPEIVKGDSGRFRQIIINLVGN
FT                   SVKFTEKGHIFVKVHLAEQSKDESEPKNALNGGVSEEMIVVSKQSSYNTLSGYEAADGR
FT                   NSWDSFKHLVSEEQSLSEFDISSNVRLMVSIEDTGIGIPLVAQGRVFMPFMQADSSTSR
FT                   NYGGTGIGLSISKCLVELMRGQINFISRPHIGSTFWFTAVLEKCDKCSAINHMKKPNVE
FT                   HLPSTFKGMKAIVVDAKPVRAAVTRYHMKRLGINVDVVTSLKTAVVAAAAFERNGSPLP
FT                   TKPQLDMILVEKDSWISTEDNDSEIRLLNSRTNGNVHHKSPKLALFATNITNSEFDRAK
FT                   SAGFADTVIMKPLRASMIGACLQQVLELRKTRQQHPEGSSPATLKSLLTGKKILVVDDN
FT                   IVNRRVAAGALKKFGAEVVCAESGQVALGLLQIPHTFDACFMDIQMPQMDGFEATRQIR
FT                   MMEKETKEKTNLEWHLPILAMTADVIHATYEECLKSGMDGYVSKPFEEENLYKSVAKSF
FT                   KPNPISPSS"
FT   CDS_pept        complement(join(363332..363563,363705..364909,
FT                   364993..365091,365170..365399,365493..365731,
FT                   365813..366031,366207..366376,366470..366706,
FT                   366887..367429))
FT                   /codon_start=1
FT                   /gene="WOL"
FT                   /gene_synonym="AHK4"
FT                   /gene_synonym="ARABIDOPSIS HISTIDINE KINASE 4"
FT                   /gene_synonym="ATCRE1"
FT                   /gene_synonym="CRE1"
FT                   /gene_synonym="CYTOKININ RESPONSE 1"
FT                   /gene_synonym="T23K3.2"
FT                   /gene_synonym="T23K3_2"
FT                   /gene_synonym="WOL1"
FT                   /gene_synonym="WOODEN LEG"
FT                   /gene_synonym="WOODEN LEG 1"
FT                   /locus_tag="AT2G01830"
FT                   /product="CHASE domain containing histidine kinase protein"
FT                   /note="WOODEN LEG (WOL); FUNCTIONS IN: osmosensor activity,
FT                   cytokine binding, cytokinin receptor activity, protein
FT                   histidine kinase activity, phosphoprotein phosphatase
FT                   activity; INVOLVED IN: in 7 processes; LOCATED IN:
FT                   membrane; EXPRESSED IN: 30 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Signal transduction histidine kinase, homodimeric
FT                   (InterPro:IPR009082), CHASE (InterPro:IPR006189), Signal
FT                   transduction histidine kinase, core (InterPro:IPR005467),
FT                   ATPase-like, ATP-binding domain (InterPro:IPR003594),
FT                   CheY-like (InterPro:IPR011006), Signal transduction
FT                   response regulator, receiver domain (InterPro:IPR001789),
FT                   Signal transduction histidine kinase, subgroup 1,
FT                   dimerisation/phosphoacceptor domain (InterPro:IPR003661),
FT                   Signal transduction histidine kinase-related protein,
FT                   C-terminal (InterPro:IPR004358); BEST Arabidopsis thaliana
FT                   protein match is: histidine kinase 2 (TAIR:AT5G35750.1);
FT                   Has 136787 Blast hits to 109703 proteins in 3011 species:
FT                   Archae - 761; Bacteria - 121785; Metazoa - 32; Fungi -
FT                   2267; Plants - 2388; Viruses - 27; Other Eukaryotes - 9527
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9C5U0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="PDB:3T4J"
FT                   /db_xref="PDB:3T4K"
FT                   /db_xref="PDB:3T4L"
FT                   /db_xref="PDB:3T4O"
FT                   /db_xref="PDB:3T4Q"
FT                   /db_xref="PDB:3T4S"
FT                   /db_xref="PDB:3T4T"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5U0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES206889.1,INSD:AV553937.1,INSD:EH946060.1,
FT                   INSD:BE528214.1,INSD:AV558986.1,INSD:BE520452.1,
FT                   INSD:EH814004.1,INSD:AV545228.1,INSD:BE520454.1,
FT                   INSD:AI992824.1,INSD:BE520453.1,INSD:T20648.1,
FT                   INSD:AV559363.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AJ278528.1,INSD:AB049934.1"
FT                   /protein_id="AEC05507.1"
FT                   /translation="MNWALNNHQEEEEEPRRIEISDSESLENLKSSDFYQLGGGGALNS
FT                   SEKPRKIDFWRSGLMGFAKMQQQQQLQHSVAVKMNNNNNNDLMGNKKGSTFIQEHRALL
FT                   PKALILWIIIVGFISSGIYQWMDDANKIRREEVLVSMCDQRARMLQDQFSVSVNHVHAL
FT                   AILVSTFHYHKNPSAIDQETFAEYTARTAFERPLLSGVAYAEKVVNFEREMFERQHNWV
FT                   IKTMDRGEPSPVRDEYAPVIFSQDSVSYLESLDMMSGEEDRENILRARETGKAVLTSPF
FT                   RLLETHHLGVVLTFPVYKSSLPENPTVEERIAATAGYLGGAFDVESLVENLLGQLAGNQ
FT                   AIVVHVYDITNASDPLVMYGNQDEEADRSLSHESKLDFGDPFRKHKMICRYHQKAPIPL
FT                   NVLTTVPLFFAIGFLVGYILYGAAMHIVKVEDDFHEMQELKVRAEAADVAKSQFLATVS
FT                   HEIRTPMNGILGMLAMLLDTELSSTQRDYAQTAQVCGKALIALINEVLDRAKIEAGKLE
FT                   LESVPFDIRSILDDVLSLFSEESRNKSIELAVFVSDKVPEIVKGDSGRFRQIIINLVGN
FT                   SVKFTEKGHIFVKVHLAEQSKDESEPKNALNGGVSEEMIVVSKQSSYNTLSGYEAADGR
FT                   NSWDSFKHLVSEEQSLSEFDISSNVRLMVSIEDTGIGIPLVAQGRVFMPFMQADSSTSR
FT                   NYGGTGIGLSISKCLVELMRGQINFISRPHIGSTFWFTAVLEKCDKCSAINHMKKPNVE
FT                   HLPSTFKGMKAIVVDAKPVRAAVTRYHMKRLGINVDVVTSLKTAVVAAAAFERNGSPLP
FT                   TKPQLDMILVEKDSWISTEDNDSEIRLLNSRTNGNVHHKSPKLALFATNITNSEFDRAK
FT                   SAGFADTVIMKPLRASMIGACLQQVLELRKTRQQHPEGSSPATLKSLLTGKKILVVDDN
FT                   IVNRRVAAGALKKFGAEVVCAESGQVALGLLQIPHTFDACFMDIQMPQMDGFEATRQIR
FT                   MMEKETKEKTNLEWHLPILAMTADVIHATYEECLKSGMDGYVSKPFEEENLYKSVAKSF
FT                   KPNPISPSS"
FT   gene            complement(373125..378447)
FT                   /pseudo
FT                   /gene_synonym="T23K3.3"
FT                   /gene_synonym="T23K3_3"
FT                   /locus_tag="AT2G01840"
FT   mRNA            complement(<373125..>378447)
FT                   /pseudo
FT                   /gene_synonym="T23K3.3"
FT                   /gene_synonym="T23K3_3"
FT                   /locus_tag="AT2G01840"
FT                   /product="hypothetical protein"
FT   gene            385171..387478
FT                   /gene="EXGT-A3"
FT                   /gene_synonym="ATXTH27"
FT                   /gene_synonym="endoxyloglucan transferase A3"
FT                   /gene_synonym="T23K3.4"
FT                   /gene_synonym="T23K3_4"
FT                   /gene_synonym="XTH27"
FT                   /gene_synonym="XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE
FT                   27"
FT                   /locus_tag="AT2G01850"
FT                   /note="EXGT-A3 has homology to xyloglucan
FT                   endotransglucosylases/hydrolases (XTHs). Mutants in this
FT                   gene show a lesion mimic phenotype associated with leaf
FT                   maturation and a reduction in the number of tertiary veins.
FT                   Individual tracheary elements in the mutants are shorter,
FT                   but phloem transport activity is not severely affected.
FT                   EXGT-A3 plays a role in xyloglucan degradation in the
FT                   differentiating tracheary elements of rosette leaves."
FT   mRNA            join(385171..385557,385632..385732,385858..386066,
FT                   386631..387478)
FT                   /gene="EXGT-A3"
FT                   /gene_synonym="ATXTH27"
FT                   /gene_synonym="endoxyloglucan transferase A3"
FT                   /gene_synonym="T23K3.4"
FT                   /gene_synonym="T23K3_4"
FT                   /gene_synonym="XTH27"
FT                   /gene_synonym="XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE
FT                   27"
FT                   /locus_tag="AT2G01850"
FT                   /product="endoxyloglucan transferase A3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL079948.1,INSD:BP633300.1,INSD:BP628704.1,
FT                   INSD:ES012215.1,INSD:BP629097.1,INSD:BP667673.1,
FT                   INSD:DR341507.1,INSD:AV801549.1,INSD:CK117901.1,
FT                   INSD:DR341497.1,INSD:BP859933.1,INSD:EG517310.1,
FT                   INSD:EL246571.1,INSD:EL167506.1,INSD:BE526770.1,
FT                   INSD:BP590672.1,INSD:EG478776.1,INSD:CD533257.1,
FT                   INSD:DR341508.1,INSD:EH900132.1,INSD:EG526902.1,
FT                   INSD:DR341520.1,INSD:BP591984.1,INSD:EG497245.1,
FT                   INSD:ES179426.1,INSD:AV826785.1,INSD:EL304128.1,
FT                   INSD:ES153536.1,INSD:AV558372.1,INSD:BP844676.1,
FT                   INSD:EL266904.1,INSD:EH891649.1,INSD:BP793819.1,
FT                   INSD:BP782165.1,INSD:BP645389.1,INSD:DR372938.1,
FT                   INSD:ES110257.1,INSD:AV562032.1,INSD:EG517311.1,
FT                   INSD:DR341504.1,INSD:EG526903.1,INSD:EL122905.1,
FT                   INSD:AV813570.1,INSD:EL307474.1,INSD:BE037629.1,
FT                   INSD:DR341517.1,INSD:DR341518.1,INSD:N37447.1,
FT                   INSD:DR341511.1,INSD:EL028892.1,INSD:CD529965.1,
FT                   INSD:EL144012.1,INSD:EL036280.1,INSD:EL338248.1,
FT                   INSD:BP585316.1,INSD:DR341509.1,INSD:EL037160.1,
FT                   INSD:BP595585.1,INSD:BP663936.1,INSD:EL295384.1,
FT                   INSD:BP611677.1,INSD:EL049699.1,INSD:EH936398.1,
FT                   INSD:BP786667.1,INSD:DR341514.1,INSD:DR341522.1,
FT                   INSD:EL045995.1,INSD:ES075506.1,INSD:EH981808.1,
FT                   INSD:EH846846.1,INSD:EH837198.1,INSD:EH859914.1,
FT                   INSD:BP589862.1,INSD:DR341503.1,INSD:EH933653.1,
FT                   INSD:EL109021.1,INSD:EL307224.1,INSD:BP634906.1,
FT                   INSD:CA781839.1,INSD:EH937173.1,INSD:AI995783.1,
FT                   INSD:DR341500.1,INSD:BP860972.1,INSD:BP601117.1,
FT                   INSD:BP668156.1,INSD:EL213995.1,INSD:AV808814.1,
FT                   INSD:AV550129.1,INSD:BP650975.1,INSD:DR378042.1,
FT                   INSD:EH926621.1,INSD:DR341515.1,INSD:EH890758.1,
FT                   INSD:ES006311.1,INSD:DR341498.1,INSD:EL119841.1,
FT                   INSD:DR341501.1,INSD:DR341506.1,INSD:DR341519.1,
FT                   INSD:EH974471.1,INSD:EH844903.1,INSD:EH961487.1,
FT                   INSD:EG455516.1,INSD:EG497244.1,INSD:AV796252.1,
FT                   INSD:CD534773.1,INSD:EL258420.1,INSD:BP589697.1,
FT                   INSD:DR341502.1,INSD:BP586152.1,INSD:DR341512.1,
FT                   INSD:EL283299.1,INSD:EL174869.1,INSD:DR341521.1,
FT                   INSD:DR341505.1,INSD:AV815412.1,INSD:DR341496.1,
FT                   INSD:DR341510.1,INSD:DR341516.1,INSD:EL321506.1,
FT                   INSD:ES026088.1,INSD:BP778377.1,INSD:BP786265.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:D63509.1,INSD:AY085835.1,INSD:BT008820.1,
FT                   INSD:AY059910.1,INSD:BX819603.1"
FT   CDS_pept        join(385374..385557,385632..385732,385858..386066,
FT                   386631..387138)
FT                   /codon_start=1
FT                   /gene="EXGT-A3"
FT                   /gene_synonym="ATXTH27"
FT                   /gene_synonym="endoxyloglucan transferase A3"
FT                   /gene_synonym="T23K3.4"
FT                   /gene_synonym="T23K3_4"
FT                   /gene_synonym="XTH27"
FT                   /gene_synonym="XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE
FT                   27"
FT                   /locus_tag="AT2G01850"
FT                   /product="endoxyloglucan transferase A3"
FT                   /note="endoxyloglucan transferase A3 (EXGT-A3); FUNCTIONS
FT                   IN: hydrolase activity, acting on glycosyl bonds,
FT                   xyloglucan:xyloglucosyl transferase activity; INVOLVED IN:
FT                   phloem or xylem histogenesis; LOCATED IN: endomembrane
FT                   system, cell wall, apoplast; EXPRESSED IN: 25 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Xyloglucan
FT                   endotransglucosylase/hydrolase (InterPro:IPR016455),
FT                   Xyloglucan endo-transglycosylase, C-terminal
FT                   (InterPro:IPR010713), Concanavalin A-like lectin/glucanase,
FT                   subgroup (InterPro:IPR013320), Concanavalin A-like
FT                   lectin/glucanase (InterPro:IPR008985), Glycoside hydrolase,
FT                   family 16 (InterPro:IPR000757); BEST Arabidopsis thaliana
FT                   protein match is: xyloglucan endotransglucosylase/hydrolase
FT                   28 (TAIR:AT1G14720.1); Has 2101 Blast hits to 2091 proteins
FT                   in 291 species: Archae - 0; Bacteria - 238; Metazoa - 0;
FT                   Fungi - 449; Plants - 1341; Viruses - 0; Other Eukaryotes -
FT                   73 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01850"
FT                   /db_xref="GOA:Q8LDS2"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR010713"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR016455"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LDS2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL079948.1,INSD:BP633300.1,INSD:BP628704.1,
FT                   INSD:ES012215.1,INSD:BP629097.1,INSD:BP667673.1,
FT                   INSD:DR341507.1,INSD:AV801549.1,INSD:CK117901.1,
FT                   INSD:DR341497.1,INSD:BP859933.1,INSD:EG517310.1,
FT                   INSD:EL246571.1,INSD:EL167506.1,INSD:BE526770.1,
FT                   INSD:BP590672.1,INSD:EG478776.1,INSD:CD533257.1,
FT                   INSD:DR341508.1,INSD:EH900132.1,INSD:EG526902.1,
FT                   INSD:DR341520.1,INSD:BP591984.1,INSD:EG497245.1,
FT                   INSD:ES179426.1,INSD:AV826785.1,INSD:EL304128.1,
FT                   INSD:ES153536.1,INSD:AV558372.1,INSD:BP844676.1,
FT                   INSD:EL266904.1,INSD:EH891649.1,INSD:BP793819.1,
FT                   INSD:BP782165.1,INSD:BP645389.1,INSD:DR372938.1,
FT                   INSD:ES110257.1,INSD:AV562032.1,INSD:EG517311.1,
FT                   INSD:DR341504.1,INSD:EG526903.1,INSD:EL122905.1,
FT                   INSD:AV813570.1,INSD:EL307474.1,INSD:BE037629.1,
FT                   INSD:DR341517.1,INSD:DR341518.1,INSD:N37447.1,
FT                   INSD:DR341511.1,INSD:EL028892.1,INSD:CD529965.1,
FT                   INSD:EL144012.1,INSD:EL036280.1,INSD:EL338248.1,
FT                   INSD:BP585316.1,INSD:DR341509.1,INSD:EL037160.1,
FT                   INSD:BP595585.1,INSD:BP663936.1,INSD:EL295384.1,
FT                   INSD:BP611677.1,INSD:EL049699.1,INSD:EH936398.1,
FT                   INSD:BP786667.1,INSD:DR341514.1,INSD:DR341522.1,
FT                   INSD:EL045995.1,INSD:ES075506.1,INSD:EH981808.1,
FT                   INSD:EH846846.1,INSD:EH837198.1,INSD:EH859914.1,
FT                   INSD:BP589862.1,INSD:DR341503.1,INSD:EH933653.1,
FT                   INSD:EL109021.1,INSD:EL307224.1,INSD:BP634906.1,
FT                   INSD:CA781839.1,INSD:EH937173.1,INSD:AI995783.1,
FT                   INSD:DR341500.1,INSD:BP860972.1,INSD:BP601117.1,
FT                   INSD:BP668156.1,INSD:EL213995.1,INSD:AV808814.1,
FT                   INSD:AV550129.1,INSD:BP650975.1,INSD:DR378042.1,
FT                   INSD:EH926621.1,INSD:DR341515.1,INSD:EH890758.1,
FT                   INSD:ES006311.1,INSD:DR341498.1,INSD:EL119841.1,
FT                   INSD:DR341501.1,INSD:DR341506.1,INSD:DR341519.1,
FT                   INSD:EH974471.1,INSD:EH844903.1,INSD:EH961487.1,
FT                   INSD:EG455516.1,INSD:EG497244.1,INSD:AV796252.1,
FT                   INSD:CD534773.1,INSD:EL258420.1,INSD:BP589697.1,
FT                   INSD:DR341502.1,INSD:BP586152.1,INSD:DR341512.1,
FT                   INSD:EL283299.1,INSD:EL174869.1,INSD:DR341521.1,
FT                   INSD:DR341505.1,INSD:AV815412.1,INSD:DR341496.1,
FT                   INSD:DR341510.1,INSD:DR341516.1,INSD:EL321506.1,
FT                   INSD:ES026088.1,INSD:BP778377.1,INSD:BP786265.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:D63509.1,INSD:AY085835.1,INSD:BT008820.1,
FT                   INSD:AY059910.1,INSD:BX819603.1"
FT                   /protein_id="AEC05508.1"
FT                   /translation="METLSRLLVFMSLFSGLVSGFALQNLPITSFEESYTQLFGDKNLF
FT                   VHQDGKSVRLTLDERTGSGFVSNDYYLHGFFSASIKLPSDYTAGVVVAFYMSNGDMYEK
FT                   NHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREERYNLWFDPTEDFHQYSILWSDSH
FT                   IIFFVDNVPIREVKRTAEMGGHFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIAR
FT                   FSDLVLHGCPVDPIEQFPRCDEGAAEDMRAAQEITPSQRSKMDVFRRRLMTYSYCYDRA
FT                   RYNVALSECVVNPAEAQRLRVYDPVRFGGIPRRHRNGKHRSKRSRVDGTESI"
FT   gene            388055..389918
FT                   /gene="EMB975"
FT                   /gene_synonym="EMBRYO DEFECTIVE 975"
FT                   /gene_synonym="T23K3.5"
FT                   /gene_synonym="T23K3_5"
FT                   /locus_tag="AT2G01860"
FT   mRNA            388055..389918
FT                   /gene="EMB975"
FT                   /gene_synonym="EMBRYO DEFECTIVE 975"
FT                   /gene_synonym="T23K3.5"
FT                   /gene_synonym="T23K3_5"
FT                   /locus_tag="AT2G01860"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES182974.1,INSD:BP778824.1,INSD:EH903865.1,
FT                   INSD:EL020567.1,INSD:DR320552.1,INSD:AU228663.1,
FT                   INSD:ES164956.1,INSD:EH928458.1,INSD:ES055108.1,
FT                   INSD:EL250011.1,INSD:DR371404.1,INSD:AI995446.1,
FT                   INSD:AU237586.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX819947.1,INSD:BX819470.1,INSD:AK229094.1,
FT                   INSD:BT020200.1,INSD:BT015882.1"
FT   gene            complement(388080..388313)
FT                   /locus_tag="AT2G04125"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT2G01860"
FT   ncRNA           complement(388080..388313)
FT                   /locus_tag="AT2G04125"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   CDS_pept        388283..389743
FT                   /codon_start=1
FT                   /gene="EMB975"
FT                   /gene_synonym="EMBRYO DEFECTIVE 975"
FT                   /gene_synonym="T23K3.5"
FT                   /gene_synonym="T23K3_5"
FT                   /locus_tag="AT2G01860"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /note="EMBRYO DEFECTIVE 975 (EMB975); FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Pentatricopeptide repeat
FT                   (InterPro:IPR002885); BEST Arabidopsis thaliana protein
FT                   match is: LATERAL ORGAN JUNCTION (TAIR:AT2G39230.1); Has
FT                   35333 Blast hits to 34131 proteins in 2444 species: Archae
FT                   - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
FT                   - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01860"
FT                   /db_xref="GOA:Q5XET4"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XET4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES182974.1,INSD:BP778824.1,INSD:EH903865.1,
FT                   INSD:EL020567.1,INSD:DR320552.1,INSD:AU228663.1,
FT                   INSD:ES164956.1,INSD:EH928458.1,INSD:ES055108.1,
FT                   INSD:EL250011.1,INSD:DR371404.1,INSD:AI995446.1,
FT                   INSD:AU237586.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX819947.1,INSD:BX819470.1,INSD:AK229094.1,
FT                   INSD:BT020200.1,INSD:BT015882.1"
FT                   /protein_id="AEC05509.1"
FT                   /translation="MILHCPVSLSLSFHLNLRTSRIGNIGVTRVNASQRNHSKKLTKNL
FT                   RNPRRTKLPPDFGVNLFLRKPKIEPLVIDDDDEQVQESVNDDDDAVVWEPEEIEAISSL
FT                   FQKRIPQKPDKPSRVRPLPLPQPHKLRPLGLPTPKKNIIRSPALSSVSKQVYKDPSFLI
FT                   GLAREIKSLPSSDADVSLVLNKWVSFLRKGSLSTTIRELGHMGLPERALQTYHWAEKHS
FT                   HLVPDNRILASTIQVLAKHHELKLLKFDNSLASKNVIEAMIKGCIEGGWLNLARKLILI
FT                   SKSNNRILDSSVYVKMILEIAKNPDKYHLVVALLEELKKREDLKLSQQDCTSIMKICVK
FT                   LGEFELVESLFDWFKASNREPSVVMYTTMIHSRYSEQKYREAMSVVWEMEESNCLLDLP
FT                   AYRVVIKLFVALDDLGRAMRYYSKLKEAGFSPTYDIYRDMISVYTASGRLTKCKEICKE
FT                   VEDAGLRLDKDTSFRLLQLEKQTMSLLH"
FT   gene            complement(389470..390405)
FT                   /gene_synonym="T23K3.6"
FT                   /gene_synonym="T23K3_6"
FT                   /locus_tag="AT2G01870"
FT   mRNA            complement(389470..390405)
FT                   /gene_synonym="T23K3.6"
FT                   /gene_synonym="T23K3_6"
FT                   /locus_tag="AT2G01870"
FT                   /product="transmembrane protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH942505.1,INSD:EH823289.1,INSD:EH981992.1,
FT                   INSD:ES182974.1,INSD:EL340729.1,INSD:BP778824.1,
FT                   INSD:EL088428.1,INSD:DR320552.1,INSD:AU228663.1,
FT                   INSD:EL283985.1,INSD:EH866897.1,INSD:EH826802.1,
FT                   INSD:EL173777.1,INSD:EL298439.1,INSD:BP864067.1,
FT                   INSD:DR371404.1,INSD:AI995446.1,INSD:EH981149.1,
FT                   INSD:EL142314.1,INSD:EL203801.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT025731.1,INSD:AY088625.1,INSD:AK175254.1"
FT   CDS_pept        complement(389846..390319)
FT                   /codon_start=1
FT                   /gene_synonym="T23K3.6"
FT                   /gene_synonym="T23K3_6"
FT                   /locus_tag="AT2G01870"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: chloroplast thylakoid membrane, chloroplast; EXPRESSED
FT                   IN: 22 plant structures; EXPRESSED DURING: 13 growth
FT                   stages; Has 11 Blast hits to 11 proteins in 5 species:
FT                   Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants -
FT                   11; Viruses - 0; Other Eukaryotes - 0 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9SIS7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SIS7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH942505.1,INSD:EH823289.1,INSD:EH981992.1,
FT                   INSD:ES182974.1,INSD:EL340729.1,INSD:BP778824.1,
FT                   INSD:EL088428.1,INSD:DR320552.1,INSD:AU228663.1,
FT                   INSD:EL283985.1,INSD:EH866897.1,INSD:EH826802.1,
FT                   INSD:EL173777.1,INSD:EL298439.1,INSD:BP864067.1,
FT                   INSD:DR371404.1,INSD:AI995446.1,INSD:EH981149.1,
FT                   INSD:EL142314.1,INSD:EL203801.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT025731.1,INSD:AY088625.1,INSD:AK175254.1"
FT                   /protein_id="AEC05510.1"
FT                   /translation="MVVVLGLQSLKWYTHGRIMETKKKRHLMRIVQATEREDSFQIDRD
FT                   KAREALKQLDQQIESQADEKPRIINKTSSDVVRTNNDPIMFEEPPEISGSFLTSSAFVL
FT                   LALTLFYNILFITVIKPSMDGPESVPEENSVAMSDSDIVKFPLSSLPENTFKQ"
FT   gene            390175..390454
FT                   /locus_tag="AT2G04145"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT2G01870"
FT   ncRNA           390175..390454
FT                   /locus_tag="AT2G04145"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(391421..394184)
FT                   /gene="PAP7"
FT                   /gene_synonym="ATPAP7"
FT                   /gene_synonym="purple acid phosphatase 7"
FT                   /gene_synonym="PURPLE ACID PHOSPHATASE 7"
FT                   /gene_synonym="T23K3.7"
FT                   /gene_synonym="T23K3_7"
FT                   /locus_tag="AT2G01880"
FT   mRNA            complement(join(391421..391773,391884..391948,
FT                   392076..392204,392297..392424,392514..392621,
FT                   393023..393179,393779..394184))
FT                   /gene="PAP7"
FT                   /gene_synonym="ATPAP7"
FT                   /gene_synonym="purple acid phosphatase 7"
FT                   /gene_synonym="PURPLE ACID PHOSPHATASE 7"
FT                   /gene_synonym="T23K3.7"
FT                   /gene_synonym="T23K3_7"
FT                   /locus_tag="AT2G01880"
FT                   /product="purple acid phosphatase 7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR224199.1,INSD:BP802936.2,INSD:DR224203.1,
FT                   INSD:EG514473.1,INSD:DR224205.1,INSD:DR224204.1,
FT                   INSD:AU239713.1,INSD:DR224198.1,INSD:DR224201.1,
FT                   INSD:EG514410.1,INSD:BP852590.1,INSD:DR224200.1,
FT                   INSD:DR224202.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK118834.1,INSD:AF492659.1,INSD:BT026449.1"
FT   CDS_pept        complement(join(391563..391773,391884..391948,
FT                   392076..392204,392297..392424,392514..392621,
FT                   393023..393179,393779..393967))
FT                   /codon_start=1
FT                   /gene="PAP7"
FT                   /gene_synonym="ATPAP7"
FT                   /gene_synonym="purple acid phosphatase 7"
FT                   /gene_synonym="PURPLE ACID PHOSPHATASE 7"
FT                   /gene_synonym="T23K3.7"
FT                   /gene_synonym="T23K3_7"
FT                   /locus_tag="AT2G01880"
FT                   /product="purple acid phosphatase 7"
FT                   /note="purple acid phosphatase 7 (PAP7); FUNCTIONS IN:
FT                   protein serine/threonine phosphatase activity, acid
FT                   phosphatase activity; LOCATED IN: endomembrane system;
FT                   EXPRESSED IN: 7 plant structures; CONTAINS InterPro
FT                   DOMAIN/s: Metallophosphoesterase (InterPro:IPR004843); BEST
FT                   Arabidopsis thaliana protein match is: purple acid
FT                   phosphatase 17 (TAIR:AT3G17790.1); Has 30201 Blast hits to
FT                   17322 proteins in 780 species: Archae - 12; Bacteria -
FT                   1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses
FT                   - 0; Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8S341"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024927"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8S341"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR224199.1,INSD:BP802936.2,INSD:DR224203.1,
FT                   INSD:EG514473.1,INSD:DR224205.1,INSD:DR224204.1,
FT                   INSD:AU239713.1,INSD:DR224198.1,INSD:DR224201.1,
FT                   INSD:EG514410.1,INSD:BP852590.1,INSD:DR224200.1,
FT                   INSD:DR224202.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK118834.1,INSD:AF492659.1,INSD:BT026449.1"
FT                   /protein_id="AEC05511.1"
FT                   /translation="MKMHVCFSVILMFLSIFFINGALSKLERLKHPVKKKSDGSLSFLV
FT                   IGDWGRKGGFNQSLVAHQMGVVGEKLDIDFVISVGDNFYDDGLKGVNDPSFEASFSHIY
FT                   THPSLQKQWYSVLGNHDYRGNVEAQLSKVLTQKDWRWFCRRSFVLSSGMVDFFFADTNP
FT                   FVEKYFTEPEDHTYDWRNVLPRNKYISNLLHDLDLEIKKSRATWKFVVGHHGIKTAGNH
FT                   GVTQELVDQLLPILEENKVDLYINGHDHCLQHIGSHGKTQFLTSGGGSKAWRGHVQPWD
FT                   PKELKLYYDGQGFMSLHITHSKAKFIYYDVSGNVLHRSSLSKRSAHL"
FT   gene            complement(396756..399338)
FT                   /gene="PAP8"
FT                   /gene_synonym="ATPAP8"
FT                   /gene_synonym="purple acid phosphatase 8"
FT                   /gene_synonym="PURPLE ACID PHOSPHATASE 8"
FT                   /gene_synonym="T23K3.8"
FT                   /gene_synonym="T23K3_8"
FT                   /locus_tag="AT2G01890"
FT                   /note="Encodes a purple acid phosphatase (PAP) belonging to
FT                   the low molecular weight plant PAP group."
FT   mRNA            complement(join(396756..397201,397289..397356,
FT                   397446..397574,397728..397855,397923..398030,
FT                   398162..398318,398968..399338))
FT                   /gene="PAP8"
FT                   /gene_synonym="ATPAP8"
FT                   /gene_synonym="purple acid phosphatase 8"
FT                   /gene_synonym="PURPLE ACID PHOSPHATASE 8"
FT                   /gene_synonym="T23K3.8"
FT                   /gene_synonym="T23K3_8"
FT                   /locus_tag="AT2G01890"
FT                   /product="purple acid phosphatase 8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL048526.1,INSD:CD529453.1,INSD:BP618612.1,
FT                   INSD:BP802397.1,INSD:AV804832.1,INSD:AI992790.1,
FT                   INSD:EL171699.1,INSD:EL026442.1,INSD:BP618034.1,
FT                   INSD:BP669637.1,INSD:BP606321.1,INSD:EH880977.1,
FT                   INSD:EH802176.1,INSD:AV829182.1,INSD:BP627753.1,
FT                   INSD:BP797414.1,INSD:CD529635.1,INSD:EG516515.1,
FT                   INSD:AV815474.1,INSD:EH840366.1,INSD:EH836107.1,
FT                   INSD:AA586157.1,INSD:T45273.1,INSD:BP644624.1,
FT                   INSD:EL243367.1,INSD:EG516516.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX821902.1,INSD:AF492660.1,INSD:AY117232.1,
FT                   INSD:AY065434.1,INSD:BX821425.1,INSD:AF200827.1"
FT   mRNA            complement(join(396768..397201,397289..397356,
FT                   397446..397574,397728..397855,398007..398030,
FT                   398162..398318,398968..399208))
FT                   /gene="PAP8"
FT                   /gene_synonym="ATPAP8"
FT                   /gene_synonym="purple acid phosphatase 8"
FT                   /gene_synonym="PURPLE ACID PHOSPHATASE 8"
FT                   /gene_synonym="T23K3.8"
FT                   /gene_synonym="T23K3_8"
FT                   /locus_tag="AT2G01890"
FT                   /product="purple acid phosphatase 8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL048526.1,INSD:EH802176.1,INSD:BP627753.1,
FT                   INSD:BP797414.1,INSD:BP618612.1,INSD:BP802397.1,
FT                   INSD:AV804832.1,INSD:AV815474.1,INSD:EL171699.1,
FT                   INSD:EH840366.1,INSD:EL026442.1,INSD:BP618034.1,
FT                   INSD:EH836107.1,INSD:AA586157.1,INSD:BP644624.1,
FT                   INSD:EL243367.1,INSD:BP669637.1,INSD:BP606321.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX820634.1"
FT   mRNA            complement(join(396768..397201,397289..397356,
FT                   397446..397574,397728..397855,397923..398030,
FT                   398162..398566))
FT                   /gene="PAP8"
FT                   /gene_synonym="ATPAP8"
FT                   /gene_synonym="purple acid phosphatase 8"
FT                   /gene_synonym="PURPLE ACID PHOSPHATASE 8"
FT                   /gene_synonym="T23K3.8"
FT                   /gene_synonym="T23K3_8"
FT                   /locus_tag="AT2G01890"
FT                   /product="purple acid phosphatase 8"
FT   CDS_pept        complement(join(396985..397201,397289..397356,
FT                   397446..397574,397728..397855,398007..398030,
FT                   398162..398318,398968..399168))
FT                   /codon_start=1
FT                   /gene="PAP8"
FT                   /gene_synonym="ATPAP8"
FT                   /gene_synonym="purple acid phosphatase 8"
FT                   /gene_synonym="PURPLE ACID PHOSPHATASE 8"
FT                   /gene_synonym="T23K3.8"
FT                   /gene_synonym="T23K3_8"
FT                   /locus_tag="AT2G01890"
FT                   /product="purple acid phosphatase 8"
FT                   /note="purple acid phosphatase 8 (PAP8); FUNCTIONS IN:
FT                   protein serine/threonine phosphatase activity, acid
FT                   phosphatase activity; INVOLVED IN: dephosphorylation;
FT                   LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 12 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Metallophosphoesterase
FT                   (InterPro:IPR004843); BEST Arabidopsis thaliana protein
FT                   match is: purple acid phosphatase 3 (TAIR:AT1G14700.1); Has
FT                   35333 Blast hits to 34131 proteins in 2444 species: Archae
FT                   - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
FT                   - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01890"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01890.1"
FT                   /db_xref="GOA:Q8VYZ2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024927"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VYZ2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL048526.1,INSD:EH802176.1,INSD:BP627753.1,
FT                   INSD:BP797414.1,INSD:BP618612.1,INSD:BP802397.1,
FT                   INSD:AV804832.1,INSD:AV815474.1,INSD:EL171699.1,
FT                   INSD:EH840366.1,INSD:EL026442.1,INSD:BP618034.1,
FT                   INSD:EH836107.1,INSD:AA586157.1,INSD:BP644624.1,
FT                   INSD:EL243367.1,INSD:BP669637.1,INSD:BP606321.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX820634.1"
FT                   /protein_id="AEC05513.1"
FT                   /translation="MDSLRDVKPIKLIFSIFCLVIILSACNSTAELPRFVQPPEPDGSL
FT                   SFLVVGDWGRRGSYNQSQVALQMGKIGKDLNIDFLISTGDNFYDDGIISPYDSQFQDSF
FT                   TNIYTATSLQKPWYNVLGNHDYREIVDIFFVDTTPFVDRYFDEPKDHVYDWRGVLPRNK
FT                   YLNSLLTDVDVALQESMAKWKIVVGHHTIKSAGHHGNTIELEKQLLPILEANEVDLYIN
FT                   GHDHCLEHISSINSGIQFMTSGGGSKAWKGDVNDWNPQEMRFYYDGQGFMSVYTSEAEL
FT                   RVVFYDGLGHVLHRWSTLKNGVYSDI"
FT   CDS_pept        complement(join(396985..397201,397289..397356,
FT                   397446..397574,397728..397855,397923..398030,
FT                   398162..398318,398968..399168))
FT                   /codon_start=1
FT                   /gene="PAP8"
FT                   /gene_synonym="ATPAP8"
FT                   /gene_synonym="purple acid phosphatase 8"
FT                   /gene_synonym="PURPLE ACID PHOSPHATASE 8"
FT                   /gene_synonym="T23K3.8"
FT                   /gene_synonym="T23K3_8"
FT                   /locus_tag="AT2G01890"
FT                   /product="purple acid phosphatase 8"
FT                   /note="purple acid phosphatase 8 (PAP8); FUNCTIONS IN:
FT                   protein serine/threonine phosphatase activity, acid
FT                   phosphatase activity; INVOLVED IN: dephosphorylation;
FT                   LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 12 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Metallophosphoesterase
FT                   (InterPro:IPR004843); BEST Arabidopsis thaliana protein
FT                   match is: purple acid phosphatase 3 (TAIR:AT1G14700.1); Has
FT                   30201 Blast hits to 17322 proteins in 780 species: Archae -
FT                   12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants
FT                   - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q8VYZ2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024927"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VYZ2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL048526.1,INSD:CD529453.1,INSD:BP618612.1,
FT                   INSD:BP802397.1,INSD:AV804832.1,INSD:AI992790.1,
FT                   INSD:EL171699.1,INSD:EL026442.1,INSD:BP618034.1,
FT                   INSD:BP669637.1,INSD:BP606321.1,INSD:EH880977.1,
FT                   INSD:EH802176.1,INSD:AV829182.1,INSD:BP627753.1,
FT                   INSD:BP797414.1,INSD:CD529635.1,INSD:EG516515.1,
FT                   INSD:AV815474.1,INSD:EH840366.1,INSD:EH836107.1,
FT                   INSD:AA586157.1,INSD:T45273.1,INSD:BP644624.1,
FT                   INSD:EL243367.1,INSD:EG516516.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX821902.1,INSD:AF492660.1,INSD:AY117232.1,
FT                   INSD:AY065434.1,INSD:BX821425.1,INSD:AF200827.1"
FT                   /protein_id="AEC05512.1"
FT                   /translation="MDSLRDVKPIKLIFSIFCLVIILSACNSTAELPRFVQPPEPDGSL
FT                   SFLVVGDWGRRGSYNQSQVALQMGKIGKDLNIDFLISTGDNFYDDGIISPYDSQFQDSF
FT                   TNIYTATSLQKPWYNVLGNHDYRGNVYAQLSPILRDLDCRWICLRSYVVNAEIVDIFFV
FT                   DTTPFVDRYFDEPKDHVYDWRGVLPRNKYLNSLLTDVDVALQESMAKWKIVVGHHTIKS
FT                   AGHHGNTIELEKQLLPILEANEVDLYINGHDHCLEHISSINSGIQFMTSGGGSKAWKGD
FT                   VNDWNPQEMRFYYDGQGFMSVYTSEAELRVVFYDGLGHVLHRWSTLKNGVYSDI"
FT   CDS_pept        complement(join(396985..397201,397289..397356,
FT                   397446..397574,397728..397855,397923..398030,
FT                   398162..398318))
FT                   /codon_start=1
FT                   /gene="PAP8"
FT                   /gene_synonym="ATPAP8"
FT                   /gene_synonym="purple acid phosphatase 8"
FT                   /gene_synonym="PURPLE ACID PHOSPHATASE 8"
FT                   /gene_synonym="T23K3.8"
FT                   /gene_synonym="T23K3_8"
FT                   /locus_tag="AT2G01890"
FT                   /product="purple acid phosphatase 8"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01890"
FT                   /db_xref="GOA:A0A1P8B2S6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024927"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B2S6"
FT                   /protein_id="ANM63172.1"
FT                   /translation="MGKIGKDLNIDFLISTGDNFYDDGIISPYDSQFQDSFTNIYTATS
FT                   LQKPWYNVLGNHDYRGNVYAQLSPILRDLDCRWICLRSYVVNAEIVDIFFVDTTPFVDR
FT                   YFDEPKDHVYDWRGVLPRNKYLNSLLTDVDVALQESMAKWKIVVGHHTIKSAGHHGNTI
FT                   ELEKQLLPILEANEVDLYINGHDHCLEHISSINSGIQFMTSGGGSKAWKGDVNDWNPQE
FT                   MRFYYDGQGFMSVYTSEAELRVVFYDGLGHVLHRWSTLKNGVYSDI"
FT   gene            405762..409203
FT                   /gene_synonym="T23K3.9"
FT                   /gene_synonym="T23K3_9"
FT                   /locus_tag="AT2G01900"
FT   mRNA            join(405762..406311,406684..406791,406885..407188,
FT                   407812..407996,408268..408376,408475..408626,
FT                   408714..409203)
FT                   /gene_synonym="T23K3.9"
FT                   /gene_synonym="T23K3_9"
FT                   /locus_tag="AT2G01900"
FT                   /product="DNAse I-like superfamily protein"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX818920.1"
FT   mRNA            join(405762..406311,406684..406791,406885..407188,
FT                   407812..407996,408268..408376,408502..408626,
FT                   408714..409203)
FT                   /gene_synonym="T23K3.9"
FT                   /gene_synonym="T23K3_9"
FT                   /locus_tag="AT2G01900"
FT                   /product="DNAse I-like superfamily protein"
FT   mRNA            join(405762..405987,406133..406311,406684..406791,
FT                   406885..407188,407812..407996,408268..408376,
FT                   408475..408626,408714..409203)
FT                   /gene_synonym="T23K3.9"
FT                   /gene_synonym="T23K3_9"
FT                   /locus_tag="AT2G01900"
FT                   /product="DNAse I-like superfamily protein"
FT   CDS_pept        join(405967..405987,406133..406311,406684..406791,
FT                   406885..407188,407812..407996,408268..408376,
FT                   408475..408626,408714..408933)
FT                   /codon_start=1
FT                   /gene_synonym="T23K3.9"
FT                   /gene_synonym="T23K3_9"
FT                   /locus_tag="AT2G01900"
FT                   /product="DNAse I-like superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01900"
FT                   /db_xref="GOA:A0A1P8AXI3"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AXI3"
FT                   /protein_id="ANM61330.1"
FT                   /translation="MLGSYREVMWPRLVANKILRKSLGSNNFVADFPPNTDQKLIEASG
FT                   LADERSKSILHNQHKTTLLNYKVFVSTWNVGGIVPDDGLDMEDLLETHKTPCDIYVLGF
FT                   QEVVPLRASNVLGSDNNKVSTKWNSLIRDALNKRARPHRDEDLSESKGINGISQDFRCI
FT                   ISKQMVGILITVWVRGDLWPYIRYPSVSCVGCGIMGCLGNKGSVSVRFQLHETTFCFVC
FT                   SHLASGGRDRDERQRNSDVNEILARSSFPRGSSLDLPKKILDHDRVIFLGDLNYRISLP
FT                   EEKTRLLVESKKWNILLENDQLRMEIMNGQIFRGWQEGIVKFAPTYKYVPNSDLYYGCI
FT                   TYKKDEKKRAPAWCDRIIWYGNGLKQHEYTRGETKISDHRPVKAIFTTEITVTRRGKKI
FT                   RNFFFSDRFEERIGDIDSKDYSWIST"
FT   CDS_pept        join(406136..406311,406684..406791,406885..407188,
FT                   407812..407996,408268..408376,408475..408626,
FT                   408714..408933)
FT                   /codon_start=1
FT                   /gene_synonym="T23K3.9"
FT                   /gene_synonym="T23K3_9"
FT                   /locus_tag="AT2G01900"
FT                   /product="DNAse I-like superfamily protein"
FT                   /note="DNAse I-like superfamily protein; FUNCTIONS IN:
FT                   hydrolase activity, inositol or phosphatidylinositol
FT                   phosphatase activity; INVOLVED IN: biological_process
FT                   unknown; EXPRESSED IN: hypocotyl, sepal, root; EXPRESSED
FT                   DURING: 4 anthesis; CONTAINS InterPro DOMAIN/s: Inositol
FT                   polyphosphate related phosphatase (InterPro:IPR000300),
FT                   Endonuclease/exonuclease/phosphatase (InterPro:IPR005135);
FT                   BEST Arabidopsis thaliana protein match is: DNAse I-like
FT                   superfamily protein (TAIR:AT2G37440.1); Has 2320 Blast hits
FT                   to 2027 proteins in 223 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 735; Fungi - 544; Plants - 769; Viruses - 0;
FT                   Other Eukaryotes - 272 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01900.1"
FT                   /db_xref="GOA:Q9SIS4"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SIS4"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX818920.1"
FT                   /protein_id="AEC05514.1"
FT                   /translation="MWPRLVANKILRKSLGSNNFVADFPPNTDQKLIEASGLADERSKS
FT                   ILHNQHKTTLLNYKVFVSTWNVGGIVPDDGLDMEDLLETHKTPCDIYVLGFQEVVPLRA
FT                   SNVLGSDNNKVSTKWNSLIRDALNKRARPHRDEDLSESKGINGISQDFRCIISKQMVGI
FT                   LITVWVRGDLWPYIRYPSVSCVGCGIMGCLGNKGSVSVRFQLHETTFCFVCSHLASGGR
FT                   DRDERQRNSDVNEILARSSFPRGSSLDLPKKILDHDRVIFLGDLNYRISLPEEKTRLLV
FT                   ESKKWNILLENDQLRMEIMNGQIFRGWQEGIVKFAPTYKYVPNSDLYYGCITYKKDEKK
FT                   RAPAWCDRIIWYGNGLKQHEYTRGETKISDHRPVKAIFTTEITVTRRGKKIRNFFFSDR
FT                   FEERIGDIDSKDYSWIST"
FT   CDS_pept        join(406136..406311,406684..406791,406885..407188,
FT                   407812..407996,408268..408376,408502..408626,
FT                   408714..408933)
FT                   /codon_start=1
FT                   /gene_synonym="T23K3.9"
FT                   /gene_synonym="T23K3_9"
FT                   /locus_tag="AT2G01900"
FT                   /product="DNAse I-like superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01900"
FT                   /db_xref="GOA:A0A1P8AXD3"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AXD3"
FT                   /protein_id="ANM61331.1"
FT                   /translation="MWPRLVANKILRKSLGSNNFVADFPPNTDQKLIEASGLADERSKS
FT                   ILHNQHKTTLLNYKVFVSTWNVGGIVPDDGLDMEDLLETHKTPCDIYVLGFQEVVPLRA
FT                   SNVLGSDNNKVSTKWNSLIRDALNKRARPHRDEDLSESKGINGISQDFRCIISKQMVGI
FT                   LITVWVRGDLWPYIRYPSVSCVGCGIMGCLGNKGSVSVRFQLHETTFCFVCSHLASGGR
FT                   DRDERQRNSDVNEILARSSFPRGSSLDLPKKILDHDRVIFLGDLNYRISLPEEKTRLLV
FT                   ESKKWNILLENDQIFRGWQEGIVKFAPTYKYVPNSDLYYGCITYKKDEKKRAPAWCDRI
FT                   IWYGNGLKQHEYTRGETKISDHRPVKAIFTTEITVTRRGKKIRNFFFSDRFEERIGDID
FT                   SKDYSWIST"
FT   gene            410321..416000
FT                   /gene="CYCJ18"
FT                   /gene_synonym="cyclin J18"
FT                   /locus_tag="AT2G01905"
FT                   /note="cyclin J18 (cycJ18)"
FT   mRNA            join(410321..410435,410545..410621,410933..411032,
FT                   411121..411219,411300..411317,411417..411487,
FT                   411598..411724,411843..411903,413389..416000)
FT                   /gene="CYCJ18"
FT                   /gene_synonym="cyclin J18"
FT                   /locus_tag="AT2G01905"
FT                   /product="cyclin J18"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG503971.1,INSD:EG503970.1,INSD:EG503967.1,
FT                   INSD:EG503968.1,INSD:EG503969.1"
FT   CDS_pept        join(410373..410435,410545..410621,410933..411032,
FT                   411121..411219,411300..411317,411417..411487,
FT                   411598..411724,411843..411903,413389..413477)
FT                   /codon_start=1
FT                   /gene="CYCJ18"
FT                   /gene_synonym="cyclin J18"
FT                   /locus_tag="AT2G01905"
FT                   /product="cyclin J18"
FT                   /note="cyclin J18 (CYCJ18); CONTAINS InterPro DOMAIN/s:
FT                   Cyclin-like (InterPro:IPR011028), Cyclin-related
FT                   (InterPro:IPR013763), Cyclin, N-terminal
FT                   (InterPro:IPR006671), Cyclin (InterPro:IPR006670); Has
FT                   35333 Blast hits to 34131 proteins in 2444 species: Archae
FT                   - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
FT                   - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01905"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01905.1"
FT                   /db_xref="GOA:Q9C5X2"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5X2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG503971.1,INSD:EG503970.1,INSD:EG503967.1,
FT                   INSD:EG503968.1,INSD:EG503969.1"
FT                   /protein_id="AEC05515.1"
FT                   /translation="MSTEIGHLRRRLVEFLIQSTTLLELPPIVKYSALSLFFDRFRPNL
FT                   VRFLQKKKAEHWLLQPLNESNLQLFVLISIWISCKMHCTRGLSVHSLKSFGDKVITEQL
FT                   FMVRDFLDAELVFLKVLKFEIGTLNIAYTRLEDLLIQFKEVAKVGEQLNFEACMDMMDL
FT                   LYEKEDTSLLYQSSKSLAASILVSSYIITVPKQQYEFPILPWVKMVTNKEEREVVELVE
FT                   YILAHVLYSNSP"
FT   gene            416021..420661
FT                   /gene="ATMAP65-6"
FT                   /gene_synonym="MAP65-6"
FT                   /gene_synonym="T23K3.10"
FT                   /gene_synonym="T23K3_10"
FT                   /locus_tag="AT2G01910"
FT                   /note="Binds microtubules. Induces a crisscross mesh of
FT                   microtubules, not bundles. Not involved in microtubule
FT                   polymerization nor nucleation. Localizes to mitochondria."
FT   mRNA            join(416021..417268,417653..417856,417957..418226,
FT                   418299..418514,418621..418776,418861..419020,
FT                   419114..419265,419336..419423,419515..419588,
FT                   419671..419745,419829..420202,420305..420661)
FT                   /gene="ATMAP65-6"
FT                   /gene_synonym="MAP65-6"
FT                   /gene_synonym="T23K3.10"
FT                   /gene_synonym="T23K3_10"
FT                   /locus_tag="AT2G01910"
FT                   /product="Microtubule associated protein (MAP65/ASE1)
FT                   family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV533722.1,INSD:ES135132.1,INSD:EL288274.1,
FT                   INSD:ES195774.1,INSD:ES014775.1,INSD:ES111944.1,
FT                   INSD:ES214540.1,INSD:EH994726.1,INSD:AV562298.1,
FT                   INSD:EH961577.1,INSD:EL052921.1,INSD:AU228527.1,
FT                   INSD:BP809577.1,INSD:BP807413.1,INSD:EL225104.1,
FT                   INSD:EL226186.1,INSD:EH963467.1,INSD:EH934241.1,
FT                   INSD:ES136670.1,INSD:ES197002.1,INSD:EL309347.1,
FT                   INSD:ES035909.1,INSD:EL976385.1,INSD:EL153020.1,
FT                   INSD:EL296519.1,INSD:ES031823.1,INSD:ES026308.1,
FT                   INSD:ES029752.1,INSD:EL122795.1,INSD:BP603864.1,
FT                   INSD:EL227568.1,INSD:ES016867.1"
FT   CDS_pept        join(417191..417268,417653..417856,417957..418226,
FT                   418299..418514,418621..418776,418861..419020,
FT                   419114..419265,419336..419423,419515..419588,
FT                   419671..419745,419829..420182)
FT                   /codon_start=1
FT                   /gene="ATMAP65-6"
FT                   /gene_synonym="MAP65-6"
FT                   /gene_synonym="T23K3.10"
FT                   /gene_synonym="T23K3_10"
FT                   /locus_tag="AT2G01910"
FT                   /product="Microtubule associated protein (MAP65/ASE1)
FT                   family protein"
FT                   /note="ATMAP65-6; CONTAINS InterPro DOMAIN/s:
FT                   Microtubule-associated protein, MAP65/ASE1-type
FT                   (InterPro:IPR007145); BEST Arabidopsis thaliana protein
FT                   match is: microtubule-associated protein 65-7
FT                   (TAIR:AT1G14690.2); Has 5922 Blast hits to 4912 proteins in
FT                   547 species: Archae - 118; Bacteria - 527; Metazoa - 2917;
FT                   Fungi - 542; Plants - 628; Viruses - 11; Other Eukaryotes -
FT                   1179 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9SIS3"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SIS3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV533722.1,INSD:ES135132.1,INSD:EL288274.1,
FT                   INSD:ES195774.1,INSD:ES014775.1,INSD:ES111944.1,
FT                   INSD:ES214540.1,INSD:EH994726.1,INSD:AV562298.1,
FT                   INSD:EH961577.1,INSD:EL052921.1,INSD:AU228527.1,
FT                   INSD:BP809577.1,INSD:BP807413.1,INSD:EL225104.1,
FT                   INSD:EL226186.1,INSD:EH963467.1,INSD:EH934241.1,
FT                   INSD:ES136670.1,INSD:ES197002.1,INSD:EL309347.1,
FT                   INSD:ES035909.1,INSD:EL976385.1,INSD:EL153020.1,
FT                   INSD:EL296519.1,INSD:ES031823.1,INSD:ES026308.1,
FT                   INSD:ES029752.1,INSD:EL122795.1,INSD:BP603864.1,
FT                   INSD:EL227568.1,INSD:ES016867.1"
FT                   /protein_id="AEC05516.1"
FT                   /translation="MLEIGSPNALFFRTNTTCNNLLRELQKIWVEIGETETEKDRMLME
FT                   LERECLQIYQRKVDEAANSKAKLHQSVASIEAEVASLMAALGVLNINSPIKLDKGSKSL
FT                   KEKLAAVTPLVEELRIQKEERMKQFSDIKAQIEKISGEISGYSDHLNKAMNISLTLEEQ
FT                   DLTLRNLNEYQTHLRTLQKEKSDRLNKVLGYVNEVHALCGVLGVDFSQTVSAVHPSLHR
FT                   TDQEQSTNISDSTLEGLEHMIQKLKTERKSRFQKLKDVVASLFELWNLMDTPQEDRTKF
FT                   GKVTYVVRSSEANITEPGILSTETIEQVSTEVDSLSKLKASRMKELVMKRRSELEDLCR
FT                   LTHIQPDTSTSAEKSTALIDSGLVDPSELLANIEMQINKIKDEAQSRKDIMDRIDRWLS
FT                   ACEEENWLEEYNLDENRYSAGRGGHVNLKRAERARVTINKIPGMVDTLIKKTLVWEEDM
FT                   QKSFLYDGVRLVNILEDYKLTRKQQEEEKKRYRDQKKRQDLLLTQRESIYGSKPSPRRS
FT                   SSFRKPNGFNISNGNGSVPPTPRRGSVGTTTPDVLLTPRSYSGHHRQNGYFKEVRRLST
FT                   TPLNYVAMQKEDTVSTTYTSIYSSEPDSPLQG"
FT   mRNA            join(417427..417487,417653..417856,417957..418226,
FT                   418299..418514,418621..418776,418861..419020,
FT                   419114..419265,419336..419423,419515..419588,
FT                   419671..419745,419829..420202,420305..420588)
FT                   /gene="ATMAP65-6"
FT                   /gene_synonym="MAP65-6"
FT                   /gene_synonym="T23K3.10"
FT                   /gene_synonym="T23K3_10"
FT                   /locus_tag="AT2G01910"
FT                   /product="Microtubule associated protein (MAP65/ASE1)
FT                   family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV533722.1,INSD:ES135132.1,INSD:EL288274.1,
FT                   INSD:ES195774.1,INSD:ES014775.1,INSD:ES111944.1,
FT                   INSD:ES214540.1,INSD:EH994726.1,INSD:AV562298.1,
FT                   INSD:EH961577.1,INSD:EL052921.1,INSD:AU228527.1,
FT                   INSD:EL225104.1,INSD:EL226186.1,INSD:AU237456.1,
FT                   INSD:EH963467.1,INSD:EH934241.1,INSD:ES136670.1,
FT                   INSD:ES197002.1,INSD:EL309347.1,INSD:ES035909.1,
FT                   INSD:EL976385.1,INSD:EL153020.1,INSD:ES031823.1,
FT                   INSD:ES026308.1,INSD:ES029752.1,INSD:EL122795.1,
FT                   INSD:BP603864.1,INSD:EL227568.1,INSD:ES016867.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK228964.1"
FT   CDS_pept        join(417698..417856,417957..418226,418299..418514,
FT                   418621..418776,418861..419020,419114..419265,
FT                   419336..419423,419515..419588,419671..419745,
FT                   419829..420182)
FT                   /codon_start=1
FT                   /gene="ATMAP65-6"
FT                   /gene_synonym="MAP65-6"
FT                   /gene_synonym="T23K3.10"
FT                   /gene_synonym="T23K3_10"
FT                   /locus_tag="AT2G01910"
FT                   /product="Microtubule associated protein (MAP65/ASE1)
FT                   family protein"
FT                   /note="ATMAP65-6; CONTAINS InterPro DOMAIN/s:
FT                   Microtubule-associated protein, MAP65/ASE1-type
FT                   (InterPro:IPR007145); BEST Arabidopsis thaliana protein
FT                   match is: microtubule-associated protein 65-7
FT                   (TAIR:AT1G14690.2); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01910"
FT                   /db_xref="GOA:Q9SIS3"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SIS3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV533722.1,INSD:ES135132.1,INSD:EL288274.1,
FT                   INSD:ES195774.1,INSD:ES014775.1,INSD:ES111944.1,
FT                   INSD:ES214540.1,INSD:EH994726.1,INSD:AV562298.1,
FT                   INSD:EH961577.1,INSD:EL052921.1,INSD:AU228527.1,
FT                   INSD:EL225104.1,INSD:EL226186.1,INSD:AU237456.1,
FT                   INSD:EH963467.1,INSD:EH934241.1,INSD:ES136670.1,
FT                   INSD:ES197002.1,INSD:EL309347.1,INSD:ES035909.1,
FT                   INSD:EL976385.1,INSD:EL153020.1,INSD:ES031823.1,
FT                   INSD:ES026308.1,INSD:ES029752.1,INSD:EL122795.1,
FT                   INSD:BP603864.1,INSD:EL227568.1,INSD:ES016867.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK228964.1"
FT                   /protein_id="AEC05517.1"
FT                   /translation="MLMELERECLQIYQRKVDEAANSKAKLHQSVASIEAEVASLMAAL
FT                   GVLNINSPIKLDKGSKSLKEKLAAVTPLVEELRIQKEERMKQFSDIKAQIEKISGEISG
FT                   YSDHLNKAMNISLTLEEQDLTLRNLNEYQTHLRTLQKEKSDRLNKVLGYVNEVHALCGV
FT                   LGVDFSQTVSAVHPSLHRTDQEQSTNISDSTLEGLEHMIQKLKTERKSRFQKLKDVVAS
FT                   LFELWNLMDTPQEDRTKFGKVTYVVRSSEANITEPGILSTETIEQVSTEVDSLSKLKAS
FT                   RMKELVMKRRSELEDLCRLTHIQPDTSTSAEKSTALIDSGLVDPSELLANIEMQINKIK
FT                   DEAQSRKDIMDRIDRWLSACEEENWLEEYNLDENRYSAGRGGHVNLKRAERARVTINKI
FT                   PGMVDTLIKKTLVWEEDMQKSFLYDGVRLVNILEDYKLTRKQQEEEKKRYRDQKKRQDL
FT                   LLTQRESIYGSKPSPRRSSSFRKPNGFNISNGNGSVPPTPRRGSVGTTTPDVLLTPRSY
FT                   SGHHRQNGYFKEVRRLSTTPLNYVAMQKEDTVSTTYTSIYSSEPDSPLQG"
FT   gene            complement(421608..422643)
FT                   /locus_tag="AT2G01913"
FT   mRNA            complement(join(421608..422166,422241..422399,
FT                   422552..422643))
FT                   /locus_tag="AT2G01913"
FT                   /product="hypothetical protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES132440.1,INSD:EG455316.1,INSD:EG502155.1,
FT                   INSD:EG455318.1,INSD:EG455323.1,INSD:EG455322.1,
FT                   INSD:EG455312.1,INSD:EG455321.1,INSD:EG462879.1,
FT                   INSD:ES163295.1,INSD:EG462871.1,INSD:EG455315.1,
FT                   INSD:EG462882.1,INSD:EG462880.1,INSD:EH924249.1,
FT                   INSD:EG462875.1,INSD:EG462872.1,INSD:ES212109.1,
FT                   INSD:EL976759.1,INSD:EG462878.1,INSD:EG502152.1,
FT                   INSD:ES170823.1,INSD:EG462873.1,INSD:EG462867.1,
FT                   INSD:EG462877.1,INSD:EG462868.1,INSD:EG455317.1,
FT                   INSD:EG455324.1,INSD:EG500228.1,INSD:EG500217.1,
FT                   INSD:EG455313.1,INSD:EG455310.1,INSD:EG455325.1,
FT                   INSD:EG455314.1,INSD:EG455320.1,INSD:EG455309.1,
FT                   INSD:EG462876.1,INSD:EG502143.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:EF182944.1,INSD:BT030659.1,INSD:DQ487505.1"
FT   CDS_pept        complement(join(421927..422166,422241..422399,
FT                   422552..422569))
FT                   /codon_start=1
FT                   /locus_tag="AT2G01913"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01913.1"
FT                   /db_xref="GOA:Q1G3S9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1G3S9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES132440.1,INSD:EG455316.1,INSD:EG502155.1,
FT                   INSD:EG455318.1,INSD:EG455323.1,INSD:EG455322.1,
FT                   INSD:EG455312.1,INSD:EG455321.1,INSD:EG462879.1,
FT                   INSD:ES163295.1,INSD:EG462871.1,INSD:EG455315.1,
FT                   INSD:EG462882.1,INSD:EG462880.1,INSD:EH924249.1,
FT                   INSD:EG462875.1,INSD:EG462872.1,INSD:ES212109.1,
FT                   INSD:EL976759.1,INSD:EG462878.1,INSD:EG502152.1,
FT                   INSD:ES170823.1,INSD:EG462873.1,INSD:EG462867.1,
FT                   INSD:EG462877.1,INSD:EG462868.1,INSD:EG455317.1,
FT                   INSD:EG455324.1,INSD:EG500228.1,INSD:EG500217.1,
FT                   INSD:EG455313.1,INSD:EG455310.1,INSD:EG455325.1,
FT                   INSD:EG455314.1,INSD:EG455320.1,INSD:EG455309.1,
FT                   INSD:EG462876.1,INSD:EG502143.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:EF182944.1,INSD:BT030659.1,INSD:DQ487505.1"
FT                   /protein_id="AEC05518.1"
FT                   /translation="MDFDSADKRESVEETVMMEYDEETNQFDVEFCPVEHPIEPEEEDR
FT                   PVKCPVPISSSLIHKPKEKSKPGWVKHRASSYETPVYPPPRHHVRNVRKRHNSFDVEGN
FT                   NNFFTRSHDDDETTSRRSNVTFYRVLQQVQEFES"
FT   gene            complement(424060..425810)
FT                   /gene="PQL3"
FT                   /gene_synonym="PsbQ-like 3"
FT                   /locus_tag="AT2G01918"
FT                   /note="Encode a protein homologous to each PQL protein.
FT                   Mutational analysis indicates that PQL3 is also required
FT                   for NDH activity."
FT   mRNA            complement(join(424060..424349,424428..424634,
FT                   425418..425810))
FT                   /gene="PQL3"
FT                   /gene_synonym="PsbQ-like 3"
FT                   /locus_tag="AT2G01918"
FT                   /product="PsbQ-like 3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG501015.1,INSD:EG501025.1,INSD:EG462171.1,
FT                   INSD:EG501010.1,INSD:EG455996.1,INSD:EG462159.1,
FT                   INSD:EG462172.1,INSD:DR311566.1,INSD:EG462143.1,
FT                   INSD:EG501019.1,INSD:EG501011.1,INSD:DR375525.1,
FT                   INSD:EG462165.1,INSD:EG455995.1,INSD:EG462155.1,
FT                   INSD:EG462139.1,INSD:EG462161.1,INSD:EG462157.1,
FT                   INSD:EG462164.1,INSD:EG501008.1,INSD:EG501021.1,
FT                   INSD:EG462162.1,INSD:EG462145.1,INSD:EG501014.1,
FT                   INSD:EG462166.1,INSD:EG501027.1,INSD:EG462146.1,
FT                   INSD:EH878976.1,INSD:EG501012.1,INSD:EG462144.1,
FT                   INSD:EG462156.1,INSD:EG501072.1,INSD:EL117125.1,
FT                   INSD:EG501013.1,INSD:EG462160.1,INSD:EG462147.1,
FT                   INSD:EG501026.1,INSD:EG455994.1,INSD:EG462173.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ487506.1,INSD:EF182946.1,INSD:DQ108851.1"
FT   CDS_pept        complement(join(424254..424349,424428..424634,
FT                   425418..425678))
FT                   /codon_start=1
FT                   /gene="PQL3"
FT                   /gene_synonym="PsbQ-like 3"
FT                   /locus_tag="AT2G01918"
FT                   /product="PsbQ-like 3"
FT                   /note="PsbQ-like 3 (PQL3); CONTAINS InterPro DOMAIN/s:
FT                   Photosystem II oxygen evolving complex protein PsbQ
FT                   (InterPro:IPR008797); BEST Arabidopsis thaliana protein
FT                   match is: photosystem II subunit QA (TAIR:AT4G21280.2); Has
FT                   35333 Blast hits to 34131 proteins in 2444 species: Archae
FT                   - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
FT                   - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01918"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01918.1"
FT                   /db_xref="GOA:Q2V4B2"
FT                   /db_xref="InterPro:IPR008797"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2V4B2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG501015.1,INSD:EG501025.1,INSD:EG462171.1,
FT                   INSD:EG501010.1,INSD:EG455996.1,INSD:EG462159.1,
FT                   INSD:EG462172.1,INSD:DR311566.1,INSD:EG462143.1,
FT                   INSD:EG501019.1,INSD:EG501011.1,INSD:DR375525.1,
FT                   INSD:EG462165.1,INSD:EG455995.1,INSD:EG462155.1,
FT                   INSD:EG462139.1,INSD:EG462161.1,INSD:EG462157.1,
FT                   INSD:EG462164.1,INSD:EG501008.1,INSD:EG501021.1,
FT                   INSD:EG462162.1,INSD:EG462145.1,INSD:EG501014.1,
FT                   INSD:EG462166.1,INSD:EG501027.1,INSD:EG462146.1,
FT                   INSD:EH878976.1,INSD:EG501012.1,INSD:EG462144.1,
FT                   INSD:EG462156.1,INSD:EG501072.1,INSD:EL117125.1,
FT                   INSD:EG501013.1,INSD:EG462160.1,INSD:EG462147.1,
FT                   INSD:EG501026.1,INSD:EG455994.1,INSD:EG462173.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ487506.1,INSD:EF182946.1,INSD:DQ108851.1"
FT                   /protein_id="AEC05519.1"
FT                   /translation="MAISKPPPLHFTFFHNQDSSIDTSDSNLALSIDTSRRRRDVLLTI
FT                   SGTLIPQLFFFDRKRSSSANAADFFNFGAPPPEPERTVELAQEGLRKNAENIKRIKEIM
FT                   IEKKLWKEGGKELRRSASNMKQDFYLIIQAKPPKDRPLFRSLYSSLFNSITKMDYAARD
FT                   GDETKVLEYYINIVAILDDIFPRI"
FT   gene            426052..427091
FT                   /gene_synonym="F23I14.1"
FT                   /gene_synonym="F23I14_1"
FT                   /locus_tag="AT2G01920"
FT   mRNA            426052..427091
FT                   /gene_synonym="F23I14.1"
FT                   /gene_synonym="F23I14_1"
FT                   /locus_tag="AT2G01920"
FT                   /product="ENTH/VHS/GAT family protein"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ056522.1"
FT   CDS_pept        426052..426990
FT                   /codon_start=1
FT                   /gene_synonym="F23I14.1"
FT                   /gene_synonym="F23I14_1"
FT                   /locus_tag="AT2G01920"
FT                   /product="ENTH/VHS/GAT family protein"
FT                   /note="ENTH/VHS/GAT family protein; FUNCTIONS IN:
FT                   phospholipid binding, binding; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: cellular_component
FT                   unknown; EXPRESSED IN: sperm cell, male gametophyte, pollen
FT                   tube; EXPRESSED DURING: L mature pollen stage, M germinated
FT                   pollen stage; CONTAINS InterPro DOMAIN/s: Epsin-like,
FT                   N-terminal (InterPro:IPR013809), ANTH (InterPro:IPR011417),
FT                   ENTH/VHS (InterPro:IPR008942); BEST Arabidopsis thaliana
FT                   protein match is: ENTH/ANTH/VHS superfamily protein
FT                   (TAIR:AT1G14686.1); Has 316 Blast hits to 316 proteins in
FT                   15 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 316; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01920"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01920.1"
FT                   /db_xref="GOA:Q9SHV5"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR014712"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SHV5"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ056522.1"
FT                   /protein_id="AEC05520.1"
FT                   /translation="MRRKMKLWRRVSGAIKDKLSLITATDEKFTAAVIKATSHNDVSMD
FT                   IENVQFIYRYIQSNPSSFKPIIRAVSLRVEHTRNWTVALKCLMLLHGLFFSGIMTVDSI
FT                   GRLPFDLSGFGRRKSRFSRTGRFNIFVRAYFMFLDERSILYYNKNMIRLEIIVKMQRIV
FT                   DSLMRIKPIGETPLVIEAMEYVISEVVLINGHICRGFAGFLSDVQSNMLEISSAEADLA
FT                   MNIVAKSLSQREKLFKYFEFCRGFGVTNAQETSNILRITESQMIVLDKLLHIAPELDWK
FT                   AAKVTPVTAADMVDLVTSEERSNTPSDFLTF"
FT   gene            complement(427114..428900)
FT                   /gene="BPC1"
FT                   /gene_synonym="ATBPC1"
FT                   /gene_synonym="basic pentacysteine1"
FT                   /gene_synonym="BASIC PENTACYSTEINE1"
FT                   /gene_synonym="BBR"
FT                   /gene_synonym="F23I14.2"
FT                   /gene_synonym="F23I14_2"
FT                   /locus_tag="AT2G01930"
FT                   /note="BASIC PENTACYSTEINE1 (BPC1) is a regulator of the
FT                   homeotic Arabidopsis thaliana gene SEEDSTICK (STK), which
FT                   controls ovule identity. BPC1 induces conformational
FT                   changes by cooperative binding to purine-rich elements
FT                   present in the STK regulatory sequence. STK is upregulated
FT                   in bpc1 mutant."
FT   mRNA            complement(join(427114..428223,428706..428900))
FT                   /gene="BPC1"
FT                   /gene_synonym="ATBPC1"
FT                   /gene_synonym="basic pentacysteine1"
FT                   /gene_synonym="BASIC PENTACYSTEINE1"
FT                   /gene_synonym="BBR"
FT                   /gene_synonym="F23I14.2"
FT                   /gene_synonym="F23I14_2"
FT                   /locus_tag="AT2G01930"
FT                   /product="basic pentacysteine1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP630880.1,INSD:ES141619.1,INSD:DR296535.1,
FT                   INSD:ES047560.1,INSD:ES074569.1,INSD:DR296534.1,
FT                   INSD:BP787794.1,INSD:BP848721.1,INSD:T43629.1,
FT                   INSD:AV804755.1,INSD:CD530307.1,INSD:H36442.1,
FT                   INSD:DR296533.1,INSD:DR371111.1,INSD:BE524425.1,
FT                   INSD:EL042784.1,INSD:EH905081.1,INSD:AV829171.1,
FT                   INSD:EL301444.1,INSD:BP633411.1,INSD:EL179300.1,
FT                   INSD:BP848295.1,INSD:ES036560.1,INSD:T44711.1,
FT                   INSD:T44705.1,INSD:ES051847.1,INSD:ES073184.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY096550.1,INSD:AY088464.1,INSD:AY380334.1,
FT                   INSD:AY065225.1"
FT   mRNA            complement(427114..428900)
FT                   /gene="BPC1"
FT                   /gene_synonym="ATBPC1"
FT                   /gene_synonym="basic pentacysteine1"
FT                   /gene_synonym="BASIC PENTACYSTEINE1"
FT                   /gene_synonym="BBR"
FT                   /gene_synonym="F23I14.2"
FT                   /gene_synonym="F23I14_2"
FT                   /locus_tag="AT2G01930"
FT                   /product="basic pentacysteine1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP630880.1,INSD:ES141619.1,INSD:DR296535.1,
FT                   INSD:ES047560.1,INSD:ES074569.1,INSD:DR296534.1,
FT                   INSD:BP787794.1,INSD:BP848721.1,INSD:T43629.1,
FT                   INSD:AV804755.1,INSD:CD530307.1,INSD:H36442.1,
FT                   INSD:DR296533.1,INSD:DR371111.1,INSD:BE524425.1,
FT                   INSD:EL042784.1,INSD:AV829171.1,INSD:EH905081.1,
FT                   INSD:BP633411.1,INSD:EL179300.1,INSD:T44711.1,
FT                   INSD:T44705.1,INSD:ES051847.1,INSD:ES073184.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY096550.1,INSD:AY088464.1,INSD:AY380334.1,
FT                   INSD:AY065225.1"
FT   CDS_pept        complement(427358..428209)
FT                   /codon_start=1
FT                   /gene="BPC1"
FT                   /gene_synonym="ATBPC1"
FT                   /gene_synonym="basic pentacysteine1"
FT                   /gene_synonym="BASIC PENTACYSTEINE1"
FT                   /gene_synonym="BBR"
FT                   /gene_synonym="F23I14.2"
FT                   /gene_synonym="F23I14_2"
FT                   /locus_tag="AT2G01930"
FT                   /product="basic pentacysteine1"
FT                   /note="basic pentacysteine1 (BPC1); FUNCTIONS IN: DNA
FT                   binding, sequence-specific DNA binding transcription factor
FT                   activity, specific transcriptional repressor activity;
FT                   INVOLVED IN: regulation of transcription, DNA-dependent;
FT                   LOCATED IN: nucleus; EXPRESSED IN: 24 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: GAGA binding-like (InterPro:IPR010409); BEST
FT                   Arabidopsis thaliana protein match is: basic pentacysteine
FT                   2 (TAIR:AT1G14685.1); Has 220 Blast hits to 218 proteins in
FT                   22 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 220; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q9SKD0"
FT                   /db_xref="InterPro:IPR010409"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SKD0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP630880.1,INSD:ES141619.1,INSD:DR296535.1,
FT                   INSD:ES047560.1,INSD:ES074569.1,INSD:DR296534.1,
FT                   INSD:BP787794.1,INSD:BP848721.1,INSD:T43629.1,
FT                   INSD:AV804755.1,INSD:CD530307.1,INSD:H36442.1,
FT                   INSD:DR296533.1,INSD:DR371111.1,INSD:BE524425.1,
FT                   INSD:EL042784.1,INSD:AV829171.1,INSD:EH905081.1,
FT                   INSD:BP633411.1,INSD:EL179300.1,INSD:T44711.1,
FT                   INSD:T44705.1,INSD:ES051847.1,INSD:ES073184.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY096550.1,INSD:AY088464.1,INSD:AY380334.1,
FT                   INSD:AY065225.1"
FT                   /protein_id="AEC05521.1"
FT                   /translation="MDDDGFRNWGYYEPAAASSFKGNLGLQLMSTIDRNTKPFLPGRES
FT                   NLMIGSNGSYHSREQDMNYSWINQPKDNKFFNMLPISTPSYSNVLSETSGSNSIQMIHQ
FT                   PVLNSSRFEENPIPPPAPCEEQTGKKRKMRGSIATPTVPKAKKMRKPKEERDVTNNNVQ
FT                   QQQQRVKPVKKSVDLVINGVSMDISGLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNIS
FT                   VYPLPMSTKRRGARISGRKMSQGAFKKVLEKLSTEGYSFGNAIDLKSHWARHGTNKFVT
FT                   IR"
FT   CDS_pept        complement(427358..428209)
FT                   /codon_start=1
FT                   /gene="BPC1"
FT                   /gene_synonym="ATBPC1"
FT                   /gene_synonym="basic pentacysteine1"
FT                   /gene_synonym="BASIC PENTACYSTEINE1"
FT                   /gene_synonym="BBR"
FT                   /gene_synonym="F23I14.2"
FT                   /gene_synonym="F23I14_2"
FT                   /locus_tag="AT2G01930"
FT                   /product="basic pentacysteine1"
FT                   /note="basic pentacysteine1 (BPC1); FUNCTIONS IN: DNA
FT                   binding, sequence-specific DNA binding transcription factor
FT                   activity, specific transcriptional repressor activity;
FT                   INVOLVED IN: regulation of transcription, DNA-dependent;
FT                   LOCATED IN: nucleus; EXPRESSED IN: 24 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: GAGA binding-like (InterPro:IPR010409); BEST
FT                   Arabidopsis thaliana protein match is: basic pentacysteine
FT                   2 (TAIR:AT1G14685.1); Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9SKD0"
FT                   /db_xref="InterPro:IPR010409"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SKD0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP630880.1,INSD:ES141619.1,INSD:DR296535.1,
FT                   INSD:ES047560.1,INSD:ES074569.1,INSD:DR296534.1,
FT                   INSD:BP787794.1,INSD:BP848721.1,INSD:T43629.1,
FT                   INSD:AV804755.1,INSD:CD530307.1,INSD:H36442.1,
FT                   INSD:DR296533.1,INSD:DR371111.1,INSD:BE524425.1,
FT                   INSD:EL042784.1,INSD:EH905081.1,INSD:AV829171.1,
FT                   INSD:EL301444.1,INSD:BP633411.1,INSD:EL179300.1,
FT                   INSD:BP848295.1,INSD:ES036560.1,INSD:T44711.1,
FT                   INSD:T44705.1,INSD:ES051847.1,INSD:ES073184.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY096550.1,INSD:AY088464.1,INSD:AY380334.1,
FT                   INSD:AY065225.1"
FT                   /protein_id="AEC05522.1"
FT                   /translation="MDDDGFRNWGYYEPAAASSFKGNLGLQLMSTIDRNTKPFLPGRES
FT                   NLMIGSNGSYHSREQDMNYSWINQPKDNKFFNMLPISTPSYSNVLSETSGSNSIQMIHQ
FT                   PVLNSSRFEENPIPPPAPCEEQTGKKRKMRGSIATPTVPKAKKMRKPKEERDVTNNNVQ
FT                   QQQQRVKPVKKSVDLVINGVSMDISGLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNIS
FT                   VYPLPMSTKRRGARISGRKMSQGAFKKVLEKLSTEGYSFGNAIDLKSHWARHGTNKFVT
FT                   IR"
FT   gene            432195..435100
FT                   /gene="SGR5"
FT                   /gene_synonym="ARABIDOPSIS THALIANA
FT                   INDETERMINATE(ID)-DOMAIN 15"
FT                   /gene_synonym="ATIDD15"
FT                   /gene_synonym="F14H20.1"
FT                   /gene_synonym="F14H20_1"
FT                   /gene_synonym="IDD15"
FT                   /gene_synonym="INDETERMINATE(ID)-DOMAIN 15"
FT                   /gene_synonym="SHOOT GRAVITROPISM 5"
FT                   /locus_tag="AT2G01940"
FT                   /note="May be involved in an early event in shoot
FT                   gravitropism such as gravity perception and/or a signaling
FT                   process subsequent to amyloplast sedimentation as a
FT                   putative transcription factor in gravity-perceptive cells."
FT   mRNA            join(432195..432811,433125..433527,434143..435100)
FT                   /gene="SGR5"
FT                   /gene_synonym="ARABIDOPSIS THALIANA
FT                   INDETERMINATE(ID)-DOMAIN 15"
FT                   /gene_synonym="ATIDD15"
FT                   /gene_synonym="F14H20.1"
FT                   /gene_synonym="F14H20_1"
FT                   /gene_synonym="IDD15"
FT                   /gene_synonym="INDETERMINATE(ID)-DOMAIN 15"
FT                   /gene_synonym="SHOOT GRAVITROPISM 5"
FT                   /locus_tag="AT2G01940"
FT                   /product="C2H2-like zinc finger protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX834114.1,INSD:EH977896.1,INSD:DR383897.1,
FT                   INSD:EH992312.1,INSD:BX836827.1,INSD:EL049821.1,
FT                   INSD:EL159202.1,INSD:DR353381.1,INSD:ES081877.1,
FT                   INSD:BE524459.1,INSD:EH957406.1,INSD:BP598823.1,
FT                   INSD:BP794685.1,INSD:DR353380.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX819715.1"
FT   mRNA            join(432275..432811,433125..433511,434124..435077)
FT                   /gene="SGR5"
FT                   /gene_synonym="ARABIDOPSIS THALIANA
FT                   INDETERMINATE(ID)-DOMAIN 15"
FT                   /gene_synonym="ATIDD15"
FT                   /gene_synonym="F14H20.1"
FT                   /gene_synonym="F14H20_1"
FT                   /gene_synonym="SHOOT GRAVITROPISM 5"
FT                   /gene_synonym="IDD15"
FT                   /gene_synonym="INDETERMINATE(ID)-DOMAIN 15"
FT                   /locus_tag="AT2G01940"
FT                   /product="C2H2-like zinc finger protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH977896.1,INSD:EH992312.1,INSD:DR383897.1,
FT                   INSD:BX836827.1,INSD:EL049821.1,INSD:EL159202.1,
FT                   INSD:DR353381.1,INSD:ES081877.1,INSD:BE524459.1,
FT                   INSD:BX838940.1,INSD:EH957406.1,INSD:BP598823.1,
FT                   INSD:BP794685.1,INSD:DR353380.1"
FT   CDS_pept        join(432652..432811,433125..433527,434143..434917)
FT                   /codon_start=1
FT                   /gene="SGR5"
FT                   /gene_synonym="ARABIDOPSIS THALIANA
FT                   INDETERMINATE(ID)-DOMAIN 15"
FT                   /gene_synonym="ATIDD15"
FT                   /gene_synonym="F14H20.1"
FT                   /gene_synonym="F14H20_1"
FT                   /gene_synonym="SHOOT GRAVITROPISM 5"
FT                   /gene_synonym="IDD15"
FT                   /gene_synonym="INDETERMINATE(ID)-DOMAIN 15"
FT                   /locus_tag="AT2G01940"
FT                   /product="C2H2-like zinc finger protein"
FT                   /note="SHOOT GRAVITROPISM 5 (SGR5); CONTAINS InterPro
FT                   DOMAIN/s: Zinc finger, C2H2-like (InterPro:IPR015880), Zinc
FT                   finger, C2H2-type (InterPro:IPR007087); BEST Arabidopsis
FT                   thaliana protein match is: indeterminate(ID)-domain 14
FT                   (TAIR:AT1G68130.1); Has 34856 Blast hits to 17366 proteins
FT                   in 321 species: Archae - 1; Bacteria - 0; Metazoa - 32828;
FT                   Fungi - 237; Plants - 754; Viruses - 1; Other Eukaryotes -
FT                   1035 (source: NCBI BLink)."
FT                   /db_xref="GOA:F4IPE3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR039288"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4IPE3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX834114.1,INSD:EH977896.1,INSD:DR383897.1,
FT                   INSD:EH992312.1,INSD:BX836827.1,INSD:EL049821.1,
FT                   INSD:EL159202.1,INSD:DR353381.1,INSD:ES081877.1,
FT                   INSD:BE524459.1,INSD:EH957406.1,INSD:BP598823.1,
FT                   INSD:BP794685.1,INSD:DR353380.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX819715.1"
FT                   /protein_id="AEC05523.1"
FT                   /translation="MRTDQVMLSNKNTNTCCVVSSSSSDPFLSSSENGVTTTNTSTQKR
FT                   KRRPAGTPDPDAEVVSLSPRTLLESDRYICEICNQGFQRDQNLQMHRRRHKVPWKLLKR
FT                   DNNIEVKKRVYVCPEPTCLHHNPCHALGDLVGIKKHFRRKHSNHKQWVCERCSKGYAVQ
FT                   SDYKAHLKTCGTRGHSCDCGRVFSRVESFIEHQDNCSARRVHREPPRPPQTAVTVPACS
FT                   SRTASTVSTPSSETNYGGTVAVTTPQPLEGRPIHQRISSSILTNSSNNLNLELQLLPLS
FT                   SNQNPNQENQQQKVKEPSHHHNHNHDTTNLNLSIAPSSSYQHYNNFDRIKEIMASEQIM
FT                   KIAMKEKAYAEEAKREAKRQREIAENEFANAKKIRQKAQAELERAKFLKEQSMKKISST
FT                   IMQVTCQTCKGQFQAVAVPAATADETSLVVSYMSSANTDGELENGF"
FT   CDS_pept        join(432652..432811,433125..433511,434124..434917)
FT                   /codon_start=1
FT                   /gene="SGR5"
FT                   /gene_synonym="ARABIDOPSIS THALIANA
FT                   INDETERMINATE(ID)-DOMAIN 15"
FT                   /gene_synonym="ATIDD15"
FT                   /gene_synonym="F14H20.1"
FT                   /gene_synonym="F14H20_1"
FT                   /gene_synonym="SHOOT GRAVITROPISM 5"
FT                   /gene_synonym="IDD15"
FT                   /gene_synonym="INDETERMINATE(ID)-DOMAIN 15"
FT                   /locus_tag="AT2G01940"
FT                   /product="C2H2-like zinc finger protein"
FT                   /note="SHOOT GRAVITROPISM 5 (SGR5); CONTAINS InterPro
FT                   DOMAIN/s: Zinc finger, C2H2-like (InterPro:IPR015880), Zinc
FT                   finger, C2H2-type (InterPro:IPR007087); BEST Arabidopsis
FT                   thaliana protein match is: indeterminate(ID)-domain 14
FT                   (TAIR:AT1G68130.1); Has 13187 Blast hits to 8766 proteins
FT                   in 255 species: Archae - 0; Bacteria - 0; Metazoa - 12025;
FT                   Fungi - 55; Plants - 746; Viruses - 1; Other Eukaryotes -
FT                   360 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01940"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01940.3"
FT                   /db_xref="GOA:F4IPE3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR039288"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4IPE3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH977896.1,INSD:EH992312.1,INSD:DR383897.1,
FT                   INSD:BX836827.1,INSD:EL049821.1,INSD:EL159202.1,
FT                   INSD:DR353381.1,INSD:ES081877.1,INSD:BE524459.1,
FT                   INSD:BX838940.1,INSD:EH957406.1,INSD:BP598823.1,
FT                   INSD:BP794685.1,INSD:DR353380.1"
FT                   /protein_id="AEC05525.1"
FT                   /translation="MRTDQVMLSNKNTNTCCVVSSSSSDPFLSSSENGVTTTNTSTQKR
FT                   KRRPAGTPDPDAEVVSLSPRTLLESDRYICEICNQGFQRDQNLQMHRRRHKVPWKLLKR
FT                   DNNIEVKKRVYVCPEPTCLHHNPCHALGDLVGIKKHFRRKHSNHKQWVCERCSKGYAVQ
FT                   SDYKAHLKTCGTRGHSCDCGFFSSFRVESFIEHQDNCSARRVHREPPRPPQTAVTVPAC
FT                   SSRTASTVSTPSSETNYGGTVAVTTPQPLEGRPIHQRISSSILTNSSNNLNLELQLLPL
FT                   SSNQNPNQENQQQKVKEPSHHHNHNHDTTNLNLSIAPSSSYQHYNNFDRIKEIMASEQI
FT                   MKIAMKEKAYAEEAKREAKRQREIAENEFANAKKIRQKAQAELERAKFLKEQSMKKISS
FT                   TIMQVTCQTCKGQFQAVAVPAATADETSLVVSYMSSANTDGELENGF"
FT   mRNA            join(432847..433011,433125..433527,434143..435077)
FT                   /gene="SGR5"
FT                   /gene_synonym="ARABIDOPSIS THALIANA
FT                   INDETERMINATE(ID)-DOMAIN 15"
FT                   /gene_synonym="ATIDD15"
FT                   /gene_synonym="F14H20.1"
FT                   /gene_synonym="F14H20_1"
FT                   /gene_synonym="IDD15"
FT                   /gene_synonym="INDETERMINATE(ID)-DOMAIN 15"
FT                   /gene_synonym="SHOOT GRAVITROPISM 5"
FT                   /locus_tag="AT2G01940"
FT                   /product="C2H2-like zinc finger protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX834114.1,INSD:ES081877.1,INSD:EH977896.1,
FT                   INSD:DR383897.1,INSD:EH992312.1,INSD:EH957406.1,
FT                   INSD:BP598823.1,INSD:BP794685.1,INSD:EL049821.1,
FT                   INSD:EL159202.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK226703.1"
FT   CDS_pept        join(433232..433527,434143..434917)
FT                   /codon_start=1
FT                   /gene="SGR5"
FT                   /gene_synonym="ARABIDOPSIS THALIANA
FT                   INDETERMINATE(ID)-DOMAIN 15"
FT                   /gene_synonym="ATIDD15"
FT                   /gene_synonym="F14H20.1"
FT                   /gene_synonym="F14H20_1"
FT                   /gene_synonym="SHOOT GRAVITROPISM 5"
FT                   /gene_synonym="IDD15"
FT                   /gene_synonym="INDETERMINATE(ID)-DOMAIN 15"
FT                   /locus_tag="AT2G01940"
FT                   /product="C2H2-like zinc finger protein"
FT                   /note="SHOOT GRAVITROPISM 5 (SGR5); BEST Arabidopsis
FT                   thaliana protein match is: indeterminate(ID)-domain 14
FT                   (TAIR:AT1G68130.2); Has 5058 Blast hits to 4353 proteins in
FT                   195 species: Archae - 1; Bacteria - 0; Metazoa - 3999;
FT                   Fungi - 151; Plants - 716; Viruses - 0; Other Eukaryotes -
FT                   191 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01940"
FT                   /db_xref="GOA:F4IPE3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR039288"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4IPE3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX834114.1,INSD:ES081877.1,INSD:EH977896.1,
FT                   INSD:DR383897.1,INSD:EH992312.1,INSD:EH957406.1,
FT                   INSD:BP598823.1,INSD:BP794685.1,INSD:EL049821.1,
FT                   INSD:EL159202.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK226703.1"
FT                   /protein_id="AEC05524.1"
FT                   /translation="MHRRRHKVPWKLLKRDNNIEVKKRVYVCPEPTCLHHNPCHALGDL
FT                   VGIKKHFRRKHSNHKQWVCERCSKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRVESFI
FT                   EHQDNCSARRVHREPPRPPQTAVTVPACSSRTASTVSTPSSETNYGGTVAVTTPQPLEG
FT                   RPIHQRISSSILTNSSNNLNLELQLLPLSSNQNPNQENQQQKVKEPSHHHNHNHDTTNL
FT                   NLSIAPSSSYQHYNNFDRIKEIMASEQIMKIAMKEKAYAEEAKREAKRQREIAENEFAN
FT                   AKKIRQKAQAELERAKFLKEQSMKKISSTIMQVTCQTCKGQFQAVAVPAATADETSLVV
FT                   SYMSSANTDGELENGF"
FT   gene            complement(440624..444324)
FT                   /gene="BRL2"
FT                   /gene_synonym="BRI1-like 2"
FT                   /gene_synonym="F14H20.2"
FT                   /gene_synonym="F14H20_2"
FT                   /gene_synonym="VASCULAR HIGHWAY 1"
FT                   /gene_synonym="VH1"
FT                   /locus_tag="AT2G01950"
FT                   /note="Encodes a leucine rich repeat receptor kinase and
FT                   associated with provascular/procambial cells. Similar to
FT                   BRI, brassinosteroid receptor protein."
FT   mRNA            complement(440624..444324)
FT                   /gene="BRL2"
FT                   /gene_synonym="BRI1-like 2"
FT                   /gene_synonym="F14H20.2"
FT                   /gene_synonym="F14H20_2"
FT                   /gene_synonym="VASCULAR HIGHWAY 1"
FT                   /gene_synonym="VH1"
FT                   /locus_tag="AT2G01950"
FT                   /product="BRI1-like 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH951845.1,INSD:AV546455.1,INSD:EH984415.1,
FT                   INSD:CK120095.1,INSD:AV547583.1,INSD:F14464.1,
FT                   INSD:EG510696.1,INSD:EL229245.1,INSD:AV561815.1,
FT                   INSD:F15234.1,INSD:EG510698.1,INSD:AV522887.1,
FT                   INSD:AV546559.1,INSD:EL214783.1,INSD:AV831427.1,
FT                   INSD:AV548510.1,INSD:AV528429.1,INSD:AV816025.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY074313.1"
FT   CDS_pept        complement(440805..444236)
FT                   /codon_start=1
FT                   /gene="BRL2"
FT                   /gene_synonym="BRI1-like 2"
FT                   /gene_synonym="F14H20.2"
FT                   /gene_synonym="F14H20_2"
FT                   /gene_synonym="VASCULAR HIGHWAY 1"
FT                   /gene_synonym="VH1"
FT                   /locus_tag="AT2G01950"
FT                   /product="BRI1-like 2"
FT                   /note="BRI1-like 2 (BRL2); FUNCTIONS IN: protein binding,
FT                   protein serine/threonine kinase activity, transmembrane
FT                   receptor protein serine/threonine kinase activity, ATP
FT                   binding; INVOLVED IN: in 7 processes; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), Leucine-rich repeat-containing
FT                   N-terminal domain, type 2 (InterPro:IPR013210),
FT                   Leucine-rich repeat (InterPro:IPR001611),
FT                   Serine/threonine-protein kinase-like domain
FT                   (InterPro:IPR017442), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), Protein kinase-like
FT                   domain (InterPro:IPR011009), Protein kinase, catalytic
FT                   domain (InterPro:IPR000719), Leucine-rich repeat, typical
FT                   subtype (InterPro:IPR003591), Tyrosine-protein kinase,
FT                   catalytic domain (InterPro:IPR020635); BEST Arabidopsis
FT                   thaliana protein match is: BRI1 like (TAIR:AT1G55610.2);
FT                   Has 216585 Blast hits to 138440 proteins in 4665 species:
FT                   Archae - 155; Bacteria - 20149; Metazoa - 71991; Fungi -
FT                   10737; Plants - 87183; Viruses - 376; Other Eukaryotes -
FT                   25994 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01950"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01950.1"
FT                   /db_xref="GOA:Q9ZPS9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZPS9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH951845.1,INSD:AV546455.1,INSD:EH984415.1,
FT                   INSD:CK120095.1,INSD:AV547583.1,INSD:F14464.1,
FT                   INSD:EG510696.1,INSD:EL229245.1,INSD:AV561815.1,
FT                   INSD:F15234.1,INSD:EG510698.1,INSD:AV522887.1,
FT                   INSD:AV546559.1,INSD:EL214783.1,INSD:AV831427.1,
FT                   INSD:AV548510.1,INSD:AV528429.1,INSD:AV816025.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY074313.1"
FT                   /protein_id="AEC05526.1"
FT                   /translation="MTTSPIRVRIRTRIQISFIFLLTHLSQSSSSDQSSLKTDSLSLLS
FT                   FKTMIQDDPNNILSNWSPRKSPCQFSGVTCLGGRVTEINLSGSGLSGIVSFNAFTSLDS
FT                   LSVLKLSENFFVLNSTSLLLLPLTLTHLELSSSGLIGTLPENFFSKYSNLISITLSYNN
FT                   FTGKLPNDLFLSSKKLQTLDLSYNNITGPISGLTIPLSSCVSMTYLDFSGNSISGYISD
FT                   SLINCTNLKSLNLSYNNFDGQIPKSFGELKLLQSLDLSHNRLTGWIPPEIGDTCRSLQN
FT                   LRLSYNNFTGVIPESLSSCSWLQSLDLSNNNISGPFPNTILRSFGSLQILLLSNNLISG
FT                   DFPTSISACKSLRIADFSSNRFSGVIPPDLCPGAASLEELRLPDNLVTGEIPPAISQCS
FT                   ELRTIDLSLNYLNGTIPPEIGNLQKLEQFIAWYNNIAGEIPPEIGKLQNLKDLILNNNQ
FT                   LTGEIPPEFFNCSNIEWVSFTSNRLTGEVPKDFGILSRLAVLQLGNNNFTGEIPPELGK
FT                   CTTLVWLDLNTNHLTGEIPPRLGRQPGSKALSGLLSGNTMAFVRNVGNSCKGVGGLVEF
FT                   SGIRPERLLQIPSLKSCDFTRMYSGPILSLFTRYQTIEYLDLSYNQLRGKIPDEIGEMI
FT                   ALQVLELSHNQLSGEIPFTIGQLKNLGVFDASDNRLQGQIPESFSNLSFLVQIDLSNNE
FT                   LTGPIPQRGQLSTLPATQYANNPGLCGVPLPECKNGNNQLPAGTEEGKRAKHGTRAASW
FT                   ANSIVLGVLISAASVCILIVWAIAVRARRRDADDAKMLHSLQAVNSATTWKIEKEKEPL
FT                   SINVATFQRQLRKLKFSQLIEATNGFSAASMIGHGGFGEVFKATLKDGSSVAIKKLIRL
FT                   SCQGDREFMAEMETLGKIKHRNLVPLLGYCKIGEERLLVYEFMQYGSLEEVLHGPRTGE
FT                   KRRILGWEERKKIAKGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDQDMEARVSDFGMAR
FT                   LISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSIGVVMLEILSGKRPTDKEEF
FT                   GDTNLVGWSKMKAREGKHMEVIDEDLLKEGSSESLNEKEGFEGGVIVKEMLRYLEIALR
FT                   CVDDFPSKRPNMLQVVASLRELRGSENNSHSHSNSL"
FT   gene            450379..451910
FT                   /gene="TET14"
FT                   /gene_synonym="F14H20.3"
FT                   /gene_synonym="F14H20_3"
FT                   /gene_synonym="tetraspanin14"
FT                   /locus_tag="AT2G01960"
FT                   /note="Member of TETRASPANIN family"
FT   mRNA            join(450379..450890,451518..451910)
FT                   /gene="TET14"
FT                   /gene_synonym="F14H20.3"
FT                   /gene_synonym="F14H20_3"
FT                   /gene_synonym="tetraspanin14"
FT                   /locus_tag="AT2G01960"
FT                   /product="tetraspanin14"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV806916.1,INSD:EH853325.1,INSD:EG444699.1,
FT                   INSD:AV796648.1,INSD:EG444692.1,INSD:EG444703.1,
FT                   INSD:EG444672.1,INSD:AV787283.1,INSD:BP638482.1,
FT                   INSD:BP789301.1,INSD:ES163419.1,INSD:AV816165.1,
FT                   INSD:EL006771.1,INSD:EG444660.1,INSD:EG444658.1,
FT                   INSD:AV802831.1,INSD:EL032756.1,INSD:BP782718.1,
FT                   INSD:EG444677.1,INSD:EG444678.1,INSD:EG444670.1,
FT                   INSD:AV796804.1,INSD:EG444656.1,INSD:AA585862.1,
FT                   INSD:BP779127.1,INSD:EG444668.1,INSD:AV815925.1,
FT                   INSD:AV803465.1,INSD:BP792147.1,INSD:BP604910.1,
FT                   INSD:AV805842.1,INSD:BX835464.1,INSD:EG444694.1,
FT                   INSD:BP651441.1,INSD:AV815356.1,INSD:EG444701.1,
FT                   INSD:EG444690.1,INSD:AV813296.1,INSD:AV521930.1,
FT                   INSD:AV806964.1,INSD:BP786109.1,INSD:AV562494.1,
FT                   INSD:BP793041.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY954776.1,INSD:AY168991.1"
FT   CDS_pept        join(450393..450890,451518..451802)
FT                   /codon_start=1
FT                   /gene="TET14"
FT                   /gene_synonym="F14H20.3"
FT                   /gene_synonym="F14H20_3"
FT                   /gene_synonym="tetraspanin14"
FT                   /locus_tag="AT2G01960"
FT                   /product="tetraspanin14"
FT                   /note="tetraspanin14 (TET14); FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: endomembrane system; EXPRESSED IN:
FT                   flower, carpel; EXPRESSED DURING: petal differentiation and
FT                   expansion stage; BEST Arabidopsis thaliana protein match
FT                   is: tetraspanin15 (TAIR:AT5G57810.1); Has 57 Blast hits to
FT                   57 proteins in 12 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 0; Fungi - 0; Plants - 57; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01960.1"
FT                   /db_xref="GOA:Q58G33"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q58G33"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV806916.1,INSD:EH853325.1,INSD:EG444699.1,
FT                   INSD:AV796648.1,INSD:EG444692.1,INSD:EG444703.1,
FT                   INSD:EG444672.1,INSD:AV787283.1,INSD:BP638482.1,
FT                   INSD:BP789301.1,INSD:ES163419.1,INSD:AV816165.1,
FT                   INSD:EL006771.1,INSD:EG444660.1,INSD:EG444658.1,
FT                   INSD:AV802831.1,INSD:EL032756.1,INSD:BP782718.1,
FT                   INSD:EG444677.1,INSD:EG444678.1,INSD:EG444670.1,
FT                   INSD:AV796804.1,INSD:EG444656.1,INSD:AA585862.1,
FT                   INSD:BP779127.1,INSD:EG444668.1,INSD:AV815925.1,
FT                   INSD:AV803465.1,INSD:BP792147.1,INSD:BP604910.1,
FT                   INSD:AV805842.1,INSD:BX835464.1,INSD:EG444694.1,
FT                   INSD:BP651441.1,INSD:AV815356.1,INSD:EG444701.1,
FT                   INSD:EG444690.1,INSD:AV813296.1,INSD:AV521930.1,
FT                   INSD:AV806964.1,INSD:BP786109.1,INSD:AV562494.1,
FT                   INSD:BP793041.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY954776.1,INSD:AY168991.1"
FT                   /protein_id="AEC05527.1"
FT                   /translation="MKSQSHKPWNLVAGIFFPIITFFLSAPLVGHALYLFCMRNDHVYY
FT                   RDFQSTLPRVQTLVSVSLLALFLLSNIGMFLRPRRLSYFLVIVFFIGFAYSGVYKMESR
FT                   RFSPTPMCFKGEYNNGQGERKTEQYQVVKIEQSQGRLQRVHLRFVNSYALPPYDRRLLP
FT                   SVKTGCCNRPGNCKLETVNATLWVTRNREGPPLETAMIYDRYGGNADIKDYYDMWRHEL
FT                   SVLYYDCMTCQVRIIKSPRLRKWWQFGVFLSSLTSLFR"
FT   gene            complement(451858..454959)
FT                   /gene_synonym="F14H20.4"
FT                   /gene_synonym="F14H20_4"
FT                   /locus_tag="AT2G01970"
FT   mRNA            complement(join(451858..452416,452690..453174,
FT                   453252..453408,453491..453628,453716..454301,
FT                   454402..454442,454668..454959))
FT                   /gene_synonym="F14H20.4"
FT                   /gene_synonym="F14H20_4"
FT                   /locus_tag="AT2G01970"
FT                   /product="Endomembrane protein 70 protein family"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV806916.1,INSD:ES145543.1,INSD:EL172095.1,
FT                   INSD:EH930313.1,INSD:ES163419.1,INSD:EL300503.1,
FT                   INSD:ES161003.1,INSD:EL198475.1,INSD:EH802257.1,
FT                   INSD:BP562472.1,INSD:AV824680.1,INSD:EL126843.1,
FT                   INSD:EL016487.1,INSD:EL234887.1,INSD:AW004297.1,
FT                   INSD:BP792147.1,INSD:BP829710.1,INSD:BP651441.1,
FT                   INSD:EL264063.1,INSD:ES174489.1,INSD:EL341173.1,
FT                   INSD:EL079038.1,INSD:BX839158.1,INSD:BP789301.1,
FT                   INSD:EL006771.1,INSD:EL073820.1,INSD:EL032756.1,
FT                   INSD:ES086572.1,INSD:AV830823.1,INSD:AV796804.1,
FT                   INSD:EL052933.1,INSD:AA585862.1,INSD:BP779127.1,
FT                   INSD:EL268164.1,INSD:AV815925.1,INSD:AV803465.1,
FT                   INSD:BP604910.1,INSD:AV805842.1,INSD:EH850706.1,
FT                   INSD:EG444694.1,INSD:ES154193.1,INSD:AV826870.1,
FT                   INSD:BE528907.1,INSD:EH891669.1,INSD:AV813296.1,
FT                   INSD:AV806964.1,INSD:EL141397.1,INSD:AV787235.1,
FT                   INSD:EG444703.1,INSD:EH820267.1,INSD:EH935522.1,
FT                   INSD:AV829377.1,INSD:AV560514.1,INSD:ES191029.1,
FT                   INSD:AV555936.1,INSD:ES014246.1,INSD:BP782718.1,
FT                   INSD:EH864259.1,INSD:EL187465.1,INSD:EL175295.1,
FT                   INSD:ES184202.1,INSD:ES213949.1,INSD:BP826556.1,
FT                   INSD:BP823896.1,INSD:AV815356.1,INSD:EL163204.1,
FT                   INSD:EH906058.1,INSD:EL978101.1,INSD:AV441093.1,
FT                   INSD:EH913776.1,INSD:EL319542.1,INSD:AV543040.1,
FT                   INSD:EH851376.1,INSD:BP793041.1,INSD:AV442489.1,
FT                   INSD:EH853325.1,INSD:EH881557.1,INSD:EH811490.1,
FT                   INSD:EL028232.1,INSD:EH850243.1,INSD:AV796648.1,
FT                   INSD:EH880999.1,INSD:EG444692.1,INSD:EH880389.1,
FT                   INSD:AV787283.1,INSD:EL987628.1,INSD:BP638482.1,
FT                   INSD:ES020126.1,INSD:EH804705.1,INSD:EH803704.1,
FT                   INSD:AV802831.1,INSD:EL217243.1,INSD:EL000417.1,
FT                   INSD:ES088591.1,INSD:CB260308.1,INSD:EL198456.1,
FT                   INSD:ES070191.1,INSD:ES029572.1,INSD:ES147565.1,
FT                   INSD:EL272256.1,INSD:EH933185.1,INSD:ES211547.1,
FT                   INSD:ES059730.1,INSD:BX835464.1,INSD:EH795620.1,
FT                   INSD:EH808753.1,INSD:ES110921.1,INSD:ES013060.1,
FT                   INSD:BP786109.1,INSD:ES054980.1,INSD:EL305028.1,
FT                   INSD:AV562494.1,INSD:T42088.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY060579.1,INSD:AK226487.1,INSD:BX822006.1,
FT                   INSD:BX820415.1,INSD:AY058869.1,INSD:AK221852.1"
FT   CDS_pept        complement(join(452197..452416,452690..453174,
FT                   453252..453408,453491..453628,453716..454301,
FT                   454402..454442,454668..454819))
FT                   /codon_start=1
FT                   /gene_synonym="F14H20.4"
FT                   /gene_synonym="F14H20_4"
FT                   /locus_tag="AT2G01970"
FT                   /product="Endomembrane protein 70 protein family"
FT                   /note="Endomembrane protein 70 protein family; INVOLVED IN:
FT                   transport; LOCATED IN: integral to membrane, Golgi
FT                   apparatus, plasma membrane, plant-type cell wall; EXPRESSED
FT                   IN: 26 plant structures; EXPRESSED DURING: 15 growth
FT                   stages; CONTAINS InterPro DOMAIN/s: Nonaspanin (TM9SF)
FT                   (InterPro:IPR004240); BEST Arabidopsis thaliana protein
FT                   match is: Endomembrane protein 70 protein family
FT                   (TAIR:AT1G14670.1); Has 1574 Blast hits to 1528 proteins in
FT                   319 species: Archae - 0; Bacteria - 2; Metazoa - 611; Fungi
FT                   - 238; Plants - 459; Viruses - 0; Other Eukaryotes - 264
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01970"
FT                   /db_xref="GOA:Q9ZPS7"
FT                   /db_xref="InterPro:IPR004240"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZPS7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV806916.1,INSD:ES145543.1,INSD:EL172095.1,
FT                   INSD:EH930313.1,INSD:ES163419.1,INSD:EL300503.1,
FT                   INSD:ES161003.1,INSD:EL198475.1,INSD:EH802257.1,
FT                   INSD:BP562472.1,INSD:AV824680.1,INSD:EL126843.1,
FT                   INSD:EL016487.1,INSD:EL234887.1,INSD:AW004297.1,
FT                   INSD:BP792147.1,INSD:BP829710.1,INSD:BP651441.1,
FT                   INSD:EL264063.1,INSD:ES174489.1,INSD:EL341173.1,
FT                   INSD:EL079038.1,INSD:BX839158.1,INSD:BP789301.1,
FT                   INSD:EL006771.1,INSD:EL073820.1,INSD:EL032756.1,
FT                   INSD:ES086572.1,INSD:AV830823.1,INSD:AV796804.1,
FT                   INSD:EL052933.1,INSD:AA585862.1,INSD:BP779127.1,
FT                   INSD:EL268164.1,INSD:AV815925.1,INSD:AV803465.1,
FT                   INSD:BP604910.1,INSD:AV805842.1,INSD:EH850706.1,
FT                   INSD:EG444694.1,INSD:ES154193.1,INSD:AV826870.1,
FT                   INSD:BE528907.1,INSD:EH891669.1,INSD:AV813296.1,
FT                   INSD:AV806964.1,INSD:EL141397.1,INSD:AV787235.1,
FT                   INSD:EG444703.1,INSD:EH820267.1,INSD:EH935522.1,
FT                   INSD:AV829377.1,INSD:AV560514.1,INSD:ES191029.1,
FT                   INSD:AV555936.1,INSD:ES014246.1,INSD:BP782718.1,
FT                   INSD:EH864259.1,INSD:EL187465.1,INSD:EL175295.1,
FT                   INSD:ES184202.1,INSD:ES213949.1,INSD:BP826556.1,
FT                   INSD:BP823896.1,INSD:AV815356.1,INSD:EL163204.1,
FT                   INSD:EH906058.1,INSD:EL978101.1,INSD:AV441093.1,
FT                   INSD:EH913776.1,INSD:EL319542.1,INSD:AV543040.1,
FT                   INSD:EH851376.1,INSD:BP793041.1,INSD:AV442489.1,
FT                   INSD:EH853325.1,INSD:EH881557.1,INSD:EH811490.1,
FT                   INSD:EL028232.1,INSD:EH850243.1,INSD:AV796648.1,
FT                   INSD:EH880999.1,INSD:EG444692.1,INSD:EH880389.1,
FT                   INSD:AV787283.1,INSD:EL987628.1,INSD:BP638482.1,
FT                   INSD:ES020126.1,INSD:EH804705.1,INSD:EH803704.1,
FT                   INSD:AV802831.1,INSD:EL217243.1,INSD:EL000417.1,
FT                   INSD:ES088591.1,INSD:CB260308.1,INSD:EL198456.1,
FT                   INSD:ES070191.1,INSD:ES029572.1,INSD:ES147565.1,
FT                   INSD:EL272256.1,INSD:EH933185.1,INSD:ES211547.1,
FT                   INSD:ES059730.1,INSD:BX835464.1,INSD:EH795620.1,
FT                   INSD:EH808753.1,INSD:ES110921.1,INSD:ES013060.1,
FT                   INSD:BP786109.1,INSD:ES054980.1,INSD:EL305028.1,
FT                   INSD:AV562494.1,INSD:T42088.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY060579.1,INSD:AK226487.1,INSD:BX822006.1,
FT                   INSD:BX820415.1,INSD:AY058869.1,INSD:AK221852.1"
FT                   /protein_id="AEC05528.1"
FT                   /translation="MRLPTTLLLFIGALIFSGAGTVRSDASDHRYKDGDSVPLYANKVG
FT                   PFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGDRLVSAPYKLNFRDEKDSEVYCKK
FT                   KLSREEVEHFRRAVEKDYYFQMYYDDLPIWGFIGKVDKESKSDPSEFKYFLYKHIQFEI
FT                   LYNKDRVIEINARMDPHSLVDLTEDKEVDAEFMYTVKWKETETSFEKRMDKYAMSSSLP
FT                   HHLEIHWFSIINSCVTVLLLTGFLATILMRVLKNDFMKYAQDEEAADDQEETGWKYIHG
FT                   DVFRFPKNKSLFAASLGSGTQLFTLTIFIFMLSLVGVFYPYNRGALFTALVVIYALTSG
FT                   IAGYTASSFYCQLEGKNWVRNLLLTGGLFCGPLFLTFCFLNTVAIAYSATAALPFGTII
FT                   VIVLIWTLVTSPLLVLGGIAGKNSKAEFQAPVRTTKYPREIPPLPWYRSAVPQMAMAGF
FT                   LPFSAIYIELYYIFASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEW
FT                   WWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFR
FT                   AALLFVRHIYRSIKCE"
FT   gene            complement(455659..456088)
FT                   /pseudo
FT                   /locus_tag="AT2G01973"
FT                   /note="pseudogene of OTU-like cysteine protease family
FT                   protein"
FT   misc_RNA        complement(455659..456088)
FT                   /pseudo
FT                   /locus_tag="AT2G01973"
FT                   /note="pseudogene of Cysteine proteinases superfamily
FT                   protein; AT2G01973.1"
FT   gene            457002..463408
FT                   /gene="SOS1"
FT                   /gene_synonym="ARABIDOPSIS NA+/H+ ANTIPORTER 7"
FT                   /gene_synonym="ARABIDOPSIS SALT OVERLY SENSITIVE 1"
FT                   /gene_synonym="ATNHX7"
FT                   /gene_synonym="ATSOS1"
FT                   /gene_synonym="F14H20.5"
FT                   /gene_synonym="F14H20_5"
FT                   /gene_synonym="SALT OVERLY SENSITIVE 1"
FT                   /locus_tag="AT2G01980"
FT                   /note="Encodes a plasma membrane-localized Na+/H+
FT                   antiporter SOS1. Functions in the extrusion of toxic Na+
FT                   from cells and is essential for plant salt tolerance. Has
FT                   12 predicted transmembrane domains in the N-terminal region
FT                   and a long cytoplasmic tail of approx. 700 aa at the
FT                   C-terminal side. SOS1 interacts through its predicted
FT                   cytoplasmic tail with RCD1, a regulator of oxidative-stress
FT                   responses, suggesting that SOS1 might function in
FT                   oxidative-stress tolerance."
FT   mRNA            join(457002..457295,457399..457449,457528..457619,
FT                   457700..457777,457873..458030,458113..458214,
FT                   458304..458421,458501..458553,458640..458705,
FT                   458807..458851,459002..459054,459539..459723,
FT                   459836..459880,459968..460075,460291..460522,
FT                   460600..460899,461081..461178,461262..461393,
FT                   461476..461694,461781..461984,462072..462342,
FT                   462444..462742,462840..463408)
FT                   /gene="SOS1"
FT                   /gene_synonym="ARABIDOPSIS NA+/H+ ANTIPORTER 7"
FT                   /gene_synonym="ARABIDOPSIS SALT OVERLY SENSITIVE 1"
FT                   /gene_synonym="ATNHX7"
FT                   /gene_synonym="ATSOS1"
FT                   /gene_synonym="F14H20.5"
FT                   /gene_synonym="F14H20_5"
FT                   /gene_synonym="SALT OVERLY SENSITIVE 1"
FT                   /locus_tag="AT2G01980"
FT                   /product="sodium proton exchanger, putative (NHX7) (SOS1)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES099080.1,INSD:EG498791.1,INSD:BP634468.1,
FT                   INSD:BX834746.1,INSD:ES044130.1,INSD:AV796152.1,
FT                   INSD:AV826734.1,INSD:EH954067.1,INSD:EG498790.1,
FT                   INSD:EL032375.1,INSD:AV814512.1,INSD:BX837890.1,
FT                   INSD:EH878326.1,INSD:EL015778.1,INSD:AV808641.1,
FT                   INSD:EL093297.1,INSD:AV817817.1,INSD:EH975054.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY062746.1"
FT   CDS_pept        join(457070..457295,457399..457449,457528..457619,
FT                   457700..457777,457873..458030,458113..458214,
FT                   458304..458421,458501..458553,458640..458705,
FT                   458807..458851,459002..459054,459539..459723,
FT                   459836..459880,459968..460075,460291..460522,
FT                   460600..460899,461081..461178,461262..461393,
FT                   461476..461694,461781..461984,462072..462342,
FT                   462444..462742,462840..463145)
FT                   /codon_start=1
FT                   /gene="SOS1"
FT                   /gene_synonym="ARABIDOPSIS NA+/H+ ANTIPORTER 7"
FT                   /gene_synonym="ARABIDOPSIS SALT OVERLY SENSITIVE 1"
FT                   /gene_synonym="ATNHX7"
FT                   /gene_synonym="ATSOS1"
FT                   /gene_synonym="F14H20.5"
FT                   /gene_synonym="F14H20_5"
FT                   /gene_synonym="SALT OVERLY SENSITIVE 1"
FT                   /locus_tag="AT2G01980"
FT                   /product="sodium proton exchanger, putative (NHX7) (SOS1)"
FT                   /note="SALT OVERLY SENSITIVE 1 (SOS1); FUNCTIONS IN:
FT                   sodium:hydrogen antiporter activity; INVOLVED IN: in 7
FT                   processes; LOCATED IN: plasma membrane, chloroplast
FT                   envelope; EXPRESSED IN: 26 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Cyclic nucleotide-binding (InterPro:IPR000595), Cation/H+
FT                   exchanger, conserved region (InterPro:IPR018422), Cation/H+
FT                   exchanger (InterPro:IPR006153), Cyclic
FT                   nucleotide-binding-like (InterPro:IPR018490), RmlC-like
FT                   jelly roll fold (InterPro:IPR014710), Na+/H+ exchanger,
FT                   isoforms 7/8, conserved region (InterPro:IPR018418); BEST
FT                   Arabidopsis thaliana protein match is: Na+/H+ exchanger 8
FT                   (TAIR:AT1G14660.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01980"
FT                   /db_xref="GOA:Q9LKW9"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LKW9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES099080.1,INSD:EG498791.1,INSD:BP634468.1,
FT                   INSD:BX834746.1,INSD:ES044130.1,INSD:AV796152.1,
FT                   INSD:AV826734.1,INSD:EH954067.1,INSD:EG498790.1,
FT                   INSD:EL032375.1,INSD:AV814512.1,INSD:BX837890.1,
FT                   INSD:EH878326.1,INSD:EL015778.1,INSD:AV808641.1,
FT                   INSD:EL093297.1,INSD:AV817817.1,INSD:EH975054.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY062746.1"
FT                   /protein_id="AEC05529.1"
FT                   /translation="MTTVIDATMAYRFLEEATDSSSSSSSSKLESSPVDAVLFVGMSLV
FT                   LGIASRHLLRGTRVPYTVALLVIGIALGSLEYGAKHNLGKIGHGIRIWNEIDPELLLAV
FT                   FLPALLFESSFSMEVHQIKRCLGQMVLLAVPGVLISTACLGSLVKVTFPYEWDWKTSLL
FT                   LGGLLSATDPVAVVALLKELGASKKLSTIIEGESLMNDGTAIVVFQLFLKMAMGQNSDW
FT                   SSIIKFLLKVALGAVGIGLAFGIASVIWLKFIFNDTVIEITLTIAVSYFAYYTAQEWAG
FT                   ASGVLTVMTLGMFYAAFARTAFKGDSQKSLHHFWEMVAYIANTLIFILSGVVIAEGILD
FT                   SDKIAYQGNSWRFLFLLYVYIQLSRVVVVGVLYPLLCRFGYGLDWKESIILVWSGLRGA
FT                   VALALSLSVKQSSGNSHISKETGTLFLFFTGGIVFLTLIVNGSTTQFVLRLLRMDILPA
FT                   PKKRILEYTKYEMLNKALRAFQDLGDDEELGPADWPTVESYISSLKGSEGELVHHPHNG
FT                   SKIGSLDPKSLKDIRMRFLNGVQATYWEMLDEGRISEVTANILMQSVDEALDQVSTTLC
FT                   DWRGLKPHVNFPNYYNFLHSKVVPRKLVTYFAVERLESACYISAAFLRAHTIARQQLYD
FT                   FLGESNIGSIVINESEKEGEEAKKFLEKVRSSFPQVLRVVKTKQVTYSVLNHLLGYIEN
FT                   LEKVGLLEEKEIAHLHDAVQTGLKKLLRNPPIVKLPKLSDMITSHPLSVALPPAFCEPL
FT                   KHSKKEPMKLRGVTLYKEGSKPTGVWLIFDGIVKWKSKILSNNHSLHPTFSHGSTLGLY
FT                   EVLTGKPYLCDLITDSMVLCFFIDSEKILSLQSDSTIDDFLWQESALVLLKLLRPQIFE
FT                   SVAMQELRALVSTESSKLTTYVTGESIEIDCNSIGLLLEGFVKPVGIKEELISSPAALS
FT                   PSNGNQSFHNSSEASGIMRVSFSQQATQYIVETRARAIIFNIGAFGADRTLHRRPSSLT
FT                   PPRSSSSDQLQRSFRKEHRGLMSWPENIYAKQQQEINKTTLSLSERAMQLSIFGSMVNV
FT                   YRRSVSFGGIYNNKLQDNLLYKKLPLNPAQGLVSAKSESSIVTKKQLETRKHACQLPLK
FT                   GESSTRQNTMVESSDEEDEDEGIVVRIDSPSKIVFRNDL"
FT   gene            complement(464994..466955)
FT                   /gene_synonym="F14H20.6"
FT                   /gene_synonym="F14H20_6"
FT                   /locus_tag="AT2G01990"
FT   mRNA            complement(join(464994..465603,466151..466220,
FT                   466333..466511,466670..466955))
FT                   /gene_synonym="F14H20.6"
FT                   /gene_synonym="F14H20_6"
FT                   /locus_tag="AT2G01990"
FT                   /product="XRI1-like protein"
FT   mRNA            complement(join(465001..465603,466151..466220,
FT                   466333..466511,466670..466724))
FT                   /gene_synonym="F14H20.6"
FT                   /gene_synonym="F14H20_6"
FT                   /locus_tag="AT2G01990"
FT                   /product="XRI1-like protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH888388.1,INSD:EH860089.1,INSD:EG443062.1,
FT                   INSD:EH949902.1,INSD:BP574564.1,INSD:EL111047.1,
FT                   INSD:EL261550.1,INSD:EH885208.1,INSD:EG443064.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT020397.1,INSD:BX819950.1"
FT   CDS_pept        complement(join(465197..465603,466151..466220,
FT                   466333..466511,466670..466748))
FT                   /codon_start=1
FT                   /gene_synonym="F14H20.6"
FT                   /gene_synonym="F14H20_6"
FT                   /locus_tag="AT2G01990"
FT                   /product="XRI1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01990"
FT                   /db_xref="GOA:A0A1P8B1L8"
FT                   /db_xref="InterPro:IPR039933"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B1L8"
FT                   /protein_id="ANM62800.1"
FT                   /translation="MSELLYSLPTWDIHNLGSLFKPDFNLDTCGFMNRSPEHIFGSPEI
FT                   DYSDVSTGYLEDALIESGERSKRRRLLFEDPSKSFNDDDSQNDWGLHESYSCLNSQFVT
FT                   PHVNTGERISGVSYCQETISNVYESPDTSVSYDKIYVREKSPTEPSSSNCGNKNKRLIT
FT                   KLVYPFGLVKPGGRENDVTLNDINERILMAPSRPIRHPVGDFASRPCVSGRGPGLSGKA
FT                   VVALTKIQTQGRGTITIIRTKG"
FT   CDS_pept        complement(join(465197..465603,466151..466220,
FT                   466333..466497))
FT                   /codon_start=1
FT                   /gene_synonym="F14H20.6"
FT                   /gene_synonym="F14H20_6"
FT                   /locus_tag="AT2G01990"
FT                   /product="XRI1-like protein"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT1G14630.1); Has 118 Blast
FT                   hits to 118 proteins in 14 species: Archae - 0; Bacteria -
FT                   0; Metazoa - 0; Fungi - 0; Plants - 118; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G01990"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G01990.1"
FT                   /db_xref="GOA:Q5M751"
FT                   /db_xref="InterPro:IPR039933"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M751"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH888388.1,INSD:EH860089.1,INSD:EG443062.1,
FT                   INSD:EH949902.1,INSD:BP574564.1,INSD:EL111047.1,
FT                   INSD:EL261550.1,INSD:EH885208.1,INSD:EG443064.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT020397.1,INSD:BX819950.1"
FT                   /protein_id="AEC05530.1"
FT                   /translation="MNRSPEHIFGSPEIDYSDVSTGYLEDALIESGERSKRRRLLFEDP
FT                   SKSFNDDDSQNDWGLHESYSCLNSQFVTPHVNTGERISGVSYCQETISNVYESPDTSVS
FT                   YDKIYVREKSPTEPSSSNCGNKNKRLITKLVYPFGLVKPGGRENDVTLNDINERILMAP
FT                   SRPIRHPVGDFASRPCVSGRGPGLSGKAVVALTKIQTQGRGTITIIRTKG"
FT   gene            complement(469370..472070)
FT                   /gene="GAD3"
FT                   /gene_synonym="F14H20.7"
FT                   /gene_synonym="F14H20_7"
FT                   /gene_synonym="glutamate decarboxylase 3"
FT                   /locus_tag="AT2G02000"
FT   mRNA            complement(join(469370..469993,470199..470251,
FT                   470327..470580,470911..471125,471207..471612,
FT                   471912..472070))
FT                   /gene="GAD3"
FT                   /gene_synonym="F14H20.7"
FT                   /gene_synonym="F14H20_7"
FT                   /gene_synonym="glutamate decarboxylase 3"
FT                   /locus_tag="AT2G02000"
FT                   /product="glutamate decarboxylase 3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES063282.1,INSD:ES083512.1,INSD:AU230236.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK118125.1"
FT   CDS_pept        complement(join(469505..469993,470199..470251,
FT                   470327..470580,470911..471125,471207..471612,
FT                   471912..471997))
FT                   /codon_start=1
FT                   /gene="GAD3"
FT                   /gene_synonym="F14H20.7"
FT                   /gene_synonym="F14H20_7"
FT                   /gene_synonym="glutamate decarboxylase 3"
FT                   /locus_tag="AT2G02000"
FT                   /product="glutamate decarboxylase 3"
FT                   /note="glutamate decarboxylase 3 (GAD3); FUNCTIONS IN:
FT                   calmodulin binding; INVOLVED IN: carboxylic acid metabolic
FT                   process, glutamate metabolic process, glutamate
FT                   decarboxylation to succinate; LOCATED IN:
FT                   cellular_component unknown; CONTAINS InterPro DOMAIN/s:
FT                   Pyridoxal phosphate-dependent transferase, major domain
FT                   (InterPro:IPR015424), Pyridoxal phosphate-dependent
FT                   decarboxylase (InterPro:IPR002129), Glutamate decarboxylase
FT                   (InterPro:IPR010107), Pyridoxal phosphate-dependent
FT                   transferase, major region, subdomain 1
FT                   (InterPro:IPR015421); BEST Arabidopsis thaliana protein
FT                   match is: glutamate decarboxylase 4 (TAIR:AT2G02010.1); Has
FT                   2817 Blast hits to 2814 proteins in 863 species: Archae -
FT                   192; Bacteria - 1666; Metazoa - 146; Fungi - 354; Plants -
FT                   282; Viruses - 7; Other Eukaryotes - 170 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G02000"
FT                   /db_xref="GOA:Q9ZPS4"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZPS4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES063282.1,INSD:ES083512.1,INSD:AU230236.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK118125.1"
FT                   /protein_id="AEC05531.1"
FT                   /translation="MVLSKTASKSDDSIHSTFASRYVRNSISRFEIPKNSIPKEAAYQI
FT                   INDELKFDGNPRLNLASFVTTWMEPECDKLMMESINKNNVEMDQYPVTTDLQNRCVNMI
FT                   ARLFNAPLGDGEAAIGVGTVGSSEAVMLAGLAFKRQWQNKRKALGLPYDRPNIVTGANI
FT                   QVCLEKFARYFEVELKEVKLREGYYVMDPDKAVEMVDENTICVVAILGSTLTGEFEDVK
FT                   LLNDLLVEKNKKTGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLV
FT                   YAGIGWVVWRTKTDLPDELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGY
FT                   RNVMDNCRENMMVLRQGLEKTGRFNIVSKENGVPLVAFSLKDSSRHNEFEVAEMLRRFG
FT                   WIVPAYTMPADAQHVTVLRVVIREDFSRTLAERLVADFEKVLHELDTLPARVHAKMASG
FT                   KVNGVKKTPEETQREVTAYWKKFVDTKTDKNGVPLVASITNQ"
FT   gene            complement(474108..476997)
FT                   /gene="GAD4"
FT                   /gene_synonym="F14H20.8"
FT                   /gene_synonym="F14H20_8"
FT                   /gene_synonym="glutamate decarboxylase 4"
FT                   /locus_tag="AT2G02010"
FT   mRNA            complement(join(474108..474842,475008..475060,
FT                   475163..475416,475503..475717,475818..476223,
FT                   476410..476650))
FT                   /gene="GAD4"
FT                   /gene_synonym="F14H20.8"
FT                   /gene_synonym="F14H20_8"
FT                   /gene_synonym="glutamate decarboxylase 4"
FT                   /locus_tag="AT2G02010"
FT                   /product="glutamate decarboxylase 4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BE662982.1,INSD:EL297675.1,INSD:BP562497.2,
FT                   INSD:EG512396.1,INSD:BE662983.1,INSD:AV827275.1,
FT                   INSD:CB185697.2,INSD:AV440371.1,INSD:EG512395.1,
FT                   INSD:AV797725.1,INSD:EL030757.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY124860.1,INSD:AF361836.1,INSD:BX820266.1"
FT   mRNA            complement(join(474165..474842,475008..475060,
FT                   475163..475416,475503..475717,475818..476223,
FT                   476410..476997))
FT                   /gene="GAD4"
FT                   /gene_synonym="F14H20.8"
FT                   /gene_synonym="F14H20_8"
FT                   /gene_synonym="glutamate decarboxylase 4"
FT                   /locus_tag="AT2G02010"
FT                   /product="glutamate decarboxylase 4"
FT   CDS_pept        complement(join(474375..474842,475008..475060,
FT                   475163..475416,475503..475717,475818..476223,
FT                   476410..476651))
FT                   /codon_start=1
FT                   /gene="GAD4"
FT                   /gene_synonym="F14H20.8"
FT                   /gene_synonym="F14H20_8"
FT                   /gene_synonym="glutamate decarboxylase 4"
FT                   /locus_tag="AT2G02010"
FT                   /product="glutamate decarboxylase 4"
FT                   /db_xref="EnsemblGenomes-Gn:AT2G02010"
FT                   /db_xref="GOA:A0A1P8AZ64"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8AZ64"
FT                   /protein_id="ANM61964.1"
FT                   /translation="MKRHILSTIYTICSSSSNSTHSSSTTKQKHYYTFFPLVHFKPKNQ
FT                   SSKLKEDMVLSKTVSESDVSIHSTFASRYVRNSLPRFEMPENSIPKEAAYQIINDELML
FT                   DGNPRLNLASFVTTWMEPECDKLMMESINKNYVDMDEYPVTTELQNRCVNMIARLFNAP
FT                   LGDGEAAVGVGTVGSSEAIMLAGLAFKRQWQNKRKAQGLPYDKPNIVTGANVQVCWEKF
FT                   ARYFEVELKEVNLREDYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLV
FT                   EKNKQTGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWV
FT                   VWRTKTDLPDELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMDNC
FT                   RENMMVLRQGLEKTGRFKIVSKENGVPLVAFSLKDSSRHNEFEVAHTLRRFGWIVPAYT
FT                   MPADAQHVTVLRVVIREDFSRTLAERLVADFEKVLHELDTLPARVHAKMANGKVNGVKK
FT                   TPEETQREVTAYWKKLLETKKTNKNTIC"
FT   CDS_pept        complement(join(474375..474842,475008..475060,
FT                   475163..475416,475503..475717,475818..476223,
FT                   476410..476495))
FT                   /codon_start=1
FT                   /gene="GAD4"
FT                   /gene_synonym="F14H20.8"
FT                   /gene_synonym="F14H20_8"
FT                   /gene_synonym="glutamate decarboxylase 4"
FT                   /locus_tag="AT2G02010"
FT                   /product="glutamate decarboxylase 4"
FT                   /note="glutamate decarboxylase 4 (GAD4); FUNCTIONS IN:
FT                   calmodulin binding; INVOLVED IN: carboxylic acid metabolic
FT                   process, glutamate metabolic process, glutamate
FT                   decarboxylation to succinate; LOCATED IN: cytosol, nucleus;
FT                   CONTAINS InterPro DOMAIN/s: Pyridoxal phosphate-dependent
FT                   transferase, major domain (InterPro:IPR015424), Pyridoxal
FT                   phosphate-dependent decarboxylase (InterPro:IPR002129),
FT                   Glutamate decarboxylase (InterPro:IPR010107), Pyridoxal
FT                   phosphate-dependent transferase, major region, subdomain 1
FT                   (InterPro:IPR015421); BEST Arabidopsis thaliana protein
FT                   match is: glutamate decarboxylase 3 (TAIR:AT2G02000.1); Has
FT                   2849 Blast hits to 2845 proteins in 876 species: Archae -
FT                   190; Bacteria - 1701; Metazoa - 147; Fungi - 354; Plants -
FT                   286; Viruses - 3; Other Eukaryotes - 168 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G02010"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G02010.1"
FT                   /db_xref="GOA:Q9ZPS3"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZPS3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BE662982.1,INSD:EL297675.1,INSD:BP562497.2,
FT                   INSD:EG512396.1,INSD:BE662983.1,INSD:AV827275.1,
FT                   INSD:CB185697.2,INSD:AV440371.1,INSD:EG512395.1,
FT                   INSD:AV797725.1,INSD:EL030757.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY124860.1,INSD:AF361836.1,INSD:BX820266.1"
FT                   /protein_id="AEC05532.1"
FT                   /translation="MVLSKTVSESDVSIHSTFASRYVRNSLPRFEMPENSIPKEAAYQI
FT                   INDELMLDGNPRLNLASFVTTWMEPECDKLMMESINKNYVDMDEYPVTTELQNRCVNMI
FT                   ARLFNAPLGDGEAAVGVGTVGSSEAIMLAGLAFKRQWQNKRKAQGLPYDKPNIVTGANV
FT                   QVCWEKFARYFEVELKEVNLREDYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVK
FT                   LLNDLLVEKNKQTGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLV
FT                   YAGIGWVVWRTKTDLPDELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGY
FT                   RNVMDNCRENMMVLRQGLEKTGRFKIVSKENGVPLVAFSLKDSSRHNEFEVAHTLRRFG
FT                   WIVPAYTMPADAQHVTVLRVVIREDFSRTLAERLVADFEKVLHELDTLPARVHAKMANG
FT                   KVNGVKKTPEETQREVTAYWKKLLETKKTNKNTIC"
FT   gene            476692..477011
FT                   /locus_tag="AT2G04155"
FT   ncRNA           476692..477011
FT                   /locus_tag="AT2G04155"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            478977..481185
FT                   /gene="PTR4"
FT                   /gene_synonym="AtNPF8.4"
FT                   /gene_synonym="AtPTR4"
FT                   /gene_synonym="F14H20.9"
FT                   /gene_synonym="F14H20_9"
FT                   /gene_synonym="NPF8.4"
FT                   /gene_synonym="NRT1/ PTR family 8.4"
FT                   /gene_synonym="peptide transporter 4"
FT                   /locus_tag="AT2G02020"
FT   mRNA            join(478977..479173,479248..479350,479452..479669,
FT                   479749..480235,480359..481185)
FT                   /gene="PTR4"
FT                   /gene_synonym="AtNPF8.4"
FT                   /gene_synonym="AtPTR4"
FT                   /gene_synonym="F14H20.9"
FT                   /gene_synonym="F14H20_9"
FT                   /gene_synonym="NPF8.4"
FT                   /gene_synonym="NRT1/ PTR family 8.4"
FT                   /gene_synonym="peptide transporter 4"
FT                   /locus_tag="AT2G02020"
FT                   /product="Major facilitator superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL103886.1,INSD:AU227239.1,INSD:EH953929.1,
FT                   INSD:EH802683.1,INSD:AU236340.1,INSD:EL093653.1"
FT   mRNA            join(479101..479173,479248..479350,479452..479669,
FT                   479749..480235,480330..480391,480484..481185)
FT                   /gene="PTR4"
FT                   /gene_synonym="F14H20.9"
FT                   /gene_synonym="F14H20_9"
FT                   /gene_synonym="AtNPF8.4"
FT                   /gene_synonym="AtPTR4"
FT                   /gene_synonym="NPF8.4"
FT                   /gene_synonym="NRT1/ PTR family 8.4"
FT                   /gene_synonym="peptide transporter 4"
FT                   /locus_tag="AT2G02020"
FT                   /product="Major facilitator superfamily protein"
FT   CDS_pept        join(479117..479173,479248..479350,479452..479669,
FT                   479749..480235,480330..480391,480484..481131)
FT                   /codon_start=1
FT                   /gene="PTR4"
FT                   /gene_synonym="F14H20.9"
FT                   /gene_synonym="F14H20_9"
FT                   /gene_synonym="AtNPF8.4"
FT                   /gene_synonym="AtPTR4"
FT                   /gene_synonym="NPF8.4"
FT                   /gene_synonym="NRT1/ PTR family 8.4"
FT                   /gene_synonym="peptide transporter 4"
FT                   /locus_tag="AT2G02020"
FT                   /product="Major facilitator superfamily protein"
FT                   /note="Major facilitator superfamily protein; FUNCTIONS IN:
FT                   transporter activity; INVOLVED IN: oligopeptide transport;
FT                   LOCATED IN: membrane; EXPRESSED IN: 6 plant structures;
FT                   EXPRESSED DURING: LP.06 six leaves visible; CONTAINS
FT                   InterPro DOMAIN/s: PTR2 family proton/oligopeptide
FT                   symporter, conserved site (InterPro:IPR018456),
FT                   Oligopeptide transporter (InterPro:IPR000109), Major
FT                   facilitator superfamily, general substrate transporter
FT                   (InterPro:IPR016196); BEST Arabidopsis thaliana protein
FT                   match is: Major facilitator superfamily protein
FT                   (TAIR:AT1G62200.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G02020"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G02020.2"
FT                   /db_xref="GOA:F4IPF3"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:F4IPF3"
FT                   /protein_id="AEC05534.1"
FT                   /translation="MASIDEERSLLEVEESLIQEEVKLYAEDGSIDIHGNPPLKQTTGN
FT                   WKACPFIFANECCERLAYYGIAKNLITYFTNELHETNVSAARHVMTWQGTCYITPLIGA
FT                   LIADAYWGRYWTIACFSAIYFTGMVALTLSASVPGLKPAECIGSLCPPATMVQSTVLFS
FT                   GLYLIALGTGGIKPCVSSFGADQFDKTDPSERVRKASFFNWFYFTINIGAFVSSTVLVW
FT                   IQENYGWELGFLIPTVFMGLATMSFFFGTPLYRFQKPRGSPITSVCQVLVAAYRKSNLK
FT                   VPEDSTDGFLTKRQLYQKEMQTLTRGSYIYTLFVQQGRCMKRTIGLFEIPPATLGMFDT
FT                   ASVLISVPIYDRVIVPLVRRFTGLAKGFTELQRMGIGLFVSVLSLTFAAIVETVRLQLA
FT                   RDLDLVESGDIVPLNIFWQIPQYFLMGTAGVFFFVGRIEFFYEQSPDSMRSLCSAWALL
FT                   TTTLGNYLSSLIITLVAYLSGKDCWIPSDNINNGHLDYFFWLLVSLGSVNIPVFVFFSV
FT                   KYTHMKV"
FT   CDS_pept        join(479117..479173,479248..479350,479452..479669,
FT                   479749..480235,480359..481131)
FT                   /codon_start=1
FT                   /gene="PTR4"
FT                   /gene_synonym="F14H20.9"
FT                   /gene_synonym="F14H20_9"
FT                   /gene_synonym="AtNPF8.4"
FT                   /gene_synonym="AtPTR4"
FT                   /gene_synonym="NPF8.4"
FT                   /gene_synonym="NRT1/ PTR family 8.4"
FT                   /gene_synonym="peptide transporter 4"
FT                   /locus_tag="AT2G02020"
FT                   /product="Major facilitator superfamily protein"
FT                   /note="Major facilitator superfamily protein; FUNCTIONS IN:
FT                   transporter activity; INVOLVED IN: oligopeptide transport;
FT                   LOCATED IN: membrane; EXPRESSED IN: 6 plant structures;
FT                   EXPRESSED DURING: LP.06 six leaves visible; CONTAINS
FT                   InterPro DOMAIN/s: PTR2 family proton/oligopeptide
FT                   symporter, conserved site (InterPro:IPR018456),
FT                   Oligopeptide transporter (InterPro:IPR000109), Major
FT                   facilitator superfamily, general substrate transporter
FT                   (InterPro:IPR016196); BEST Arabidopsis thaliana protein
FT                   match is: peptide transporter 2 (TAIR:AT2G02040.1); Has
FT                   8051 Blast hits to 7680 proteins in 1472 species: Archae -
FT                   0; Bacteria - 4049; Metazoa - 790; Fungi - 469; Plants -
FT                   2161; Viruses - 0; Other Eukaryotes - 582 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT2G02020.1"
FT                   /db_xref="GOA:Q84WG0"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84WG0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL103886.1,INSD:AU227239.1,INSD:EH953929.1,
FT                   INSD:EH802683.1,INSD:AU236340.1,INSD:EL093653.1"
FT                   /protein_id="AEC05533.1"
FT                   /translation="MASIDEERSLLEVEESLIQEEVKLYAEDGSIDIHGNPPLKQTTGN
FT                   WKACPFIFANECCERLAYYGIAKNLITYFTNELHETNVSAARHVMTWQGTCYITPLIGA
FT                   LIADAYWGRYWTIACFSAIYFTGMVALTLSASVPGLKPAECIGSLCPPATMVQSTVLFS
FT                   GLYLIALGTGGIKPCVSSFGADQFDKTDPSERVRKASFFNWFYFTINIGAFVSSTVLVW
FT                   IQENYGWELGFLIPTVFMGLATMSFFFGTPLYRFQKPRGSPITSVCQVLVAAYRKSNLK
FT                   VPEDSTDEGDANTNPWKLCTVTQVEEVKILLRLVPIWASGIIFSVLHSQIYTLFVQQGR
FT                   CMKRTIGLFEIPPATLGMFDTASVLISVPIYDRVIVPLVRRFTGLAKGFTELQRMGIGL
FT                   FVSVLSLTFAAIVETVRLQLARDLDLVESGDIVPLNIFWQIPQYFLMGTAGVFFFVGRI
FT                   EFFYEQSPDSMRSLCSAWALLTTTLGNYLSSLIITLVAYLSGKDCWIPSDNINNGHLDY
FT                   FFWLLVSLGSVNIPVFVFFSVKYTHMKV"
FT   gene            complement(481467..481830)
FT                   /locus_tag="AT2G02023"
FT   mRNA            complement(481467..481830)
FT                   /locus_tag="AT2G02023"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(481467..481778)
FT                   /codon_start=1
FT                   /locus_tag="AT2G02023"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; Has 0 Blast hits to 0
FT                   proteins in 0 species (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G02023"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G02023.1"
FT                   /db_xref="GOA:F4IPF5"
FT                   /db_xref="UniProtKB/TrEMBL:F4IPF5"
FT                   /protein_id="AEC05535.1"
FT                   /translation="MSVMGTSHCDVNLAIHCQSSIDSGALPSEPLQEVLAEDQMRLVAT
FT                   LPHNWCFGRRIWVPGILCLRRFDKLAQEKMKTNGLNPLVSLVKGKSIVINRCRAFQKA"
FT   gene            481907..482086
FT                   /locus_tag="AT2G02026"
FT   mRNA            481907..482086
FT                   /locus_tag="AT2G02026"
FT                   /product="hypothetical protein"
FT   CDS_pept        481907..482086
FT                   /codon_start=1
FT                   /locus_tag="AT2G02026"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G02026"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G02026.1"
FT                   /db_xref="UniProtKB/TrEMBL:B3H5U2"
FT                   /protein_id="AEC05536.1"
FT                   /translation="MKERHGSYYEMIKPHQERREQRTGRMFDATYVGDGAHDVCDKICF
FT                   FMVMMVTTSYVNLA"
FT   gene            482335..483829
FT                   /gene_synonym="F14H20.10"
FT                   /gene_synonym="F14H20_10"
FT                   /locus_tag="AT2G02030"
FT   mRNA            join(482335..482405,482896..483829)
FT                   /gene_synonym="F14H20.10"
FT                   /gene_synonym="F14H20_10"
FT                   /locus_tag="AT2G02030"
FT                   /product="F-box family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG491100.1,INSD:EG491117.1,INSD:EG491105.1"
FT   CDS_pept        join(482335..482405,482896..483829)
FT                   /codon_start=1
FT                   /gene_synonym="F14H20.10"
FT                   /gene_synonym="F14H20_10"
FT                   /locus_tag="AT2G02030"
FT                   /product="F-box family protein"
FT                   /note="F-box family protein; CONTAINS InterPro DOMAIN/s:
FT                   F-box domain, cyclin-like (InterPro:IPR001810), F-box
FT                   domain, Skp2-like (InterPro:IPR022364); BEST Arabidopsis
FT                   thaliana protein match is: F-box and associated interaction
FT                   domains-containing protein (TAIR:AT1G12870.1); Has 1703
FT                   Blast hits to 1685 proteins in 46 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 1701;
FT                   Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT2G02030"
FT                   /db_xref="EnsemblGenomes-Tr:AT2G02030.1"
FT                   /db_xref="GOA:Q9ZPS1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR017451"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZPS1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG491100.1,INSD:EG491117.1,INSD:EG491105.1"
FT                   /protein_id="AEC05537.1"
FT                   /translation="MSGKTSSRGQQDEISGEKHEPTPTKEIKRRRKEFEKIHIPNEIVE
FT                   EILVRLPVKSLTRFQTVSKHWRTLITSKYFGKRHMALEKSKGCKLLFVCDDFVDRAEDT
FT                   LFLKTVALEKTSVSEGDEQAFEFEGYKGFLDISESCDGLVCFYDTTRAVEVMNPATTMF
FT                   IELPLSRIQQLCIYKPNPEVELEPVQDPNPVLDPVMTCSQIGVGKDSVSGSYKLVWMYN
FT                   TSPATPPTCEVLDLDGKKWRFVNTTSLDHHQILCDQRPVFANGSLYWLTGDEEGYATTQ
FT                   TKLIVLDLHTEMFQVIQTPPFITRDASGDKIGLCNLDGRLCISELKKDCKQEF"
FT   gene            484075..484602
FT                   /locus_tag="AT2G04175"
FT   ncRNA           484075..484602
FT                   /locus_tag="AT2G04175"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            487398..489941
FT                   /gene="PTR2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 2"
FT                   /gene_synonym="AtNPF8.3"
FT                   /gene_synonym="ATPTR2"
FT                   /gene_synonym="ATPTR2-B"
FT                   /gene_synonym="F14H20.11"
FT                   /gene_synonym="F14H20_11"
FT                   /gene_synonym="HISTIDINE TRANSPORT PROTEIN"
FT                   /gene_synonym="NITRATE TRANSPORTER 1"
FT                   /gene_synonym="NPF8.3"
FT                   /gene_synonym="NRT1/ PTR family 8.3"
FT                   /gene_synonym="NTR1"
FT                   /gene_synonym="peptide transporter 2"
FT                   /gene_synonym="PTR2-B"
FT                   /locus_tag="AT2G02040"
FT                   /note="Encodes a di- and tri-peptide transporter that
FT                   recognizes a variety of different amino acid combinations.
FT                   Expression of the transcripts for this gene can be detected
FT                   in the embryo through in situ hybridization. This protein
FT                   does not have nitrate transporter activity based on oocyte
FT                   transport assays."
FT   mRNA            join(487398..487598,487854..488171,488250..488806,
FT                   488882..489941)
FT                   /gene="PTR2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 2"
FT                   /gene_synonym="AtNPF8.3"
FT                   /gene_synonym="ATPTR2"
FT                   /gene_synonym="ATPTR2-B"
FT                   /gene_synonym="F14H20.11"
FT                   /gene_synonym="F14H20_11"
FT                   /gene_synonym="HISTIDINE TRANSPORT PROTEIN"
FT                   /gene_synonym="NITRATE TRANSPORTER 1"
FT                   /gene_synonym="NPF8.3"
FT                   /gene_synonym="NRT1/ PTR family 8.3"
FT                   /gene_synonym="NTR1"
FT                   /gene_synonym="peptide transporter 2"
FT                   /gene_synonym="PTR2-B"
FT                   /locus_tag="AT2G02040"
FT                   /product="peptide transporter 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP804473.1,INSD:EL055749.1,INSD:ES147277.1,
FT                   INSD:BX837095.1,INSD:ES083441.1,INSD:DR265370.1,
FT                   INSD:AA720355.1,INSD:BP568881.1,INSD:EL125855.1,
FT                   INSD:EL318950.1,INSD:AV798018.1,INSD:DR265368.1,
FT                   INSD:EL041792.1,INSD:DR227346.1,INSD:EL005844.1,
FT                   INSD:AV567697.1,INSD:DR375682.1,INSD:EL180189.1,
FT                   INSD:AV518326.1,INSD:BP615324.1,INSD:AA651379.1,
FT                   INSD:BP661366.1,INSD:EH935711.1,INSD:AV787154.1,
FT                   INSD:BP848072.1,INSD:AV537496.1,INSD:AV537528.1,
FT                   INSD:DR265373.1,INSD:EL287261.1,INSD:EL261954.1,
FT                   INSD:DR348831.1,INSD:AV525088.1,INSD:DR265372.1,
FT                   INSD:BP831851.1,INSD:EH879119.1,INSD:Z26376.1,
FT                   INSD:DR265371.1,INSD:EL998541.1,INSD:EH845606.1,
FT                   INSD:ES201740.1,INSD:EL257492.1,INSD:EL039157.1,
FT                   INSD:AV812367.1,INSD:EH915825.1,INSD:CB185767.2,
FT                   INSD:BP847133.1,INSD:AV803123.1,INSD:BP851958.1,
FT                   INSD:EL077477.1,INSD:AV549409.1,INSD:DR265369.1,
FT                   INSD:AI994076.1,INSD:EH921021.1,INSD:DR265367.1,
FT                   INSD:BP814852.1,INSD:EL188751.1,INSD:AV814228.1,
FT                   INSD:ES167222.1,INSD:EL003293.1,INSD:EL017003.1,
FT                   INSD:BP621737.1,INSD:ES080249.1,INSD:R30015.1,
FT                   INSD:R29830.1,INSD:BP780817.1,INSD:EL030379.1,
FT                   INSD:EL180466.1,INSD:DR265366.1,INSD:DR371401.1,
FT                   INSD:EL115388.1,INSD:BP667984.1,INSD:EH826839.1,
FT                   INSD:ES023135.1,INSD:EH824229.1,INSD:EH819275.1,
FT                   INSD:EL174765.1,INSD:BP795888.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF372946.1,INSD:X77503.1,INSD:L39082.1,
FT                   INSD:AY143954.1,INSD:BX842007.1"
FT   CDS_pept        join(487542..487598,487854..488171,488250..488806,
FT                   488882..489707)
FT                   /codon_start=1
FT                   /gene="PTR2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 2"
FT                   /gene_synonym="ATPTR2"
FT                   /gene_synonym="ATPTR2-B"
FT                   /gene_synonym="F14H20.11"
FT                   /gene_synonym="F14H20_11"
FT                   /gene_synonym="HISTIDINE TRANSPORT PROTEIN"
FT                   /gene_synonym="NITRATE TRANSPORTER 1"
FT                   /gene_synonym="NTR1"
FT                   /gene_synonym="peptide transporter 2"
FT                   /gene_synonym="PTR2-B"
FT                   /gene_synonym="AtNPF8.3"
FT                   /gene_synonym="NPF8.3"
FT                   /gene_synonym="NRT1/ PTR family 8.3"
FT                   /locus_tag="AT2G02040"
FT                   /product="peptide transporter 2"
FT                   /note="peptide transporter 2 (PTR2); FUNCTIONS IN:
FT                   dipeptide transporter activity, high affinity oligopeptide
FT                   transporter activity, tripeptide transporter activity,
FT                   peptide transporter activity, transporter activity;
FT                   INVOLVED IN: dipeptide transport, tripeptide transport,
FT                   peptide transport; LOCATED IN: vacuolar membrane, plasma
FT                   membrane, vacuole, plant-type vacuole; EXPRESSED IN: 24
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: PTR2 family proton/oligopeptide
FT                   symporter, conserved site (InterPro:IPR018456),
FT                   Oligopeptide transporter (InterPro:IPR000109), Major
FT                   facilitator superfamily, general substrate transporter
FT                   (InterPro:IPR016196); BEST Arabidopsis thaliana protein
FT                   match is: Major facilitator superfamily protein
FT                   (TAIR:AT1G62200.1); Has 8080 Blast hits to 7668 proteins in
FT                   1494 species: Archae - 0; Bacteria - 3960; Metazoa - 799;
FT                   Fungi - 488; Plants - 2224; Viruses - 0; Other Eukaryotes -
FT                   609 (source: NCBI BLink)."
FT                   /db_xref="GOA:P46032"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46032"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP804473.1,INSD:EL055749.1,INSD:ES147277.1,
FT                   INSD:BX837095.1,INSD:ES083441.1,INSD:DR265370.1,
FT                   INSD:AA720355.1,INSD:BP568881.1,INSD:EL125855.1,
FT                   INSD:EL318950.1,INSD:AV798018.1,INSD:DR265368.1,
FT                   INSD:EL041792.1,INSD:DR227346.1,INSD:EL005844.1,
FT                   INSD:AV567697.1,INSD:DR375682.1,INSD:EL180189.1,
FT                   INSD:AV518326.1,INSD:BP615324.1,INSD:AA651379.1,
FT                   INSD:BP661366.1,INSD:EH935711.1,INSD:AV787154.1,
FT                   INSD:BP848072.1,INSD:AV537496.1,INSD:AV537528.1,
FT                   INSD:DR265373.1,INSD:EL287261.1,INSD:EL261954.1,
FT                   INSD:DR348831.1,INSD:AV525088.1,INSD:DR265372.1,
FT                   INSD:BP831851.1,INSD:EH879119.1,INSD:Z26376.1,
FT                   INSD:DR265371.1,INSD:EL998541.1,INSD:EH845606.1,
FT                   INSD:ES201740.1,INSD:EL257492.1,INSD:EL039157.1,
FT                   INSD:AV812367.1,INSD:EH915825.1,INSD:CB185767.2,
FT                   INSD:BP847133.1,INSD:AV803123.1,INSD:BP851958.1,
FT                   INSD:EL077477.1,INSD:AV549409.1,INSD:DR265369.1,
FT                   INSD:AI994076.1,INSD:EH921021.1,INSD:DR265367.1,
FT                   INSD:BP814852.1,INSD:EL188751.1,INSD:AV814228.1,
FT                   INSD:ES167222.1,INSD:EL003293.1,INSD:EL017003.1,
FT                   INSD:BP621737.1,INSD:ES080249.1,INSD:R30015.1,
FT                   INSD:R29830.1,INSD:BP780817.1,INSD:EL030379.1,
FT                   INSD:EL180466.1,INSD:DR265366.1,INSD:DR371401.1,
FT                   INSD:EL115388.1,INSD:BP667984.1,INSD:EH826839.1,
FT                   INSD:ES023135.1,INSD:EH824229.1,INSD:EH819275.1,
FT                   INSD:EL174765.1,INSD:BP795888.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF372946.1,INSD:X77503.1,INSD:L39082.1,
FT                   INSD:AY143954.1,INSD:BX842007.1"
FT                   /protein_id="AEC05538.1"
FT                   /translation="MGSIEEEARPLIEEGLILQEVKLYAEDGSVDFNGNPPLKEKTGNW
FT                   KACPFILGNECCERLAYYGIAGNLITYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAV
FT                   LADAYWGRYWTIACFSGIYFIGMSALTLSASVPALKPAECIGDFCPSATPAQYAMFFGG
FT                   LYLIALGTGGIKPCVSSFGADQFDDTDSRERVRKASFFNWFYFSINIGALVSSSLLVWI
FT                   QENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQKPGGSPITRISQVVVASFRKSSVKV
FT                   PEDATLLYETQDKNSAIAGSRKIEHTDDCQYLDKAAVISEEESKSGDYSNSWRLCTVTQ
FT                   VEELKILIRMFPIWASGIIFSAVYAQMSTMFVQQGRAMNCKIGSFQLPPAALGTFDTAS
FT                   VIIWVPLYDRFIVPLARKFTGVDKGFTEIQRMGIGLFVSVLCMAAAAIVEIIRLHMAND
FT                   LGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEFFYDQSPDAMRSLCSALALLTN
FT                   ALGNYLSSLILTLVTYFTTRNGQEGWISDNLNSGHLDYFFWLLAGLSLVNMAVYFFSAA
FT                   RYKQKKASS"
FT   gene            489952..492058
FT                   /locus_tag="AT2G02050"
FT   mRNA            join(489952..490374,491758..492058)
FT                   /locus_tag="AT2G02050"
FT                   /product="NADH-ubiquinone oxidoreductase B18 subunit"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR199200.1,INSD:ES192242.1,INSD:DR199214.1,
FT                   INSD:EL063088.1,INSD:BP638705.1,INSD:ES157687.1,
FT                   INSD:AV824861.1,INSD:DR199194.1,INSD:DR350912.1,
FT                   INSD:DR199218.1,INSD:EL341636.1,INSD:EH801223.1,
FT                   INSD:ES182945.1,INSD:DR199219.1,INSD:ES104707.1,
FT                   INSD:EH886128.1,INSD:DR375113.1,INSD:EL989983.1,
FT                   INSD:AV822689.1,INSD:EL180603.1,INSD:DR199211.1,
FT                   INSD:EH830142.1,INSD:EL264910.1,INSD:ES035877.1,
FT                   INSD:BP620368.1,INSD:ES203856.1,INSD:EL009300.1,
FT                   INSD:Z27010.1,INSD:EL091219.1,INSD:DR286128.1,
FT                   INSD:EH797694.1,INSD:BP660007.1,INSD:EL979000.1,
FT                   INSD:DR199223.1,INSD:BP828957.1,INSD:DR199213.1,
FT                   INSD:DR350910.1,INSD:DR199217.1,INSD:DR199221.1,
FT                   INSD:EL978717.1,INSD:DR225491.1,INSD:EG455647.1,
FT                   INSD:BP836928.1,INSD:AA042535.1,INSD:DR199205.1,
FT                   INSD:EH813302.1,INSD:DR223464.1,INSD:DR223463.1,
FT                   INSD:EL076014.1,INSD:DR199220.1,INSD:DR286127.1,
FT                   INSD:ES164513.1,INSD:EL156288.1,INSD:EH909805.1,
FT                   INSD:DR199203.1,INSD:EL050318.1,INSD:ES107712.1,
FT                   INSD:ES144276.1,INSD:BP846088.1,INSD:DR225490.1,
FT                   INSD:DR199209.1,INSD:DR199195.1,INSD:ES122146.1,
FT                   INSD:ES062715.1,INSD:DR199190.1,INSD:DR199191.1,
FT                   INSD:EH816951.1,INSD:DR199202.1,INSD:DR199197.1,
FT                   INSD:ES211211.1,INSD:DR199204.1,INSD:ES152684.1,
FT                   INSD:EH852516.1,INSD:AV783508.1,INSD:DR199222.1,
FT                   INSD:AV788189.1,INSD:EH889821.1,INSD:DR199206.1,
FT                   INSD:DR376415.1,INSD:EL295318.1,INSD:DR199216.1,
FT                   INSD:DR223461.1,INSD:DR223462.1,INSD:DR199210.1,
FT                   INSD:AV535510.1,INSD:ES123965.1,INSD:DR340262.1,
FT                   INSD:DR199199.1,INSD:DR199201.1,INSD:DR350908.1,
FT                   INSD:EL304851.1,INSD:EL995837.1,INSD:DR376896.1,
FT                   INSD:EL218097.1,INSD:ES095166.1,INSD:DR199196.1,
FT                   INSD:EH919888.1,INSD:BE527454.1,INSD:ES183304.1,
FT                   INSD:BP801712.1,INSD:BP630208.1,INSD:EL988031.1,
FT                   INSD:ES141255.1,INSD:EH836925.1,INSD:ES192789.1,
FT                   INSD:BP799276.1,INSD:DR199193.1,INSD:BP625068.1,
FT                   INSD:ES120789.1,INSD:ES198854.1,INSD:DR199208.1,
FT                   INSD:DR199198.1,INSD:EL240628.1,INSD:DR199212.1,
FT                   INSD:DR199224.1,INSD:AU230027.1,INSD:ES086758.1,
FT                   INSD:DR199192.1,INSD:ES051345.1,INSD:DR199215.1,
FT                   INSD:ES139626.1,INSD:EL104961.1,INSD:AU238788.1,
FT                   INSD:EL075543.1,INSD:BP564248.1,INSD:DR286125.1,
FT                   INSD:DR350909.1,INSD:ES058128.1,INSD:Z29839.1,
FT                   INSD:BP574392.1,INSD:DR350911.1,INSD:BP568397.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF324660.2,INSD:AF326908.1,INSD:AK117949.1,
FT                   INSD:AY052268.1,INSD:BX819882.1,INSD:AY087888.1,
FT                   INSD:AY143799.1"
FT   CDS_pept        490024..490335
FT                   /codon_start=1
FT                   /locus_tag="AT2G02050"
FT                   /product="NADH-ubiquinone oxidoreductase B18 subunit"
FT                   /note="NADH-ubiquinone oxidoreductase B18 subunit,
FT                   putative; FUNCTIONS IN: NADH dehydrogenase activity, NADH
FT                   dehydrogenase (ubiquinone) activity; INVOLVED IN:
FT                   mitochondrial electron transport, NADH to ubiquinone,
FT                   photorespiration; LOCATED IN: mitochondrion, mitochondrial
FT                   membrane, mitochondrial respiratory chain complex I,
FT                   respiratory chain complex I; EXPRESSED IN: 25 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: NADH:ubiquinone oxidoreductase, B18
FT                   subunit (InterPro:IPR008698); Has 270 Blast hits to 270
FT                   proteins in 128 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 127; Fungi - 75; Plants - 50; Viruses - 0; Other
FT                   Eukaryotes - 18 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9SKC9"
FT                   /db_xref="InterPro:IPR008698"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SKC9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR199200.1,INSD:ES192242.1,INSD:DR199214.1,
FT                   INSD:EL063088.1,INSD:BP638705.1,INSD:ES157687.1,
FT                   INSD:AV824861.1,INSD:DR199194.1,INSD:DR350912.1,
FT                   INSD:DR199218.1,INSD:EL341636.1,INSD:EH801223.1,
FT                   INSD:ES182945.1,INSD:DR199219.1,INSD:ES104707.1,
FT                   INSD:EH886128.1,INSD:DR375113.1,INSD:EL989983.1,
FT                   INSD:AV822689.1,INSD:EL180603.1,INSD:DR199211.1,
FT                   INSD:EH830142.1,INSD:EL264910.1,INSD:ES035877.1,
FT                   INSD:BP620368.1,INSD:ES203856.1,INSD:EL009300.1,
FT                   INSD:Z27010.1,INSD:EL091219.1,INSD:DR286128.1,
FT                   INSD:EH797694.1,INSD:BP660007.1,INSD:EL979000.1,
FT                   INSD:DR199223.1,INSD:BP828957.1,INSD:DR199213.1,
FT                   INSD:DR350910.1,INSD:DR199217.1,INSD:DR199221.1,
FT                   INSD:EL978717.1,INSD:DR225491.1,INSD:EG455647.1,
FT                   INSD:BP836928.1,INSD:AA042535.1,INSD:DR199205.1,
FT                   INSD:EH813302.1,INSD:DR223464.1,INSD:DR223463.1,
FT                   INSD:EL076014.1,INSD:DR199220.1,INSD:DR286127.1,
FT                   INSD:ES164513.1,INSD:EL156288.1,INSD:EH909805.1,
FT                   INSD:DR199203.1,INSD:EL050318.1,INSD:ES107712.1,
FT                   INSD:ES144276.1,INSD:BP846088.1,INSD:DR225490.1,
FT                   INSD:DR199209.1,INSD:DR199195.1,INSD:ES122146.1,
FT                   INSD:ES062715.1,INSD:DR199190.1,INSD:DR199191.1,
FT                   INSD:EH816951.1,INSD:DR199202.1,INSD:DR199197.1,
FT                   INSD:ES211211.1,INSD:DR199204.1,INSD:ES152684.1,
FT                   INSD:EH852516.1,INSD:AV783508.1,INSD:DR199222.1,
FT                   INSD:AV788189.1,INSD:EH889821.1,INSD:DR199206.1,
FT                   INSD:DR376415.1,INSD:EL295318.1,INSD:DR199216.1,
FT                   INSD:DR223461.1,INSD:DR223462.1,INSD:DR199210.1,
FT                   INSD:AV535510.1,INSD:ES123965.1,INSD:DR340262.1,
FT                   INSD:DR199199.1,INSD:DR199201.1,INSD:DR350908.1,
FT                   INSD:EL304851.1,INSD:EL995837.1,INSD:DR376896.1,
FT                   INSD:EL218097.1,INSD:ES095166.1,INSD:DR199196.1,
FT                   INSD:EH919888.1,INSD:BE527454.1,INSD:ES183304.1,
FT                   INSD:BP801712.1,INSD:BP630208.1,INSD:EL988031.1,
FT                   INSD:ES141255.1,INSD:EH836925.1,INSD:ES192789.1,
FT                   INSD:BP799276.1,INSD:DR199193.1,INSD:BP625068.1,
FT                   INSD:ES120789.1,INSD:ES198854.1,INSD:DR199208.1,
FT                   INSD:DR199198.1,INSD:EL240628.1,INSD:DR199212.1,
FT                   INSD:DR199224.1,INSD:AU230027.1,INSD:ES086758.1,
FT                   INSD:DR199192.1,INSD:ES051345.1,INSD:DR199215.1,
FT                   INSD:ES139626.1,INSD:EL104961.1,INSD:AU238788.1,
FT                   INSD:EL075543.1,INSD:BP564248.1,INSD:DR286125.1,
FT                   INSD:DR350909.1,INSD:ES058128.1,INSD:Z29839.1,
FT                   INSD:BP574392.1,INSD:DR350911.1,INSD:BP568397.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF324660.2,INSD:AF326908.1,INSD:AK117949.1,
FT                   INSD:AY052268.1,INSD:BX819882.1,INSD:AY087888.1,
FT                   INSD:AY143799.1"
FT                   /protein_id="AEC05539.1"
FT                   /translation="MEVPGSSKKMIATQEEMSAAKIALGSRDMCAHLLIPLNKCRQAEF
FT                   YLPWKCEDERHVYEKCEYELVMERMLAMKKIREEEALAKQNKLQGNAAVPLIPKTANA"
FT   gene            494745..497860
FT                   /gene_synonym="F14H20.13"
FT                   /locus_tag="AT2G02060"
FT   mRNA            join(494745..494760,495676..495850,496269..496345,
FT                   496452..496491,496765..496906,497032..497161,
FT                   497388..497778)
FT                   /gene_synonym="F14H20.13"
FT                   /locus_tag="AT2G02060"
FT                   /product="Homeodomain-like superfamily protein"
FT   mRNA            join(495381..495850,496269..496345,496452..496491,
FT                   496765..496906,497032..497161,497388..497860)
FT                   /gene_synonym="F14H20.13"
FT                   /locus_tag="AT2G02060"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV557774.1,INSD:EL309267.1,INSD:AU238345.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT008556.1,INSD:BT008699.1,INSD:AK229511.1"
FT   CDS_pept        join(495691..495850,496269..496345,496452..496491,
FT                   496765..496906,497032..497161,497388..497609)
FT                   /codon_start=1
FT                   /gene_synonym="F14H20.13"
FT                   /locus_tag="AT2G02060"
FT                   /product="Homeodomain-like superfami