(data stored in ACNUC16935 zone)

EMBL: CP002687

ID   CP002687; SV 1; linear; genomic DNA; STD; PLN; 18585056 BP.
XX
AC   CP002687;
XX
PR   Project:PRJNA116;
XX
DT   13-MAY-2011 (Rel. 108, Created)
DT   29-JUN-2017 (Rel. 133, Last updated, Version 8)
XX
DE   Arabidopsis thaliana chromosome 4 sequence.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-18585056
RX   DOI; 10.1038/47134.
RX   PUBMED; 10617198.
RA   Mayer K., Schuller C., Wambutt R., Murphy G., Volckaert G., Pohl T.,
RA   Dusterhoft A., Stiekema W., Entian K.D., Terryn N., Harris B., Ansorge W.,
RA   Brandt P., Grivell L., Rieger M., Weichselgartner M., de Simone V.,
RA   Obermaier B., Mache R., Muller M., Kreis M., Delseny M., Puigdomenech P.,
RA   Watson M., Schmidtheini T., Reichert B., Portatelle D., Perez-Alonso M.,
RA   Boutry M., Bancroft I., Vos P., Hoheisel J., Zimmermann W., Wedler H.,
RA   Ridley P., Langham S.A., McCullagh B., Bilham L., Robben J.,
RA   Van der Schueren J., Grymonprez B., Chuang Y.J., Vandenbussche F.,
RA   Braeken M., Weltjens I., Voet M., Bastiaens I., Aert R., Defoor E.,
RA   Weitzenegger T., Bothe G., Ramsperger U., Hilbert H., Braun M., Holzer E.,
RA   Brandt A., Peters S., van Staveren M., Dirske W., Mooijman P.,
RA   Klein Lankhorst R., Rose M., Hauf J., Kotter P., Berneiser S., Hempel S.,
RA   Feldpausch M., Lamberth S., Van den Daele H., De Keyser A., Buysshaert C.,
RA   Gielen J., Villarroel R., De Clercq R., Van Montagu M., Rogers J.,
RA   Cronin A., Quail M., Bray-Allen S., Clark L., Doggett J., Hall S., Kay M.,
RA   Lennard N., McLay K., Mayes R., Pettett A., Rajandream M.A., Lyne M.,
RA   Benes V., Rechmann S., Borkova D., Blocker H., Scharfe M., Grimm M.,
RA   Lohnert T.H., Dose S., de Haan M., Maarse A., Schafer M., Muller-Auer S.,
RA   Gabel C., Fuchs M., Fartmann B., Granderath K., Dauner D., Herzl A.,
RA   Neumann S., Argiriou A., Vitale D., Liguori R., Piravandi E., Massenet O.,
RA   Quigley F., Clabauld G., Mundlein A., Felber R., Schnabl S., Hiller R.,
RA   Schmidt W., Lecharny A., Aubourg S., Chefdor F., Cooke R., Berger C.,
RA   Montfort A., Casacuberta E., Gibbons T., Weber N., Vandenbol M.,
RA   Bargues M., Terol J., Torres A., Perez-Perez A., Purnelle B., Bent E.,
RA   Johnson S., Tacon D., Jesse T., Heijnen L., Schwarz S., Scholler P.,
RA   Heber S., Francs P., Bielke C., Frishman D., Haase D., Lemcke K.,
RA   Mewes H.W., Stocker S., Zaccaria P., Bevan M., Wilson R.K.,
RA   de la Bastide M., Habermann K., Parnell L., Dedhia N., Gnoj L., Schutz K.,
RA   Huang E., Spiegel L., Sehkon M., Murray J., Sheet P., Cordes M.,
RA   Abu-Threideh J., Stoneking T., Kalicki J., Graves T., Harmon G.,
RA   Edwards J., Latreille P., Courtney L., Cloud J., Abbott A., Scott K.,
RA   Johnson D., Minx P., Bentley D., Fulton B., Miller N., Greco T., Kemp K.,
RA   Kramer J., Fulton L., Mardis E., Dante M., Pepin K., Hillier L., Nelson J.,
RA   Spieth J., Ryan E., Andrews S., Geisel C., Layman D., Du H., Ali J.,
RA   Berghoff A., Jones K., Drone K., Cotton M., Joshu C., Antonoiu B.,
RA   Zidanic M., Strong C., Sun H., Lamar B., Yordan C., Ma P., Zhong J.,
RA   Preston R., Vil D., Shekher M., Matero A., Shah R., Swaby I.K.,
RA   O'Shaughnessy A., Rodriguez M., Hoffmann J., Till S., Granat S., Shohdy N.,
RA   Hasegawa A., Hameed A., Lodhi M., Johnson A., Chen E., Marra M.,
RA   Martienssen R., McCombie W.R.;
RT   "Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana";
RL   Nature 402(6763):769-777(1999).
XX
RN   [2]
RP   1-18585056
RG   TAIR
RA   Swarbreck D., Lamesch P., Wilks C., Huala E.;
RT   ;
RL   Submitted (18-FEB-2011) to the INSDC.
RL   Department of Plant Biology, Carnegie Institution, 260 Panama Street,
RL   Stanford, CA, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-18585056
RA   Krishnakumar V., Cheng C.-Y., Chan A.P., Schobel S., Kim M., Ferlanti E.S.,
RA   Belyaeva I., Rosen B.D., Micklem G., Miller J.R., Vaughn M., Town C.D.;
RT   ;
RL   Submitted (17-MAY-2016) to the INSDC.
RL   Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr,
RL   Rockville, MD 20850, USA
XX
DR   MD5; 21f56163f7e34510232448b14fce7578.
DR   BioSample; SAMN03081427.
DR   EnsemblGenomes-Gn; AT4G00085.
DR   EnsemblGenomes-Gn; AT4G00830.
DR   EnsemblGenomes-Gn; AT4G00885.
DR   EnsemblGenomes-Gn; AT4G00975.
DR   EnsemblGenomes-Gn; AT4G00985.
DR   EnsemblGenomes-Gn; AT4G01230.
DR   EnsemblGenomes-Gn; AT4G01355.
DR   EnsemblGenomes-Gn; AT4G01533.
DR   EnsemblGenomes-Gn; AT4G01593.
DR   EnsemblGenomes-Gn; AT4G01865.
DR   EnsemblGenomes-Gn; AT4G02005.
DR   EnsemblGenomes-Gn; AT4G02055.
DR   EnsemblGenomes-Gn; AT4G02430.
DR   EnsemblGenomes-Gn; AT4G02555.
DR   EnsemblGenomes-Gn; AT4G03038.
DR   EnsemblGenomes-Gn; AT4G03039.
DR   EnsemblGenomes-Gn; AT4G03135.
DR   EnsemblGenomes-Gn; AT4G03285.
DR   EnsemblGenomes-Gn; AT4G03295.
DR   EnsemblGenomes-Gn; AT4G03405.
DR   EnsemblGenomes-Gn; AT4G03435.
DR   EnsemblGenomes-Gn; AT4G03438.
DR   EnsemblGenomes-Gn; AT4G03445.
DR   EnsemblGenomes-Gn; AT4G03455.
DR   EnsemblGenomes-Gn; AT4G03525.
DR   EnsemblGenomes-Gn; AT4G03535.
DR   EnsemblGenomes-Gn; AT4G03545.
DR   EnsemblGenomes-Gn; AT4G03555.
DR   EnsemblGenomes-Gn; AT4G03575.
DR   EnsemblGenomes-Gn; AT4G03585.
DR   EnsemblGenomes-Gn; AT4G03595.
DR   EnsemblGenomes-Gn; AT4G03605.
DR   EnsemblGenomes-Gn; AT4G03655.
DR   EnsemblGenomes-Gn; AT4G03665.
DR   EnsemblGenomes-Gn; AT4G03675.
DR   EnsemblGenomes-Gn; AT4G03685.
DR   EnsemblGenomes-Gn; AT4G03705.
DR   EnsemblGenomes-Gn; AT4G03715.
DR   EnsemblGenomes-Gn; AT4G03725.
DR   EnsemblGenomes-Gn; AT4G03755.
DR   EnsemblGenomes-Gn; AT4G03765.
DR   EnsemblGenomes-Gn; AT4G03785.
DR   EnsemblGenomes-Gn; AT4G03805.
DR   EnsemblGenomes-Gn; AT4G03811.
DR   EnsemblGenomes-Gn; AT4G03815.
DR   EnsemblGenomes-Gn; AT4G03845.
DR   EnsemblGenomes-Gn; AT4G03855.
DR   EnsemblGenomes-Gn; AT4G03875.
DR   EnsemblGenomes-Gn; AT4G03895.
DR   EnsemblGenomes-Gn; AT4G03905.
DR   EnsemblGenomes-Gn; AT4G03915.
DR   EnsemblGenomes-Gn; AT4G03925.
DR   EnsemblGenomes-Gn; AT4G03935.
DR   EnsemblGenomes-Gn; AT4G03955.
DR   EnsemblGenomes-Gn; AT4G03985.
DR   EnsemblGenomes-Gn; AT4G03995.
DR   EnsemblGenomes-Gn; AT4G04005.
DR   EnsemblGenomes-Gn; AT4G04015.
DR   EnsemblGenomes-Gn; AT4G04035.
DR   EnsemblGenomes-Gn; AT4G04055.
DR   EnsemblGenomes-Gn; AT4G04065.
DR   EnsemblGenomes-Gn; AT4G04075.
DR   EnsemblGenomes-Gn; AT4G04077.
DR   EnsemblGenomes-Gn; AT4G04085.
DR   EnsemblGenomes-Gn; AT4G04095.
DR   EnsemblGenomes-Gn; AT4G04115.
DR   EnsemblGenomes-Gn; AT4G04125.
DR   EnsemblGenomes-Gn; AT4G04135.
DR   EnsemblGenomes-Gn; AT4G04185.
DR   EnsemblGenomes-Gn; AT4G04195.
DR   EnsemblGenomes-Gn; AT4G04205.
DR   EnsemblGenomes-Gn; AT4G04215.
DR   EnsemblGenomes-Gn; AT4G04221.
DR   EnsemblGenomes-Gn; AT4G04223.
DR   EnsemblGenomes-Gn; AT4G04225.
DR   EnsemblGenomes-Gn; AT4G04235.
DR   EnsemblGenomes-Gn; AT4G04260.
DR   EnsemblGenomes-Gn; AT4G04275.
DR   EnsemblGenomes-Gn; AT4G04285.
DR   EnsemblGenomes-Gn; AT4G04295.
DR   EnsemblGenomes-Gn; AT4G04305.
DR   EnsemblGenomes-Gn; AT4G04315.
DR   EnsemblGenomes-Gn; AT4G04325.
DR   EnsemblGenomes-Gn; AT4G04335.
DR   EnsemblGenomes-Gn; AT4G04345.
DR   EnsemblGenomes-Gn; AT4G04355.
DR   EnsemblGenomes-Gn; AT4G04365.
DR   EnsemblGenomes-Gn; AT4G04385.
DR   EnsemblGenomes-Gn; AT4G04425.
DR   EnsemblGenomes-Gn; AT4G04435.
DR   EnsemblGenomes-Gn; AT4G04445.
DR   EnsemblGenomes-Gn; AT4G04455.
DR   EnsemblGenomes-Gn; AT4G04465.
DR   EnsemblGenomes-Gn; AT4G04475.
DR   EnsemblGenomes-Gn; AT4G04485.
DR   EnsemblGenomes-Gn; AT4G04505.
DR   EnsemblGenomes-Gn; AT4G04515.
DR   EnsemblGenomes-Gn; AT4G04535.
DR   EnsemblGenomes-Gn; AT4G04565.
DR   EnsemblGenomes-Gn; AT4G04585.
DR   EnsemblGenomes-Gn; AT4G04615.
DR   EnsemblGenomes-Gn; AT4G04625.
DR   EnsemblGenomes-Gn; AT4G04645.
DR   EnsemblGenomes-Gn; AT4G04665.
DR   EnsemblGenomes-Gn; AT4G04675.
DR   EnsemblGenomes-Gn; AT4G04755.
DR   EnsemblGenomes-Gn; AT4G04765.
DR   EnsemblGenomes-Gn; AT4G04785.
DR   EnsemblGenomes-Gn; AT4G04795.
DR   EnsemblGenomes-Gn; AT4G04805.
DR   EnsemblGenomes-Gn; AT4G04815.
DR   EnsemblGenomes-Gn; AT4G04825.
DR   EnsemblGenomes-Gn; AT4G04835.
DR   EnsemblGenomes-Gn; AT4G04855.
DR   EnsemblGenomes-Gn; AT4G04865.
DR   EnsemblGenomes-Gn; AT4G04875.
DR   EnsemblGenomes-Gn; AT4G04895.
DR   EnsemblGenomes-Gn; AT4G04905.
DR   EnsemblGenomes-Gn; AT4G04945.
DR   EnsemblGenomes-Gn; AT4G04965.
DR   EnsemblGenomes-Gn; AT4G04975.
DR   EnsemblGenomes-Gn; AT4G04980.
DR   EnsemblGenomes-Gn; AT4G04995.
DR   EnsemblGenomes-Gn; AT4G05005.
DR   EnsemblGenomes-Gn; AT4G05015.
DR   EnsemblGenomes-Gn; AT4G05025.
DR   EnsemblGenomes-Gn; AT4G05045.
DR   EnsemblGenomes-Gn; AT4G05048.
DR   EnsemblGenomes-Gn; AT4G05055.
DR   EnsemblGenomes-Gn; AT4G05065.
DR   EnsemblGenomes-Gn; AT4G05075.
DR   EnsemblGenomes-Gn; AT4G05085.
DR   EnsemblGenomes-Gn; AT4G05105.
DR   EnsemblGenomes-Gn; AT4G05115.
DR   EnsemblGenomes-Gn; AT4G05125.
DR   EnsemblGenomes-Gn; AT4G05135.
DR   EnsemblGenomes-Gn; AT4G05155.
DR   EnsemblGenomes-Gn; AT4G05205.
DR   EnsemblGenomes-Gn; AT4G05215.
DR   EnsemblGenomes-Gn; AT4G05225.
DR   EnsemblGenomes-Gn; AT4G05235.
DR   EnsemblGenomes-Gn; AT4G05245.
DR   EnsemblGenomes-Gn; AT4G05255.
DR   EnsemblGenomes-Gn; AT4G05275.
DR   EnsemblGenomes-Gn; AT4G05285.
DR   EnsemblGenomes-Gn; AT4G05295.
DR   EnsemblGenomes-Gn; AT4G05305.
DR   EnsemblGenomes-Gn; AT4G05315.
DR   EnsemblGenomes-Gn; AT4G05335.
DR   EnsemblGenomes-Gn; AT4G05355.
DR   EnsemblGenomes-Gn; AT4G05365.
DR   EnsemblGenomes-Gn; AT4G05375.
DR   EnsemblGenomes-Gn; AT4G05385.
DR   EnsemblGenomes-Gn; AT4G05395.
DR   EnsemblGenomes-Gn; AT4G05405.
DR   EnsemblGenomes-Gn; AT4G05415.
DR   EnsemblGenomes-Gn; AT4G05425.
DR   EnsemblGenomes-Gn; AT4G05435.
DR   EnsemblGenomes-Gn; AT4G05445.
DR   EnsemblGenomes-Gn; AT4G05455.
DR   EnsemblGenomes-Gn; AT4G05465.
DR   EnsemblGenomes-Gn; AT4G05470.
DR   EnsemblGenomes-Gn; AT4G05485.
DR   EnsemblGenomes-Gn; AT4G05508.
DR   EnsemblGenomes-Gn; AT4G05525.
DR   EnsemblGenomes-Gn; AT4G05535.
DR   EnsemblGenomes-Gn; AT4G05545.
DR   EnsemblGenomes-Gn; AT4G05565.
DR   EnsemblGenomes-Gn; AT4G05605.
DR   EnsemblGenomes-Gn; AT4G05615.
DR   EnsemblGenomes-Gn; AT4G05625.
DR   EnsemblGenomes-Gn; AT4G05645.
DR   EnsemblGenomes-Gn; AT4G05650.
DR   EnsemblGenomes-Gn; AT4G05655.
DR   EnsemblGenomes-Gn; AT4G05660.
DR   EnsemblGenomes-Gn; AT4G05665.
DR   EnsemblGenomes-Gn; AT4G05670.
DR   EnsemblGenomes-Gn; AT4G05675.
DR   EnsemblGenomes-Gn; AT4G05680.
DR   EnsemblGenomes-Gn; AT4G05685.
DR   EnsemblGenomes-Gn; AT4G05690.
DR   EnsemblGenomes-Gn; AT4G05695.
DR   EnsemblGenomes-Gn; AT4G05700.
DR   EnsemblGenomes-Gn; AT4G05705.
DR   EnsemblGenomes-Gn; AT4G05710.
DR   EnsemblGenomes-Gn; AT4G05715.
DR   EnsemblGenomes-Gn; AT4G05720.
DR   EnsemblGenomes-Gn; AT4G05730.
DR   EnsemblGenomes-Gn; AT4G05735.
DR   EnsemblGenomes-Gn; AT4G05740.
DR   EnsemblGenomes-Gn; AT4G05745.
DR   EnsemblGenomes-Gn; AT4G05750.
DR   EnsemblGenomes-Gn; AT4G05755.
DR   EnsemblGenomes-Gn; AT4G05760.
DR   EnsemblGenomes-Gn; AT4G05765.
DR   EnsemblGenomes-Gn; AT4G05770.
DR   EnsemblGenomes-Gn; AT4G05775.
DR   EnsemblGenomes-Gn; AT4G05780.
DR   EnsemblGenomes-Gn; AT4G05785.
DR   EnsemblGenomes-Gn; AT4G05790.
DR   EnsemblGenomes-Gn; AT4G05795.
DR   EnsemblGenomes-Gn; AT4G05800.
DR   EnsemblGenomes-Gn; AT4G05805.
DR   EnsemblGenomes-Gn; AT4G05810.
DR   EnsemblGenomes-Gn; AT4G05815.
DR   EnsemblGenomes-Gn; AT4G05840.
DR   EnsemblGenomes-Gn; AT4G05845.
DR   EnsemblGenomes-Gn; AT4G05850.
DR   EnsemblGenomes-Gn; AT4G05855.
DR   EnsemblGenomes-Gn; AT4G05860.
DR   EnsemblGenomes-Gn; AT4G05865.
DR   EnsemblGenomes-Gn; AT4G05870.
DR   EnsemblGenomes-Gn; AT4G05875.
DR   EnsemblGenomes-Gn; AT4G05880.
DR   EnsemblGenomes-Gn; AT4G05885.
DR   EnsemblGenomes-Gn; AT4G05890.
DR   EnsemblGenomes-Gn; AT4G05895.
DR   EnsemblGenomes-Gn; AT4G05900.
DR   EnsemblGenomes-Gn; AT4G05905.
DR   EnsemblGenomes-Gn; AT4G05910.
DR   EnsemblGenomes-Gn; AT4G05915.
DR   EnsemblGenomes-Gn; AT4G05920.
DR   EnsemblGenomes-Gn; AT4G05925.
DR   EnsemblGenomes-Gn; AT4G05930.
DR   EnsemblGenomes-Gn; AT4G05935.
DR   EnsemblGenomes-Gn; AT4G05940.
DR   EnsemblGenomes-Gn; AT4G05945.
DR   EnsemblGenomes-Gn; AT4G05950.
DR   EnsemblGenomes-Gn; AT4G05965.
DR   EnsemblGenomes-Gn; AT4G05970.
DR   EnsemblGenomes-Gn; AT4G05975.
DR   EnsemblGenomes-Gn; AT4G05980.
DR   EnsemblGenomes-Gn; AT4G05985.
DR   EnsemblGenomes-Gn; AT4G05990.
DR   EnsemblGenomes-Gn; AT4G05995.
DR   EnsemblGenomes-Gn; AT4G06000.
DR   EnsemblGenomes-Gn; AT4G06005.
DR   EnsemblGenomes-Gn; AT4G06010.
DR   EnsemblGenomes-Gn; AT4G06015.
DR   EnsemblGenomes-Gn; AT4G06045.
DR   EnsemblGenomes-Gn; AT4G06050.
DR   EnsemblGenomes-Gn; AT4G06055.
DR   EnsemblGenomes-Gn; AT4G06060.
DR   EnsemblGenomes-Gn; AT4G06065.
DR   EnsemblGenomes-Gn; AT4G06070.
DR   EnsemblGenomes-Gn; AT4G06075.
DR   EnsemblGenomes-Gn; AT4G06080.
DR   EnsemblGenomes-Gn; AT4G06085.
DR   EnsemblGenomes-Gn; AT4G06090.
DR   EnsemblGenomes-Gn; AT4G06095.
DR   EnsemblGenomes-Gn; AT4G06105.
DR   EnsemblGenomes-Gn; AT4G06110.
DR   EnsemblGenomes-Gn; AT4G06115.
DR   EnsemblGenomes-Gn; AT4G06130.
DR   EnsemblGenomes-Gn; AT4G06135.
DR   EnsemblGenomes-Gn; AT4G06140.
DR   EnsemblGenomes-Gn; AT4G06145.
DR   EnsemblGenomes-Gn; AT4G06155.
DR   EnsemblGenomes-Gn; AT4G06160.
DR   EnsemblGenomes-Gn; AT4G06165.
DR   EnsemblGenomes-Gn; AT4G06170.
DR   EnsemblGenomes-Gn; AT4G06175.
DR   EnsemblGenomes-Gn; AT4G06185.
DR   EnsemblGenomes-Gn; AT4G06195.
DR   EnsemblGenomes-Gn; AT4G06200.
DR   EnsemblGenomes-Gn; AT4G06205.
DR   EnsemblGenomes-Gn; AT4G06210.
DR   EnsemblGenomes-Gn; AT4G06215.
DR   EnsemblGenomes-Gn; AT4G06225.
DR   EnsemblGenomes-Gn; AT4G06235.
DR   EnsemblGenomes-Gn; AT4G06240.
DR   EnsemblGenomes-Gn; AT4G06245.
DR   EnsemblGenomes-Gn; AT4G06250.
DR   EnsemblGenomes-Gn; AT4G06255.
DR   EnsemblGenomes-Gn; AT4G06260.
DR   EnsemblGenomes-Gn; AT4G06265.
DR   EnsemblGenomes-Gn; AT4G06280.
DR   EnsemblGenomes-Gn; AT4G06285.
DR   EnsemblGenomes-Gn; AT4G06290.
DR   EnsemblGenomes-Gn; AT4G06295.
DR   EnsemblGenomes-Gn; AT4G06300.
DR   EnsemblGenomes-Gn; AT4G06305.
DR   EnsemblGenomes-Gn; AT4G06310.
DR   EnsemblGenomes-Gn; AT4G06315.
DR   EnsemblGenomes-Gn; AT4G06320.
DR   EnsemblGenomes-Gn; AT4G06330.
DR   EnsemblGenomes-Gn; AT4G06335.
DR   EnsemblGenomes-Gn; AT4G06340.
DR   EnsemblGenomes-Gn; AT4G06345.
DR   EnsemblGenomes-Gn; AT4G06365.
DR   EnsemblGenomes-Gn; AT4G06370.
DR   EnsemblGenomes-Gn; AT4G06375.
DR   EnsemblGenomes-Gn; AT4G06380.
DR   EnsemblGenomes-Gn; AT4G06385.
DR   EnsemblGenomes-Gn; AT4G06390.
DR   EnsemblGenomes-Gn; AT4G06395.
DR   EnsemblGenomes-Gn; AT4G06400.
DR   EnsemblGenomes-Gn; AT4G06405.
DR   EnsemblGenomes-Gn; AT4G06410.
DR   EnsemblGenomes-Gn; AT4G06415.
DR   EnsemblGenomes-Gn; AT4G06425.
DR   EnsemblGenomes-Gn; AT4G06440.
DR   EnsemblGenomes-Gn; AT4G06445.
DR   EnsemblGenomes-Gn; AT4G06450.
DR   EnsemblGenomes-Gn; AT4G06455.
DR   EnsemblGenomes-Gn; AT4G06460.
DR   EnsemblGenomes-Gn; AT4G06665.
DR   EnsemblGenomes-Gn; AT4G06675.
DR   EnsemblGenomes-Gn; AT4G06685.
DR   EnsemblGenomes-Gn; AT4G06695.
DR   EnsemblGenomes-Gn; AT4G06701.
DR   EnsemblGenomes-Gn; AT4G06705.
DR   EnsemblGenomes-Gn; AT4G06715.
DR   EnsemblGenomes-Gn; AT4G06725.
DR   EnsemblGenomes-Gn; AT4G06745.
DR   EnsemblGenomes-Gn; AT4G06755.
DR   EnsemblGenomes-Gn; AT4G06760.
DR   EnsemblGenomes-Gn; AT4G06765.
DR   EnsemblGenomes-Gn; AT4G06770.
DR   EnsemblGenomes-Gn; AT4G06775.
DR   EnsemblGenomes-Gn; AT4G06780.
DR   EnsemblGenomes-Gn; AT4G06785.
DR   EnsemblGenomes-Gn; AT4G06795.
DR   EnsemblGenomes-Gn; AT4G06800.
DR   EnsemblGenomes-Gn; AT4G06805.
DR   EnsemblGenomes-Gn; AT4G06810.
DR   EnsemblGenomes-Gn; AT4G06815.
DR   EnsemblGenomes-Gn; AT4G06820.
DR   EnsemblGenomes-Gn; AT4G06825.
DR   EnsemblGenomes-Gn; AT4G06830.
DR   EnsemblGenomes-Gn; AT4G06835.
DR   EnsemblGenomes-Gn; AT4G06845.
DR   EnsemblGenomes-Gn; AT4G06850.
DR   EnsemblGenomes-Gn; AT4G06855.
DR   EnsemblGenomes-Gn; AT4G06860.
DR   EnsemblGenomes-Gn; AT4G06865.
DR   EnsemblGenomes-Gn; AT4G06870.
DR   EnsemblGenomes-Gn; AT4G06875.
DR   EnsemblGenomes-Gn; AT4G06880.
DR   EnsemblGenomes-Gn; AT4G06885.
DR   EnsemblGenomes-Gn; AT4G06890.
DR   EnsemblGenomes-Gn; AT4G06895.
DR   EnsemblGenomes-Gn; AT4G06900.
DR   EnsemblGenomes-Gn; AT4G06905.
DR   EnsemblGenomes-Gn; AT4G06910.
DR   EnsemblGenomes-Gn; AT4G06915.
DR   EnsemblGenomes-Gn; AT4G06920.
DR   EnsemblGenomes-Gn; AT4G06925.
DR   EnsemblGenomes-Gn; AT4G06930.
DR   EnsemblGenomes-Gn; AT4G06935.
DR   EnsemblGenomes-Gn; AT4G06945.
DR   EnsemblGenomes-Gn; AT4G06950.
DR   EnsemblGenomes-Gn; AT4G06955.
DR   EnsemblGenomes-Gn; AT4G06960.
DR   EnsemblGenomes-Gn; AT4G06965.
DR   EnsemblGenomes-Gn; AT4G06970.
DR   EnsemblGenomes-Gn; AT4G06975.
DR   EnsemblGenomes-Gn; AT4G06980.
DR   EnsemblGenomes-Gn; AT4G06985.
DR   EnsemblGenomes-Gn; AT4G06990.
DR   EnsemblGenomes-Gn; AT4G06995.
DR   EnsemblGenomes-Gn; AT4G07000.
DR   EnsemblGenomes-Gn; AT4G07005.
DR   EnsemblGenomes-Gn; AT4G07010.
DR   EnsemblGenomes-Gn; AT4G07015.
DR   EnsemblGenomes-Gn; AT4G07020.
DR   EnsemblGenomes-Gn; AT4G07025.
DR   EnsemblGenomes-Gn; AT4G07030.
DR   EnsemblGenomes-Gn; AT4G07040.
DR   EnsemblGenomes-Gn; AT4G07045.
DR   EnsemblGenomes-Gn; AT4G07050.
DR   EnsemblGenomes-Gn; AT4G07055.
DR   EnsemblGenomes-Gn; AT4G07060.
DR   EnsemblGenomes-Gn; AT4G07065.
DR   EnsemblGenomes-Gn; AT4G07070.
DR   EnsemblGenomes-Gn; AT4G07075.
DR   EnsemblGenomes-Gn; AT4G07080.
DR   EnsemblGenomes-Gn; AT4G07085.
DR   EnsemblGenomes-Gn; AT4G07090.
DR   EnsemblGenomes-Gn; AT4G07095.
DR   EnsemblGenomes-Gn; AT4G07100.
DR   EnsemblGenomes-Gn; AT4G07105.
DR   EnsemblGenomes-Gn; AT4G07110.
DR   EnsemblGenomes-Gn; AT4G07115.
DR   EnsemblGenomes-Gn; AT4G07120.
DR   EnsemblGenomes-Gn; AT4G07125.
DR   EnsemblGenomes-Gn; AT4G07130.
DR   EnsemblGenomes-Gn; AT4G07135.
DR   EnsemblGenomes-Gn; AT4G07145.
DR   EnsemblGenomes-Gn; AT4G07150.
DR   EnsemblGenomes-Gn; AT4G07160.
DR   EnsemblGenomes-Gn; AT4G07165.
DR   EnsemblGenomes-Gn; AT4G07170.
DR   EnsemblGenomes-Gn; AT4G07175.
DR   EnsemblGenomes-Gn; AT4G07180.
DR   EnsemblGenomes-Gn; AT4G07185.
DR   EnsemblGenomes-Gn; AT4G07190.
DR   EnsemblGenomes-Gn; AT4G07195.
DR   EnsemblGenomes-Gn; AT4G07200.
DR   EnsemblGenomes-Gn; AT4G07205.
DR   EnsemblGenomes-Gn; AT4G07210.
DR   EnsemblGenomes-Gn; AT4G07215.
DR   EnsemblGenomes-Gn; AT4G07220.
DR   EnsemblGenomes-Gn; AT4G07225.
DR   EnsemblGenomes-Gn; AT4G07230.
DR   EnsemblGenomes-Gn; AT4G07235.
DR   EnsemblGenomes-Gn; AT4G07240.
DR   EnsemblGenomes-Gn; AT4G07245.
DR   EnsemblGenomes-Gn; AT4G07250.
DR   EnsemblGenomes-Gn; AT4G07255.
DR   EnsemblGenomes-Gn; AT4G07260.
DR   EnsemblGenomes-Gn; AT4G07265.
DR   EnsemblGenomes-Gn; AT4G07270.
DR   EnsemblGenomes-Gn; AT4G07275.
DR   EnsemblGenomes-Gn; AT4G07280.
DR   EnsemblGenomes-Gn; AT4G07285.
DR   EnsemblGenomes-Gn; AT4G07290.
DR   EnsemblGenomes-Gn; AT4G07295.
DR   EnsemblGenomes-Gn; AT4G07300.
DR   EnsemblGenomes-Gn; AT4G07305.
DR   EnsemblGenomes-Gn; AT4G07335.
DR   EnsemblGenomes-Gn; AT4G07345.
DR   EnsemblGenomes-Gn; AT4G07365.
DR   EnsemblGenomes-Gn; AT4G07375.
DR   EnsemblGenomes-Gn; AT4G07385.
DR   EnsemblGenomes-Gn; AT4G07395.
DR   EnsemblGenomes-Gn; AT4G07405.
DR   EnsemblGenomes-Gn; AT4G07465.
DR   EnsemblGenomes-Gn; AT4G07505.
DR   EnsemblGenomes-Gn; AT4G07535.
DR   EnsemblGenomes-Gn; AT4G07545.
DR   EnsemblGenomes-Gn; AT4G07565.
DR   EnsemblGenomes-Gn; AT4G07575.
DR   EnsemblGenomes-Gn; AT4G07625.
DR   EnsemblGenomes-Gn; AT4G07635.
DR   EnsemblGenomes-Gn; AT4G07645.
DR   EnsemblGenomes-Gn; AT4G07655.
DR   EnsemblGenomes-Gn; AT4G07665.
DR   EnsemblGenomes-Gn; AT4G07715.
DR   EnsemblGenomes-Gn; AT4G07735.
DR   EnsemblGenomes-Gn; AT4G07745.
DR   EnsemblGenomes-Gn; AT4G07765.
DR   EnsemblGenomes-Gn; AT4G07775.
DR   EnsemblGenomes-Gn; AT4G07785.
DR   EnsemblGenomes-Gn; AT4G07805.
DR   EnsemblGenomes-Gn; AT4G07815.
DR   EnsemblGenomes-Gn; AT4G07845.
DR   EnsemblGenomes-Gn; AT4G07855.
DR   EnsemblGenomes-Gn; AT4G07865.
DR   EnsemblGenomes-Gn; AT4G07875.
DR   EnsemblGenomes-Gn; AT4G07895.
DR   EnsemblGenomes-Gn; AT4G07905.
DR   EnsemblGenomes-Gn; AT4G07925.
DR   EnsemblGenomes-Gn; AT4G07955.
DR   EnsemblGenomes-Gn; AT4G07975.
DR   EnsemblGenomes-Gn; AT4G07985.
DR   EnsemblGenomes-Gn; AT4G08005.
DR   EnsemblGenomes-Gn; AT4G08015.
DR   EnsemblGenomes-Gn; AT4G08035.
DR   EnsemblGenomes-Gn; AT4G08045.
DR   EnsemblGenomes-Gn; AT4G08055.
DR   EnsemblGenomes-Gn; AT4G08065.
DR   EnsemblGenomes-Gn; AT4G08075.
DR   EnsemblGenomes-Gn; AT4G08085.
DR   EnsemblGenomes-Gn; AT4G08116.
DR   EnsemblGenomes-Gn; AT4G08125.
DR   EnsemblGenomes-Gn; AT4G08155.
DR   EnsemblGenomes-Gn; AT4G08165.
DR   EnsemblGenomes-Gn; AT4G08175.
DR   EnsemblGenomes-Gn; AT4G08185.
DR   EnsemblGenomes-Gn; AT4G08195.
DR   EnsemblGenomes-Gn; AT4G08205.
DR   EnsemblGenomes-Gn; AT4G08215.
DR   EnsemblGenomes-Gn; AT4G08225.
DR   EnsemblGenomes-Gn; AT4G08235.
DR   EnsemblGenomes-Gn; AT4G08245.
DR   EnsemblGenomes-Gn; AT4G08255.
DR   EnsemblGenomes-Gn; AT4G08265.
DR   EnsemblGenomes-Gn; AT4G08285.
DR   EnsemblGenomes-Gn; AT4G08295.
DR   EnsemblGenomes-Gn; AT4G08305.
DR   EnsemblGenomes-Gn; AT4G08315.
DR   EnsemblGenomes-Gn; AT4G08325.
DR   EnsemblGenomes-Gn; AT4G08335.
DR   EnsemblGenomes-Gn; AT4G08345.
DR   EnsemblGenomes-Gn; AT4G08355.
DR   EnsemblGenomes-Gn; AT4G08365.
DR   EnsemblGenomes-Gn; AT4G08385.
DR   EnsemblGenomes-Gn; AT4G08415.
DR   EnsemblGenomes-Gn; AT4G08425.
DR   EnsemblGenomes-Gn; AT4G08435.
DR   EnsemblGenomes-Gn; AT4G08445.
DR   EnsemblGenomes-Gn; AT4G08465.
DR   EnsemblGenomes-Gn; AT4G08475.
DR   EnsemblGenomes-Gn; AT4G08495.
DR   EnsemblGenomes-Gn; AT4G08505.
DR   EnsemblGenomes-Gn; AT4G08515.
DR   EnsemblGenomes-Gn; AT4G08525.
DR   EnsemblGenomes-Gn; AT4G08560.
DR   EnsemblGenomes-Gn; AT4G08565.
DR   EnsemblGenomes-Gn; AT4G08575.
DR   EnsemblGenomes-Gn; AT4G08585.
DR   EnsemblGenomes-Gn; AT4G08595.
DR   EnsemblGenomes-Gn; AT4G08615.
DR   EnsemblGenomes-Gn; AT4G08625.
DR   EnsemblGenomes-Gn; AT4G08635.
DR   EnsemblGenomes-Gn; AT4G08665.
DR   EnsemblGenomes-Gn; AT4G08705.
DR   EnsemblGenomes-Gn; AT4G08715.
DR   EnsemblGenomes-Gn; AT4G08725.
DR   EnsemblGenomes-Gn; AT4G08755.
DR   EnsemblGenomes-Gn; AT4G08775.
DR   EnsemblGenomes-Gn; AT4G08785.
DR   EnsemblGenomes-Gn; AT4G08795.
DR   EnsemblGenomes-Gn; AT4G08805.
DR   EnsemblGenomes-Gn; AT4G08815.
DR   EnsemblGenomes-Gn; AT4G08825.
DR   EnsemblGenomes-Gn; AT4G08835.
DR   EnsemblGenomes-Gn; AT4G08845.
DR   EnsemblGenomes-Gn; AT4G08855.
DR   EnsemblGenomes-Gn; AT4G08865.
DR   EnsemblGenomes-Gn; AT4G08885.
DR   EnsemblGenomes-Gn; AT4G08915.
DR   EnsemblGenomes-Gn; AT4G08925.
DR   EnsemblGenomes-Gn; AT4G08935.
DR   EnsemblGenomes-Gn; AT4G08955.
DR   EnsemblGenomes-Gn; AT4G08965.
DR   EnsemblGenomes-Gn; AT4G08975.
DR   EnsemblGenomes-Gn; AT4G08985.
DR   EnsemblGenomes-Gn; AT4G09005.
DR   EnsemblGenomes-Gn; AT4G09015.
DR   EnsemblGenomes-Gn; AT4G09025.
DR   EnsemblGenomes-Gn; AT4G09045.
DR   EnsemblGenomes-Gn; AT4G09055.
DR   EnsemblGenomes-Gn; AT4G09065.
DR   EnsemblGenomes-Gn; AT4G09075.
DR   EnsemblGenomes-Gn; AT4G09085.
DR   EnsemblGenomes-Gn; AT4G09105.
DR   EnsemblGenomes-Gn; AT4G09115.
DR   EnsemblGenomes-Gn; AT4G09125.
DR   EnsemblGenomes-Gn; AT4G09135.
DR   EnsemblGenomes-Gn; AT4G09145.
DR   EnsemblGenomes-Gn; AT4G09155.
DR   EnsemblGenomes-Gn; AT4G09165.
DR   EnsemblGenomes-Gn; AT4G09175.
DR   EnsemblGenomes-Gn; AT4G09185.
DR   EnsemblGenomes-Gn; AT4G09195.
DR   EnsemblGenomes-Gn; AT4G09225.
DR   EnsemblGenomes-Gn; AT4G09235.
DR   EnsemblGenomes-Gn; AT4G09240.
DR   EnsemblGenomes-Gn; AT4G09265.
DR   EnsemblGenomes-Gn; AT4G09275.
DR   EnsemblGenomes-Gn; AT4G09285.
DR   EnsemblGenomes-Gn; AT4G09295.
DR   EnsemblGenomes-Gn; AT4G09305.
DR   EnsemblGenomes-Gn; AT4G09315.
DR   EnsemblGenomes-Gn; AT4G09325.
DR   EnsemblGenomes-Gn; AT4G09335.
DR   EnsemblGenomes-Gn; AT4G09365.
DR   EnsemblGenomes-Gn; AT4G09375.
DR   EnsemblGenomes-Gn; AT4G09385.
DR   EnsemblGenomes-Gn; AT4G09395.
DR   EnsemblGenomes-Gn; AT4G09405.
DR   EnsemblGenomes-Gn; AT4G09415.
DR   EnsemblGenomes-Gn; AT4G09432.
DR   EnsemblGenomes-Gn; AT4G09445.
DR   EnsemblGenomes-Gn; AT4G09475.
DR   EnsemblGenomes-Gn; AT4G09485.
DR   EnsemblGenomes-Gn; AT4G09495.
DR   EnsemblGenomes-Gn; AT4G09515.
DR   EnsemblGenomes-Gn; AT4G09525.
DR   EnsemblGenomes-Gn; AT4G09535.
DR   EnsemblGenomes-Gn; AT4G09555.
DR   EnsemblGenomes-Gn; AT4G09575.
DR   EnsemblGenomes-Gn; AT4G09605.
DR   EnsemblGenomes-Gn; AT4G09635.
DR   EnsemblGenomes-Gn; AT4G09645.
DR   EnsemblGenomes-Gn; AT4G09655.
DR   EnsemblGenomes-Gn; AT4G09665.
DR   EnsemblGenomes-Gn; AT4G09675.
DR   EnsemblGenomes-Gn; AT4G09685.
DR   EnsemblGenomes-Gn; AT4G09695.
DR   EnsemblGenomes-Gn; AT4G09705.
DR   EnsemblGenomes-Gn; AT4G09715.
DR   EnsemblGenomes-Gn; AT4G09725.
DR   EnsemblGenomes-Gn; AT4G09735.
DR   EnsemblGenomes-Gn; AT4G09755.
DR   EnsemblGenomes-Gn; AT4G09765.
DR   EnsemblGenomes-Gn; AT4G09785.
DR   EnsemblGenomes-Gn; AT4G09815.
DR   EnsemblGenomes-Gn; AT4G09825.
DR   EnsemblGenomes-Gn; AT4G09845.
DR   EnsemblGenomes-Gn; AT4G09855.
DR   EnsemblGenomes-Gn; AT4G09865.
DR   EnsemblGenomes-Gn; AT4G09885.
DR   EnsemblGenomes-Gn; AT4G09895.
DR   EnsemblGenomes-Gn; AT4G09905.
DR   EnsemblGenomes-Gn; AT4G09915.
DR   EnsemblGenomes-Gn; AT4G09925.
DR   EnsemblGenomes-Gn; AT4G09935.
DR   EnsemblGenomes-Gn; AT4G09945.
DR   EnsemblGenomes-Gn; AT4G09955.
DR   EnsemblGenomes-Gn; AT4G09975.
DR   EnsemblGenomes-Gn; AT4G09985.
DR   EnsemblGenomes-Gn; AT4G09995.
DR   EnsemblGenomes-Gn; AT4G10345.
DR   EnsemblGenomes-Gn; AT4G10507.
DR   EnsemblGenomes-Gn; AT4G10510.
DR   EnsemblGenomes-Gn; AT4G10530.
DR   EnsemblGenomes-Gn; AT4G10595.
DR   EnsemblGenomes-Gn; AT4G10767.
DR   EnsemblGenomes-Gn; AT4G10815.
DR   EnsemblGenomes-Gn; AT4G11177.
DR   EnsemblGenomes-Gn; AT4G11213.
DR   EnsemblGenomes-Gn; AT4G11216.
DR   EnsemblGenomes-Gn; AT4G11355.
DR   EnsemblGenomes-Gn; AT4G11405.
DR   EnsemblGenomes-Gn; AT4G11530.
DR   EnsemblGenomes-Gn; AT4G11985.
DR   EnsemblGenomes-Gn; AT4G12065.
DR   EnsemblGenomes-Gn; AT4G12115.
DR   EnsemblGenomes-Gn; AT4G12405.
DR   EnsemblGenomes-Gn; AT4G12485.
DR   EnsemblGenomes-Gn; AT4G12750.
DR   EnsemblGenomes-Gn; AT4G12917.
DR   EnsemblGenomes-Gn; AT4G13080.
DR   EnsemblGenomes-Gn; AT4G13245.
DR   EnsemblGenomes-Gn; AT4G13265.
DR   EnsemblGenomes-Gn; AT4G13280.
DR   EnsemblGenomes-Gn; AT4G13445.
DR   EnsemblGenomes-Gn; AT4G13493.
DR   EnsemblGenomes-Gn; AT4G13494.
DR   EnsemblGenomes-Gn; AT4G13495.
DR   EnsemblGenomes-Gn; AT4G13505.
DR   EnsemblGenomes-Gn; AT4G13554.
DR   EnsemblGenomes-Gn; AT4G13555.
DR   EnsemblGenomes-Gn; AT4G13564.
DR   EnsemblGenomes-Gn; AT4G13918.
DR   EnsemblGenomes-Gn; AT4G13965.
DR   EnsemblGenomes-Gn; AT4G14250.
DR   EnsemblGenomes-Gn; AT4G14345.
DR   EnsemblGenomes-Gn; AT4G14415.
DR   EnsemblGenomes-Gn; AT4G14504.
DR   EnsemblGenomes-Gn; AT4G14548.
DR   EnsemblGenomes-Gn; AT4G14570.
DR   EnsemblGenomes-Gn; AT4G14811.
DR   EnsemblGenomes-Gn; AT4G15060.
DR   EnsemblGenomes-Gn; AT4G15130.
DR   EnsemblGenomes-Gn; AT4G15236.
DR   EnsemblGenomes-Gn; AT4G15242.
DR   EnsemblGenomes-Gn; AT4G15258.
DR   EnsemblGenomes-Gn; AT4G15775.
DR   EnsemblGenomes-Gn; AT4G15780.
DR   EnsemblGenomes-Gn; AT4G15920.
DR   EnsemblGenomes-Gn; AT4G15950.
DR   EnsemblGenomes-Gn; AT4G15970.
DR   EnsemblGenomes-Gn; AT4G15975.
DR   EnsemblGenomes-Gn; AT4G16105.
DR   EnsemblGenomes-Gn; AT4G16110.
DR   EnsemblGenomes-Gn; AT4G16144.
DR   EnsemblGenomes-Gn; AT4G16150.
DR   EnsemblGenomes-Gn; AT4G16230.
DR   EnsemblGenomes-Gn; AT4G16235.
DR   EnsemblGenomes-Gn; AT4G16355.
DR   EnsemblGenomes-Gn; AT4G16360.
DR   EnsemblGenomes-Gn; AT4G16370.
DR   EnsemblGenomes-Gn; AT4G16465.
DR   EnsemblGenomes-Gn; AT4G16475.
DR   EnsemblGenomes-Gn; AT4G16590.
DR   EnsemblGenomes-Gn; AT4G16680.
DR   EnsemblGenomes-Gn; AT4G16730.
DR   EnsemblGenomes-Gn; AT4G16748.
DR   EnsemblGenomes-Gn; AT4G16892.
DR   EnsemblGenomes-Gn; AT4G17098.
DR   EnsemblGenomes-Gn; AT4G17100.
DR   EnsemblGenomes-Gn; AT4G17612.
DR   EnsemblGenomes-Gn; AT4G17765.
DR   EnsemblGenomes-Gn; AT4G17788.
DR   EnsemblGenomes-Gn; AT4G17975.
DR   EnsemblGenomes-Gn; AT4G17990.
DR   EnsemblGenomes-Gn; AT4G18255.
DR   EnsemblGenomes-Gn; AT4G18660.
DR   EnsemblGenomes-Gn; AT4G18680.
DR   EnsemblGenomes-Gn; AT4G18725.
DR   EnsemblGenomes-Gn; AT4G18815.
DR   EnsemblGenomes-Gn; AT4G19000.
DR   EnsemblGenomes-Gn; AT4G19035.
DR   EnsemblGenomes-Gn; AT4G19395.
DR   EnsemblGenomes-Gn; AT4G19850.
DR   EnsemblGenomes-Gn; AT4G20115.
DR   EnsemblGenomes-Gn; AT4G20235.
DR   EnsemblGenomes-Gn; AT4G20240.
DR   EnsemblGenomes-Gn; AT4G20362.
DR   EnsemblGenomes-Gn; AT4G20650.
DR   EnsemblGenomes-Gn; AT4G20900.
DR   EnsemblGenomes-Gn; AT4G21260.
DR   EnsemblGenomes-Gn; AT4G21323.
DR   EnsemblGenomes-Gn; AT4G21326.
DR   EnsemblGenomes-Gn; AT4G21362.
DR   EnsemblGenomes-Gn; AT4G21410.
DR   EnsemblGenomes-Gn; AT4G21540.
DR   EnsemblGenomes-Gn; AT4G21595.
DR   EnsemblGenomes-Gn; AT4G21640.
DR   EnsemblGenomes-Gn; AT4G22030.
DR   EnsemblGenomes-Gn; AT4G22233.
DR   EnsemblGenomes-Gn; AT4G22265.
DR   EnsemblGenomes-Gn; AT4G22635.
DR   EnsemblGenomes-Gn; AT4G22754.
DR   EnsemblGenomes-Gn; AT4G22890.
DR   EnsemblGenomes-Gn; AT4G23200.
DR   EnsemblGenomes-Gn; AT4G23205.
DR   EnsemblGenomes-Gn; AT4G23375.
DR   EnsemblGenomes-Gn; AT4G23387.
DR   EnsemblGenomes-Gn; AT4G23635.
DR   EnsemblGenomes-Gn; AT4G23713.
DR   EnsemblGenomes-Gn; AT4G23915.
DR   EnsemblGenomes-Gn; AT4G24025.
DR   EnsemblGenomes-Gn; AT4G24415.
DR   EnsemblGenomes-Gn; AT4G24565.
DR   EnsemblGenomes-Gn; AT4G24715.
DR   EnsemblGenomes-Gn; AT4G25400.
DR   EnsemblGenomes-Gn; AT4G25435.
DR   EnsemblGenomes-Gn; AT4G25585.
DR   EnsemblGenomes-Gn; AT4G25631.
DR   EnsemblGenomes-Gn; AT4G25635.
DR   EnsemblGenomes-Gn; AT4G25719.
DR   EnsemblGenomes-Gn; AT4G25885.
DR   EnsemblGenomes-Gn; AT4G26095.
DR   EnsemblGenomes-Gn; AT4G26225.
DR   EnsemblGenomes-Gn; AT4G26255.
DR   EnsemblGenomes-Gn; AT4G26365.
DR   EnsemblGenomes-Gn; AT4G26375.
DR   EnsemblGenomes-Gn; AT4G26385.
DR   EnsemblGenomes-Gn; AT4G26488.
DR   EnsemblGenomes-Gn; AT4G26542.
DR   EnsemblGenomes-Gn; AT4G26582.
DR   EnsemblGenomes-Gn; AT4G26675.
DR   EnsemblGenomes-Gn; AT4G26795.
DR   EnsemblGenomes-Gn; AT4G27395.
DR   EnsemblGenomes-Gn; AT4G27765.
DR   EnsemblGenomes-Gn; AT4G27852.
DR   EnsemblGenomes-Gn; AT4G27875.
DR   EnsemblGenomes-Gn; AT4G27885.
DR   EnsemblGenomes-Gn; AT4G28162.
DR   EnsemblGenomes-Gn; AT4G28362.
DR   EnsemblGenomes-Gn; AT4G28395.
DR   EnsemblGenomes-Gn; AT4G28652.
DR   EnsemblGenomes-Gn; AT4G28800.
DR   EnsemblGenomes-Gn; AT4G28915.
DR   EnsemblGenomes-Gn; AT4G29415.
DR   EnsemblGenomes-Gn; AT4G30872.
DR   EnsemblGenomes-Gn; AT4G30972.
DR   EnsemblGenomes-Gn; AT4G30975.
DR   EnsemblGenomes-Gn; AT4G31075.
DR   EnsemblGenomes-Gn; AT4G31248.
DR   EnsemblGenomes-Gn; AT4G31265.
DR   EnsemblGenomes-Gn; AT4G31398.
DR   EnsemblGenomes-Gn; AT4G31408.
DR   EnsemblGenomes-Gn; AT4G31690.
DR   EnsemblGenomes-Gn; AT4G31695.
DR   EnsemblGenomes-Gn; AT4G31877.
DR   EnsemblGenomes-Gn; AT4G31895.
DR   EnsemblGenomes-Gn; AT4G32265.
DR   EnsemblGenomes-Gn; AT4G32445.
DR   EnsemblGenomes-Gn; AT4G32475.
DR   EnsemblGenomes-Gn; AT4G32765.
DR   EnsemblGenomes-Gn; AT4G33735.
DR   EnsemblGenomes-Gn; AT4G34035.
DR   EnsemblGenomes-Gn; AT4G34071.
DR   EnsemblGenomes-Gn; AT4G34332.
DR   EnsemblGenomes-Gn; AT4G34415.
DR   EnsemblGenomes-Gn; AT4G34695.
DR   EnsemblGenomes-Gn; AT4G34975.
DR   EnsemblGenomes-Gn; AT4G35335.
DR   EnsemblGenomes-Gn; AT4G36032.
DR   EnsemblGenomes-Gn; AT4G36052.
DR   EnsemblGenomes-Gn; AT4G36197.
DR   EnsemblGenomes-Gn; AT4G36245.
DR   EnsemblGenomes-Gn; AT4G36270.
DR   EnsemblGenomes-Gn; AT4G36570.
DR   EnsemblGenomes-Gn; AT4G36635.
DR   EnsemblGenomes-Gn; AT4G36648.
DR   EnsemblGenomes-Gn; AT4G36780.
DR   EnsemblGenomes-Gn; AT4G36808.
DR   EnsemblGenomes-Gn; AT4G37175.
DR   EnsemblGenomes-Gn; AT4G37225.
DR   EnsemblGenomes-Gn; AT4G37432.
DR   EnsemblGenomes-Gn; AT4G37553.
DR   EnsemblGenomes-Gn; AT4G37630.
DR   EnsemblGenomes-Gn; AT4G37895.
DR   EnsemblGenomes-Gn; AT4G38215.
DR   EnsemblGenomes-Gn; AT4G38545.
DR   EnsemblGenomes-Gn; AT4G38552.
DR   EnsemblGenomes-Gn; AT4G38780.
DR   EnsemblGenomes-Gn; AT4G38932.
DR   EnsemblGenomes-Gn; AT4G39195.
DR   EnsemblGenomes-Gn; AT4G39345.
DR   EnsemblGenomes-Gn; AT4G39361.
DR   EnsemblGenomes-Gn; AT4G39363.
DR   EnsemblGenomes-Gn; AT4G39364.
DR   EnsemblGenomes-Gn; AT4G39366.
DR   EnsemblGenomes-Gn; AT4G39404.
DR   EnsemblGenomes-Gn; AT4G39615.
DR   EnsemblGenomes-Gn; AT4G39672.
DR   EnsemblGenomes-Gn; AT4G39838.
DR   EnsemblGenomes-Gn; AT4G39865.
DR   EnsemblGenomes-Gn; AT4G39985.
DR   EnsemblGenomes-Gn; AT4G40065.
DR   EnsemblGenomes-Gn; AT4G40085.
DR   EnsemblGenomes-Gn; AT4G40100.
DR   EnsemblGenomes-Gn; ENSRNA049492415.
DR   EnsemblGenomes-Gn; ENSRNA049492416.
DR   EnsemblGenomes-Gn; ENSRNA049492417.
DR   EnsemblGenomes-Gn; ENSRNA049492418.
DR   EnsemblGenomes-Gn; ENSRNA049492419.
DR   EnsemblGenomes-Gn; ENSRNA049492420.
DR   EnsemblGenomes-Gn; ENSRNA049492421.
DR   EnsemblGenomes-Gn; ENSRNA049492422.
DR   EnsemblGenomes-Gn; ENSRNA049492423.
DR   EnsemblGenomes-Gn; ENSRNA049492424.
DR   EnsemblGenomes-Gn; ENSRNA049492425.
DR   EnsemblGenomes-Gn; ENSRNA049492426.
DR   EnsemblGenomes-Gn; ENSRNA049492427.
DR   EnsemblGenomes-Gn; ENSRNA049492429.
DR   EnsemblGenomes-Gn; ENSRNA049492430.
DR   EnsemblGenomes-Gn; ENSRNA049492431.
DR   EnsemblGenomes-Gn; ENSRNA049492432.
DR   EnsemblGenomes-Gn; ENSRNA049492433.
DR   EnsemblGenomes-Gn; ENSRNA049492434.
DR   EnsemblGenomes-Gn; ENSRNA049492435.
DR   EnsemblGenomes-Gn; ENSRNA049492436.
DR   EnsemblGenomes-Gn; ENSRNA049492437.
DR   EnsemblGenomes-Gn; ENSRNA049492438.
DR   EnsemblGenomes-Gn; ENSRNA049492439.
DR   EnsemblGenomes-Gn; ENSRNA049492440.
DR   EnsemblGenomes-Gn; ENSRNA049492441.
DR   EnsemblGenomes-Gn; ENSRNA049492442.
DR   EnsemblGenomes-Gn; ENSRNA049492443.
DR   EnsemblGenomes-Gn; ENSRNA049492444.
DR   EnsemblGenomes-Gn; ENSRNA049492445.
DR   EnsemblGenomes-Gn; ENSRNA049492446.
DR   EnsemblGenomes-Gn; ENSRNA049492447.
DR   EnsemblGenomes-Gn; ENSRNA049492448.
DR   EnsemblGenomes-Gn; ENSRNA049492449.
DR   EnsemblGenomes-Gn; ENSRNA049492450.
DR   EnsemblGenomes-Gn; ENSRNA049492451.
DR   EnsemblGenomes-Gn; ENSRNA049493726.
DR   EnsemblGenomes-Gn; ENSRNA049493728.
DR   EnsemblGenomes-Gn; ENSRNA049493729.
DR   EnsemblGenomes-Gn; ENSRNA049493731.
DR   EnsemblGenomes-Gn; ENSRNA049493733.
DR   EnsemblGenomes-Gn; ENSRNA049493737.
DR   EnsemblGenomes-Gn; ENSRNA049493741.
DR   EnsemblGenomes-Gn; ENSRNA049493744.
DR   EnsemblGenomes-Gn; ENSRNA049493747.
DR   EnsemblGenomes-Gn; ENSRNA049493748.
DR   EnsemblGenomes-Gn; ENSRNA049493749.
DR   EnsemblGenomes-Gn; ENSRNA049493751.
DR   EnsemblGenomes-Gn; ENSRNA049493753.
DR   EnsemblGenomes-Gn; ENSRNA049493756.
DR   EnsemblGenomes-Gn; ENSRNA049493758.
DR   EnsemblGenomes-Gn; ENSRNA049493761.
DR   EnsemblGenomes-Gn; ENSRNA049493764.
DR   EnsemblGenomes-Gn; ENSRNA049493770.
DR   EnsemblGenomes-Gn; ENSRNA049493832.
DR   EnsemblGenomes-Gn; ENSRNA049493835.
DR   EnsemblGenomes-Gn; ENSRNA049493837.
DR   EnsemblGenomes-Gn; ENSRNA049493841.
DR   EnsemblGenomes-Gn; ENSRNA049493842.
DR   EnsemblGenomes-Gn; ENSRNA049493845.
DR   EnsemblGenomes-Gn; ENSRNA049493847.
DR   EnsemblGenomes-Gn; ENSRNA049493848.
DR   EnsemblGenomes-Gn; ENSRNA049493849.
DR   EnsemblGenomes-Gn; ENSRNA049493850.
DR   EnsemblGenomes-Gn; ENSRNA049493852.
DR   EnsemblGenomes-Gn; ENSRNA049493854.
DR   EnsemblGenomes-Gn; ENSRNA049493858.
DR   EnsemblGenomes-Gn; ENSRNA049493860.
DR   EnsemblGenomes-Gn; ENSRNA049493862.
DR   EnsemblGenomes-Gn; ENSRNA049493864.
DR   EnsemblGenomes-Gn; ENSRNA049493867.
DR   EnsemblGenomes-Gn; ENSRNA049493870.
DR   EnsemblGenomes-Gn; ENSRNA049493874.
DR   EnsemblGenomes-Gn; ENSRNA049493877.
DR   EnsemblGenomes-Gn; ENSRNA049493879.
DR   EnsemblGenomes-Gn; ENSRNA049493880.
DR   EnsemblGenomes-Gn; ENSRNA049493883.
DR   EnsemblGenomes-Gn; ENSRNA049493885.
DR   EnsemblGenomes-Gn; ENSRNA049493887.
DR   EnsemblGenomes-Gn; ENSRNA049493889.
DR   EnsemblGenomes-Gn; ENSRNA049493890.
DR   EnsemblGenomes-Gn; ENSRNA049493891.
DR   EnsemblGenomes-Gn; ENSRNA049493892.
DR   EnsemblGenomes-Gn; ENSRNA049493894.
DR   EnsemblGenomes-Gn; ENSRNA049493895.
DR   EnsemblGenomes-Gn; ENSRNA049493896.
DR   EnsemblGenomes-Gn; ENSRNA049493897.
DR   EnsemblGenomes-Gn; ENSRNA049493898.
DR   EnsemblGenomes-Gn; ENSRNA049493899.
DR   EnsemblGenomes-Gn; ENSRNA049493900.
DR   EnsemblGenomes-Gn; ENSRNA049493902.
DR   EnsemblGenomes-Gn; ENSRNA049493903.
DR   EnsemblGenomes-Gn; ENSRNA049493905.
DR   EnsemblGenomes-Gn; ENSRNA049493907.
DR   EnsemblGenomes-Gn; ENSRNA049493909.
DR   EnsemblGenomes-Gn; ENSRNA049493911.
DR   EnsemblGenomes-Gn; ENSRNA049493912.
DR   EnsemblGenomes-Gn; ENSRNA049493914.
DR   EnsemblGenomes-Tr; AT4G00085.1.
DR   EnsemblGenomes-Tr; AT4G00114.1.
DR   EnsemblGenomes-Tr; AT4G00225.1.
DR   EnsemblGenomes-Tr; AT4G00236.1.
DR   EnsemblGenomes-Tr; AT4G00356.1.
DR   EnsemblGenomes-Tr; AT4G00413.1.
DR   EnsemblGenomes-Tr; AT4G00753.1.
DR   EnsemblGenomes-Tr; AT4G00885.1.
DR   EnsemblGenomes-Tr; AT4G00891.1.
DR   EnsemblGenomes-Tr; AT4G00975.1.
DR   EnsemblGenomes-Tr; AT4G00985.1.
DR   EnsemblGenomes-Tr; AT4G01060.1.
DR   EnsemblGenomes-Tr; AT4G01265.1.
DR   EnsemblGenomes-Tr; AT4G01355.1.
DR   EnsemblGenomes-Tr; AT4G01430.2.
DR   EnsemblGenomes-Tr; AT4G01450.1.
DR   EnsemblGenomes-Tr; AT4G01450.3.
DR   EnsemblGenomes-Tr; AT4G01455.1.
DR   EnsemblGenomes-Tr; AT4G01490.1.
DR   EnsemblGenomes-Tr; AT4G01505.1.
DR   EnsemblGenomes-Tr; AT4G01515.1.
DR   EnsemblGenomes-Tr; AT4G01525.1.
DR   EnsemblGenomes-Tr; AT4G01530.1.
DR   EnsemblGenomes-Tr; AT4G01533.1.
DR   EnsemblGenomes-Tr; AT4G01550.2.
DR   EnsemblGenomes-Tr; AT4G01593.1.
DR   EnsemblGenomes-Tr; AT4G01593.2.
DR   EnsemblGenomes-Tr; AT4G01600.2.
DR   EnsemblGenomes-Tr; AT4G01690.2.
DR   EnsemblGenomes-Tr; AT4G01865.1.
DR   EnsemblGenomes-Tr; AT4G01975.1.
DR   EnsemblGenomes-Tr; AT4G01980.1.
DR   EnsemblGenomes-Tr; AT4G02005.1.
DR   EnsemblGenomes-Tr; AT4G02005.2.
DR   EnsemblGenomes-Tr; AT4G02055.1.
DR   EnsemblGenomes-Tr; AT4G02200.2.
DR   EnsemblGenomes-Tr; AT4G02312.1.
DR   EnsemblGenomes-Tr; AT4G02314.1.
DR   EnsemblGenomes-Tr; AT4G02317.1.
DR   EnsemblGenomes-Tr; AT4G02487.1.
DR   EnsemblGenomes-Tr; AT4G02490.1.
DR   EnsemblGenomes-Tr; AT4G02555.1.
DR   EnsemblGenomes-Tr; AT4G02590.3.
DR   EnsemblGenomes-Tr; AT4G02640.2.
DR   EnsemblGenomes-Tr; AT4G02960.1.
DR   EnsemblGenomes-Tr; AT4G03038.1.
DR   EnsemblGenomes-Tr; AT4G03039.1.
DR   EnsemblGenomes-Tr; AT4G03060.1.
DR   EnsemblGenomes-Tr; AT4G03063.1.
DR   EnsemblGenomes-Tr; AT4G03135.1.
DR   EnsemblGenomes-Tr; AT4G03230.1.
DR   EnsemblGenomes-Tr; AT4G03280.2.
DR   EnsemblGenomes-Tr; AT4G03285.1.
DR   EnsemblGenomes-Tr; AT4G03295.1.
DR   EnsemblGenomes-Tr; AT4G03300.1.
DR   EnsemblGenomes-Tr; AT4G03305.1.
DR   EnsemblGenomes-Tr; AT4G03310.1.
DR   EnsemblGenomes-Tr; AT4G03364.1.
DR   EnsemblGenomes-Tr; AT4G03376.1.
DR   EnsemblGenomes-Tr; AT4G03405.1.
DR   EnsemblGenomes-Tr; AT4G03435.1.
DR   EnsemblGenomes-Tr; AT4G03437.1.
DR   EnsemblGenomes-Tr; AT4G03438.1.
DR   EnsemblGenomes-Tr; AT4G03445.1.
DR   EnsemblGenomes-Tr; AT4G03455.1.
DR   EnsemblGenomes-Tr; AT4G03530.1.
DR   EnsemblGenomes-Tr; AT4G03640.1.
DR   EnsemblGenomes-Tr; AT4G03650.1.
DR   EnsemblGenomes-Tr; AT4G03660.1.
DR   EnsemblGenomes-Tr; AT4G03670.1.
DR   EnsemblGenomes-Tr; AT4G03680.1.
DR   EnsemblGenomes-Tr; AT4G03690.1.
DR   EnsemblGenomes-Tr; AT4G03695.1.
DR   EnsemblGenomes-Tr; AT4G03700.1.
DR   EnsemblGenomes-Tr; AT4G03710.1.
DR   EnsemblGenomes-Tr; AT4G03720.1.
DR   EnsemblGenomes-Tr; AT4G03726.1.
DR   EnsemblGenomes-Tr; AT4G03730.1.
DR   EnsemblGenomes-Tr; AT4G03732.1.
DR   EnsemblGenomes-Tr; AT4G03745.1.
DR   EnsemblGenomes-Tr; AT4G03750.1.
DR   EnsemblGenomes-Tr; AT4G03760.1.
DR   EnsemblGenomes-Tr; AT4G03770.2.
DR   EnsemblGenomes-Tr; AT4G03775.1.
DR   EnsemblGenomes-Tr; AT4G03780.1.
DR   EnsemblGenomes-Tr; AT4G03790.1.
DR   EnsemblGenomes-Tr; AT4G03795.1.
DR   EnsemblGenomes-Tr; AT4G03800.1.
DR   EnsemblGenomes-Tr; AT4G03810.1.
DR   EnsemblGenomes-Tr; AT4G03811.1.
DR   EnsemblGenomes-Tr; AT4G03813.1.
DR   EnsemblGenomes-Tr; AT4G03816.1.
DR   EnsemblGenomes-Tr; AT4G03823.1.
DR   EnsemblGenomes-Tr; AT4G03824.1.
DR   EnsemblGenomes-Tr; AT4G03825.1.
DR   EnsemblGenomes-Tr; AT4G03826.1.
DR   EnsemblGenomes-Tr; AT4G03835.1.
DR   EnsemblGenomes-Tr; AT4G03837.1.
DR   EnsemblGenomes-Tr; AT4G03840.1.
DR   EnsemblGenomes-Tr; AT4G03850.1.
DR   EnsemblGenomes-Tr; AT4G03860.1.
DR   EnsemblGenomes-Tr; AT4G03865.1.
DR   EnsemblGenomes-Tr; AT4G03870.1.
DR   EnsemblGenomes-Tr; AT4G03873.1.
DR   EnsemblGenomes-Tr; AT4G03876.1.
DR   EnsemblGenomes-Tr; AT4G03880.1.
DR   EnsemblGenomes-Tr; AT4G03885.1.
DR   EnsemblGenomes-Tr; AT4G03890.1.
DR   EnsemblGenomes-Tr; AT4G03900.1.
DR   EnsemblGenomes-Tr; AT4G03910.1.
DR   EnsemblGenomes-Tr; AT4G03911.1.
DR   EnsemblGenomes-Tr; AT4G03912.1.
DR   EnsemblGenomes-Tr; AT4G03913.1.
DR   EnsemblGenomes-Tr; AT4G03914.1.
DR   EnsemblGenomes-Tr; AT4G03916.1.
DR   EnsemblGenomes-Tr; AT4G03920.1.
DR   EnsemblGenomes-Tr; AT4G03923.1.
DR   EnsemblGenomes-Tr; AT4G03926.1.
DR   EnsemblGenomes-Tr; AT4G03935.1.
DR   EnsemblGenomes-Tr; AT4G03970.1.
DR   EnsemblGenomes-Tr; AT4G03975.1.
DR   EnsemblGenomes-Tr; AT4G03976.1.
DR   EnsemblGenomes-Tr; AT4G03977.1.
DR   EnsemblGenomes-Tr; AT4G03978.1.
DR   EnsemblGenomes-Tr; AT4G03979.1.
DR   EnsemblGenomes-Tr; AT4G03980.1.
DR   EnsemblGenomes-Tr; AT4G03981.1.
DR   EnsemblGenomes-Tr; AT4G03990.1.
DR   EnsemblGenomes-Tr; AT4G04000.1.
DR   EnsemblGenomes-Tr; AT4G04010.1.
DR   EnsemblGenomes-Tr; AT4G04050.1.
DR   EnsemblGenomes-Tr; AT4G04070.1.
DR   EnsemblGenomes-Tr; AT4G04077.1.
DR   EnsemblGenomes-Tr; AT4G04100.1.
DR   EnsemblGenomes-Tr; AT4G04105.1.
DR   EnsemblGenomes-Tr; AT4G04120.1.
DR   EnsemblGenomes-Tr; AT4G04130.1.
DR   EnsemblGenomes-Tr; AT4G04140.1.
DR   EnsemblGenomes-Tr; AT4G04145.1.
DR   EnsemblGenomes-Tr; AT4G04150.1.
DR   EnsemblGenomes-Tr; AT4G04155.1.
DR   EnsemblGenomes-Tr; AT4G04157.1.
DR   EnsemblGenomes-Tr; AT4G04165.1.
DR   EnsemblGenomes-Tr; AT4G04167.1.
DR   EnsemblGenomes-Tr; AT4G04170.1.
DR   EnsemblGenomes-Tr; AT4G04175.1.
DR   EnsemblGenomes-Tr; AT4G04221.1.
DR   EnsemblGenomes-Tr; AT4G04223.1.
DR   EnsemblGenomes-Tr; AT4G04223.2.
DR   EnsemblGenomes-Tr; AT4G04230.1.
DR   EnsemblGenomes-Tr; AT4G04245.1.
DR   EnsemblGenomes-Tr; AT4G04250.1.
DR   EnsemblGenomes-Tr; AT4G04255.1.
DR   EnsemblGenomes-Tr; AT4G04270.1.
DR   EnsemblGenomes-Tr; AT4G04273.1.
DR   EnsemblGenomes-Tr; AT4G04276.1.
DR   EnsemblGenomes-Tr; AT4G04280.1.
DR   EnsemblGenomes-Tr; AT4G04290.1.
DR   EnsemblGenomes-Tr; AT4G04293.1.
DR   EnsemblGenomes-Tr; AT4G04296.1.
DR   EnsemblGenomes-Tr; AT4G04300.1.
DR   EnsemblGenomes-Tr; AT4G04310.1.
DR   EnsemblGenomes-Tr; AT4G04313.1.
DR   EnsemblGenomes-Tr; AT4G04315.1.
DR   EnsemblGenomes-Tr; AT4G04316.1.
DR   EnsemblGenomes-Tr; AT4G04375.1.
DR   EnsemblGenomes-Tr; AT4G04380.1.
DR   EnsemblGenomes-Tr; AT4G04390.1.
DR   EnsemblGenomes-Tr; AT4G04392.1.
DR   EnsemblGenomes-Tr; AT4G04393.1.
DR   EnsemblGenomes-Tr; AT4G04394.1.
DR   EnsemblGenomes-Tr; AT4G04395.1.
DR   EnsemblGenomes-Tr; AT4G04396.1.
DR   EnsemblGenomes-Tr; AT4G04398.1.
DR   EnsemblGenomes-Tr; AT4G04400.1.
DR   EnsemblGenomes-Tr; AT4G04405.1.
DR   EnsemblGenomes-Tr; AT4G04407.1.
DR   EnsemblGenomes-Tr; AT4G04408.1.
DR   EnsemblGenomes-Tr; AT4G04409.1.
DR   EnsemblGenomes-Tr; AT4G04410.1.
DR   EnsemblGenomes-Tr; AT4G04420.1.
DR   EnsemblGenomes-Tr; AT4G04426.1.
DR   EnsemblGenomes-Tr; AT4G04430.1.
DR   EnsemblGenomes-Tr; AT4G04440.1.
DR   EnsemblGenomes-Tr; AT4G04495.1.
DR   EnsemblGenomes-Tr; AT4G04520.1.
DR   EnsemblGenomes-Tr; AT4G04525.1.
DR   EnsemblGenomes-Tr; AT4G04530.1.
DR   EnsemblGenomes-Tr; AT4G04545.1.
DR   EnsemblGenomes-Tr; AT4G04547.1.
DR   EnsemblGenomes-Tr; AT4G04550.1.
DR   EnsemblGenomes-Tr; AT4G04560.1.
DR   EnsemblGenomes-Tr; AT4G04590.1.
DR   EnsemblGenomes-Tr; AT4G04600.1.
DR   EnsemblGenomes-Tr; AT4G04635.1.
DR   EnsemblGenomes-Tr; AT4G04653.1.
DR   EnsemblGenomes-Tr; AT4G04655.1.
DR   EnsemblGenomes-Tr; AT4G04660.1.
DR   EnsemblGenomes-Tr; AT4G04692.1.
DR   EnsemblGenomes-Tr; AT4G04692.2.
DR   EnsemblGenomes-Tr; AT4G04693.1.
DR   EnsemblGenomes-Tr; AT4G04760.1.
DR   EnsemblGenomes-Tr; AT4G04820.1.
DR   EnsemblGenomes-Tr; AT4G04920.2.
DR   EnsemblGenomes-Tr; AT4G05048.1.
DR   EnsemblGenomes-Tr; AT4G05049.1.
DR   EnsemblGenomes-Tr; AT4G05053.1.
DR   EnsemblGenomes-Tr; AT4G05073.1.
DR   EnsemblGenomes-Tr; AT4G05076.1.
DR   EnsemblGenomes-Tr; AT4G05087.1.
DR   EnsemblGenomes-Tr; AT4G05105.1.
DR   EnsemblGenomes-Tr; AT4G05133.1.
DR   EnsemblGenomes-Tr; AT4G05145.1.
DR   EnsemblGenomes-Tr; AT4G05280.1.
DR   EnsemblGenomes-Tr; AT4G05290.1.
DR   EnsemblGenomes-Tr; AT4G05300.1.
DR   EnsemblGenomes-Tr; AT4G05303.1.
DR   EnsemblGenomes-Tr; AT4G05306.1.
DR   EnsemblGenomes-Tr; AT4G05495.1.
DR   EnsemblGenomes-Tr; AT4G05500.1.
DR   EnsemblGenomes-Tr; AT4G05502.1.
DR   EnsemblGenomes-Tr; AT4G05505.1.
DR   EnsemblGenomes-Tr; AT4G05508.1.
DR   EnsemblGenomes-Tr; AT4G05510.1.
DR   EnsemblGenomes-Tr; AT4G05526.1.
DR   EnsemblGenomes-Tr; AT4G05550.1.
DR   EnsemblGenomes-Tr; AT4G05556.1.
DR   EnsemblGenomes-Tr; AT4G05560.1.
DR   EnsemblGenomes-Tr; AT4G05570.1.
DR   EnsemblGenomes-Tr; AT4G05575.1.
DR   EnsemblGenomes-Tr; AT4G05580.1.
DR   EnsemblGenomes-Tr; AT4G05581.1.
DR   EnsemblGenomes-Tr; AT4G05582.1.
DR   EnsemblGenomes-Tr; AT4G05583.2.
DR   EnsemblGenomes-Tr; AT4G05584.1.
DR   EnsemblGenomes-Tr; AT4G05585.1.
DR   EnsemblGenomes-Tr; AT4G05586.1.
DR   EnsemblGenomes-Tr; AT4G05587.1.
DR   EnsemblGenomes-Tr; AT4G05588.1.
DR   EnsemblGenomes-Tr; AT4G05589.1.
DR   EnsemblGenomes-Tr; AT4G05591.1.
DR   EnsemblGenomes-Tr; AT4G05592.1.
DR   EnsemblGenomes-Tr; AT4G05593.1.
DR   EnsemblGenomes-Tr; AT4G05594.1.
DR   EnsemblGenomes-Tr; AT4G05595.1.
DR   EnsemblGenomes-Tr; AT4G05597.1.
DR   EnsemblGenomes-Tr; AT4G05600.1.
DR   EnsemblGenomes-Tr; AT4G05610.1.
DR   EnsemblGenomes-Tr; AT4G05613.1.
DR   EnsemblGenomes-Tr; AT4G05616.1.
DR   EnsemblGenomes-Tr; AT4G05633.1.
DR   EnsemblGenomes-Tr; AT4G05634.1.
DR   EnsemblGenomes-Tr; AT4G05635.1.
DR   EnsemblGenomes-Tr; AT4G05636.1.
DR   EnsemblGenomes-Tr; AT4G05638.1.
DR   EnsemblGenomes-Tr; AT4G05640.1.
DR   EnsemblGenomes-Tr; AT4G05918.1.
DR   EnsemblGenomes-Tr; AT4G06196.1.
DR   EnsemblGenomes-Tr; AT4G06474.1.
DR   EnsemblGenomes-Tr; AT4G06477.1.
DR   EnsemblGenomes-Tr; AT4G06480.2.
DR   EnsemblGenomes-Tr; AT4G06481.1.
DR   EnsemblGenomes-Tr; AT4G06482.1.
DR   EnsemblGenomes-Tr; AT4G06483.1.
DR   EnsemblGenomes-Tr; AT4G06484.1.
DR   EnsemblGenomes-Tr; AT4G06485.1.
DR   EnsemblGenomes-Tr; AT4G06486.1.
DR   EnsemblGenomes-Tr; AT4G06487.1.
DR   EnsemblGenomes-Tr; AT4G06488.1.
DR   EnsemblGenomes-Tr; AT4G06489.1.
DR   EnsemblGenomes-Tr; AT4G06491.1.
DR   EnsemblGenomes-Tr; AT4G06492.1.
DR   EnsemblGenomes-Tr; AT4G06493.1.
DR   EnsemblGenomes-Tr; AT4G06494.1.
DR   EnsemblGenomes-Tr; AT4G06495.1.
DR   EnsemblGenomes-Tr; AT4G06496.1.
DR   EnsemblGenomes-Tr; AT4G06497.1.
DR   EnsemblGenomes-Tr; AT4G06498.1.
DR   EnsemblGenomes-Tr; AT4G06499.1.
DR   EnsemblGenomes-Tr; AT4G06500.1.
DR   EnsemblGenomes-Tr; AT4G06501.1.
DR   EnsemblGenomes-Tr; AT4G06502.1.
DR   EnsemblGenomes-Tr; AT4G06503.1.
DR   EnsemblGenomes-Tr; AT4G06504.1.
DR   EnsemblGenomes-Tr; AT4G06505.1.
DR   EnsemblGenomes-Tr; AT4G06506.1.
DR   EnsemblGenomes-Tr; AT4G06507.1.
DR   EnsemblGenomes-Tr; AT4G06508.1.
DR   EnsemblGenomes-Tr; AT4G06509.1.
DR   EnsemblGenomes-Tr; AT4G06510.1.
DR   EnsemblGenomes-Tr; AT4G06511.1.
DR   EnsemblGenomes-Tr; AT4G06512.1.
DR   EnsemblGenomes-Tr; AT4G06513.1.
DR   EnsemblGenomes-Tr; AT4G06514.1.
DR   EnsemblGenomes-Tr; AT4G06515.1.
DR   EnsemblGenomes-Tr; AT4G06516.1.
DR   EnsemblGenomes-Tr; AT4G06517.1.
DR   EnsemblGenomes-Tr; AT4G06518.1.
DR   EnsemblGenomes-Tr; AT4G06519.1.
DR   EnsemblGenomes-Tr; AT4G06520.1.
DR   EnsemblGenomes-Tr; AT4G06521.1.
DR   EnsemblGenomes-Tr; AT4G06522.1.
DR   EnsemblGenomes-Tr; AT4G06523.1.
DR   EnsemblGenomes-Tr; AT4G06524.1.
DR   EnsemblGenomes-Tr; AT4G06525.1.
DR   EnsemblGenomes-Tr; AT4G06527.1.
DR   EnsemblGenomes-Tr; AT4G06528.1.
DR   EnsemblGenomes-Tr; AT4G06529.1.
DR   EnsemblGenomes-Tr; AT4G06530.1.
DR   EnsemblGenomes-Tr; AT4G06531.1.
DR   EnsemblGenomes-Tr; AT4G06532.1.
DR   EnsemblGenomes-Tr; AT4G06533.1.
DR   EnsemblGenomes-Tr; AT4G06535.1.
DR   EnsemblGenomes-Tr; AT4G06537.1.
DR   EnsemblGenomes-Tr; AT4G06538.1.
DR   EnsemblGenomes-Tr; AT4G06539.1.
DR   EnsemblGenomes-Tr; AT4G06540.1.
DR   EnsemblGenomes-Tr; AT4G06541.1.
DR   EnsemblGenomes-Tr; AT4G06542.1.
DR   EnsemblGenomes-Tr; AT4G06543.1.
DR   EnsemblGenomes-Tr; AT4G06544.1.
DR   EnsemblGenomes-Tr; AT4G06545.1.
DR   EnsemblGenomes-Tr; AT4G06546.1.
DR   EnsemblGenomes-Tr; AT4G06547.1.
DR   EnsemblGenomes-Tr; AT4G06548.1.
DR   EnsemblGenomes-Tr; AT4G06549.1.
DR   EnsemblGenomes-Tr; AT4G06550.1.
DR   EnsemblGenomes-Tr; AT4G06551.1.
DR   EnsemblGenomes-Tr; AT4G06552.1.
DR   EnsemblGenomes-Tr; AT4G06553.1.
DR   EnsemblGenomes-Tr; AT4G06554.1.
DR   EnsemblGenomes-Tr; AT4G06555.1.
DR   EnsemblGenomes-Tr; AT4G06556.1.
DR   EnsemblGenomes-Tr; AT4G06557.1.
DR   EnsemblGenomes-Tr; AT4G06558.1.
DR   EnsemblGenomes-Tr; AT4G06559.1.
DR   EnsemblGenomes-Tr; AT4G06560.1.
DR   EnsemblGenomes-Tr; AT4G06561.1.
DR   EnsemblGenomes-Tr; AT4G06562.1.
DR   EnsemblGenomes-Tr; AT4G06563.1.
DR   EnsemblGenomes-Tr; AT4G06564.1.
DR   EnsemblGenomes-Tr; AT4G06565.1.
DR   EnsemblGenomes-Tr; AT4G06566.1.
DR   EnsemblGenomes-Tr; AT4G06567.1.
DR   EnsemblGenomes-Tr; AT4G06568.1.
DR   EnsemblGenomes-Tr; AT4G06569.1.
DR   EnsemblGenomes-Tr; AT4G06570.1.
DR   EnsemblGenomes-Tr; AT4G06571.1.
DR   EnsemblGenomes-Tr; AT4G06572.1.
DR   EnsemblGenomes-Tr; AT4G06573.1.
DR   EnsemblGenomes-Tr; AT4G06574.1.
DR   EnsemblGenomes-Tr; AT4G06575.1.
DR   EnsemblGenomes-Tr; AT4G06576.1.
DR   EnsemblGenomes-Tr; AT4G06577.1.
DR   EnsemblGenomes-Tr; AT4G06578.1.
DR   EnsemblGenomes-Tr; AT4G06579.1.
DR   EnsemblGenomes-Tr; AT4G06580.1.
DR   EnsemblGenomes-Tr; AT4G06581.1.
DR   EnsemblGenomes-Tr; AT4G06582.1.
DR   EnsemblGenomes-Tr; AT4G06584.1.
DR   EnsemblGenomes-Tr; AT4G06585.1.
DR   EnsemblGenomes-Tr; AT4G06586.1.
DR   EnsemblGenomes-Tr; AT4G06587.1.
DR   EnsemblGenomes-Tr; AT4G06588.1.
DR   EnsemblGenomes-Tr; AT4G06589.1.
DR   EnsemblGenomes-Tr; AT4G06590.1.
DR   EnsemblGenomes-Tr; AT4G06591.1.
DR   EnsemblGenomes-Tr; AT4G06592.1.
DR   EnsemblGenomes-Tr; AT4G06593.1.
DR   EnsemblGenomes-Tr; AT4G06594.1.
DR   EnsemblGenomes-Tr; AT4G06595.1.
DR   EnsemblGenomes-Tr; AT4G06596.1.
DR   EnsemblGenomes-Tr; AT4G06597.1.
DR   EnsemblGenomes-Tr; AT4G06600.1.
DR   EnsemblGenomes-Tr; AT4G06601.1.
DR   EnsemblGenomes-Tr; AT4G06602.1.
DR   EnsemblGenomes-Tr; AT4G06603.1.
DR   EnsemblGenomes-Tr; AT4G06604.1.
DR   EnsemblGenomes-Tr; AT4G06605.1.
DR   EnsemblGenomes-Tr; AT4G06606.1.
DR   EnsemblGenomes-Tr; AT4G06607.1.
DR   EnsemblGenomes-Tr; AT4G06608.1.
DR   EnsemblGenomes-Tr; AT4G06609.1.
DR   EnsemblGenomes-Tr; AT4G06610.1.
DR   EnsemblGenomes-Tr; AT4G06611.1.
DR   EnsemblGenomes-Tr; AT4G06612.1.
DR   EnsemblGenomes-Tr; AT4G06613.1.
DR   EnsemblGenomes-Tr; AT4G06614.1.
DR   EnsemblGenomes-Tr; AT4G06615.1.
DR   EnsemblGenomes-Tr; AT4G06616.1.
DR   EnsemblGenomes-Tr; AT4G06617.1.
DR   EnsemblGenomes-Tr; AT4G06618.1.
DR   EnsemblGenomes-Tr; AT4G06619.1.
DR   EnsemblGenomes-Tr; AT4G06620.1.
DR   EnsemblGenomes-Tr; AT4G06621.1.
DR   EnsemblGenomes-Tr; AT4G06622.1.
DR   EnsemblGenomes-Tr; AT4G06623.1.
DR   EnsemblGenomes-Tr; AT4G06624.1.
DR   EnsemblGenomes-Tr; AT4G06625.1.
DR   EnsemblGenomes-Tr; AT4G06626.1.
DR   EnsemblGenomes-Tr; AT4G06627.1.
DR   EnsemblGenomes-Tr; AT4G06628.1.
DR   EnsemblGenomes-Tr; AT4G06629.1.
DR   EnsemblGenomes-Tr; AT4G06630.1.
DR   EnsemblGenomes-Tr; AT4G06631.1.
DR   EnsemblGenomes-Tr; AT4G06632.1.
DR   EnsemblGenomes-Tr; AT4G06633.1.
DR   EnsemblGenomes-Tr; AT4G06634.2.
DR   EnsemblGenomes-Tr; AT4G06635.1.
DR   EnsemblGenomes-Tr; AT4G06636.1.
DR   EnsemblGenomes-Tr; AT4G06637.1.
DR   EnsemblGenomes-Tr; AT4G06638.1.
DR   EnsemblGenomes-Tr; AT4G06640.1.
DR   EnsemblGenomes-Tr; AT4G06641.1.
DR   EnsemblGenomes-Tr; AT4G06642.1.
DR   EnsemblGenomes-Tr; AT4G06644.1.
DR   EnsemblGenomes-Tr; AT4G06646.1.
DR   EnsemblGenomes-Tr; AT4G06648.1.
DR   EnsemblGenomes-Tr; AT4G06650.1.
DR   EnsemblGenomes-Tr; AT4G06652.1.
DR   EnsemblGenomes-Tr; AT4G06654.1.
DR   EnsemblGenomes-Tr; AT4G06656.1.
DR   EnsemblGenomes-Tr; AT4G06658.1.
DR   EnsemblGenomes-Tr; AT4G06660.1.
DR   EnsemblGenomes-Tr; AT4G06664.1.
DR   EnsemblGenomes-Tr; AT4G06666.1.
DR   EnsemblGenomes-Tr; AT4G06668.1.
DR   EnsemblGenomes-Tr; AT4G06670.1.
DR   EnsemblGenomes-Tr; AT4G06672.1.
DR   EnsemblGenomes-Tr; AT4G06674.1.
DR   EnsemblGenomes-Tr; AT4G06678.1.
DR   EnsemblGenomes-Tr; AT4G06680.1.
DR   EnsemblGenomes-Tr; AT4G06682.1.
DR   EnsemblGenomes-Tr; AT4G06684.1.
DR   EnsemblGenomes-Tr; AT4G06686.1.
DR   EnsemblGenomes-Tr; AT4G06692.1.
DR   EnsemblGenomes-Tr; AT4G06694.1.
DR   EnsemblGenomes-Tr; AT4G06696.1.
DR   EnsemblGenomes-Tr; AT4G06697.1.
DR   EnsemblGenomes-Tr; AT4G06698.1.
DR   EnsemblGenomes-Tr; AT4G06699.1.
DR   EnsemblGenomes-Tr; AT4G06700.1.
DR   EnsemblGenomes-Tr; AT4G06701.1.
DR   EnsemblGenomes-Tr; AT4G06701.2.
DR   EnsemblGenomes-Tr; AT4G06701.3.
DR   EnsemblGenomes-Tr; AT4G06701.4.
DR   EnsemblGenomes-Tr; AT4G06701.5.
DR   EnsemblGenomes-Tr; AT4G06702.1.
DR   EnsemblGenomes-Tr; AT4G06704.1.
DR   EnsemblGenomes-Tr; AT4G06708.1.
DR   EnsemblGenomes-Tr; AT4G06710.1.
DR   EnsemblGenomes-Tr; AT4G06712.1.
DR   EnsemblGenomes-Tr; AT4G06714.1.
DR   EnsemblGenomes-Tr; AT4G06716.1.
DR   EnsemblGenomes-Tr; AT4G06718.1.
DR   EnsemblGenomes-Tr; AT4G06720.1.
DR   EnsemblGenomes-Tr; AT4G06722.1.
DR   EnsemblGenomes-Tr; AT4G06724.1.
DR   EnsemblGenomes-Tr; AT4G06726.1.
DR   EnsemblGenomes-Tr; AT4G06728.1.
DR   EnsemblGenomes-Tr; AT4G06730.1.
DR   EnsemblGenomes-Tr; AT4G06732.1.
DR   EnsemblGenomes-Tr; AT4G06734.1.
DR   EnsemblGenomes-Tr; AT4G06735.1.
DR   EnsemblGenomes-Tr; AT4G06736.1.
DR   EnsemblGenomes-Tr; AT4G06738.1.
DR   EnsemblGenomes-Tr; AT4G06742.1.
DR   EnsemblGenomes-Tr; AT4G06748.1.
DR   EnsemblGenomes-Tr; AT4G06750.1.
DR   EnsemblGenomes-Tr; AT4G06752.1.
DR   EnsemblGenomes-Tr; AT4G07031.1.
DR   EnsemblGenomes-Tr; AT4G07310.1.
DR   EnsemblGenomes-Tr; AT4G07315.1.
DR   EnsemblGenomes-Tr; AT4G07320.1.
DR   EnsemblGenomes-Tr; AT4G07324.1.
DR   EnsemblGenomes-Tr; AT4G07327.1.
DR   EnsemblGenomes-Tr; AT4G07330.1.
DR   EnsemblGenomes-Tr; AT4G07331.1.
DR   EnsemblGenomes-Tr; AT4G07332.1.
DR   EnsemblGenomes-Tr; AT4G07334.1.
DR   EnsemblGenomes-Tr; AT4G07336.1.
DR   EnsemblGenomes-Tr; AT4G07338.1.
DR   EnsemblGenomes-Tr; AT4G07339.1.
DR   EnsemblGenomes-Tr; AT4G07340.1.
DR   EnsemblGenomes-Tr; AT4G07355.1.
DR   EnsemblGenomes-Tr; AT4G07360.1.
DR   EnsemblGenomes-Tr; AT4G07370.1.
DR   EnsemblGenomes-Tr; AT4G07415.1.
DR   EnsemblGenomes-Tr; AT4G07420.1.
DR   EnsemblGenomes-Tr; AT4G07425.1.
DR   EnsemblGenomes-Tr; AT4G07430.1.
DR   EnsemblGenomes-Tr; AT4G07435.1.
DR   EnsemblGenomes-Tr; AT4G07440.1.
DR   EnsemblGenomes-Tr; AT4G07450.1.
DR   EnsemblGenomes-Tr; AT4G07452.1.
DR   EnsemblGenomes-Tr; AT4G07454.1.
DR   EnsemblGenomes-Tr; AT4G07456.1.
DR   EnsemblGenomes-Tr; AT4G07458.1.
DR   EnsemblGenomes-Tr; AT4G07460.1.
DR   EnsemblGenomes-Tr; AT4G07470.1.
DR   EnsemblGenomes-Tr; AT4G07475.1.
DR   EnsemblGenomes-Tr; AT4G07480.1.
DR   EnsemblGenomes-Tr; AT4G07485.1.
DR   EnsemblGenomes-Tr; AT4G07490.1.
DR   EnsemblGenomes-Tr; AT4G07491.1.
DR   EnsemblGenomes-Tr; AT4G07492.1.
DR   EnsemblGenomes-Tr; AT4G07493.1.
DR   EnsemblGenomes-Tr; AT4G07494.1.
DR   EnsemblGenomes-Tr; AT4G07495.1.
DR   EnsemblGenomes-Tr; AT4G07496.1.
DR   EnsemblGenomes-Tr; AT4G07498.1.
DR   EnsemblGenomes-Tr; AT4G07500.1.
DR   EnsemblGenomes-Tr; AT4G07502.1.
DR   EnsemblGenomes-Tr; AT4G07504.1.
DR   EnsemblGenomes-Tr; AT4G07507.1.
DR   EnsemblGenomes-Tr; AT4G07510.1.
DR   EnsemblGenomes-Tr; AT4G07516.1.
DR   EnsemblGenomes-Tr; AT4G07517.1.
DR   EnsemblGenomes-Tr; AT4G07518.1.
DR   EnsemblGenomes-Tr; AT4G07519.1.
DR   EnsemblGenomes-Tr; AT4G07520.1.
DR   EnsemblGenomes-Tr; AT4G07521.1.
DR   EnsemblGenomes-Tr; AT4G07522.1.
DR   EnsemblGenomes-Tr; AT4G07523.1.
DR   EnsemblGenomes-Tr; AT4G07525.1.
DR   EnsemblGenomes-Tr; AT4G07528.1.
DR   EnsemblGenomes-Tr; AT4G07530.1.
DR   EnsemblGenomes-Tr; AT4G07540.1.
DR   EnsemblGenomes-Tr; AT4G07550.1.
DR   EnsemblGenomes-Tr; AT4G07560.1.
DR   EnsemblGenomes-Tr; AT4G07563.1.
DR   EnsemblGenomes-Tr; AT4G07566.1.
DR   EnsemblGenomes-Tr; AT4G07570.1.
DR   EnsemblGenomes-Tr; AT4G07580.1.
DR   EnsemblGenomes-Tr; AT4G07583.1.
DR   EnsemblGenomes-Tr; AT4G07586.1.
DR   EnsemblGenomes-Tr; AT4G07590.1.
DR   EnsemblGenomes-Tr; AT4G07595.1.
DR   EnsemblGenomes-Tr; AT4G07600.1.
DR   EnsemblGenomes-Tr; AT4G07605.1.
DR   EnsemblGenomes-Tr; AT4G07620.1.
DR   EnsemblGenomes-Tr; AT4G07630.1.
DR   EnsemblGenomes-Tr; AT4G07640.1.
DR   EnsemblGenomes-Tr; AT4G07650.1.
DR   EnsemblGenomes-Tr; AT4G07660.1.
DR   EnsemblGenomes-Tr; AT4G07662.1.
DR   EnsemblGenomes-Tr; AT4G07664.1.
DR   EnsemblGenomes-Tr; AT4G07668.1.
DR   EnsemblGenomes-Tr; AT4G07680.1.
DR   EnsemblGenomes-Tr; AT4G07685.1.
DR   EnsemblGenomes-Tr; AT4G07686.1.
DR   EnsemblGenomes-Tr; AT4G07688.1.
DR   EnsemblGenomes-Tr; AT4G07690.1.
DR   EnsemblGenomes-Tr; AT4G07693.1.
DR   EnsemblGenomes-Tr; AT4G07696.1.
DR   EnsemblGenomes-Tr; AT4G07699.1.
DR   EnsemblGenomes-Tr; AT4G07700.1.
DR   EnsemblGenomes-Tr; AT4G07703.1.
DR   EnsemblGenomes-Tr; AT4G07706.1.
DR   EnsemblGenomes-Tr; AT4G07713.1.
DR   EnsemblGenomes-Tr; AT4G07720.1.
DR   EnsemblGenomes-Tr; AT4G07725.1.
DR   EnsemblGenomes-Tr; AT4G07730.1.
DR   EnsemblGenomes-Tr; AT4G07733.1.
DR   EnsemblGenomes-Tr; AT4G07736.1.
DR   EnsemblGenomes-Tr; AT4G07738.1.
DR   EnsemblGenomes-Tr; AT4G07742.1.
DR   EnsemblGenomes-Tr; AT4G07744.1.
DR   EnsemblGenomes-Tr; AT4G07747.1.
DR   EnsemblGenomes-Tr; AT4G07750.1.
DR   EnsemblGenomes-Tr; AT4G07755.1.
DR   EnsemblGenomes-Tr; AT4G07760.1.
DR   EnsemblGenomes-Tr; AT4G07770.1.
DR   EnsemblGenomes-Tr; AT4G07780.1.
DR   EnsemblGenomes-Tr; AT4G07790.1.
DR   EnsemblGenomes-Tr; AT4G07795.1.
DR   EnsemblGenomes-Tr; AT4G07800.1.
DR   EnsemblGenomes-Tr; AT4G07803.1.
DR   EnsemblGenomes-Tr; AT4G07806.1.
DR   EnsemblGenomes-Tr; AT4G07810.1.
DR   EnsemblGenomes-Tr; AT4G07812.1.
DR   EnsemblGenomes-Tr; AT4G07830.1.
DR   EnsemblGenomes-Tr; AT4G07840.1.
DR   EnsemblGenomes-Tr; AT4G07841.1.
DR   EnsemblGenomes-Tr; AT4G07843.1.
DR   EnsemblGenomes-Tr; AT4G07846.1.
DR   EnsemblGenomes-Tr; AT4G07850.1.
DR   EnsemblGenomes-Tr; AT4G07856.1.
DR   EnsemblGenomes-Tr; AT4G07862.1.
DR   EnsemblGenomes-Tr; AT4G07869.1.
DR   EnsemblGenomes-Tr; AT4G07874.1.
DR   EnsemblGenomes-Tr; AT4G07890.1.
DR   EnsemblGenomes-Tr; AT4G07893.1.
DR   EnsemblGenomes-Tr; AT4G07896.1.
DR   EnsemblGenomes-Tr; AT4G07915.1.
DR   EnsemblGenomes-Tr; AT4G07917.1.
DR   EnsemblGenomes-Tr; AT4G07920.1.
DR   EnsemblGenomes-Tr; AT4G07931.1.
DR   EnsemblGenomes-Tr; AT4G07933.1.
DR   EnsemblGenomes-Tr; AT4G07934.1.
DR   EnsemblGenomes-Tr; AT4G07935.1.
DR   EnsemblGenomes-Tr; AT4G07936.1.
DR   EnsemblGenomes-Tr; AT4G07937.1.
DR   EnsemblGenomes-Tr; AT4G07938.1.
DR   EnsemblGenomes-Tr; AT4G07939.1.
DR   EnsemblGenomes-Tr; AT4G07941.1.
DR   EnsemblGenomes-Tr; AT4G07942.1.
DR   EnsemblGenomes-Tr; AT4G07943.1.
DR   EnsemblGenomes-Tr; AT4G07944.1.
DR   EnsemblGenomes-Tr; AT4G07945.1.
DR   EnsemblGenomes-Tr; AT4G07946.1.
DR   EnsemblGenomes-Tr; AT4G07947.1.
DR   EnsemblGenomes-Tr; AT4G07967.1.
DR   EnsemblGenomes-Tr; AT4G07970.1.
DR   EnsemblGenomes-Tr; AT4G08000.1.
DR   EnsemblGenomes-Tr; AT4G08010.1.
DR   EnsemblGenomes-Tr; AT4G08013.1.
DR   EnsemblGenomes-Tr; AT4G08016.1.
DR   EnsemblGenomes-Tr; AT4G08020.1.
DR   EnsemblGenomes-Tr; AT4G08022.1.
DR   EnsemblGenomes-Tr; AT4G08030.1.
DR   EnsemblGenomes-Tr; AT4G08032.1.
DR   EnsemblGenomes-Tr; AT4G08033.1.
DR   EnsemblGenomes-Tr; AT4G08034.1.
DR   EnsemblGenomes-Tr; AT4G08035.1.
DR   EnsemblGenomes-Tr; AT4G08035.2.
DR   EnsemblGenomes-Tr; AT4G08036.1.
DR   EnsemblGenomes-Tr; AT4G08038.1.
DR   EnsemblGenomes-Tr; AT4G08050.1.
DR   EnsemblGenomes-Tr; AT4G08053.1.
DR   EnsemblGenomes-Tr; AT4G08054.1.
DR   EnsemblGenomes-Tr; AT4G08056.1.
DR   EnsemblGenomes-Tr; AT4G08060.1.
DR   EnsemblGenomes-Tr; AT4G08070.1.
DR   EnsemblGenomes-Tr; AT4G08071.1.
DR   EnsemblGenomes-Tr; AT4G08072.1.
DR   EnsemblGenomes-Tr; AT4G08074.1.
DR   EnsemblGenomes-Tr; AT4G08076.1.
DR   EnsemblGenomes-Tr; AT4G08078.1.
DR   EnsemblGenomes-Tr; AT4G08080.1.
DR   EnsemblGenomes-Tr; AT4G08090.1.
DR   EnsemblGenomes-Tr; AT4G08091.1.
DR   EnsemblGenomes-Tr; AT4G08092.1.
DR   EnsemblGenomes-Tr; AT4G08093.1.
DR   EnsemblGenomes-Tr; AT4G08094.1.
DR   EnsemblGenomes-Tr; AT4G08095.1.
DR   EnsemblGenomes-Tr; AT4G08096.1.
DR   EnsemblGenomes-Tr; AT4G08098.1.
DR   EnsemblGenomes-Tr; AT4G08099.1.
DR   EnsemblGenomes-Tr; AT4G08100.1.
DR   EnsemblGenomes-Tr; AT4G08101.1.
DR   EnsemblGenomes-Tr; AT4G08102.1.
DR   EnsemblGenomes-Tr; AT4G08103.1.
DR   EnsemblGenomes-Tr; AT4G08104.1.
DR   EnsemblGenomes-Tr; AT4G08105.1.
DR   EnsemblGenomes-Tr; AT4G08106.1.
DR   EnsemblGenomes-Tr; AT4G08107.1.
DR   EnsemblGenomes-Tr; AT4G08108.1.
DR   EnsemblGenomes-Tr; AT4G08109.1.
DR   EnsemblGenomes-Tr; AT4G08110.1.
DR   EnsemblGenomes-Tr; AT4G08111.1.
DR   EnsemblGenomes-Tr; AT4G08112.1.
DR   EnsemblGenomes-Tr; AT4G08113.1.
DR   EnsemblGenomes-Tr; AT4G08114.1.
DR   EnsemblGenomes-Tr; AT4G08115.1.
DR   EnsemblGenomes-Tr; AT4G08116.1.
DR   EnsemblGenomes-Tr; AT4G08120.1.
DR   EnsemblGenomes-Tr; AT4G08130.1.
DR   EnsemblGenomes-Tr; AT4G08131.1.
DR   EnsemblGenomes-Tr; AT4G08132.1.
DR   EnsemblGenomes-Tr; AT4G08134.1.
DR   EnsemblGenomes-Tr; AT4G08135.1.
DR   EnsemblGenomes-Tr; AT4G08136.1.
DR   EnsemblGenomes-Tr; AT4G08138.1.
DR   EnsemblGenomes-Tr; AT4G08145.1.
DR   EnsemblGenomes-Tr; AT4G08180.3.
DR   EnsemblGenomes-Tr; AT4G08200.1.
DR   EnsemblGenomes-Tr; AT4G08220.1.
DR   EnsemblGenomes-Tr; AT4G08262.1.
DR   EnsemblGenomes-Tr; AT4G08264.1.
DR   EnsemblGenomes-Tr; AT4G08275.1.
DR   EnsemblGenomes-Tr; AT4G08290.2.
DR   EnsemblGenomes-Tr; AT4G08333.1.
DR   EnsemblGenomes-Tr; AT4G08336.1.
DR   EnsemblGenomes-Tr; AT4G08340.1.
DR   EnsemblGenomes-Tr; AT4G08345.1.
DR   EnsemblGenomes-Tr; AT4G08347.1.
DR   EnsemblGenomes-Tr; AT4G08375.1.
DR   EnsemblGenomes-Tr; AT4G08405.1.
DR   EnsemblGenomes-Tr; AT4G08420.1.
DR   EnsemblGenomes-Tr; AT4G08490.1.
DR   EnsemblGenomes-Tr; AT4G08590.2.
DR   EnsemblGenomes-Tr; AT4G08596.1.
DR   EnsemblGenomes-Tr; AT4G08598.1.
DR   EnsemblGenomes-Tr; AT4G08599.1.
DR   EnsemblGenomes-Tr; AT4G08600.1.
DR   EnsemblGenomes-Tr; AT4G08602.1.
DR   EnsemblGenomes-Tr; AT4G08610.1.
DR   EnsemblGenomes-Tr; AT4G08645.1.
DR   EnsemblGenomes-Tr; AT4G08650.1.
DR   EnsemblGenomes-Tr; AT4G08652.1.
DR   EnsemblGenomes-Tr; AT4G08655.1.
DR   EnsemblGenomes-Tr; AT4G08657.1.
DR   EnsemblGenomes-Tr; AT4G08660.1.
DR   EnsemblGenomes-Tr; AT4G08680.1.
DR   EnsemblGenomes-Tr; AT4G08692.1.
DR   EnsemblGenomes-Tr; AT4G08695.1.
DR   EnsemblGenomes-Tr; AT4G08710.1.
DR   EnsemblGenomes-Tr; AT4G08720.1.
DR   EnsemblGenomes-Tr; AT4G08750.1.
DR   EnsemblGenomes-Tr; AT4G08765.1.
DR   EnsemblGenomes-Tr; AT4G08820.1.
DR   EnsemblGenomes-Tr; AT4G08830.1.
DR   EnsemblGenomes-Tr; AT4G08850.2.
DR   EnsemblGenomes-Tr; AT4G08860.1.
DR   EnsemblGenomes-Tr; AT4G08871.1.
DR   EnsemblGenomes-Tr; AT4G08872.1.
DR   EnsemblGenomes-Tr; AT4G08873.1.
DR   EnsemblGenomes-Tr; AT4G08880.1.
DR   EnsemblGenomes-Tr; AT4G08890.1.
DR   EnsemblGenomes-Tr; AT4G08945.1.
DR   EnsemblGenomes-Tr; AT4G08953.1.
DR   EnsemblGenomes-Tr; AT4G08956.1.
DR   EnsemblGenomes-Tr; AT4G08970.1.
DR   EnsemblGenomes-Tr; AT4G08991.1.
DR   EnsemblGenomes-Tr; AT4G08995.1.
DR   EnsemblGenomes-Tr; AT4G09143.1.
DR   EnsemblGenomes-Tr; AT4G09146.1.
DR   EnsemblGenomes-Tr; AT4G09205.1.
DR   EnsemblGenomes-Tr; AT4G09230.1.
DR   EnsemblGenomes-Tr; AT4G09255.1.
DR   EnsemblGenomes-Tr; AT4G09280.1.
DR   EnsemblGenomes-Tr; AT4G09290.1.
DR   EnsemblGenomes-Tr; AT4G09313.1.
DR   EnsemblGenomes-Tr; AT4G09316.1.
DR   EnsemblGenomes-Tr; AT4G09370.1.
DR   EnsemblGenomes-Tr; AT4G09380.1.
DR   EnsemblGenomes-Tr; AT4G09390.1.
DR   EnsemblGenomes-Tr; AT4G09400.1.
DR   EnsemblGenomes-Tr; AT4G09410.1.
DR   EnsemblGenomes-Tr; AT4G09425.1.
DR   EnsemblGenomes-Tr; AT4G09432.1.
DR   EnsemblGenomes-Tr; AT4G09452.1.
DR   EnsemblGenomes-Tr; AT4G09455.1.
DR   EnsemblGenomes-Tr; AT4G09468.1.
DR   EnsemblGenomes-Tr; AT4G09470.1.
DR   EnsemblGenomes-Tr; AT4G09480.1.
DR   EnsemblGenomes-Tr; AT4G09500.1.
DR   EnsemblGenomes-Tr; AT4G09510.2.
DR   EnsemblGenomes-Tr; AT4G09540.1.
DR   EnsemblGenomes-Tr; AT4G09565.1.
DR   EnsemblGenomes-Tr; AT4G09584.1.
DR   EnsemblGenomes-Tr; AT4G09595.1.
DR   EnsemblGenomes-Tr; AT4G09625.1.
DR   EnsemblGenomes-Tr; AT4G09644.1.
DR   EnsemblGenomes-Tr; AT4G09680.2.
DR   EnsemblGenomes-Tr; AT4G09700.1.
DR   EnsemblGenomes-Tr; AT4G09710.1.
DR   EnsemblGenomes-Tr; AT4G09720.2.
DR   EnsemblGenomes-Tr; AT4G09745.1.
DR   EnsemblGenomes-Tr; AT4G09790.1.
DR   EnsemblGenomes-Tr; AT4G09875.1.
DR   EnsemblGenomes-Tr; AT4G09960.2.
DR   EnsemblGenomes-Tr; AT4G09987.1.
DR   EnsemblGenomes-Tr; AT4G10201.1.
DR   EnsemblGenomes-Tr; AT4G10345.1.
DR   EnsemblGenomes-Tr; AT4G10414.1.
DR   EnsemblGenomes-Tr; AT4G10460.1.
DR   EnsemblGenomes-Tr; AT4G10507.1.
DR   EnsemblGenomes-Tr; AT4G10580.1.
DR   EnsemblGenomes-Tr; AT4G10655.1.
DR   EnsemblGenomes-Tr; AT4G10690.1.
DR   EnsemblGenomes-Tr; AT4G10767.1.
DR   EnsemblGenomes-Tr; AT4G10815.1.
DR   EnsemblGenomes-Tr; AT4G10830.1.
DR   EnsemblGenomes-Tr; AT4G10865.1.
DR   EnsemblGenomes-Tr; AT4G10980.1.
DR   EnsemblGenomes-Tr; AT4G10990.1.
DR   EnsemblGenomes-Tr; AT4G11070.2.
DR   EnsemblGenomes-Tr; AT4G11177.1.
DR   EnsemblGenomes-Tr; AT4G11200.1.
DR   EnsemblGenomes-Tr; AT4G11213.1.
DR   EnsemblGenomes-Tr; AT4G11216.1.
DR   EnsemblGenomes-Tr; AT4G11355.1.
DR   EnsemblGenomes-Tr; AT4G11375.1.
DR   EnsemblGenomes-Tr; AT4G11405.1.
DR   EnsemblGenomes-Tr; AT4G11500.1.
DR   EnsemblGenomes-Tr; AT4G11642.1.
DR   EnsemblGenomes-Tr; AT4G11710.1.
DR   EnsemblGenomes-Tr; AT4G11820.1.
DR   EnsemblGenomes-Tr; AT4G11830.1.
DR   EnsemblGenomes-Tr; AT4G11945.1.
DR   EnsemblGenomes-Tr; AT4G11985.1.
DR   EnsemblGenomes-Tr; AT4G12030.1.
DR   EnsemblGenomes-Tr; AT4G12065.1.
DR   EnsemblGenomes-Tr; AT4G12115.1.
DR   EnsemblGenomes-Tr; AT4G12135.1.
DR   EnsemblGenomes-Tr; AT4G12160.1.
DR   EnsemblGenomes-Tr; AT4G12180.1.
DR   EnsemblGenomes-Tr; AT4G12200.1.
DR   EnsemblGenomes-Tr; AT4G12260.1.
DR   EnsemblGenomes-Tr; AT4G12275.1.
DR   EnsemblGenomes-Tr; AT4G12405.1.
DR   EnsemblGenomes-Tr; AT4G12423.1.
DR   EnsemblGenomes-Tr; AT4G12426.1.
DR   EnsemblGenomes-Tr; AT4G12460.2.
DR   EnsemblGenomes-Tr; AT4G12610.1.
DR   EnsemblGenomes-Tr; AT4G12915.1.
DR   EnsemblGenomes-Tr; AT4G12917.1.
DR   EnsemblGenomes-Tr; AT4G13040.2.
DR   EnsemblGenomes-Tr; AT4G13120.1.
DR   EnsemblGenomes-Tr; AT4G13215.1.
DR   EnsemblGenomes-Tr; AT4G13245.1.
DR   EnsemblGenomes-Tr; AT4G13251.1.
DR   EnsemblGenomes-Tr; AT4G13252.1.
DR   EnsemblGenomes-Tr; AT4G13253.1.
DR   EnsemblGenomes-Tr; AT4G13254.1.
DR   EnsemblGenomes-Tr; AT4G13255.1.
DR   EnsemblGenomes-Tr; AT4G13256.1.
DR   EnsemblGenomes-Tr; AT4G13257.1.
DR   EnsemblGenomes-Tr; AT4G13258.1.
DR   EnsemblGenomes-Tr; AT4G13259.1.
DR   EnsemblGenomes-Tr; AT4G13262.1.
DR   EnsemblGenomes-Tr; AT4G13264.1.
DR   EnsemblGenomes-Tr; AT4G13265.1.
DR   EnsemblGenomes-Tr; AT4G13280.1.
DR   EnsemblGenomes-Tr; AT4G13285.1.
DR   EnsemblGenomes-Tr; AT4G13442.1.
DR   EnsemblGenomes-Tr; AT4G13445.1.
DR   EnsemblGenomes-Tr; AT4G13455.1.
DR   EnsemblGenomes-Tr; AT4G13470.1.
DR   EnsemblGenomes-Tr; AT4G13493.1.
DR   EnsemblGenomes-Tr; AT4G13494.1.
DR   EnsemblGenomes-Tr; AT4G13495.1.
DR   EnsemblGenomes-Tr; AT4G13495.2.
DR   EnsemblGenomes-Tr; AT4G13505.1.
DR   EnsemblGenomes-Tr; AT4G13554.1.
DR   EnsemblGenomes-Tr; AT4G13555.1.
DR   EnsemblGenomes-Tr; AT4G13564.1.
DR   EnsemblGenomes-Tr; AT4G13611.1.
DR   EnsemblGenomes-Tr; AT4G13870.1.
DR   EnsemblGenomes-Tr; AT4G13900.1.
DR   EnsemblGenomes-Tr; AT4G13918.1.
DR   EnsemblGenomes-Tr; AT4G13996.1.
DR   EnsemblGenomes-Tr; AT4G14135.1.
DR   EnsemblGenomes-Tr; AT4G14149.1.
DR   EnsemblGenomes-Tr; AT4G14180.1.
DR   EnsemblGenomes-Tr; AT4G14240.2.
DR   EnsemblGenomes-Tr; AT4G14270.2.
DR   EnsemblGenomes-Tr; AT4G14345.1.
DR   EnsemblGenomes-Tr; AT4G14410.2.
DR   EnsemblGenomes-Tr; AT4G14415.1.
DR   EnsemblGenomes-Tr; AT4G14460.1.
DR   EnsemblGenomes-Tr; AT4G14470.1.
DR   EnsemblGenomes-Tr; AT4G14504.1.
DR   EnsemblGenomes-Tr; AT4G14548.1.
DR   EnsemblGenomes-Tr; AT4G14610.1.
DR   EnsemblGenomes-Tr; AT4G14661.1.
DR   EnsemblGenomes-Tr; AT4G14743.1.
DR   EnsemblGenomes-Tr; AT4G14811.1.
DR   EnsemblGenomes-Tr; AT4G15060.1.
DR   EnsemblGenomes-Tr; AT4G15210.2.
DR   EnsemblGenomes-Tr; AT4G15233.1.
DR   EnsemblGenomes-Tr; AT4G15233.2.
DR   EnsemblGenomes-Tr; AT4G15242.1.
DR   EnsemblGenomes-Tr; AT4G15258.1.
DR   EnsemblGenomes-Tr; AT4G15320.1.
DR   EnsemblGenomes-Tr; AT4G15345.1.
DR   EnsemblGenomes-Tr; AT4G15398.1.
DR   EnsemblGenomes-Tr; AT4G15510.2.
DR   EnsemblGenomes-Tr; AT4G15510.3.
DR   EnsemblGenomes-Tr; AT4G15590.1.
DR   EnsemblGenomes-Tr; AT4G15775.1.
DR   EnsemblGenomes-Tr; AT4G15860.1.
DR   EnsemblGenomes-Tr; AT4G16010.1.
DR   EnsemblGenomes-Tr; AT4G16020.2.
DR   EnsemblGenomes-Tr; AT4G16105.1.
DR   EnsemblGenomes-Tr; AT4G16160.1.
DR   EnsemblGenomes-Tr; AT4G16220.1.
DR   EnsemblGenomes-Tr; AT4G16235.1.
DR   EnsemblGenomes-Tr; AT4G16267.1.
DR   EnsemblGenomes-Tr; AT4G16280.1.
DR   EnsemblGenomes-Tr; AT4G16280.3.
DR   EnsemblGenomes-Tr; AT4G16355.1.
DR   EnsemblGenomes-Tr; AT4G16420.2.
DR   EnsemblGenomes-Tr; AT4G16420.3.
DR   EnsemblGenomes-Tr; AT4G16465.1.
DR   EnsemblGenomes-Tr; AT4G16475.1.
DR   EnsemblGenomes-Tr; AT4G16730.1.
DR   EnsemblGenomes-Tr; AT4G16740.2.
DR   EnsemblGenomes-Tr; AT4G16748.1.
DR   EnsemblGenomes-Tr; AT4G16870.1.
DR   EnsemblGenomes-Tr; AT4G16892.1.
DR   EnsemblGenomes-Tr; AT4G16910.1.
DR   EnsemblGenomes-Tr; AT4G16935.1.
DR   EnsemblGenomes-Tr; AT4G17005.1.
DR   EnsemblGenomes-Tr; AT4G17098.1.
DR   EnsemblGenomes-Tr; AT4G17450.1.
DR   EnsemblGenomes-Tr; AT4G17512.1.
DR   EnsemblGenomes-Tr; AT4G17587.1.
DR   EnsemblGenomes-Tr; AT4G17612.1.
DR   EnsemblGenomes-Tr; AT4G17765.1.
DR   EnsemblGenomes-Tr; AT4G17788.1.
DR   EnsemblGenomes-Tr; AT4G17820.1.
DR   EnsemblGenomes-Tr; AT4G17890.2.
DR   EnsemblGenomes-Tr; AT4G17908.1.
DR   EnsemblGenomes-Tr; AT4G17914.1.
DR   EnsemblGenomes-Tr; AT4G17915.1.
DR   EnsemblGenomes-Tr; AT4G17975.1.
DR   EnsemblGenomes-Tr; AT4G18010.2.
DR   EnsemblGenomes-Tr; AT4G18020.4.
DR   EnsemblGenomes-Tr; AT4G18020.5.
DR   EnsemblGenomes-Tr; AT4G18120.1.
DR   EnsemblGenomes-Tr; AT4G18120.2.
DR   EnsemblGenomes-Tr; AT4G18220.1.
DR   EnsemblGenomes-Tr; AT4G18255.1.
DR   EnsemblGenomes-Tr; AT4G18360.2.
DR   EnsemblGenomes-Tr; AT4G18375.1.
DR   EnsemblGenomes-Tr; AT4G18410.1.
DR   EnsemblGenomes-Tr; AT4G18420.1.
DR   EnsemblGenomes-Tr; AT4G18725.1.
DR   EnsemblGenomes-Tr; AT4G18815.1.
DR   EnsemblGenomes-Tr; AT4G18975.2.
DR   EnsemblGenomes-Tr; AT4G19239.1.
DR   EnsemblGenomes-Tr; AT4G19280.1.
DR   EnsemblGenomes-Tr; AT4G19290.1.
DR   EnsemblGenomes-Tr; AT4G19300.1.
DR   EnsemblGenomes-Tr; AT4G19305.1.
DR   EnsemblGenomes-Tr; AT4G19310.1.
DR   EnsemblGenomes-Tr; AT4G19320.1.
DR   EnsemblGenomes-Tr; AT4G19395.1.
DR   EnsemblGenomes-Tr; AT4G19452.1.
DR   EnsemblGenomes-Tr; AT4G19633.1.
DR   EnsemblGenomes-Tr; AT4G19680.1.
DR   EnsemblGenomes-Tr; AT4G19690.1.
DR   EnsemblGenomes-Tr; AT4G19710.1.
DR   EnsemblGenomes-Tr; AT4G19780.1.
DR   EnsemblGenomes-Tr; AT4G19790.1.
DR   EnsemblGenomes-Tr; AT4G19902.1.
DR   EnsemblGenomes-Tr; AT4G20010.2.
DR   EnsemblGenomes-Tr; AT4G20115.1.
DR   EnsemblGenomes-Tr; AT4G20180.1.
DR   EnsemblGenomes-Tr; AT4G20235.1.
DR   EnsemblGenomes-Tr; AT4G20260.4.
DR   EnsemblGenomes-Tr; AT4G20362.1.
DR   EnsemblGenomes-Tr; AT4G20365.1.
DR   EnsemblGenomes-Tr; AT4G20380.1.
DR   EnsemblGenomes-Tr; AT4G20380.3.
DR   EnsemblGenomes-Tr; AT4G20380.4.
DR   EnsemblGenomes-Tr; AT4G20380.5.
DR   EnsemblGenomes-Tr; AT4G20380.6.
DR   EnsemblGenomes-Tr; AT4G20400.2.
DR   EnsemblGenomes-Tr; AT4G20490.1.
DR   EnsemblGenomes-Tr; AT4G20500.1.
DR   EnsemblGenomes-Tr; AT4G20510.1.
DR   EnsemblGenomes-Tr; AT4G20530.1.
DR   EnsemblGenomes-Tr; AT4G20540.1.
DR   EnsemblGenomes-Tr; AT4G20550.1.
DR   EnsemblGenomes-Tr; AT4G20560.1.
DR   EnsemblGenomes-Tr; AT4G20570.1.
DR   EnsemblGenomes-Tr; AT4G20580.1.
DR   EnsemblGenomes-Tr; AT4G20590.1.
DR   EnsemblGenomes-Tr; AT4G20600.1.
DR   EnsemblGenomes-Tr; AT4G20610.1.
DR   EnsemblGenomes-Tr; AT4G20620.1.
DR   EnsemblGenomes-Tr; AT4G20630.1.
DR   EnsemblGenomes-Tr; AT4G20640.1.
DR   EnsemblGenomes-Tr; AT4G20710.1.
DR   EnsemblGenomes-Tr; AT4G20715.1.
DR   EnsemblGenomes-Tr; AT4G20725.1.
DR   EnsemblGenomes-Tr; AT4G20730.1.
DR   EnsemblGenomes-Tr; AT4G20830.2.
DR   EnsemblGenomes-Tr; AT4G20940.1.
DR   EnsemblGenomes-Tr; AT4G21065.2.
DR   EnsemblGenomes-Tr; AT4G21170.1.
DR   EnsemblGenomes-Tr; AT4G21280.1.
DR   EnsemblGenomes-Tr; AT4G21360.1.
DR   EnsemblGenomes-Tr; AT4G21362.1.
DR   EnsemblGenomes-Tr; AT4G21363.1.
DR   EnsemblGenomes-Tr; AT4G21370.1.
DR   EnsemblGenomes-Tr; AT4G21420.1.
DR   EnsemblGenomes-Tr; AT4G21437.1.
DR   EnsemblGenomes-Tr; AT4G21450.2.
DR   EnsemblGenomes-Tr; AT4G21540.3.
DR   EnsemblGenomes-Tr; AT4G21595.1.
DR   EnsemblGenomes-Tr; AT4G21605.1.
DR   EnsemblGenomes-Tr; AT4G21730.1.
DR   EnsemblGenomes-Tr; AT4G21830.2.
DR   EnsemblGenomes-Tr; AT4G21850.2.
DR   EnsemblGenomes-Tr; AT4G21860.2.
DR   EnsemblGenomes-Tr; AT4G22020.1.
DR   EnsemblGenomes-Tr; AT4G22040.1.
DR   EnsemblGenomes-Tr; AT4G22065.1.
DR   EnsemblGenomes-Tr; AT4G22066.1.
DR   EnsemblGenomes-Tr; AT4G22160.1.
DR   EnsemblGenomes-Tr; AT4G22185.1.
DR   EnsemblGenomes-Tr; AT4G22230.2.
DR   EnsemblGenomes-Tr; AT4G22233.1.
DR   EnsemblGenomes-Tr; AT4G22233.2.
DR   EnsemblGenomes-Tr; AT4G22265.1.
DR   EnsemblGenomes-Tr; AT4G22415.1.
DR   EnsemblGenomes-Tr; AT4G22450.1.
DR   EnsemblGenomes-Tr; AT4G22540.2.
DR   EnsemblGenomes-Tr; AT4G22540.3.
DR   EnsemblGenomes-Tr; AT4G22540.4.
DR   EnsemblGenomes-Tr; AT4G22545.1.
DR   EnsemblGenomes-Tr; AT4G22635.1.
DR   EnsemblGenomes-Tr; AT4G22753.2.
DR   EnsemblGenomes-Tr; AT4G22754.1.
DR   EnsemblGenomes-Tr; AT4G22785.1.
DR   EnsemblGenomes-Tr; AT4G22890.4.
DR   EnsemblGenomes-Tr; AT4G22890.5.
DR   EnsemblGenomes-Tr; AT4G22970.2.
DR   EnsemblGenomes-Tr; AT4G23130.2.
DR   EnsemblGenomes-Tr; AT4G23140.2.
DR   EnsemblGenomes-Tr; AT4G23205.1.
DR   EnsemblGenomes-Tr; AT4G23210.2.
DR   EnsemblGenomes-Tr; AT4G23215.1.
DR   EnsemblGenomes-Tr; AT4G23320.1.
DR   EnsemblGenomes-Tr; AT4G23364.1.
DR   EnsemblGenomes-Tr; AT4G23375.1.
DR   EnsemblGenomes-Tr; AT4G23387.1.
DR   EnsemblGenomes-Tr; AT4G23430.1.
DR   EnsemblGenomes-Tr; AT4G23430.3.
DR   EnsemblGenomes-Tr; AT4G23570.3.
DR   EnsemblGenomes-Tr; AT4G23600.2.
DR   EnsemblGenomes-Tr; AT4G23635.1.
DR   EnsemblGenomes-Tr; AT4G23713.1.
DR   EnsemblGenomes-Tr; AT4G23915.1.
DR   EnsemblGenomes-Tr; AT4G24025.1.
DR   EnsemblGenomes-Tr; AT4G24220.2.
DR   EnsemblGenomes-Tr; AT4G24230.1.
DR   EnsemblGenomes-Tr; AT4G24290.1.
DR   EnsemblGenomes-Tr; AT4G24415.1.
DR   EnsemblGenomes-Tr; AT4G24415.2.
DR   EnsemblGenomes-Tr; AT4G24415.3.
DR   EnsemblGenomes-Tr; AT4G24565.1.
DR   EnsemblGenomes-Tr; AT4G24620.2.
DR   EnsemblGenomes-Tr; AT4G24652.1.
DR   EnsemblGenomes-Tr; AT4G24730.1.
DR   EnsemblGenomes-Tr; AT4G24977.1.
DR   EnsemblGenomes-Tr; AT4G25080.4.
DR   EnsemblGenomes-Tr; AT4G25110.2.
DR   EnsemblGenomes-Tr; AT4G25235.1.
DR   EnsemblGenomes-Tr; AT4G25390.2.
DR   EnsemblGenomes-Tr; AT4G25434.2.
DR   EnsemblGenomes-Tr; AT4G25435.1.
DR   EnsemblGenomes-Tr; AT4G25450.2.
DR   EnsemblGenomes-Tr; AT4G25585.1.
DR   EnsemblGenomes-Tr; AT4G25631.1.
DR   EnsemblGenomes-Tr; AT4G25635.1.
DR   EnsemblGenomes-Tr; AT4G25650.1.
DR   EnsemblGenomes-Tr; AT4G25700.2.
DR   EnsemblGenomes-Tr; AT4G25719.1.
DR   EnsemblGenomes-Tr; AT4G25720.3.
DR   EnsemblGenomes-Tr; AT4G25880.2.
DR   EnsemblGenomes-Tr; AT4G25880.3.
DR   EnsemblGenomes-Tr; AT4G25885.1.
DR   EnsemblGenomes-Tr; AT4G26070.1.
DR   EnsemblGenomes-Tr; AT4G26095.1.
DR   EnsemblGenomes-Tr; AT4G26140.2.
DR   EnsemblGenomes-Tr; AT4G26225.1.
DR   EnsemblGenomes-Tr; AT4G26255.1.
DR   EnsemblGenomes-Tr; AT4G26260.2.
DR   EnsemblGenomes-Tr; AT4G26360.1.
DR   EnsemblGenomes-Tr; AT4G26365.1.
DR   EnsemblGenomes-Tr; AT4G26375.1.
DR   EnsemblGenomes-Tr; AT4G26385.1.
DR   EnsemblGenomes-Tr; AT4G26420.2.
DR   EnsemblGenomes-Tr; AT4G26470.2.
DR   EnsemblGenomes-Tr; AT4G26488.1.
DR   EnsemblGenomes-Tr; AT4G26542.1.
DR   EnsemblGenomes-Tr; AT4G26570.2.
DR   EnsemblGenomes-Tr; AT4G26582.1.
DR   EnsemblGenomes-Tr; AT4G26640.1.
DR   EnsemblGenomes-Tr; AT4G26675.1.
DR   EnsemblGenomes-Tr; AT4G26795.1.
DR   EnsemblGenomes-Tr; AT4G26795.2.
DR   EnsemblGenomes-Tr; AT4G26910.2.
DR   EnsemblGenomes-Tr; AT4G26910.3.
DR   EnsemblGenomes-Tr; AT4G26940.2.
DR   EnsemblGenomes-Tr; AT4G27052.1.
DR   EnsemblGenomes-Tr; AT4G27200.1.
DR   EnsemblGenomes-Tr; AT4G27210.1.
DR   EnsemblGenomes-Tr; AT4G27395.1.
DR   EnsemblGenomes-Tr; AT4G27597.1.
DR   EnsemblGenomes-Tr; AT4G27630.1.
DR   EnsemblGenomes-Tr; AT4G27765.1.
DR   EnsemblGenomes-Tr; AT4G27800.3.
DR   EnsemblGenomes-Tr; AT4G27852.1.
DR   EnsemblGenomes-Tr; AT4G27875.1.
DR   EnsemblGenomes-Tr; AT4G27885.1.
DR   EnsemblGenomes-Tr; AT4G28162.1.
DR   EnsemblGenomes-Tr; AT4G28362.1.
DR   EnsemblGenomes-Tr; AT4G28420.1.
DR   EnsemblGenomes-Tr; AT4G28520.2.
DR   EnsemblGenomes-Tr; AT4G28520.4.
DR   EnsemblGenomes-Tr; AT4G28652.1.
DR   EnsemblGenomes-Tr; AT4G28790.2.
DR   EnsemblGenomes-Tr; AT4G28900.1.
DR   EnsemblGenomes-Tr; AT4G28915.1.
DR   EnsemblGenomes-Tr; AT4G28960.1.
DR   EnsemblGenomes-Tr; AT4G28970.1.
DR   EnsemblGenomes-Tr; AT4G29160.2.
DR   EnsemblGenomes-Tr; AT4G29170.2.
DR   EnsemblGenomes-Tr; AT4G29210.2.
DR   EnsemblGenomes-Tr; AT4G29276.1.
DR   EnsemblGenomes-Tr; AT4G29281.1.
DR   EnsemblGenomes-Tr; AT4G29415.1.
DR   EnsemblGenomes-Tr; AT4G29540.1.
DR   EnsemblGenomes-Tr; AT4G29670.1.
DR   EnsemblGenomes-Tr; AT4G29930.1.
DR   EnsemblGenomes-Tr; AT4G29930.2.
DR   EnsemblGenomes-Tr; AT4G29930.4.
DR   EnsemblGenomes-Tr; AT4G30072.1.
DR   EnsemblGenomes-Tr; AT4G30200.1.
DR   EnsemblGenomes-Tr; AT4G30200.3.
DR   EnsemblGenomes-Tr; AT4G30200.4.
DR   EnsemblGenomes-Tr; AT4G30210.1.
DR   EnsemblGenomes-Tr; AT4G30872.1.
DR   EnsemblGenomes-Tr; AT4G30972.1.
DR   EnsemblGenomes-Tr; AT4G30975.1.
DR   EnsemblGenomes-Tr; AT4G31075.1.
DR   EnsemblGenomes-Tr; AT4G31120.2.
DR   EnsemblGenomes-Tr; AT4G31190.1.
DR   EnsemblGenomes-Tr; AT4G31248.1.
DR   EnsemblGenomes-Tr; AT4G31265.1.
DR   EnsemblGenomes-Tr; AT4G31390.2.
DR   EnsemblGenomes-Tr; AT4G31398.1.
DR   EnsemblGenomes-Tr; AT4G31408.1.
DR   EnsemblGenomes-Tr; AT4G31550.2.
DR   EnsemblGenomes-Tr; AT4G31695.1.
DR   EnsemblGenomes-Tr; AT4G31780.1.
DR   EnsemblGenomes-Tr; AT4G31860.2.
DR   EnsemblGenomes-Tr; AT4G31877.1.
DR   EnsemblGenomes-Tr; AT4G31895.1.
DR   EnsemblGenomes-Tr; AT4G32205.1.
DR   EnsemblGenomes-Tr; AT4G32212.1.
DR   EnsemblGenomes-Tr; AT4G32215.1.
DR   EnsemblGenomes-Tr; AT4G32220.1.
DR   EnsemblGenomes-Tr; AT4G32265.1.
DR   EnsemblGenomes-Tr; AT4G32445.1.
DR   EnsemblGenomes-Tr; AT4G32475.1.
DR   EnsemblGenomes-Tr; AT4G32765.1.
DR   EnsemblGenomes-Tr; AT4G33000.2.
DR   EnsemblGenomes-Tr; AT4G33260.2.
DR   EnsemblGenomes-Tr; AT4G33330.2.
DR   EnsemblGenomes-Tr; AT4G33350.2.
DR   EnsemblGenomes-Tr; AT4G33355.2.
DR   EnsemblGenomes-Tr; AT4G33520.1.
DR   EnsemblGenomes-Tr; AT4G33850.1.
DR   EnsemblGenomes-Tr; AT4G34000.3.
DR   EnsemblGenomes-Tr; AT4G34020.2.
DR   EnsemblGenomes-Tr; AT4G34035.1.
DR   EnsemblGenomes-Tr; AT4G34065.1.
DR   EnsemblGenomes-Tr; AT4G34071.1.
DR   EnsemblGenomes-Tr; AT4G34103.1.
DR   EnsemblGenomes-Tr; AT4G34332.1.
DR   EnsemblGenomes-Tr; AT4G34415.1.
DR   EnsemblGenomes-Tr; AT4G34430.3.
DR   EnsemblGenomes-Tr; AT4G34430.4.
DR   EnsemblGenomes-Tr; AT4G34695.1.
DR   EnsemblGenomes-Tr; AT4G34975.1.
DR   EnsemblGenomes-Tr; AT4G35400.1.
DR   EnsemblGenomes-Tr; AT4G35731.1.
DR   EnsemblGenomes-Tr; AT4G35740.2.
DR   EnsemblGenomes-Tr; AT4G35860.2.
DR   EnsemblGenomes-Tr; AT4G36032.1.
DR   EnsemblGenomes-Tr; AT4G36052.1.
DR   EnsemblGenomes-Tr; AT4G36060.2.
DR   EnsemblGenomes-Tr; AT4G36197.1.
DR   EnsemblGenomes-Tr; AT4G36245.1.
DR   EnsemblGenomes-Tr; AT4G36540.2.
DR   EnsemblGenomes-Tr; AT4G36570.1.
DR   EnsemblGenomes-Tr; AT4G36635.1.
DR   EnsemblGenomes-Tr; AT4G36648.1.
DR   EnsemblGenomes-Tr; AT4G36730.2.
DR   EnsemblGenomes-Tr; AT4G36780.1.
DR   EnsemblGenomes-Tr; AT4G36808.1.
DR   EnsemblGenomes-Tr; AT4G37175.1.
DR   EnsemblGenomes-Tr; AT4G37225.1.
DR   EnsemblGenomes-Tr; AT4G37432.1.
DR   EnsemblGenomes-Tr; AT4G37553.1.
DR   EnsemblGenomes-Tr; AT4G37570.1.
DR   EnsemblGenomes-Tr; AT4G37620.1.
DR   EnsemblGenomes-Tr; AT4G37630.2.
DR   EnsemblGenomes-Tr; AT4G37705.1.
DR   EnsemblGenomes-Tr; AT4G37895.1.
DR   EnsemblGenomes-Tr; AT4G38215.1.
DR   EnsemblGenomes-Tr; AT4G38230.1.
DR   EnsemblGenomes-Tr; AT4G38545.1.
DR   EnsemblGenomes-Tr; AT4G38545.2.
DR   EnsemblGenomes-Tr; AT4G38552.1.
DR   EnsemblGenomes-Tr; AT4G38910.1.
DR   EnsemblGenomes-Tr; AT4G38932.1.
DR   EnsemblGenomes-Tr; AT4G38990.1.
DR   EnsemblGenomes-Tr; AT4G39195.1.
DR   EnsemblGenomes-Tr; AT4G39330.2.
DR   EnsemblGenomes-Tr; AT4G39345.1.
DR   EnsemblGenomes-Tr; AT4G39361.1.
DR   EnsemblGenomes-Tr; AT4G39363.1.
DR   EnsemblGenomes-Tr; AT4G39364.1.
DR   EnsemblGenomes-Tr; AT4G39366.1.
DR   EnsemblGenomes-Tr; AT4G39370.2.
DR   EnsemblGenomes-Tr; AT4G39404.1.
DR   EnsemblGenomes-Tr; AT4G39615.1.
DR   EnsemblGenomes-Tr; AT4G39672.1.
DR   EnsemblGenomes-Tr; AT4G39838.1.
DR   EnsemblGenomes-Tr; AT4G39865.1.
DR   EnsemblGenomes-Tr; AT4G39985.1.
DR   EnsemblGenomes-Tr; AT4G40065.1.
DR   EnsemblGenomes-Tr; AT4G40085.1.
DR   EnsemblGenomes-Tr; AT4G40085.2.
DR   EuropePMC; PMC5213257; 28070306.
DR   EuropePMC; PMC5333544; 28265494.
DR   GOA; F2Q9V5.
DR   GOA; F4JJH5.
DR   GOA; F4JJP1.
DR   GOA; F4JN00.
DR   GOA; F4JRF5.
DR   GOA; O23086.
DR   GOA; O23257.
DR   GOA; O23317.
DR   GOA; O23373.
DR   GOA; O23429.
DR   GOA; O49413.
DR   GOA; O65420.
DR   GOA; O65468.
DR   GOA; O65483.
DR   GOA; O81778.
DR   GOA; O81866.
DR   GOA; P0CG07.
DR   GOA; P0CJ49.
DR   GOA; P0CJ57.
DR   GOA; P0CJ58.
DR   GOA; P0CJ59.
DR   GOA; P0CJ61.
DR   GOA; P0DH87.
DR   GOA; P0DKJ0.
DR   GOA; P0DKJ2.
DR   GOA; P82722.
DR   GOA; Q5PNU3.
DR   GOA; Q5UBY2.
DR   GOA; Q6DBA5.
DR   GOA; Q6DBN1.
DR   GOA; Q84LM4.
DR   GOA; Q84W54.
DR   GOA; Q8VZQ9.
DR   GOA; Q9LDQ3.
DR   GOA; Q9M0C2.
DR   GOA; Q9SCU8.
DR   GOA; Q9STJ7.
DR   GOA; Q9SUS1.
DR   GOA; Q9SVM3.
DR   GOA; Q9SVU7.
DR   GOA; Q9SVV9.
DR   GOA; Q9ZT94.
DR   GOA; Q9ZTA2.
DR   InterPro; IPR000555; JAMM/MPN+_dom.
DR   InterPro; IPR000922; Lectin_gal-bd_dom.
DR   InterPro; IPR001584; Integrase_cat-core.
DR   InterPro; IPR001944; Glycoside_Hdrlase_35.
DR   InterPro; IPR004252; Probable_transposase_24.
DR   InterPro; IPR006527; F-box-assoc_dom_typ1.
DR   InterPro; IPR006577; UAS.
DR   InterPro; IPR006590; RNA_pol_Rpb4/RPC9_core.
DR   InterPro; IPR007201; Mei2-like_Rrm_C.
DR   InterPro; IPR007271; Nuc_sug_transpt.
DR   InterPro; IPR010997; HRDC-like_sf.
DR   InterPro; IPR018501; DDT_dom.
DR   InterPro; IPR025724; GAG-pre-integrase_dom.
DR   InterPro; IPR028942; WHIM1_dom.
DR   InterPro; IPR034453; MEI2-like_RRM1.
DR   InterPro; IPR034454; MEI2-like_RRM3.
DR   InterPro; IPR037518; MPN.
DR   InterPro; IPR038324; Rpb4/RPC9_sf.
DR   InterPro; IPR039537; Retrotran_Ty1/copia-like.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00003; U1.
DR   RFAM; RF00004; U2.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00016; SNORD14.
DR   RFAM; RF00020; U5.
DR   RFAM; RF00026; U6.
DR   RFAM; RF00069; SNORD24.
DR   RFAM; RF00073; mir-156.
DR   RFAM; RF00075; mir-166.
DR   RFAM; RF00086; SNORD27.
DR   RFAM; RF00097; snoR71.
DR   RFAM; RF00132; snoR24.
DR   RFAM; RF00135; snoZ223.
DR   RFAM; RF00204; snoR12.
DR   RFAM; RF00205; snoR41.
DR   RFAM; RF00247; mir-160.
DR   RFAM; RF00309; snosnR60_Z15.
DR   RFAM; RF00315; snoJ33.
DR   RFAM; RF00316; snoR43.
DR   RFAM; RF00326; snoZ155.
DR   RFAM; RF00330; snoZ43.
DR   RFAM; RF00333; snoZ157.
DR   RFAM; RF00337; snoZ112.
DR   RFAM; RF00339; snoR60.
DR   RFAM; RF00348; snoR9_plant.
DR   RFAM; RF00349; snoR11.
DR   RFAM; RF00350; snoZ152.
DR   RFAM; RF00351; snoR20.
DR   RFAM; RF00352; snoR21.
DR   RFAM; RF00355; snoR28.
DR   RFAM; RF00638; MIR159.
DR   RFAM; RF00645; MIR169_2.
DR   RFAM; RF00677; MIR168.
DR   RFAM; RF00704; MIR397.
DR   RFAM; RF00768; MIR405.
DR   RFAM; RF00893; MIR854.
DR   RFAM; RF00901; MIR845_1.
DR   RFAM; RF00943; MIR824.
DR   RFAM; RF01026; MIR828.
DR   RFAM; RF01059; mir-598.
DR   RFAM; RF01206; snoR109.
DR   RFAM; RF01208; snoR99.
DR   RFAM; RF01213; snoR103.
DR   RFAM; RF01224; snoR80.
DR   RFAM; RF01236; snoU19.
DR   RFAM; RF01292; snoR2.
DR   RFAM; RF01300; snoU49.
DR   RFAM; RF01302; snoU36a.
DR   RFAM; RF01430; snoR134.
DR   RFAM; RF01433; snoR137.
DR   RFAM; RF01847; Plant_U3.
DR   RFAM; RF01855; Plant_SRP.
DR   TAIR; 1000429508; AT4G13445.
DR   TAIR; 1000429509; AT4G13265.
DR   TAIR; 1000429510; AT4G18255.
DR   TAIR; 1000429514; AT4G01865.
DR   TAIR; 1000429517; AT4G17975.
DR   TAIR; 1000429519; AT4G39865.
DR   TAIR; 1000429520; AT4G39985.
DR   TAIR; 1000429523; AT4G34695.
DR   TAIR; 1000429524; AT4G12405.
DR   TAIR; 1000429525; AT4G23915.
DR   TAIR; 1000429526; AT4G25435.
DR   TAIR; 1000429566; AT4G08345.
DR   TAIR; 1000429567; AT4G27875.
DR   TAIR; 1000429568; AT4G27885.
DR   TAIR; 1000429569; AT4G26385.
DR   TAIR; 1000429570; AT4G26375.
DR   TAIR; 1000429571; AT4G26225.
DR   TAIR; 1000429593; AT4G39345.
DR   TAIR; 1000429594; AT4G39195.
DR   TAIR; 1000429595; AT4G11177.
DR   TAIR; 1000429598; AT4G24025.
DR   TAIR; 1000429599; AT4G00985.
DR   TAIR; 1000429602; AT4G26675.
DR   TAIR; 1000429605; AT4G22754.
DR   TAIR; 1000429606; AT4G22785.
DR   TAIR; 1000429628; AT4G02055.
DR   TAIR; 1000429629; AT4G22265.
DR   TAIR; 1000429630; AT4G25585.
DR   TAIR; 1000429631; AT4G27395.
DR   TAIR; 1000429632; AT4G25635.
DR   TAIR; 1000429633; AT4G16475.
DR   TAIR; 1000429634; AT4G14345.
DR   TAIR; 1000429635; AT4G16235.
DR   TAIR; 1000429636; AT4G17612.
DR   TAIR; 1000429637; AT4G16465.
DR   TAIR; 1000429638; AT4G17765.
DR   TAIR; 1000429639; AT4G16105.
DR   TAIR; 1000429640; AT4G15775.
DR   TAIR; 1000429641; AT4G14415.
DR   TAIR; 1000429648; AT4G03435.
DR   TAIR; 1000429673; AT4G23635.
DR   TAIR; 1000429675; AT4G11355.
DR   TAIR; 1000429676; AT4G11216.
DR   TAIR; 1000429677; AT4G11213.
DR   TAIR; 1000429692; AT4G31265.
DR   TAIR; 1000429693; AT4G32475.
DR   TAIR; 1000429694; AT4G22635.
DR   TAIR; 1000429695; AT4G00085.
DR   TAIR; 1000429696; AT4G31075.
DR   TAIR; 1000429700; AT4G32765.
DR   TAIR; 1000429701; AT4G03135.
DR   TAIR; 1000429702; AT4G03405.
DR   TAIR; 1000429703; AT4G03285.
DR   TAIR; 1000429704; AT4G01355.
DR   TAIR; 1000429705; AT4G31695.
DR   TAIR; 1000429707; AT4G34035.
DR   TAIR; 1000429708; AT4G18725.
DR   TAIR; 1000429709; AT4G18815.
DR   TAIR; 1000429710; AT4G28915.
DR   TAIR; 1000429711; AT4G10815.
DR   TAIR; 1000429712; AT4G11405.
DR   TAIR; 1000429714; AT4G39615.
DR   TAIR; 1000429715; AT4G39672.
DR   TAIR; 1000429716; AT4G36197.
DR   TAIR; 1000429717; AT4G36245.
DR   TAIR; 1000429718; AT4G24565.
DR   TAIR; 1000429720; AT4G28362.
DR   TAIR; 1000429752; AT4G20115.
DR   TAIR; 1000429761; AT4G29415.
DR   TAIR; 1000429762; AT4G11985.
DR   TAIR; 1000429763; AT4G12065.
DR   TAIR; 1000429764; AT4G12115.
DR   TAIR; 1000429809; AT4G01455.
DR   TAIR; 1000429810; AT4G34975.
DR   TAIR; 1000429811; AT4G31895.
DR   TAIR; 1000429812; AT4G32265.
DR   TAIR; 1000429814; AT4G34415.
DR   TAIR; 1000429815; AT4G37175.
DR   TAIR; 1000429816; AT4G36635.
DR   TAIR; 1000529677; AT4G31877.
DR   TAIR; 1001029660; AT4G19395.
DR   TAIR; 1001029674; AT4G30972.
DR   TAIR; 1001029682; AT4G23713.
DR   TAIR; 1001029698; AT4G17788.
DR   TAIR; 1001029705; AT4G25631.
DR   TAIR; 1001029723; AT4G00885.
DR   TAIR; 1001029727; AT4G15258.
DR   TAIR; 1001029734; AT4G05048.
DR   TAIR; 1501129898; AT4G00975.
DR   TAIR; 1501129900; AT4G01533.
DR   TAIR; 1501129901; AT4G01593.
DR   TAIR; 1501129902; AT4G02005.
DR   TAIR; 1501129903; AT4G03038.
DR   TAIR; 1501129905; AT4G03438.
DR   TAIR; 1501129906; AT4G03445.
DR   TAIR; 1501129907; AT4G03455.
DR   TAIR; 1501129909; AT4G03811.
DR   TAIR; 1501129910; AT4G03935.
DR   TAIR; 1501129911; AT4G04223.
DR   TAIR; 1501129912; AT4G04315.
DR   TAIR; 1501129913; AT4G05105.
DR   TAIR; 1501129914; AT4G05508.
DR   TAIR; 1501129915; AT4G06701.
DR   TAIR; 1501129916; AT4G08035.
DR   TAIR; 1501129917; AT4G08116.
DR   TAIR; 1501129925; AT4G12917.
DR   TAIR; 1501129928; AT4G13495.
DR   TAIR; 1501129929; AT4G13505.
DR   TAIR; 1501129930; AT4G13555.
DR   TAIR; 1501129936; AT4G17098.
DR   TAIR; 1501129938; AT4G20362.
DR   TAIR; 1501129941; AT4G21595.
DR   TAIR; 1501129943; AT4G22233.
DR   TAIR; 1501129949; AT4G23205.
DR   TAIR; 1501129950; AT4G24415.
DR   TAIR; 1501129953; AT4G26095.
DR   TAIR; 1501129954; AT4G26255.
DR   TAIR; 1501129956; AT4G26488.
DR   TAIR; 1501129957; AT4G26795.
DR   TAIR; 1501129963; AT4G30975.
DR   TAIR; 1501129964; AT4G31398.
DR   TAIR; 1501129967; AT4G32445.
DR   TAIR; 1501129973; AT4G36052.
DR   TAIR; 1501129974; AT4G36648.
DR   TAIR; 1501129976; AT4G37225.
DR   TAIR; 1501129977; AT4G37432.
DR   TAIR; 1501129979; AT4G37895.
DR   TAIR; 1501129980; AT4G38545.
DR   TAIR; 1501129981; AT4G40085.
DR   TAIR; 1501130985; AT4G03039.
DR   TAIR; 1501130990; AT4G04077.
DR   TAIR; 1501130992; AT4G04221.
DR   TAIR; 1501131026; AT4G10345.
DR   TAIR; 1501131027; AT4G10507.
DR   TAIR; 1501131038; AT4G13493.
DR   TAIR; 1501131039; AT4G13494.
DR   TAIR; 1501131040; AT4G13554.
DR   TAIR; 1501131041; AT4G13564.
DR   TAIR; 1501131050; AT4G14504.
DR   TAIR; 1501131051; AT4G14548.
DR   TAIR; 1501131053; AT4G14811.
DR   TAIR; 1501131055; AT4G15242.
DR   TAIR; 1501131058; AT4G16355.
DR   TAIR; 1501131063; AT4G16892.
DR   TAIR; 1501131084; AT4G21362.
DR   TAIR; 1501131094; AT4G23375.
DR   TAIR; 1501131095; AT4G23387.
DR   TAIR; 1501131107; AT4G25719.
DR   TAIR; 1501131108; AT4G25885.
DR   TAIR; 1501131114; AT4G27765.
DR   TAIR; 1501131123; AT4G30872.
DR   TAIR; 1501131127; AT4G31248.
DR   TAIR; 1501131131; AT4G31408.
DR   TAIR; 1501131139; AT4G34071.
DR   TAIR; 1501131142; AT4G34332.
DR   TAIR; 1501131160; AT4G38215.
DR   TAIR; 1501131165; AT4G39404.
DR   TAIR; 1501131168; AT4G40065.
DR   TAIR; 1501165992; AT4G09432.
DR   TAIR; 1501165993; AT4G13918.
DR   TAIR; 1501165995; AT4G16748.
DR   TAIR; 1501166002; AT4G26542.
DR   TAIR; 1501166003; AT4G26582.
DR   TAIR; 1501166004; AT4G27852.
DR   TAIR; 1501166005; AT4G28162.
DR   TAIR; 1501166006; AT4G28652.
DR   TAIR; 1501166008; AT4G36032.
DR   TAIR; 1501166009; AT4G36808.
DR   TAIR; 1501166010; AT4G37553.
DR   TAIR; 1501166011; AT4G38552.
DR   TAIR; 1501166012; AT4G38932.
DR   TAIR; 1501166013; AT4G39838.
DR   TAIR; 228962; AT4G13245.
DR   TAIR; 228988; AT4G03295.
DR   TAIR; 229046; AT4G26365.
DR   TAIR; 229055; AT4G02555.
DR   TAIR; 229076; AT4G39361.
DR   TAIR; 229077; AT4G39363.
DR   TAIR; 229078; AT4G39364.
DR   TAIR; 229079; AT4G39366.
DR   UniProtKB/Swiss-Prot; F2Q9V5; SPH16_ARATH.
DR   UniProtKB/Swiss-Prot; F4JJH5; SBT3C_ARATH.
DR   UniProtKB/Swiss-Prot; F4JJP1; Y4759_ARATH.
DR   UniProtKB/Swiss-Prot; F4JN00; CSTR4_ARATH.
DR   UniProtKB/Swiss-Prot; F4JRF5; RLT3_ARATH.
DR   UniProtKB/Swiss-Prot; O23086; ALMTA_ARATH.
DR   UniProtKB/Swiss-Prot; O23257; FBL72_ARATH.
DR   UniProtKB/Swiss-Prot; O23317; DRL24_ARATH.
DR   UniProtKB/Swiss-Prot; O23373; FH3_ARATH.
DR   UniProtKB/Swiss-Prot; O23429; VA724_ARATH.
DR   UniProtKB/Swiss-Prot; O49413; IWS2_ARATH.
DR   UniProtKB/Swiss-Prot; O65420; VAL3_ARATH.
DR   UniProtKB/Swiss-Prot; O65451; FB333_ARATH.
DR   UniProtKB/Swiss-Prot; O65468; CRK8_ARATH.
DR   UniProtKB/Swiss-Prot; O65483; CRK24_ARATH.
DR   UniProtKB/Swiss-Prot; O81778; REM9_ARATH.
DR   UniProtKB/Swiss-Prot; O81866; P2A02_ARATH.
DR   UniProtKB/Swiss-Prot; P0C043; PP318_ARATH.
DR   UniProtKB/Swiss-Prot; P0CG07; SCRA_ARATH.
DR   UniProtKB/Swiss-Prot; P0CJ49; CRR42_ARATH.
DR   UniProtKB/Swiss-Prot; P0CJ57; CRR50_ARATH.
DR   UniProtKB/Swiss-Prot; P0CJ58; CRR51_ARATH.
DR   UniProtKB/Swiss-Prot; P0CJ59; CRR52_ARATH.
DR   UniProtKB/Swiss-Prot; P0CJ61; CRR54_ARATH.
DR   UniProtKB/Swiss-Prot; P0DH87; PSRK_ARATH.
DR   UniProtKB/Swiss-Prot; P0DKI4; PUX14_ARATH.
DR   UniProtKB/Swiss-Prot; P0DKI5; PUX16_ARATH.
DR   UniProtKB/Swiss-Prot; P0DKJ0; P160B_ARATH.
DR   UniProtKB/Swiss-Prot; P0DKJ2; P319A_ARATH.
DR   UniProtKB/Swiss-Prot; P82722; DF139_ARATH.
DR   UniProtKB/Swiss-Prot; Q3EA38; FDL48_ARATH.
DR   UniProtKB/Swiss-Prot; Q5PNU3; AMSH3_ARATH.
DR   UniProtKB/Swiss-Prot; Q5UBY2; FRS1_ARATH.
DR   UniProtKB/Swiss-Prot; Q6DBA5; NRPD4_ARATH.
DR   UniProtKB/Swiss-Prot; Q6DBN1; Y4845_ARATH.
DR   UniProtKB/Swiss-Prot; Q84LM4; AARE_ARATH.
DR   UniProtKB/Swiss-Prot; Q84W54; CSLA1_ARATH.
DR   UniProtKB/Swiss-Prot; Q8GWI5; Y4826_ARATH.
DR   UniProtKB/Swiss-Prot; Q8L7I1; Y4193_ARATH.
DR   UniProtKB/Swiss-Prot; Q8VZQ9; REM3_ARATH.
DR   UniProtKB/Swiss-Prot; Q9LDQ3; CRK35_ARATH.
DR   UniProtKB/Swiss-Prot; Q9M0C2; EGC1_ARATH.
DR   UniProtKB/Swiss-Prot; Q9M0U8; FBL21_ARATH.
DR   UniProtKB/Swiss-Prot; Q9S9V9; FBL23_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SCU8; BGA14_ARATH.
DR   UniProtKB/Swiss-Prot; Q9STJ7; BH118_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SUS1; WRK29_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SUX7; FB245_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SVM3; RLP49_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SVU7; BH056_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SVV9; AML3_ARATH.
DR   UniProtKB/Swiss-Prot; Q9SZ95; FB224_ARATH.
DR   UniProtKB/Swiss-Prot; Q9XEC1; Y4443_ARATH.
DR   UniProtKB/Swiss-Prot; Q9ZT94; POLR2_ARATH.
DR   UniProtKB/Swiss-Prot; Q9ZTA2; AOP2C_ARATH.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..18585056
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /ecotype="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   gap             1..1000
FT                   /estimated_length=1000
FT   gene            complement(1180..1536)
FT                   /locus_tag="AT4G00005"
FT   mRNA            complement(1180..1536)
FT                   /locus_tag="AT4G00005"
FT                   /product="PRA1 (Prenylated rab acceptor) family protein"
FT   CDS_pept        complement(1180..1536)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00005"
FT                   /product="PRA1 (Prenylated rab acceptor) family protein"
FT                   /note="PRA1 (Prenylated rab acceptor) family protein;
FT                   FUNCTIONS IN: molecular_function unknown; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: endomembrane
FT                   system; CONTAINS InterPro DOMAIN/s: Prenylated rab acceptor
FT                   PRA1 (InterPro:IPR004895); BEST Arabidopsis thaliana
FT                   protein match is: prenylated RAB acceptor 1.B5
FT                   (TAIR:AT5G01640.1); Has 274 Blast hits to 274 proteins in
FT                   24 species: Archae - 0; Bacteria - 0; Metazoa - 2; Fungi -
FT                   0; Plants - 272; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00005"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00005.1"
FT                   /db_xref="GOA:F4JGU4"
FT                   /db_xref="InterPro:IPR004895"
FT                   /db_xref="UniProtKB/TrEMBL:F4JGU4"
FT                   /protein_id="AEE81812.1"
FT                   /translation="MTRFWKNSSYFRVNYVCIIALIISFSLPAHPFSLILLLCLAASWL
FT                   FLYLFRPSDRPLILIGRSFSEYETLGGLILSTIAVIFFTSVGSVLISALMIGITTIPPL
FT                   VDEFFVLVEDSITW"
FT   gene            complement(2895..10504)
FT                   /gene="BRCA2(IV)"
FT                   /gene_synonym="BRCA2A"
FT                   /gene_synonym="BREAST CANCER 2 like 2A"
FT                   /gene_synonym="EDA20"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 20"
FT                   /gene_synonym="F6N15.14"
FT                   /gene_synonym="F6N15_14"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 43"
FT                   /gene_synonym="MEE43"
FT                   /locus_tag="AT4G00020"
FT                   /note="Ortholog of breast cancer susceptibility protein 2.
FT                   Essential at meiosis. Interacts with either AtRad51 or
FT                   AtDmc1 and ATDSS1(I). Involved in embryo sac development
FT                   and defense gene transcription during plant immune
FT                   responses."
FT   mRNA            complement(join(2895..3022,4127..4149,4227..4438,
FT                   4545..4749,4839..4901,4977..5119,5406..5588,5657..5855,
FT                   6605..6676,6760..6871,6975..7056,7144..7194,7294..7375,
FT                   7453..7638,7712..7813,7914..7947,8029..8155,8244..8368,
FT                   8463..9437,9686..9847,9982..10125,10211..10364))
FT                   /gene="BRCA2(IV)"
FT                   /gene_synonym="BRCA2A"
FT                   /gene_synonym="BREAST CANCER 2 like 2A"
FT                   /gene_synonym="EDA20"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 20"
FT                   /gene_synonym="F6N15.14"
FT                   /gene_synonym="F6N15_14"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 43"
FT                   /gene_synonym="MEE43"
FT                   /locus_tag="AT4G00020"
FT                   /product="BREAST CANCER 2 like 2A"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL004160.1,INSD:AV823859.1,INSD:EL994819.1,
FT                   INSD:EL329087.1,INSD:BP851639.1,INSD:ES020315.1"
FT   CDS_pept        complement(join(2895..3022,4127..4149,4227..4438,
FT                   4545..4749,4839..4901,4977..5119,5406..5588,5657..5855,
FT                   6605..6676,6760..6871,6975..7056,7144..7194,7294..7375,
FT                   7453..7638,7712..7813,7914..7947,8029..8155,8244..8368,
FT                   8463..9437,9686..9847,9982..10125,10211..10364))
FT                   /codon_start=1
FT                   /gene="BRCA2(IV)"
FT                   /gene_synonym="BRCA2A"
FT                   /gene_synonym="BREAST CANCER 2 like 2A"
FT                   /gene_synonym="EDA20"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 20"
FT                   /gene_synonym="F6N15.14"
FT                   /gene_synonym="F6N15_14"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 43"
FT                   /gene_synonym="MEE43"
FT                   /locus_tag="AT4G00020"
FT                   /product="BREAST CANCER 2 like 2A"
FT                   /note="BREAST CANCER 2 like 2A (BRCA2(IV)); FUNCTIONS IN:
FT                   single-stranded DNA binding; INVOLVED IN: meiosis, embryo
FT                   sac morphogenesis, embryo sac development, embryo
FT                   development ending in seed dormancy; LOCATED IN: nucleus;
FT                   CONTAINS InterPro DOMAIN/s: Nucleic acid-binding,
FT                   OB-fold-like (InterPro:IPR016027), DNA recombination/repair
FT                   protein BRCA2, helical domain (InterPro:IPR015252), DNA
FT                   recombination and repair protein, BRCA2
FT                   (InterPro:IPR011370), Breast cancer type 2 susceptibility
FT                   protein (InterPro:IPR015525), BRCA2,
FT                   oligonucleotide/oligosaccharide-binding 1
FT                   (InterPro:IPR015187), BRCA2 repeat (InterPro:IPR002093);
FT                   BEST Arabidopsis thaliana protein match is: BRCA2-like B
FT                   (TAIR:AT5G01630.1); Has 319 Blast hits to 211 proteins in
FT                   92 species: Archae - 0; Bacteria - 11; Metazoa - 140; Fungi
FT                   - 22; Plants - 61; Viruses - 0; Other Eukaryotes - 85
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00020"
FT                   /db_xref="GOA:F4JGU5"
FT                   /db_xref="InterPro:IPR002093"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR015252"
FT                   /db_xref="InterPro:IPR015525"
FT                   /db_xref="InterPro:IPR036315"
FT                   /db_xref="UniProtKB/TrEMBL:F4JGU5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL004160.1,INSD:AV823859.1,INSD:EL994819.1,
FT                   INSD:EL329087.1,INSD:BP851639.1,INSD:ES020315.1"
FT                   /protein_id="AEE81814.1"
FT                   /translation="MSTWQLFPDSSGDGFRWEVAGRILQSVSDSTPTKALESTAPLPSM
FT                   ADLLLQGCSKLIAREEAMPGEIPMFRTGLGKSVVLKESSIAKAKSILAEKVTYSDLRNT
FT                   NCSIPQMRQVDTAETLPMFRTASGKSVPLKESSIAKAMSILGSDKIIDSDNVLPRESGF
FT                   GVSNSLFQTASNKKVNVSSAGLARAKALLGLEEDDLNGFNHVNQSSSSSQQHGWSGLKT
FT                   HEEFDATVVKHHSGTPGQYEDYVSGKRSEVLNPSLKVPPTKFQTAGGKSLSVSAEALKR
FT                   ARNLLGDPELGSFFDDVAGGDQFFTPEKDERLSDIAINNGSANRGYIAHEEKTSNKHTP
FT                   NSFVSPLWSSSKQFSSVNLENLASGGNLIKKFDAAVDETDCALNATHGLSNNRSLASDM
FT                   AVNNSKVNGFIPRGRQPGRPADQPLVDITNRRDTAYAYNKQDSTQKKRLGKTVSVSPFK
FT                   RPRISSFKTPSKKHALQASSGLSVVSCDTLTSKKVLSTRYPEKSPRVYIKDFFGMHPTA
FT                   TTRMDYVPDHVRRIKSSNADKYVFCDESSSNKVGAETFLQMLAESEKVCDRSFEACMWI
FT                   VWKLACYDIYYPAKCRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILSGDAPASSMM
FT                   VLCISAINPKTDNDSQEAHCSDSCSNVKVELTDGWYSMNAALDVVLTKQLNAGKLFVGQ
FT                   KLRILGAGLSGWATPTSPLEAVISSTICLLLNINGTYRAHWADRLGFCKEIGVPLALNC
FT                   IKCNGGPVPKTLAGIKRIYPILYKERLGEKKSIVRSERIESRIIQLHNQRRSALVEGIM
FT                   CEYQRGINGVHSQNDTDSEEGAKIFKLLETAAEPEFLMAEMSPEQLRSFTTYKAKFEAA
FT                   QQMRKEKSVAETLEDAGLGERNVTPFMRIRLVGLTSLSYEGEHNPKEGIVTIWDPTERQ
FT                   RTELTEGKIYMMKGLVPINSDSEILYLHARGSSSRWQPLSPKDSENFQPFFNPRKPISL
FT                   SNLGEIPLSSEFDIAAYVVYVGNAYTDVLQKKQWVFVTDGSAQHSGEISNSLLAISFST
FT                   SFMDDSSVSHISHNLVGSVVGFCNLIKRAKDVTNEIWVAEAAENSVYFINAEAAYSSHL
FT                   KTSSAHIQTWAKLSSSKSVRSRRLPLSIIIRVLSIIGACPSGLNSPDKCRAFNFFWSHS
FT                   TLKLPHTAFQNRAMRVADKPP"
FT   mRNA            complement(join(3893..4172,4265..4438,4545..4749,
FT                   4839..4901,4977..5119,5406..5588,5657..5855,6605..6676,
FT                   6760..6871,6975..7056,7144..7194,7294..7375,7453..7638,
FT                   7712..7834,8001..8155,8244..8368,8463..9437,9686..9847,
FT                   9982..10125,10211..10504))
FT                   /gene="BRCA2(IV)"
FT                   /gene_synonym="BRCA2A"
FT                   /gene_synonym="BREAST CANCER 2 like 2A"
FT                   /gene_synonym="EDA20"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 20"
FT                   /gene_synonym="F6N15.14"
FT                   /gene_synonym="F6N15_14"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 43"
FT                   /gene_synonym="MEE43"
FT                   /locus_tag="AT4G00020"
FT                   /product="BREAST CANCER 2 like 2A"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES121393.1,INSD:AV810377.1,INSD:EL004160.1,
FT                   INSD:AV784930.1,INSD:BP851639.1,INSD:BP623328.1,
FT                   INSD:ES197799.1,INSD:AV823859.1,INSD:EL329087.1,
FT                   INSD:EL994819.1,INSD:EG467749.1,INSD:ES020315.1,
FT                   INSD:EH921439.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AJ488304.1"
FT   mRNA            complement(join(3893..4438,4545..4749,4839..4901,
FT                   4977..5119,5406..5588,5657..5855,6605..6676,6760..6871,
FT                   6975..7056,7144..7194,7294..7375,7453..7638,7712..7834,
FT                   8001..8155,8244..8368,8463..9437,9686..9847,9982..10125,
FT                   10211..10504))
FT                   /gene="BRCA2(IV)"
FT                   /gene_synonym="BRCA2A"
FT                   /gene_synonym="BREAST CANCER 2 like 2A"
FT                   /gene_synonym="EDA20"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 20"
FT                   /gene_synonym="F6N15.14"
FT                   /gene_synonym="F6N15_14"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 43"
FT                   /gene_synonym="MEE43"
FT                   /locus_tag="AT4G00020"
FT                   /product="BREAST CANCER 2 like 2A"
FT   mRNA            complement(join(3893..4172,4265..4749,4839..4901,
FT                   4977..5119,5406..5588,5657..5855,6605..6676,6760..6871,
FT                   6975..7056,7144..7194,7294..7375,7453..7638,7712..7834,
FT                   8001..8155,8244..8368,8463..9437,9686..9847,9982..10125,
FT                   10211..10504))
FT                   /gene="BRCA2(IV)"
FT                   /gene_synonym="BRCA2A"
FT                   /gene_synonym="BREAST CANCER 2 like 2A"
FT                   /gene_synonym="EDA20"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 20"
FT                   /gene_synonym="F6N15.14"
FT                   /gene_synonym="F6N15_14"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 43"
FT                   /gene_synonym="MEE43"
FT                   /locus_tag="AT4G00020"
FT                   /product="BREAST CANCER 2 like 2A"
FT   mRNA            complement(join(3893..4172,4265..4749,4839..5119,
FT                   5406..5588,5657..5855,6605..6676,6760..6871,6975..7056,
FT                   7144..7194,7294..7375,7453..7638,7712..7834,8001..8155,
FT                   8244..8368,8463..9437,9686..9847,9982..10125,10211..10504))
FT                   /gene="BRCA2(IV)"
FT                   /gene_synonym="BRCA2A"
FT                   /gene_synonym="BREAST CANCER 2 like 2A"
FT                   /gene_synonym="EDA20"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 20"
FT                   /gene_synonym="F6N15.14"
FT                   /gene_synonym="F6N15_14"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 43"
FT                   /gene_synonym="MEE43"
FT                   /locus_tag="AT4G00020"
FT                   /product="BREAST CANCER 2 like 2A"
FT   CDS_pept        complement(join(4107..4172,4265..4438,4545..4749,
FT                   4839..4901,4977..5119,5406..5588,5657..5855,6605..6676,
FT                   6760..6871,6975..7056,7144..7194,7294..7375,7453..7638,
FT                   7712..7834,8001..8155,8244..8368,8463..9437,9686..9847,
FT                   9982..10125,10211..10364))
FT                   /codon_start=1
FT                   /gene="BRCA2(IV)"
FT                   /gene_synonym="BRCA2A"
FT                   /gene_synonym="BREAST CANCER 2 like 2A"
FT                   /gene_synonym="EDA20"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 20"
FT                   /gene_synonym="F6N15.14"
FT                   /gene_synonym="F6N15_14"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 43"
FT                   /gene_synonym="MEE43"
FT                   /locus_tag="AT4G00020"
FT                   /product="BREAST CANCER 2 like 2A"
FT                   /note="BREAST CANCER 2 like 2A (BRCA2(IV)); FUNCTIONS IN:
FT                   single-stranded DNA binding; INVOLVED IN: meiosis, embryo
FT                   sac morphogenesis, embryo sac development, embryo
FT                   development ending in seed dormancy; LOCATED IN: nucleus;
FT                   CONTAINS InterPro DOMAIN/s: Nucleic acid-binding,
FT                   OB-fold-like (InterPro:IPR016027), DNA recombination/repair
FT                   protein BRCA2, helical domain (InterPro:IPR015252), DNA
FT                   recombination and repair protein, BRCA2
FT                   (InterPro:IPR011370), BRCA2,
FT                   oligonucleotide/oligosaccharide-binding 1
FT                   (InterPro:IPR015187), Breast cancer type 2 susceptibility
FT                   protein (InterPro:IPR015525), BRCA2 repeat
FT                   (InterPro:IPR002093); BEST Arabidopsis thaliana protein
FT                   match is: BRCA2-like B (TAIR:AT5G01630.1); Has 30201 Blast
FT                   hits to 17322 proteins in 780 species: Archae - 12;
FT                   Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants -
FT                   5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00020"
FT                   /db_xref="GOA:Q7Y1C5"
FT                   /db_xref="InterPro:IPR002093"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR015252"
FT                   /db_xref="InterPro:IPR015525"
FT                   /db_xref="InterPro:IPR036315"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Y1C5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES121393.1,INSD:AV810377.1,INSD:EL004160.1,
FT                   INSD:AV784930.1,INSD:BP851639.1,INSD:BP623328.1,
FT                   INSD:ES197799.1,INSD:AV823859.1,INSD:EL329087.1,
FT                   INSD:EL994819.1,INSD:EG467749.1,INSD:ES020315.1,
FT                   INSD:EH921439.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AJ488304.1"
FT                   /protein_id="AEE81813.1"
FT                   /translation="MSTWQLFPDSSGDGFRWEVAGRILQSVSDSTPTKALESTAPLPSM
FT                   ADLLLQGCSKLIAREEAMPGEIPMFRTGLGKSVVLKESSIAKAKSILAEKVTYSDLRNT
FT                   NCSIPQMRQVDTAETLPMFRTASGKSVPLKESSIAKAMSILGSDKIIDSDNVLPRESGF
FT                   GVSNSLFQTASNKKVNVSSAGLARAKALLGLEEDDLNGFNHVNQSSSSSQQHGWSGLKT
FT                   HEEFDATVVKHHSGTPGQYEDYVSGKRSEVLNPSLKVPPTKFQTAGGKSLSVSAEALKR
FT                   ARNLLGDPELGSFFDDVAGGDQFFTPEKDERLSDIAINNGSANRGYIAHEEKTSNKHTP
FT                   NSFVSPLWSSSKQFSSVNLENLASGGNLIKKFDAAVDETDCALNATHGLSNNRSLASDM
FT                   AVNNSKVNGFIPRGRQPGRPADQPLVDITNRRDTAYAYNKQDSTQKKRLGKTVSVSPFK
FT                   RPRISSFKTPSKKHALQASSGLSVVSCDTLTSKKVLSTRYPEKSPRVYIKDFFGMHPTA
FT                   TTRMDYVPDHVRRIKSSNADKYVFCDESSSNKVGAETFLQMLAESGASLQHASRKWVTN
FT                   HYRWIVWKLACYDIYYPAKCRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILSGDAP
FT                   ASSMMVLCISAINPKTDNDSQEAHCSDSCSNVKVELTDGWYSMNAALDVVLTKQLNAGK
FT                   LFVGQKLRILGAGLSGWATPTSPLEAVISSTICLLLNINGTYRAHWADRLGFCKEIGVP
FT                   LALNCIKCNGGPVPKTLAGIKRIYPILYKERLGEKKSIVRSERIESRIIQLHNQRRSAL
FT                   VEGIMCEYQRGINGVHSQNDTDSEEGAKIFKLLETAAEPEFLMAEMSPEQLRSFTTYKA
FT                   KFEAAQQMRKEKSVAETLEDAGLGERNVTPFMRIRLVGLTSLSYEGEHNPKEGIVTIWD
FT                   PTERQRTELTEGKIYMMKGLVPINSDSEILYLHARGSSSRWQPLSPKDSENFQPFFNPR
FT                   KPISLSNLGEIPLSSEFDIAAYVVYVGNAYTDVLQKKQWVFVTDGSAQHSGEISNSLLA
FT                   ISFSTSFMDDSSVSHISHNLVGSVVGFCNLIKRAKDVTNEIWVAEAAENSVYFINAEAA
FT                   YSSHLKTSSAHIQTWAKLSSSKSVIHELRQRVLSIIGACKSPSC"
FT   CDS_pept        complement(join(4199..4438,4545..4749,4839..4901,
FT                   4977..5119,5406..5588,5657..5855,6605..6676,6760..6871,
FT                   6975..7056,7144..7194,7294..7375,7453..7638,7712..7834,
FT                   8001..8155,8244..8368,8463..9437,9686..9847,9982..10125,
FT                   10211..10364))
FT                   /codon_start=1
FT                   /gene="BRCA2(IV)"
FT                   /gene_synonym="BRCA2A"
FT                   /gene_synonym="BREAST CANCER 2 like 2A"
FT                   /gene_synonym="EDA20"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 20"
FT                   /gene_synonym="F6N15.14"
FT                   /gene_synonym="F6N15_14"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 43"
FT                   /gene_synonym="MEE43"
FT                   /locus_tag="AT4G00020"
FT                   /product="BREAST CANCER 2 like 2A"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00020"
FT                   /db_xref="GOA:A0A1P8B5L3"
FT                   /db_xref="InterPro:IPR002093"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR015252"
FT                   /db_xref="InterPro:IPR015525"
FT                   /db_xref="InterPro:IPR036315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B5L3"
FT                   /protein_id="ANM66870.1"
FT                   /translation="MSTWQLFPDSSGDGFRWEVAGRILQSVSDSTPTKALESTAPLPSM
FT                   ADLLLQGCSKLIAREEAMPGEIPMFRTGLGKSVVLKESSIAKAKSILAEKVTYSDLRNT
FT                   NCSIPQMRQVDTAETLPMFRTASGKSVPLKESSIAKAMSILGSDKIIDSDNVLPRESGF
FT                   GVSNSLFQTASNKKVNVSSAGLARAKALLGLEEDDLNGFNHVNQSSSSSQQHGWSGLKT
FT                   HEEFDATVVKHHSGTPGQYEDYVSGKRSEVLNPSLKVPPTKFQTAGGKSLSVSAEALKR
FT                   ARNLLGDPELGSFFDDVAGGDQFFTPEKDERLSDIAINNGSANRGYIAHEEKTSNKHTP
FT                   NSFVSPLWSSSKQFSSVNLENLASGGNLIKKFDAAVDETDCALNATHGLSNNRSLASDM
FT                   AVNNSKVNGFIPRGRQPGRPADQPLVDITNRRDTAYAYNKQDSTQKKRLGKTVSVSPFK
FT                   RPRISSFKTPSKKHALQASSGLSVVSCDTLTSKKVLSTRYPEKSPRVYIKDFFGMHPTA
FT                   TTRMDYVPDHVRRIKSSNADKYVFCDESSSNKVGAETFLQMLAESGASLQHASRKWVTN
FT                   HYRWIVWKLACYDIYYPAKCRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILSGDAP
FT                   ASSMMVLCISAINPKTDNDSQEAHCSDSCSNVKVELTDGWYSMNAALDVVLTKQLNAGK
FT                   LFVGQKLRILGAGLSGWATPTSPLEAVISSTICLLLNINGTYRAHWADRLGFCKEIGVP
FT                   LALNCIKCNGGPVPKTLAGIKRIYPILYKERLGEKKSIVRSERIESRIIQLHNQRRSAL
FT                   VEGIMCEYQRGINGVHSQNDTDSEEGAKIFKLLETAAEPEFLMAEMSPEQLRSFTTYKA
FT                   KFEAAQQMRKEKSVAETLEDAGLGERNVTPFMRIRLVGLTSLSYEGEHNPKEGIVTIWD
FT                   PTERQRTELTEGKIYMMKGLVPINSDSEILYLHARGSSSRWQPLSPKDSENFQPFFNPR
FT                   KPISLSNLGEIPLSSEFDIAAYVVYVGNAYTDVLQKKQWVFVTDGSAQHSGEISNSLLA
FT                   ISFSTSFMDDSSVSHISHNLVGSVVGFCNLIKRAKDVTNEIWVAEAAENSVYFINAEAA
FT                   YSSHLKTSSAHIQTWAKLSSSKSVRSRRLPLSIIIRFKKIGLLY"
FT   CDS_pept        complement(join(4476..4749,4839..4901,4977..5119,
FT                   5406..5588,5657..5855,6605..6676,6760..6871,6975..7056,
FT                   7144..7194,7294..7375,7453..7638,7712..7834,8001..8155,
FT                   8244..8368,8463..9437,9686..9847,9982..10125,10211..10364))
FT                   /codon_start=1
FT                   /gene="BRCA2(IV)"
FT                   /gene_synonym="BRCA2A"
FT                   /gene_synonym="BREAST CANCER 2 like 2A"
FT                   /gene_synonym="EDA20"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 20"
FT                   /gene_synonym="F6N15.14"
FT                   /gene_synonym="F6N15_14"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 43"
FT                   /gene_synonym="MEE43"
FT                   /locus_tag="AT4G00020"
FT                   /product="BREAST CANCER 2 like 2A"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00020"
FT                   /db_xref="GOA:A0A1P8B5K2"
FT                   /db_xref="InterPro:IPR002093"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR015252"
FT                   /db_xref="InterPro:IPR015525"
FT                   /db_xref="InterPro:IPR036315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B5K2"
FT                   /protein_id="ANM66868.1"
FT                   /translation="MSTWQLFPDSSGDGFRWEVAGRILQSVSDSTPTKALESTAPLPSM
FT                   ADLLLQGCSKLIAREEAMPGEIPMFRTGLGKSVVLKESSIAKAKSILAEKVTYSDLRNT
FT                   NCSIPQMRQVDTAETLPMFRTASGKSVPLKESSIAKAMSILGSDKIIDSDNVLPRESGF
FT                   GVSNSLFQTASNKKVNVSSAGLARAKALLGLEEDDLNGFNHVNQSSSSSQQHGWSGLKT
FT                   HEEFDATVVKHHSGTPGQYEDYVSGKRSEVLNPSLKVPPTKFQTAGGKSLSVSAEALKR
FT                   ARNLLGDPELGSFFDDVAGGDQFFTPEKDERLSDIAINNGSANRGYIAHEEKTSNKHTP
FT                   NSFVSPLWSSSKQFSSVNLENLASGGNLIKKFDAAVDETDCALNATHGLSNNRSLASDM
FT                   AVNNSKVNGFIPRGRQPGRPADQPLVDITNRRDTAYAYNKQDSTQKKRLGKTVSVSPFK
FT                   RPRISSFKTPSKKHALQASSGLSVVSCDTLTSKKVLSTRYPEKSPRVYIKDFFGMHPTA
FT                   TTRMDYVPDHVRRIKSSNADKYVFCDESSSNKVGAETFLQMLAESGASLQHASRKWVTN
FT                   HYRWIVWKLACYDIYYPAKCRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILSGDAP
FT                   ASSMMVLCISAINPKTDNDSQEAHCSDSCSNVKVELTDGWYSMNAALDVVLTKQLNAGK
FT                   LFVGQKLRILGAGLSGWATPTSPLEAVISSTICLLLNINGTYRAHWADRLGFCKEIGVP
FT                   LALNCIKCNGGPVPKTLAGIKRIYPILYKERLGEKKSIVRSERIESRIIQLHNQRRSAL
FT                   VEGIMCEYQRGINGVHSQNDTDSEEGAKIFKLLETAAEPEFLMAEMSPEQLRSFTTYKA
FT                   KFEAAQQMRKEKSVAETLEDAGLGERNVTPFMRIRLVGLTSLSYEGEHNPKEGIVTIWD
FT                   PTERQRTELTEGKIYMMKGLVPINSDSEILYLHARGSSSRWQPLSPKDSENFQPFFNPR
FT                   KPISLSNLGEIPLSSEFDIAAYVVYVGNAYTDVLQKKQWVFVTDGSAQHSGEISNSLLA
FT                   ISFSTSFMDDSSVSHISHNLVGSVVCTNSNLCLVLHRENMHQEIKF"
FT   CDS_pept        complement(join(4973..5119,5406..5588,5657..5855,
FT                   6605..6676,6760..6871,6975..7056,7144..7194,7294..7375,
FT                   7453..7638,7712..7834,8001..8155,8244..8368,8463..9437,
FT                   9686..9847,9982..10125,10211..10364))
FT                   /codon_start=1
FT                   /gene="BRCA2(IV)"
FT                   /gene_synonym="BRCA2A"
FT                   /gene_synonym="BREAST CANCER 2 like 2A"
FT                   /gene_synonym="EDA20"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 20"
FT                   /gene_synonym="F6N15.14"
FT                   /gene_synonym="F6N15_14"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 43"
FT                   /gene_synonym="MEE43"
FT                   /locus_tag="AT4G00020"
FT                   /product="BREAST CANCER 2 like 2A"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00020"
FT                   /db_xref="GOA:A0A1P8B5K0"
FT                   /db_xref="InterPro:IPR002093"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR015252"
FT                   /db_xref="InterPro:IPR015525"
FT                   /db_xref="InterPro:IPR036315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B5K0"
FT                   /protein_id="ANM66869.1"
FT                   /translation="MSTWQLFPDSSGDGFRWEVAGRILQSVSDSTPTKALESTAPLPSM
FT                   ADLLLQGCSKLIAREEAMPGEIPMFRTGLGKSVVLKESSIAKAKSILAEKVTYSDLRNT
FT                   NCSIPQMRQVDTAETLPMFRTASGKSVPLKESSIAKAMSILGSDKIIDSDNVLPRESGF
FT                   GVSNSLFQTASNKKVNVSSAGLARAKALLGLEEDDLNGFNHVNQSSSSSQQHGWSGLKT
FT                   HEEFDATVVKHHSGTPGQYEDYVSGKRSEVLNPSLKVPPTKFQTAGGKSLSVSAEALKR
FT                   ARNLLGDPELGSFFDDVAGGDQFFTPEKDERLSDIAINNGSANRGYIAHEEKTSNKHTP
FT                   NSFVSPLWSSSKQFSSVNLENLASGGNLIKKFDAAVDETDCALNATHGLSNNRSLASDM
FT                   AVNNSKVNGFIPRGRQPGRPADQPLVDITNRRDTAYAYNKQDSTQKKRLGKTVSVSPFK
FT                   RPRISSFKTPSKKHALQASSGLSVVSCDTLTSKKVLSTRYPEKSPRVYIKDFFGMHPTA
FT                   TTRMDYVPDHVRRIKSSNADKYVFCDESSSNKVGAETFLQMLAESGASLQHASRKWVTN
FT                   HYRWIVWKLACYDIYYPAKCRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILSGDAP
FT                   ASSMMVLCISAINPKTDNDSQEAHCSDSCSNVKVELTDGWYSMNAALDVVLTKQLNAGK
FT                   LFVGQKLRILGAGLSGWATPTSPLEAVISSTICLLLNINGTYRAHWADRLGFCKEIGVP
FT                   LALNCIKCNGGPVPKTLAGIKRIYPILYKERLGEKKSIVRSERIESRIIQLHNQRRSAL
FT                   VEGIMCEYQRGINGVHSQNDTDSEEGAKIFKLLETAAEPEFLMAEMSPEQLRSFTTYKA
FT                   KFEAAQQMRKEKSVAETLEDAGLGERNVTPFMRIRLVGLTSLSYEGEHNPKEGIVTIWD
FT                   PTERQRTELTEGKIYMMKGLVPINSDSEILYLHARGSSSRWQPLSPKDSENFQ"
FT   gene            complement(10815..13359)
FT                   /gene="SD3"
FT                   /gene_synonym="SEGREGATION DISTORTION 3"
FT                   /locus_tag="AT4G00026"
FT                   /note="Encodes SD3 (Segregation Distortion 3), a protein
FT                   with high similarity to yeast translocase on the inner
FT                   mitochondrial membrane 21 (TIM21). sd3 mutants show
FT                   seedling-lethal phenotype in light-grown seedlings and
FT                   shorter hypocotyls in dark-grown seedlings. SD3
FT                   overexpression plants show increase in cell number and cell
FT                   size, as well as elevated ATP level."
FT   mRNA            complement(join(10815..11792,11897..12016,12131..12179,
FT                   12262..12440,12573..12706,12791..12809,12924..12959,
FT                   13172..13359))
FT                   /gene="SD3"
FT                   /gene_synonym="SEGREGATION DISTORTION 3"
FT                   /locus_tag="AT4G00026"
FT                   /product="import inner membrane translocase subunit"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG455231.1,INSD:EG500700.1,INSD:EG500682.1,
FT                   INSD:EG462810.1,INSD:EG455225.1,INSD:EG500683.1,
FT                   INSD:EG462794.1,INSD:EG455227.1,INSD:EG455221.1,
FT                   INSD:EG500688.1,INSD:EG462793.1,INSD:BP858089.1,
FT                   INSD:AU228083.1,INSD:EG455234.1,INSD:EG455222.1,
FT                   INSD:ES029335.1,INSD:EG500678.1,INSD:ES039820.1,
FT                   INSD:EG455232.1,INSD:EG462797.1,INSD:EG462801.1,
FT                   INSD:EG500684.1,INSD:EG462804.1,INSD:EG455229.1,
FT                   INSD:EH982279.1,INSD:EG500696.1,INSD:EG500680.1,
FT                   INSD:EG500690.1,INSD:EG500694.1,INSD:EG462800.1,
FT                   INSD:EG500691.1,INSD:EG462795.1,INSD:EG500689.1,
FT                   INSD:EG455220.1,INSD:EG455236.1,INSD:EG462808.1,
FT                   INSD:EG462809.1,INSD:EG455218.1,INSD:ES072181.1,
FT                   INSD:EG500685.1,INSD:ES213462.1,INSD:EG455217.1,
FT                   INSD:EG462798.1,INSD:EH930594.1,INSD:EG462792.1,
FT                   INSD:ES033391.1,INSD:EG455235.1,INSD:EG499762.1,
FT                   INSD:EG500701.1,INSD:BP623114.1,INSD:ES182843.1,
FT                   INSD:EG500679.1,INSD:EG500686.1,INSD:AU237063.1,
FT                   INSD:ES174064.1,INSD:EG500681.1,INSD:ES104684.1,
FT                   INSD:ES185693.1,INSD:EG455224.1,INSD:EG455237.1,
FT                   INSD:EG462791.1,INSD:EG462806.1,INSD:EG500695.1,
FT                   INSD:ES022205.1,INSD:EG455226.1,INSD:EG500677.1,
FT                   INSD:EG462805.1,INSD:EG455228.1,INSD:EG500675.1,
FT                   INSD:EG462811.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ487573.1,INSD:EF182880.1,INSD:AK228629.1"
FT   CDS_pept        complement(join(11634..11792,11897..12016,12131..12179,
FT                   12262..12440,12573..12706,12791..12809,12924..12959,
FT                   13172..13285))
FT                   /codon_start=1
FT                   /gene="SD3"
FT                   /gene_synonym="SEGREGATION DISTORTION 3"
FT                   /locus_tag="AT4G00026"
FT                   /product="import inner membrane translocase subunit"
FT                   /note="FUNCTIONS IN: molecular_function unknown; INVOLVED
FT                   IN: biological_process unknown; LOCATED IN: chloroplast;
FT                   EXPRESSED IN: cultured cell; CONTAINS InterPro DOMAIN/s:
FT                   Mitochondrial inner membrane translocase complex, subunit
FT                   Tim21 (InterPro:IPR013261); Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00026"
FT                   /db_xref="GOA:Q1G3L1"
FT                   /db_xref="InterPro:IPR013261"
FT                   /db_xref="InterPro:IPR038552"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1G3L1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG455231.1,INSD:EG500700.1,INSD:EG500682.1,
FT                   INSD:EG462810.1,INSD:EG455225.1,INSD:EG500683.1,
FT                   INSD:EG462794.1,INSD:EG455227.1,INSD:EG455221.1,
FT                   INSD:EG500688.1,INSD:EG462793.1,INSD:BP858089.1,
FT                   INSD:AU228083.1,INSD:EG455234.1,INSD:EG455222.1,
FT                   INSD:ES029335.1,INSD:EG500678.1,INSD:ES039820.1,
FT                   INSD:EG455232.1,INSD:EG462797.1,INSD:EG462801.1,
FT                   INSD:EG500684.1,INSD:EG462804.1,INSD:EG455229.1,
FT                   INSD:EH982279.1,INSD:EG500696.1,INSD:EG500680.1,
FT                   INSD:EG500690.1,INSD:EG500694.1,INSD:EG462800.1,
FT                   INSD:EG500691.1,INSD:EG462795.1,INSD:EG500689.1,
FT                   INSD:EG455220.1,INSD:EG455236.1,INSD:EG462808.1,
FT                   INSD:EG462809.1,INSD:EG455218.1,INSD:ES072181.1,
FT                   INSD:EG500685.1,INSD:ES213462.1,INSD:EG455217.1,
FT                   INSD:EG462798.1,INSD:EH930594.1,INSD:EG462792.1,
FT                   INSD:ES033391.1,INSD:EG455235.1,INSD:EG499762.1,
FT                   INSD:EG500701.1,INSD:BP623114.1,INSD:ES182843.1,
FT                   INSD:EG500679.1,INSD:EG500686.1,INSD:AU237063.1,
FT                   INSD:ES174064.1,INSD:EG500681.1,INSD:ES104684.1,
FT                   INSD:ES185693.1,INSD:EG455224.1,INSD:EG455237.1,
FT                   INSD:EG462791.1,INSD:EG462806.1,INSD:EG500695.1,
FT                   INSD:ES022205.1,INSD:EG455226.1,INSD:EG500677.1,
FT                   INSD:EG462805.1,INSD:EG455228.1,INSD:EG500675.1,
FT                   INSD:EG462811.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ487573.1,INSD:EF182880.1,INSD:AK228629.1"
FT                   /protein_id="AEE81815.1"
FT                   /translation="MMMMNLLRRSAIAIGRQSKSKLASFSSATQPCSGIPKSSKRVFSN
FT                   SFLSKDSTGANGLLFRFRNPQASICTEARPKNINSSYFTRSFASRTSKEPGNQQNKAKK
FT                   EVTTVEDPFDSPTYHIPEKPVTFTEGASYSLVILAGLGVAGAAGYGVFKELIFQPKEYK
FT                   VFDKALKRIQDDGQVRVRIGSPIKGYGQETRNRAARQRIPNRVFTDEDGVEHVEVNFYI
FT                   RGPQGAGKVYTEMFKDKAEKEWKYTYLIVEILTPSPAKLMLESYLPA"
FT   gene            13527..14413
FT                   /gene_synonym="F6N15.13"
FT                   /gene_synonym="F6N15_13"
FT                   /locus_tag="AT4G00030"
FT   mRNA            join(13527..14028,14114..14179,14258..14413)
FT                   /gene_synonym="F6N15.13"
FT                   /gene_synonym="F6N15_13"
FT                   /locus_tag="AT4G00030"
FT                   /product="Plastid-lipid associated protein PAP / fibrillin
FT                   family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL282646.1,INSD:EH989735.1,INSD:BP806678.1,
FT                   INSD:EG424671.1,INSD:EL313598.1,INSD:BP561807.2,
FT                   INSD:BX836890.1,INSD:CF652848.1,INSD:EL206052.1,
FT                   INSD:EH994596.1,INSD:AV800092.1,INSD:AV822745.1,
FT                   INSD:EL071262.1,INSD:EG424672.1,INSD:EL090350.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY054226.1,INSD:BT015452.1,INSD:BX829061.1,
FT                   INSD:BX829258.1,INSD:AY074558.1,INSD:BX828731.1,
FT                   INSD:BT001993.1,INSD:BX841609.1"
FT   CDS_pept        join(13565..14028,14114..14179,14258..14366)
FT                   /codon_start=1
FT                   /gene_synonym="F6N15.13"
FT                   /gene_synonym="F6N15_13"
FT                   /locus_tag="AT4G00030"
FT                   /product="Plastid-lipid associated protein PAP / fibrillin
FT                   family protein"
FT                   /note="Plastid-lipid associated protein PAP / fibrillin
FT                   family protein; FUNCTIONS IN: structural molecule activity;
FT                   INVOLVED IN: biological_process unknown; LOCATED IN:
FT                   chloroplast; EXPRESSED IN: 17 plant structures; EXPRESSED
FT                   DURING: 9 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Plastid lipid-associated protein/fibrillin
FT                   (InterPro:IPR006843); Has 184 Blast hits to 184 proteins in
FT                   36 species: Archae - 0; Bacteria - 11; Metazoa - 0; Fungi -
FT                   0; Plants - 167; Viruses - 0; Other Eukaryotes - 6 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:O81304"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="InterPro:IPR039633"
FT                   /db_xref="UniProtKB/Swiss-Prot:O81304"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL282646.1,INSD:EH989735.1,INSD:BP806678.1,
FT                   INSD:EG424671.1,INSD:EL313598.1,INSD:BP561807.2,
FT                   INSD:BX836890.1,INSD:CF652848.1,INSD:EL206052.1,
FT                   INSD:EH994596.1,INSD:AV800092.1,INSD:AV822745.1,
FT                   INSD:EL071262.1,INSD:EG424672.1,INSD:EL090350.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY054226.1,INSD:BT015452.1,INSD:BX829061.1,
FT                   INSD:BX829258.1,INSD:AY074558.1,INSD:BX828731.1,
FT                   INSD:BT001993.1,INSD:BX841609.1"
FT                   /protein_id="AEE81816.1"
FT                   /translation="MALALSLSACSPPLRRTRRAGFRTSCSIFANPAQRAKRKLLELIS
FT                   EEDRGLRTQKDPKKRDEIVNAIESMTVIGRSSITTDDSLSATWRLLWTTEKEQLFIIEK
FT                   AGLFGTTAGDVLQVIDVNKRILNNVITFPPDGVFFVRSDIDIASPQRVNFRFNSAVLRG
FT                   KNWELPLPPFGKGWFENVYMDGEIRVAKDIRGDYLIVDRAPYNWTESFV"
FT   gene            14627..16079
FT                   /gene_synonym="F6N15.12"
FT                   /gene_synonym="F6N15_12"
FT                   /locus_tag="AT4G00040"
FT   mRNA            join(14627..14833,14921..16079)
FT                   /gene_synonym="F6N15.12"
FT                   /gene_synonym="F6N15_12"
FT                   /locus_tag="AT4G00040"
FT                   /product="Chalcone and stilbene synthase family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR346793.1,INSD:DR346809.1,INSD:DR346791.1,
FT                   INSD:BP582159.1,INSD:BP563826.1,INSD:BP565380.1,
FT                   INSD:DR346789.1,INSD:BP563539.1,INSD:BP814264.1,
FT                   INSD:DR346798.1,INSD:DR346802.1,INSD:DR346812.1,
FT                   INSD:DR346801.1,INSD:BP575535.1,INSD:DR346815.1,
FT                   INSD:DR379544.1,INSD:BP608048.1,INSD:BP581255.1,
FT                   INSD:BP569999.1,INSD:BP568448.1,INSD:DR346808.1,
FT                   INSD:AV783574.1,INSD:DR346795.1,INSD:DR346794.1,
FT                   INSD:DR346800.1,INSD:BP578291.1,INSD:BP598535.1,
FT                   INSD:DR346806.1,INSD:BP827388.1,INSD:BP820553.1,
FT                   INSD:DR346796.1,INSD:DR346797.1,INSD:BP658898.1,
FT                   INSD:DR346790.1,INSD:DR346805.1,INSD:BP652962.1,
FT                   INSD:BP566994.1,INSD:DR346811.1,INSD:DR346810.1,
FT                   INSD:BP784392.1,INSD:BP664061.1,INSD:DR346807.1,
FT                   INSD:BP820085.1,INSD:DR346804.1,INSD:EG424672.1,
FT                   INSD:BX834145.1,INSD:DR346792.1,INSD:DR346803.1,
FT                   INSD:BP623387.1,INSD:ES163831.1,INSD:DR373463.1,
FT                   INSD:DR346814.1,INSD:BP831124.1,INSD:DR346799.1,
FT                   INSD:BP645093.1,INSD:BP618526.1,INSD:DR346788.1,
FT                   INSD:DR346813.1,INSD:BP829411.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT008463.1,INSD:BT001993.1,INSD:AY086158.1"
FT   CDS_pept        join(14653..14833,14921..15897)
FT                   /codon_start=1
FT                   /gene_synonym="F6N15.12"
FT                   /gene_synonym="F6N15_12"
FT                   /locus_tag="AT4G00040"
FT                   /product="Chalcone and stilbene synthase family protein"
FT                   /note="Chalcone and stilbene synthase family protein;
FT                   FUNCTIONS IN: transferase activity, transferring acyl
FT                   groups other than amino-acyl groups, catalytic activity,
FT                   acyltransferase activity; INVOLVED IN: phenylpropanoid
FT                   biosynthetic process, biosynthetic process, metabolic
FT                   process; EXPRESSED IN: 21 plant structures; EXPRESSED
FT                   DURING: 12 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Chalcone/stilbene synthase, N-terminal
FT                   (InterPro:IPR001099), Thiolase-like (InterPro:IPR016039),
FT                   Polyketide synthase, type III (InterPro:IPR011141),
FT                   Thiolase-like, subgroup (InterPro:IPR016038),
FT                   Chalcone/stilbene synthase, C-terminal
FT                   (InterPro:IPR012328); BEST Arabidopsis thaliana protein
FT                   match is: Chalcone and stilbene synthase family protein
FT                   (TAIR:AT1G02050.1); Has 5683 Blast hits to 5679 proteins in
FT                   1391 species: Archae - 0; Bacteria - 1882; Metazoa - 0;
FT                   Fungi - 67; Plants - 3528; Viruses - 0; Other Eukaryotes -
FT                   206 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00040"
FT                   /db_xref="GOA:O81305"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:O81305"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR346793.1,INSD:DR346809.1,INSD:DR346791.1,
FT                   INSD:BP582159.1,INSD:BP563826.1,INSD:BP565380.1,
FT                   INSD:DR346789.1,INSD:BP563539.1,INSD:BP814264.1,
FT                   INSD:DR346798.1,INSD:DR346802.1,INSD:DR346812.1,
FT                   INSD:DR346801.1,INSD:BP575535.1,INSD:DR346815.1,
FT                   INSD:DR379544.1,INSD:BP608048.1,INSD:BP581255.1,
FT                   INSD:BP569999.1,INSD:BP568448.1,INSD:DR346808.1,
FT                   INSD:AV783574.1,INSD:DR346795.1,INSD:DR346794.1,
FT                   INSD:DR346800.1,INSD:BP578291.1,INSD:BP598535.1,
FT                   INSD:DR346806.1,INSD:BP827388.1,INSD:BP820553.1,
FT                   INSD:DR346796.1,INSD:DR346797.1,INSD:BP658898.1,
FT                   INSD:DR346790.1,INSD:DR346805.1,INSD:BP652962.1,
FT                   INSD:BP566994.1,INSD:DR346811.1,INSD:DR346810.1,
FT                   INSD:BP784392.1,INSD:BP664061.1,INSD:DR346807.1,
FT                   INSD:BP820085.1,INSD:DR346804.1,INSD:EG424672.1,
FT                   INSD:BX834145.1,INSD:DR346792.1,INSD:DR346803.1,
FT                   INSD:BP623387.1,INSD:ES163831.1,INSD:DR373463.1,
FT                   INSD:DR346814.1,INSD:BP831124.1,INSD:DR346799.1,
FT                   INSD:BP645093.1,INSD:BP618526.1,INSD:DR346788.1,
FT                   INSD:DR346813.1,INSD:BP829411.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT008463.1,INSD:BT001993.1,INSD:AY086158.1"
FT                   /protein_id="AEE81817.1"
FT                   /translation="MLVSARVEKQKRVAYQGKATVLALGKALPSNVVSQENLVEEYLRE
FT                   IKCDNLSIKDKLQHLCKSTTVKTRYTVMSRETLHKYPELATEGSPTIKQRLEIANDAVV
FT                   QMAYEASLVCIKEWGRAVEDITHLVYVSSSEFRLPGGDLYLSAQLGLSNEVQRVMLYFL
FT                   GCYGGLSGLRVAKDIAENNPGSRVLLTTSETTVLGFRPPNKARPYNLVGAALFGDGAAA
FT                   LIIGADPTESESPFMELHCAMQQFLPQTQGVIDGRLSEEGITFKLGRDLPQKIEDNVEE
FT                   FCKKLVAKAGSGALELNDLFWAVHPGGPAILSGLETKLKLKPEKLECSRRALMDYGNVS
FT                   SNTIFYIMDKVRDELEKKGTEGEEWGLGLAFGPGITFEGFLMRNL"
FT   gene            17639..20183
FT                   /gene="UNE10"
FT                   /gene_synonym="F6N15.11"
FT                   /gene_synonym="F6N15_11"
FT                   /gene_synonym="unfertilized embryo sac 10"
FT                   /locus_tag="AT4G00050"
FT   mRNA            join(17639..17954,18030..18513,18600..18692,18805..18870,
FT                   19296..19673,19762..20183)
FT                   /gene="UNE10"
FT                   /gene_synonym="F6N15.11"
FT                   /gene_synonym="F6N15_11"
FT                   /gene_synonym="unfertilized embryo sac 10"
FT                   /locus_tag="AT4G00050"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH900952.1,INSD:AU229168.1,INSD:EL255918.1,
FT                   INSD:DR749599.1,INSD:AU238037.1,INSD:DR350538.1,
FT                   INSD:EL136627.1,INSD:EH851853.1,INSD:BP795611.1,
FT                   INSD:DR350539.1,INSD:EL279911.1,INSD:EL252560.1,
FT                   INSD:T21834.1,INSD:DR749598.1,INSD:EL307546.1,
FT                   INSD:EL178041.1,INSD:EL005176.1,INSD:EL264001.1,
FT                   INSD:BP839837.1,INSD:EL157382.1,INSD:DR350540.1,
FT                   INSD:EL122595.1,INSD:AV562710.1,INSD:AV557603.1,
FT                   INSD:EH858968.1,INSD:BP794917.1,INSD:EL233070.1,
FT                   INSD:EL290597.1,INSD:BP663578.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827224.1,INSD:AF488561.1,INSD:BT025971.1,
FT                   INSD:AK117229.1"
FT   mRNA            join(17784..18513,18600..18692,18805..18870,19296..19673,
FT                   19762..20066)
FT                   /gene="UNE10"
FT                   /gene_synonym="F6N15.11"
FT                   /gene_synonym="F6N15_11"
FT                   /gene_synonym="unfertilized embryo sac 10"
FT                   /locus_tag="AT4G00050"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT   mRNA            join(17784..17954,18030..18513,18600..18692,18805..18870,
FT                   19296..19725)
FT                   /gene="UNE10"
FT                   /gene_synonym="F6N15.11"
FT                   /gene_synonym="F6N15_11"
FT                   /gene_synonym="unfertilized embryo sac 10"
FT                   /locus_tag="AT4G00050"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT   CDS_pept        join(17863..17954,18030..18513,18600..18692,18805..18870,
FT                   19296..19673,19762..19848)
FT                   /codon_start=1
FT                   /gene="UNE10"
FT                   /gene_synonym="F6N15.11"
FT                   /gene_synonym="F6N15_11"
FT                   /gene_synonym="unfertilized embryo sac 10"
FT                   /locus_tag="AT4G00050"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /note="unfertilized embryo sac 10 (UNE10); FUNCTIONS IN:
FT                   DNA binding, sequence-specific DNA binding transcription
FT                   factor activity; INVOLVED IN: double fertilization forming
FT                   a zygote and endosperm, regulation of transcription;
FT                   LOCATED IN: nucleus; EXPRESSED IN: 20 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Helix-loop-helix DNA-binding domain
FT                   (InterPro:IPR001092), Helix-loop-helix DNA-binding
FT                   (InterPro:IPR011598); BEST Arabidopsis thaliana protein
FT                   match is: phytochrome-interacting factor7
FT                   (TAIR:AT5G61270.1); Has 3766 Blast hits to 3760 proteins in
FT                   208 species: Archae - 0; Bacteria - 0; Metazoa - 365; Fungi
FT                   - 50; Plants - 3342; Viruses - 0; Other Eukaryotes - 9
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8GZ38"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GZ38"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH900952.1,INSD:AU229168.1,INSD:EL255918.1,
FT                   INSD:DR749599.1,INSD:AU238037.1,INSD:DR350538.1,
FT                   INSD:EL136627.1,INSD:EH851853.1,INSD:BP795611.1,
FT                   INSD:DR350539.1,INSD:EL279911.1,INSD:EL252560.1,
FT                   INSD:T21834.1,INSD:DR749598.1,INSD:EL307546.1,
FT                   INSD:EL178041.1,INSD:EL005176.1,INSD:EL264001.1,
FT                   INSD:BP839837.1,INSD:EL157382.1,INSD:DR350540.1,
FT                   INSD:EL122595.1,INSD:AV562710.1,INSD:AV557603.1,
FT                   INSD:EH858968.1,INSD:BP794917.1,INSD:EL233070.1,
FT                   INSD:EL290597.1,INSD:BP663578.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827224.1,INSD:AF488561.1,INSD:BT025971.1,
FT                   INSD:AK117229.1"
FT                   /protein_id="AEE81818.1"
FT                   /translation="MSQCVPNCHIDDTPAAATTTVRSTTAADIPILDYEVAELTWENGQ
FT                   LGLHGLGPPRVTASSTKYSTGAGGTLESIVDQATRLPNPKPTDELVPWFHHRSSRAAMA
FT                   MDALVPCSNLVHEQQSKPGGVGSTRVGSCSDGRTMGGGKRARVAPEWSGGGSQRLTMDT
FT                   YDVGFTSTSMGSHDNTIDDHDSVCHSRPQMEDEEEKKAGGKSSVSTKRSRAAAIHNQSE
FT                   RKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVSMMSRMNMPSMMLPM
FT                   AMQQQQQLQMSLMSNPMGLGMGMGMPGLGLLDLNSMNRAAASAPNIHANMMPNPFLPMN
FT                   CPSWDASSNDSRFQSPLIPDPMSAFLACSTQPTTMEAYSRMATLYQQMQQQLPPPSNPK
FT                   "
FT   CDS_pept        join(17863..17954,18030..18513,18600..18692,18805..18870,
FT                   19296..19715)
FT                   /codon_start=1
FT                   /gene="UNE10"
FT                   /gene_synonym="F6N15.11"
FT                   /gene_synonym="F6N15_11"
FT                   /gene_synonym="unfertilized embryo sac 10"
FT                   /locus_tag="AT4G00050"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00050"
FT                   /db_xref="GOA:A0A1P8B885"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B885"
FT                   /protein_id="ANM67799.1"
FT                   /translation="MSQCVPNCHIDDTPAAATTTVRSTTAADIPILDYEVAELTWENGQ
FT                   LGLHGLGPPRVTASSTKYSTGAGGTLESIVDQATRLPNPKPTDELVPWFHHRSSRAAMA
FT                   MDALVPCSNLVHEQQSKPGGVGSTRVGSCSDGRTMGGGKRARVAPEWSGGGSQRLTMDT
FT                   YDVGFTSTSMGSHDNTIDDHDSVCHSRPQMEDEEEKKAGGKSSVSTKRSRAAAIHNQSE
FT                   RKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQVSMMSRMNMPSMMLPM
FT                   AMQQQQQLQMSLMSNPMGLGMGMGMPGLGLLDLNSMNRAAASAPNIHANMMPNPFLPMN
FT                   CPSWDASSNDSRFQSPLIPDPMSAFLACSTQVDPFSIYRYTTWV"
FT   CDS_pept        join(18244..18513,18600..18692,18805..18870,19296..19673,
FT                   19762..19848)
FT                   /codon_start=1
FT                   /gene="UNE10"
FT                   /gene_synonym="F6N15.11"
FT                   /gene_synonym="F6N15_11"
FT                   /gene_synonym="unfertilized embryo sac 10"
FT                   /locus_tag="AT4G00050"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00050"
FT                   /db_xref="GOA:A0A1P8B876"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B876"
FT                   /protein_id="ANM67798.1"
FT                   /translation="MAMDALVPCSNLVHEQQSKPGGVGSTRVGSCSDGRTMGGGKRARV
FT                   APEWSGGGSQRLTMDTYDVGFTSTSMGSHDNTIDDHDSVCHSRPQMEDEEEKKAGGKSS
FT                   VSTKRSRAAAIHNQSERKRRDKINQRMKTLQKLVPNSSKTDKASMLDEVIEYLKQLQAQ
FT                   VSMMSRMNMPSMMLPMAMQQQQQLQMSLMSNPMGLGMGMGMPGLGLLDLNSMNRAAASA
FT                   PNIHANMMPNPFLPMNCPSWDASSNDSRFQSPLIPDPMSAFLACSTQPTTMEAYSRMAT
FT                   LYQQMQQQLPPPSNPK"
FT   gene            21351..29064
FT                   /gene="MEE44"
FT                   /gene_synonym="F6N15.10"
FT                   /gene_synonym="F6N15_10"
FT                   /gene_synonym="maternal effect embryo arrest 44"
FT                   /locus_tag="AT4G00060"
FT   mRNA            join(21351..22297,22687..23199,23274..23384,23458..25218,
FT                   25294..25410,25559..25741,25818..25880,26339..26410,
FT                   26501..26752,26884..27003,27219..27278,27383..27423,
FT                   27522..27599,27688..27772,27868..28019,28156..28281,
FT                   28373..28574,28644..28871)
FT                   /gene="MEE44"
FT                   /gene_synonym="F6N15.10"
FT                   /gene_synonym="F6N15_10"
FT                   /gene_synonym="maternal effect embryo arrest 44"
FT                   /locus_tag="AT4G00060"
FT                   /product="Nucleotidyltransferase family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES045839.1,INSD:EG450878.1,INSD:ES178516.1"
FT   mRNA            join(21363..22297,22687..23199,23274..23384,23458..25268)
FT                   /gene="MEE44"
FT                   /gene_synonym="F6N15.10"
FT                   /gene_synonym="F6N15_10"
FT                   /gene_synonym="maternal effect embryo arrest 44"
FT                   /locus_tag="AT4G00060"
FT                   /product="Nucleotidyltransferase family protein"
FT   mRNA            join(21370..22297,22687..23199,23274..23384,23458..25218,
FT                   25294..25410,25559..25741,25818..25880,26339..26410,
FT                   26501..26752,26884..27003,27219..27278,27383..27423,
FT                   27522..27599,27688..27772,27868..28019,28156..28574,
FT                   28644..29064)
FT                   /gene="MEE44"
FT                   /gene_synonym="F6N15.10"
FT                   /gene_synonym="F6N15_10"
FT                   /gene_synonym="maternal effect embryo arrest 44"
FT                   /locus_tag="AT4G00060"
FT                   /product="Nucleotidyltransferase family protein"
FT   mRNA            join(21371..22297,22687..23199,23274..23384,23458..25218,
FT                   25294..25410,25559..25741,25818..25880,26339..26410,
FT                   26501..26752,26884..27003,27219..27278,27383..27423,
FT                   27522..27599,27688..27772,27868..28076,28156..28574,
FT                   28644..28871)
FT                   /gene="MEE44"
FT                   /gene_synonym="F6N15.10"
FT                   /gene_synonym="F6N15_10"
FT                   /gene_synonym="maternal effect embryo arrest 44"
FT                   /locus_tag="AT4G00060"
FT                   /product="Nucleotidyltransferase family protein"
FT   CDS_pept        join(21437..22297,22687..23199,23274..23384,23458..25218,
FT                   25294..25410,25559..25741,25818..25880,26339..26410,
FT                   26501..26752,26884..27003,27219..27278,27383..27423,
FT                   27522..27599,27688..27772,27868..27996)
FT                   /codon_start=1
FT                   /gene="MEE44"
FT                   /gene_synonym="F6N15.10"
FT                   /gene_synonym="F6N15_10"
FT                   /gene_synonym="maternal effect embryo arrest 44"
FT                   /locus_tag="AT4G00060"
FT                   /product="Nucleotidyltransferase family protein"
FT                   /db_xref="GOA:F4JH01"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:F4JH01"
FT                   /protein_id="ANM66686.1"
FT                   /translation="MENRHLPSKFFSSASSMAQNQLIDSLTSHISLYHSHSSSSSMANT
FT                   IPNPRSAILRWFSSLSVHQRLSHLTVVDPKFVQILLQMLGYIRTKGPCSFIILPDLPSS
FT                   SDLPSLCFKKSRGLISRVSESNESERFVFDSTRLFGSGEGERAQDCSCSVNSLDSVVMA
FT                   EEFLTNVDRFVETMDVLSDGAFLRGEESDLGSNWVELEWLKAKGYYSMEAFVANRLEVS
FT                   MRLAWLNTNSGKRRGIKLKEKLNAAAAAANSYWRKKACVDWWQNLDAATHKKIWTCLFG
FT                   KSAKSVIYEILREANQAQQGEMWLFNFASARKGRTDTSAVSFCDMILEPNSVPRKPITV
FT                   ASNLSGLYVLQEFASLLILCQNGLVPVHSVFFSSMGTITTLVDCILRKLRGFLMVISID
FT                   SVKSELLDDNTHKCSPSSSSNQKLGSTNRKQKGKTRNMKKPTPEAKSDKNVNLSTKNGK
FT                   KDQAKLEFNKSREAIECKKVPTASTMINDPEASAATMEVVPGLVARKGRTKKKRKEKNK
FT                   SKKCTSLENNGEVNKSVVNSSAIVKASKCDSSCTSANQHPQEYINAQIIEEHGSFSCER
FT                   NRSGTCASVNGAANCEYSGEEESHSKAETHVISSDLSSVDPAGGPSCENVNPQKSCCRG
FT                   DRKEKLTMPNERSRTLDEGESHRIHHQRREAGYGFASSSSEFVSYEWPAVAPMYFSHVS
FT                   SHLPTATDRLHLDVGHNLHPYVRQPFVSTVQHARNPSIEGSHKQVLSRPMPMSLDWPPM
FT                   VHSNCGLTTAFTCNYDSGILVDIPEQKNKHELGNECENNWMLEEDFEVHTVSGVDYNQY
FT                   FGGGVMYWNPSDHLGTGFSRPPSLSSDDSSWAWHEAEMKRSVDDMVAFSSSYSANGLDS
FT                   PTAASFCSPFHPLGPPNQPLGYVVPGNEISTKILQAPPTTIEGAGEEEVSGTLASLSGD
FT                   VEGNSGDSLPYPILRPIIIPNMSKSEYKRSYDTKSPNVPPTRREHPRIKRPPSPVVLCV
FT                   PRAPRPPPPSPVSNSRARRGFPTVRSGSSSPRHWGMRGWFHDGVNWEEPRGAEIVLPWR
FT                   NKSLAVRPIIQPLPGALLQDHLIAMSQLGRDQEHPDVAFPLQPPELLNCPMQGESLSLI
FT                   HGILNDEIDSFCKQVAAENMARKPYINWAIKRVTRSLQVLWPRSRTNIFGSSATGLSLP
FT                   SSDVDLVVCLPPVRNLEPIKEAGILEGRNGIKETCLQHAARYLANQEWVKTDSLKTVEN
FT                   TAIPIIMLVVEVPCDLICSIQSPKDGPDCITVDQDSNGNTEMVGFEDSAAANSLPTNTG
FT                   NLAIAKSVRLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYS
FT                   GGLSSYCLVLLITRFLQHEHHLGRSINQNLGGLLMDFLYFFGNVFDPRQMRVSVQGSGI
FT                   YRNRERGYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSTSDS
FT                   CGKQQLHNLLPKIIPSIISS"
FT   CDS_pept        join(21437..22297,22687..23199,23274..23384,23458..25218,
FT                   25294..25410,25559..25741,25818..25880,26339..26410,
FT                   26501..26752,26884..27003,27219..27278,27383..27423,
FT                   27522..27599,27688..27772,27868..27996)
FT                   /codon_start=1
FT                   /gene="MEE44"
FT                   /gene_synonym="F6N15.10"
FT                   /gene_synonym="F6N15_10"
FT                   /gene_synonym="maternal effect embryo arrest 44"
FT                   /locus_tag="AT4G00060"
FT                   /product="Nucleotidyltransferase family protein"
FT                   /db_xref="GOA:F4JH01"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:F4JH01"
FT                   /protein_id="ANM66687.1"
FT                   /translation="MENRHLPSKFFSSASSMAQNQLIDSLTSHISLYHSHSSSSSMANT
FT                   IPNPRSAILRWFSSLSVHQRLSHLTVVDPKFVQILLQMLGYIRTKGPCSFIILPDLPSS
FT                   SDLPSLCFKKSRGLISRVSESNESERFVFDSTRLFGSGEGERAQDCSCSVNSLDSVVMA
FT                   EEFLTNVDRFVETMDVLSDGAFLRGEESDLGSNWVELEWLKAKGYYSMEAFVANRLEVS
FT                   MRLAWLNTNSGKRRGIKLKEKLNAAAAAANSYWRKKACVDWWQNLDAATHKKIWTCLFG
FT                   KSAKSVIYEILREANQAQQGEMWLFNFASARKGRTDTSAVSFCDMILEPNSVPRKPITV
FT                   ASNLSGLYVLQEFASLLILCQNGLVPVHSVFFSSMGTITTLVDCILRKLRGFLMVISID
FT                   SVKSELLDDNTHKCSPSSSSNQKLGSTNRKQKGKTRNMKKPTPEAKSDKNVNLSTKNGK
FT                   KDQAKLEFNKSREAIECKKVPTASTMINDPEASAATMEVVPGLVARKGRTKKKRKEKNK
FT                   SKKCTSLENNGEVNKSVVNSSAIVKASKCDSSCTSANQHPQEYINAQIIEEHGSFSCER
FT                   NRSGTCASVNGAANCEYSGEEESHSKAETHVISSDLSSVDPAGGPSCENVNPQKSCCRG
FT                   DRKEKLTMPNERSRTLDEGESHRIHHQRREAGYGFASSSSEFVSYEWPAVAPMYFSHVS
FT                   SHLPTATDRLHLDVGHNLHPYVRQPFVSTVQHARNPSIEGSHKQVLSRPMPMSLDWPPM
FT                   VHSNCGLTTAFTCNYDSGILVDIPEQKNKHELGNECENNWMLEEDFEVHTVSGVDYNQY
FT                   FGGGVMYWNPSDHLGTGFSRPPSLSSDDSSWAWHEAEMKRSVDDMVAFSSSYSANGLDS
FT                   PTAASFCSPFHPLGPPNQPLGYVVPGNEISTKILQAPPTTIEGAGEEEVSGTLASLSGD
FT                   VEGNSGDSLPYPILRPIIIPNMSKSEYKRSYDTKSPNVPPTRREHPRIKRPPSPVVLCV
FT                   PRAPRPPPPSPVSNSRARRGFPTVRSGSSSPRHWGMRGWFHDGVNWEEPRGAEIVLPWR
FT                   NKSLAVRPIIQPLPGALLQDHLIAMSQLGRDQEHPDVAFPLQPPELLNCPMQGESLSLI
FT                   HGILNDEIDSFCKQVAAENMARKPYINWAIKRVTRSLQVLWPRSRTNIFGSSATGLSLP
FT                   SSDVDLVVCLPPVRNLEPIKEAGILEGRNGIKETCLQHAARYLANQEWVKTDSLKTVEN
FT                   TAIPIIMLVVEVPCDLICSIQSPKDGPDCITVDQDSNGNTEMVGFEDSAAANSLPTNTG
FT                   NLAIAKSVRLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYS
FT                   GGLSSYCLVLLITRFLQHEHHLGRSINQNLGGLLMDFLYFFGNVFDPRQMRVSVQGSGI
FT                   YRNRERGYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSTSDS
FT                   CGKQQLHNLLPKIIPSIISS"
FT   CDS_pept        join(21437..22297,22687..23199,23274..23384,23458..25218,
FT                   25294..25410,25559..25741,25818..25880,26339..26410,
FT                   26501..26752,26884..27003,27219..27278,27383..27423,
FT                   27522..27599,27688..27772,27868..27996)
FT                   /codon_start=1
FT                   /gene="MEE44"
FT                   /gene_synonym="F6N15.10"
FT                   /gene_synonym="F6N15_10"
FT                   /gene_synonym="maternal effect embryo arrest 44"
FT                   /locus_tag="AT4G00060"
FT                   /product="Nucleotidyltransferase family protein"
FT                   /note="maternal effect embryo arrest 44 (MEE44); FUNCTIONS
FT                   IN: nucleotidyltransferase activity; INVOLVED IN: embryo
FT                   development ending in seed dormancy; CONTAINS InterPro
FT                   DOMAIN/s: Nucleotidyl transferase domain
FT                   (InterPro:IPR002934), PAP/25A-associated
FT                   (InterPro:IPR002058); BEST Arabidopsis thaliana protein
FT                   match is: Nucleotidyltransferase family protein
FT                   (TAIR:AT5G53770.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00060"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00060.1"
FT                   /db_xref="GOA:F4JH01"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:F4JH01"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES045839.1,INSD:EG450878.1,INSD:ES178516.1"
FT                   /protein_id="AEE81819.1"
FT                   /translation="MENRHLPSKFFSSASSMAQNQLIDSLTSHISLYHSHSSSSSMANT
FT                   IPNPRSAILRWFSSLSVHQRLSHLTVVDPKFVQILLQMLGYIRTKGPCSFIILPDLPSS
FT                   SDLPSLCFKKSRGLISRVSESNESERFVFDSTRLFGSGEGERAQDCSCSVNSLDSVVMA
FT                   EEFLTNVDRFVETMDVLSDGAFLRGEESDLGSNWVELEWLKAKGYYSMEAFVANRLEVS
FT                   MRLAWLNTNSGKRRGIKLKEKLNAAAAAANSYWRKKACVDWWQNLDAATHKKIWTCLFG
FT                   KSAKSVIYEILREANQAQQGEMWLFNFASARKGRTDTSAVSFCDMILEPNSVPRKPITV
FT                   ASNLSGLYVLQEFASLLILCQNGLVPVHSVFFSSMGTITTLVDCILRKLRGFLMVISID
FT                   SVKSELLDDNTHKCSPSSSSNQKLGSTNRKQKGKTRNMKKPTPEAKSDKNVNLSTKNGK
FT                   KDQAKLEFNKSREAIECKKVPTASTMINDPEASAATMEVVPGLVARKGRTKKKRKEKNK
FT                   SKKCTSLENNGEVNKSVVNSSAIVKASKCDSSCTSANQHPQEYINAQIIEEHGSFSCER
FT                   NRSGTCASVNGAANCEYSGEEESHSKAETHVISSDLSSVDPAGGPSCENVNPQKSCCRG
FT                   DRKEKLTMPNERSRTLDEGESHRIHHQRREAGYGFASSSSEFVSYEWPAVAPMYFSHVS
FT                   SHLPTATDRLHLDVGHNLHPYVRQPFVSTVQHARNPSIEGSHKQVLSRPMPMSLDWPPM
FT                   VHSNCGLTTAFTCNYDSGILVDIPEQKNKHELGNECENNWMLEEDFEVHTVSGVDYNQY
FT                   FGGGVMYWNPSDHLGTGFSRPPSLSSDDSSWAWHEAEMKRSVDDMVAFSSSYSANGLDS
FT                   PTAASFCSPFHPLGPPNQPLGYVVPGNEISTKILQAPPTTIEGAGEEEVSGTLASLSGD
FT                   VEGNSGDSLPYPILRPIIIPNMSKSEYKRSYDTKSPNVPPTRREHPRIKRPPSPVVLCV
FT                   PRAPRPPPPSPVSNSRARRGFPTVRSGSSSPRHWGMRGWFHDGVNWEEPRGAEIVLPWR
FT                   NKSLAVRPIIQPLPGALLQDHLIAMSQLGRDQEHPDVAFPLQPPELLNCPMQGESLSLI
FT                   HGILNDEIDSFCKQVAAENMARKPYINWAIKRVTRSLQVLWPRSRTNIFGSSATGLSLP
FT                   SSDVDLVVCLPPVRNLEPIKEAGILEGRNGIKETCLQHAARYLANQEWVKTDSLKTVEN
FT                   TAIPIIMLVVEVPCDLICSIQSPKDGPDCITVDQDSNGNTEMVGFEDSAAANSLPTNTG
FT                   NLAIAKSVRLDISFKTPSHTGLQTTQLVKDLTEQFPAATPLALVLKQFLADRTLDQSYS
FT                   GGLSSYCLVLLITRFLQHEHHLGRSINQNLGGLLMDFLYFFGNVFDPRQMRVSVQGSGI
FT                   YRNRERGYSIDPIHIDDPLFPTNNVGRNCFRIHQCIKAFSEAYSVLENELTCITSTSDS
FT                   CGKQQLHNLLPKIIPSIISS"
FT   CDS_pept        join(21437..22297,22687..23199,23274..23384,23458..25248)
FT                   /codon_start=1
FT                   /gene="MEE44"
FT                   /gene_synonym="F6N15.10"
FT                   /gene_synonym="F6N15_10"
FT                   /gene_synonym="maternal effect embryo arrest 44"
FT                   /locus_tag="AT4G00060"
FT                   /product="Nucleotidyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00060"
FT                   /db_xref="GOA:A0A1P8B522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B522"
FT                   /protein_id="ANM66688.1"
FT                   /translation="MENRHLPSKFFSSASSMAQNQLIDSLTSHISLYHSHSSSSSMANT
FT                   IPNPRSAILRWFSSLSVHQRLSHLTVVDPKFVQILLQMLGYIRTKGPCSFIILPDLPSS
FT                   SDLPSLCFKKSRGLISRVSESNESERFVFDSTRLFGSGEGERAQDCSCSVNSLDSVVMA
FT                   EEFLTNVDRFVETMDVLSDGAFLRGEESDLGSNWVELEWLKAKGYYSMEAFVANRLEVS
FT                   MRLAWLNTNSGKRRGIKLKEKLNAAAAAANSYWRKKACVDWWQNLDAATHKKIWTCLFG
FT                   KSAKSVIYEILREANQAQQGEMWLFNFASARKGRTDTSAVSFCDMILEPNSVPRKPITV
FT                   ASNLSGLYVLQEFASLLILCQNGLVPVHSVFFSSMGTITTLVDCILRKLRGFLMVISID
FT                   SVKSELLDDNTHKCSPSSSSNQKLGSTNRKQKGKTRNMKKPTPEAKSDKNVNLSTKNGK
FT                   KDQAKLEFNKSREAIECKKVPTASTMINDPEASAATMEVVPGLVARKGRTKKKRKEKNK
FT                   SKKCTSLENNGEVNKSVVNSSAIVKASKCDSSCTSANQHPQEYINAQIIEEHGSFSCER
FT                   NRSGTCASVNGAANCEYSGEEESHSKAETHVISSDLSSVDPAGGPSCENVNPQKSCCRG
FT                   DRKEKLTMPNERSRTLDEGESHRIHHQRREAGYGFASSSSEFVSYEWPAVAPMYFSHVS
FT                   SHLPTATDRLHLDVGHNLHPYVRQPFVSTVQHARNPSIEGSHKQVLSRPMPMSLDWPPM
FT                   VHSNCGLTTAFTCNYDSGILVDIPEQKNKHELGNECENNWMLEEDFEVHTVSGVDYNQY
FT                   FGGGVMYWNPSDHLGTGFSRPPSLSSDDSSWAWHEAEMKRSVDDMVAFSSSYSANGLDS
FT                   PTAASFCSPFHPLGPPNQPLGYVVPGNEISTKILQAPPTTIEGAGEEEVSGTLASLSGD
FT                   VEGNSGDSLPYPILRPIIIPNMSKSEYKRSYDTKSPNVPPTRREHPRIKRPPSPVVLCV
FT                   PRAPRPPPPSPVSNSRARRGFPTVRSGSSSPRHWGMRGWFHDGVNWEEPRGAEIVLPWR
FT                   NKSLAVRPIIQPLPGALLQDHLIAMSQLGRDQEHVSNVFDIYV"
FT   gene            complement(29072..31426)
FT                   /gene_synonym="F6N15.15"
FT                   /gene_synonym="F6N15_15"
FT                   /locus_tag="AT4G00070"
FT   mRNA            complement(join(29072..29767,29849..29983,30072..30137,
FT                   30900..30985,31270..31426))
FT                   /gene_synonym="F6N15.15"
FT                   /gene_synonym="F6N15_15"
FT                   /locus_tag="AT4G00070"
FT                   /product="RING/U-box superfamily protein"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT011827.1"
FT   mRNA            complement(join(29166..29983,30072..30137,30900..30985,
FT                   31270..31426))
FT                   /gene_synonym="F6N15.15"
FT                   /gene_synonym="F6N15_15"
FT                   /locus_tag="AT4G00070"
FT                   /product="RING/U-box superfamily protein"
FT   CDS_pept        complement(join(29672..29767,29849..29983,30072..30137,
FT                   30900..30985,31270..31426))
FT                   /codon_start=1
FT                   /gene_synonym="F6N15.15"
FT                   /gene_synonym="F6N15_15"
FT                   /locus_tag="AT4G00070"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; BEST Arabidopsis
FT                   thaliana protein match is: RING/U-box superfamily protein
FT                   (TAIR:AT1G36950.1); Has 668 Blast hits to 668 proteins in
FT                   83 species: Archae - 0; Bacteria - 0; Metazoa - 32; Fungi -
FT                   45; Plants - 506; Viruses - 0; Other Eukaryotes - 85
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00070"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00070.1"
FT                   /db_xref="GOA:F4JH02"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:F4JH02"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT011827.1"
FT                   /protein_id="AEE81820.1"
FT                   /translation="MSLLSEENEFLFDLNEIPEKTVYSDDGDEFLFDLNKIPPREETVN
FT                   SSDEDFAVKSAEGYTDHLHRRNQATKRKKKLRKRPKGLRMDTDPYQELRMDTDHMTYEQ
FT                   LLQLCNNMGYENSGVKASNIDRCLRNTKPSEFQSLADKICCICQDGFQKRAGVGKLNCG
FT                   HNFHVNCVKPWILTKK"
FT   CDS_pept        complement(join(29774..29983,30072..30137,30900..30985,
FT                   31270..31426))
FT                   /codon_start=1
FT                   /gene_synonym="F6N15.15"
FT                   /gene_synonym="F6N15_15"
FT                   /locus_tag="AT4G00070"
FT                   /product="RING/U-box superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B8C9"
FT                   /protein_id="ANM67847.1"
FT                   /translation="MSLLSEENEFLFDLNEIPEKTVYSDDGDEFLFDLNKIPPREETVN
FT                   SSDEDFAVKSAEGYTDHLHRRNQATKRKKKLRKRPKGLRMDTDPYQELRMDTDHMTYEQ
FT                   LLQLCNNMGYENSGVKASNIDRCLRNTKPSEFQSLADKICCICQVKVQIESFRKIIIEM
FT                   RCVHILTVN"
FT   gene            32748..33756
FT                   /gene="UNE11"
FT                   /gene_synonym="F6N15.9"
FT                   /gene_synonym="F6N15_9"
FT                   /gene_synonym="unfertilized embryo sac 11"
FT                   /locus_tag="AT4G00080"
FT   mRNA            32748..33756
FT                   /gene="UNE11"
FT                   /gene_synonym="F6N15.9"
FT                   /gene_synonym="F6N15_9"
FT                   /gene_synonym="unfertilized embryo sac 11"
FT                   /locus_tag="AT4G00080"
FT                   /product="Plant invertase/pectin methylesterase inhibitor
FT                   superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP576517.1,INSD:AU226701.1,INSD:BP570845.1,
FT                   INSD:AI998604.1,INSD:AU235919.1,INSD:BP798565.1,
FT                   INSD:CB252145.1,INSD:BP569660.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK228011.1,INSD:BT006197.1"
FT   CDS_pept        32946..33575
FT                   /codon_start=1
FT                   /gene="UNE11"
FT                   /gene_synonym="F6N15.9"
FT                   /gene_synonym="F6N15_9"
FT                   /gene_synonym="unfertilized embryo sac 11"
FT                   /locus_tag="AT4G00080"
FT                   /product="Plant invertase/pectin methylesterase inhibitor
FT                   superfamily protein"
FT                   /note="unfertilized embryo sac 11 (UNE11); FUNCTIONS IN:
FT                   enzyme inhibitor activity, pectinesterase inhibitor
FT                   activity, pectinesterase activity; INVOLVED IN: double
FT                   fertilization forming a zygote and endosperm; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: root; CONTAINS InterPro
FT                   DOMAIN/s: Pectinesterase inhibitor (InterPro:IPR006501);
FT                   BEST Arabidopsis thaliana protein match is: Plant
FT                   invertase/pectin methylesterase inhibitor superfamily
FT                   protein (TAIR:AT1G62770.1); Has 574 Blast hits to 571
FT                   proteins in 37 species: Archae - 0; Bacteria - 0; Metazoa -
FT                   0; Fungi - 0; Plants - 574; Viruses - 0; Other Eukaryotes -
FT                   0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00080"
FT                   /db_xref="GOA:O81309"
FT                   /db_xref="InterPro:IPR006501"
FT                   /db_xref="InterPro:IPR035513"
FT                   /db_xref="UniProtKB/TrEMBL:O81309"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP576517.1,INSD:AU226701.1,INSD:BP570845.1,
FT                   INSD:AI998604.1,INSD:AU235919.1,INSD:BP798565.1,
FT                   INSD:CB252145.1,INSD:BP569660.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK228011.1,INSD:BT006197.1"
FT                   /protein_id="AEE81821.1"
FT                   /translation="MAANNKLFFVLLSLFPLIIFSATATSSKDYDTKAYVHSWCRTTLY
FT                   PKLCVRSMSRYVRSRAVQNPRDLARFALKASLYRAKYTKAFLLKEVKNLETTLRPQYYA
FT                   SVHDCLDQIRDSVNQLSLAIAELDRVSRRQGKSQGDLHWHINNLQTWTSTALTDAETCV
FT                   SQFPGRRMSKLKATIKGKVKNVEETTSNALAFIEHYAAARYRARRP"
FT   gene            33800..33872
FT                   /gene_synonym="67033.TRNA-LYS-1"
FT                   /locus_tag="AT4G00085"
FT   tRNA            33800..33872
FT                   /gene_synonym="67033.TRNA-LYS-1"
FT                   /locus_tag="AT4G00085"
FT                   /product="tRNA-Lys"
FT                   /note="pre-tRNA-tRNA-Lys (anticodon: CTT)"
FT   gene            34091..36917
FT                   /gene_synonym="F6N15.8"
FT                   /gene_synonym="F6N15_8"
FT                   /locus_tag="AT4G00090"
FT   mRNA            join(34091..34437,34545..34650,34748..34808,34922..35202,
FT                   35411..35550,35627..35701,35811..35901,36070..36273,
FT                   36387..36431,36509..36917)
FT                   /gene_synonym="F6N15.8"
FT                   /gene_synonym="F6N15_8"
FT                   /locus_tag="AT4G00090"
FT                   /product="Transducin/WD40 repeat-like superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX837319.1,INSD:ES046106.1,INSD:EH890778.1,
FT                   INSD:DR267714.1,INSD:DR267716.1,INSD:BP627974.1,
FT                   INSD:BP608318.1,INSD:BP860698.1,INSD:DR267720.1,
FT                   INSD:AV828732.1,INSD:BX834703.1,INSD:ES057578.1,
FT                   INSD:BP636331.1,INSD:BP621862.1,INSD:DR373111.1,
FT                   INSD:BX837837.1,INSD:EL985404.1,INSD:DR267715.1,
FT                   INSD:BP625118.1,INSD:ES056354.1,INSD:EL272189.1,
FT                   INSD:EH908297.1,INSD:ES206163.1,INSD:AI996755.1,
FT                   INSD:ES022535.1,INSD:BP860262.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX826417.1,INSD:AY143971.1,INSD:AY056436.1"
FT   CDS_pept        join(34234..34437,34545..34650,34748..34808,34922..35202,
FT                   35411..35550,35627..35701,35811..35901,36070..36273,
FT                   36387..36431,36509..36594)
FT                   /codon_start=1
FT                   /gene_synonym="F6N15.8"
FT                   /gene_synonym="F6N15_8"
FT                   /locus_tag="AT4G00090"
FT                   /product="Transducin/WD40 repeat-like superfamily protein"
FT                   /note="Transducin/WD40 repeat-like superfamily protein;
FT                   FUNCTIONS IN: nucleotide binding; LOCATED IN: endomembrane
FT                   system; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: WD40
FT                   repeat 2 (InterPro:IPR019782), WD40 repeat-like-containing
FT                   domain (InterPro:IPR011046), WD40 repeat, conserved site
FT                   (InterPro:IPR019775), WD40-repeat-containing domain
FT                   (InterPro:IPR017986), WD40/YVTN repeat-like-containing
FT                   domain (InterPro:IPR015943), WD40 repeat
FT                   (InterPro:IPR001680), WD40 repeat, subgroup
FT                   (InterPro:IPR019781); BEST Arabidopsis thaliana protein
FT                   match is: periodic tryptophan protein 2 (TAIR:AT1G15440.2);
FT                   Has 19942 Blast hits to 11235 proteins in 520 species:
FT                   Archae - 42; Bacteria - 5638; Metazoa - 5982; Fungi - 4099;
FT                   Plants - 1742; Viruses - 0; Other Eukaryotes - 2439
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00090"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00090.1"
FT                   /db_xref="GOA:Q93ZN5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q93ZN5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX837319.1,INSD:ES046106.1,INSD:EH890778.1,
FT                   INSD:DR267714.1,INSD:DR267716.1,INSD:BP627974.1,
FT                   INSD:BP608318.1,INSD:BP860698.1,INSD:DR267720.1,
FT                   INSD:AV828732.1,INSD:BX834703.1,INSD:ES057578.1,
FT                   INSD:BP636331.1,INSD:BP621862.1,INSD:DR373111.1,
FT                   INSD:BX837837.1,INSD:EL985404.1,INSD:DR267715.1,
FT                   INSD:BP625118.1,INSD:ES056354.1,INSD:EL272189.1,
FT                   INSD:EH908297.1,INSD:ES206163.1,INSD:AI996755.1,
FT                   INSD:ES022535.1,INSD:BP860262.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX826417.1,INSD:AY143971.1,INSD:AY056436.1"
FT                   /protein_id="AEE81822.1"
FT                   /translation="MDSVLVVGIASVILGALIAVLFFGSYFRKRTSEVQSMAKAEPQDP
FT                   IRNPKSNHPAPKKNHPKSQASDKNQNKRHHPLDLNTLKGHGDAVTGLCFSSDGKSLATA
FT                   CADGVIRVFKLDDASSKSFKFLRINLPAGGHPTAVAFADDASSIVVACHHMSGSSLYMY
FT                   GEDKQKDQQGKLPLPSIKWDHHHIHEKRSVLTISGATATYGTADGSVVIASCSEGTDIV
FT                   LWHGKTGRNLGHVDTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQKDGSVKEVSR
FT                   VMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRYHLDEDPKTLKVFPIPLCD
FT                   SGGNPLHYDRLSLCPEGKILAASHGSTLQWLCAETGNVLDTAEKAHEGDITCISWAPKA
FT                   ITVGERHAMVLGTSGDDKKVKLWEAPKSQSL"
FT   gene            36916..38384
FT                   /gene="RPS13A"
FT                   /gene_synonym="ATRPS13A"
FT                   /gene_synonym="F6N15.7"
FT                   /gene_synonym="F6N15_7"
FT                   /gene_synonym="PFL2"
FT                   /gene_synonym="POINTED FIRST LEAF 2"
FT                   /gene_synonym="RIBOSOMAL PROTEIN S13"
FT                   /gene_synonym="ribosomal protein S13A"
FT                   /gene_synonym="RPS13"
FT                   /locus_tag="AT4G00100"
FT                   /note="Encodes a cytoplasmic ribosomal protein S13
FT                   homologue involved in early leaf development"
FT   mRNA            join(36916..37194,37274..37346,37429..37567,37651..37837,
FT                   38090..38384)
FT                   /gene="RPS13A"
FT                   /gene_synonym="ATRPS13A"
FT                   /gene_synonym="F6N15.7"
FT                   /gene_synonym="F6N15_7"
FT                   /gene_synonym="PFL2"
FT                   /gene_synonym="POINTED FIRST LEAF 2"
FT                   /gene_synonym="RIBOSOMAL PROTEIN S13"
FT                   /gene_synonym="ribosomal protein S13A"
FT                   /gene_synonym="RPS13"
FT                   /locus_tag="AT4G00100"
FT                   /product="ribosomal protein S13A"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP824697.1,INSD:AV549530.1,INSD:AV786844.1,
FT                   INSD:ES067714.1,INSD:AV549661.1,INSD:DR224781.1,
FT                   INSD:ES166063.1,INSD:AV536626.1,INSD:EL178698.1,
FT                   INSD:DR304326.1,INSD:ES147014.1,INSD:BP838079.1,
FT                   INSD:EL251386.1,INSD:EL282143.1,INSD:ES097327.1,
FT                   INSD:AV549768.1,INSD:BP852968.1,INSD:EL967525.1,
FT                   INSD:BP625685.1,INSD:ES093009.1,INSD:ES033671.1,
FT                   INSD:CK117735.1,INSD:ES031709.1,INSD:EL226416.1,
FT                   INSD:EH891250.1,INSD:ES153028.1,INSD:DR304334.1,
FT                   INSD:BP834856.1,INSD:ES054591.1,INSD:EG500187.1,
FT                   INSD:BP631217.1,INSD:EL256097.1,INSD:ES147468.1,
FT                   INSD:T14099.1,INSD:EH797917.1,INSD:EH906387.1,
FT                   INSD:DR304342.1,INSD:BP654406.1,INSD:DR304356.1,
FT                   INSD:EL156479.1,INSD:EL016644.1,INSD:CF774325.1,
FT                   INSD:BP852526.1,INSD:ES139445.1,INSD:DR224780.1,
FT                   INSD:EL050543.1,INSD:DR304357.1,INSD:CB258050.1,
FT                   INSD:DR233678.1,INSD:BP824293.1,INSD:EL013623.1,
FT                   INSD:EH911180.1,INSD:EH881687.1,INSD:EH937830.1,
FT                   INSD:ES061554.1,INSD:ES115563.1,INSD:BP855636.1,
FT                   INSD:BP836468.1,INSD:CF773247.1,INSD:EH931686.1,
FT                   INSD:EH965505.1,INSD:ES068434.1,INSD:EL143907.1,
FT                   INSD:DR304340.1,INSD:DR304354.1,INSD:DR304359.1,
FT                   INSD:DR304330.1,INSD:BP831928.1,INSD:ES151678.1,
FT                   INSD:DR304358.1,INSD:EL992629.1,INSD:ES147606.1,
FT                   INSD:DR304337.1,INSD:ES173058.1,INSD:DR304331.1,
FT                   INSD:BP836262.1,INSD:ES087345.1,INSD:EL109201.1,
FT                   INSD:EH839786.1,INSD:EG515403.1,INSD:EL080103.1,
FT                   INSD:ES024216.1,INSD:ES031922.1,INSD:ES068017.1,
FT                   INSD:ES209348.1,INSD:AV819808.1,INSD:ES058341.1,
FT                   INSD:AV787854.1,INSD:ES113793.1,INSD:CB260666.1,
FT                   INSD:EL206020.1,INSD:EH969044.1,INSD:ES061931.1,
FT                   INSD:EH976206.1,INSD:ES180462.1,INSD:EL218396.1,
FT                   INSD:ES075100.1,INSD:BP591378.1,INSD:EL060723.1,
FT                   INSD:EL978876.1,INSD:EH824348.1,INSD:ES030994.1,
FT                   INSD:ES189487.1,INSD:DR304350.1,INSD:EG515391.1,
FT                   INSD:EH947432.1,INSD:EL288408.1,INSD:EL237882.1,
FT                   INSD:BP799200.1,INSD:ES116558.1,INSD:ES014539.1,
FT                   INSD:BP863003.1,INSD:BP803235.1,INSD:DR304327.1,
FT                   INSD:EL065863.1,INSD:DR304339.1,INSD:ES006370.1,
FT                   INSD:EL991513.1,INSD:ES060115.1,INSD:BP834223.1,
FT                   INSD:ES095125.1,INSD:DR304343.1,INSD:EL207383.1,
FT                   INSD:EL247820.1,INSD:EL210313.1,INSD:EL155889.1,
FT                   INSD:ES092931.1,INSD:ES189365.1,INSD:ES082246.1,
FT                   INSD:BP858371.1,INSD:DR304353.1,INSD:EL151216.1,
FT                   INSD:ES070820.1,INSD:DR235821.1,INSD:EL137130.1,
FT                   INSD:EH845765.1,INSD:EH842935.1,INSD:EL190719.1,
FT                   INSD:EL983090.1,INSD:EL155598.1,INSD:DR304351.1,
FT                   INSD:AV819151.1,INSD:ES132234.1,INSD:ES214500.1,
FT                   INSD:EH803064.1,INSD:ES182960.1,INSD:EL210311.1,
FT                   INSD:EH822496.1,INSD:BP572958.1,INSD:ES042453.1,
FT                   INSD:BP564674.1,INSD:DR304332.1,INSD:EL095528.1,
FT                   INSD:EL192635.1,INSD:EL299407.1,INSD:ES018687.1,
FT                   INSD:ES063886.1,INSD:ES197572.1,INSD:EL182374.1,
FT                   INSD:BP562325.2,INSD:DR304349.1,INSD:ES188164.1,
FT                   INSD:EL137604.1,INSD:EG500185.1,INSD:EH920779.1,
FT                   INSD:EH979501.1,INSD:AA597802.1,INSD:ES123672.1,
FT                   INSD:ES063885.1,INSD:DR304346.1,INSD:BP583926.1,
FT                   INSD:DR304345.1,INSD:EH923689.1,INSD:ES130448.1,
FT                   INSD:DR304333.1,INSD:EH939484.1,INSD:ES076506.1,
FT                   INSD:ES019754.1,INSD:DR304341.1,INSD:CB260925.1,
FT                   INSD:EL328095.1,INSD:BP623444.1,INSD:BP586799.1,
FT                   INSD:EL240285.1,INSD:ES146564.1,INSD:DR370660.1,
FT                   INSD:ES016659.1,INSD:BP803381.1,INSD:EL071105.1,
FT                   INSD:CK118109.1,INSD:EL275467.1,INSD:ES065669.1,
FT                   INSD:CB074138.1,INSD:BP787136.1,INSD:ES192941.1,
FT                   INSD:R90398.1,INSD:AV787944.1,INSD:ES054574.1,
FT                   INSD:BP634777.1,INSD:EL991423.1,INSD:ES106859.1,
FT                   INSD:AV806992.1,INSD:ES104584.1,INSD:ES129548.1,
FT                   INSD:ES163112.1,INSD:BP847036.2,INSD:EL171902.1,
FT                   INSD:ES051639.1,INSD:EL281913.1,INSD:EG502328.1,
FT                   INSD:EH978700.1,INSD:EH974690.1,INSD:ES142346.1,
FT                   INSD:EL071462.1,INSD:AV829596.1,INSD:BP623779.1,
FT                   INSD:ES071175.1,INSD:ES104529.1,INSD:DR232155.1,
FT                   INSD:EL314792.1,INSD:EH925024.1,INSD:EH894355.1,
FT                   INSD:EL205912.1,INSD:ES056559.1,INSD:AV556093.1,
FT                   INSD:BP842609.1,INSD:AV819270.1,INSD:AV832091.1,
FT                   INSD:AV812777.1,INSD:DR304352.1,INSD:ES215463.1,
FT                   INSD:ES212199.1,INSD:ES082943.1,INSD:BP867712.1,
FT                   INSD:ES150601.1,INSD:EL248397.1,INSD:EH951513.1,
FT                   INSD:EL208085.1,INSD:ES118292.1,INSD:EL994769.1,
FT                   INSD:BP568243.1,INSD:DR304355.1,INSD:ES092193.1,
FT                   INSD:EG440719.1,INSD:BP867413.1,INSD:EL290580.1,
FT                   INSD:DR304344.1,INSD:EL975472.1,INSD:EH928735.1,
FT                   INSD:EL972856.1,INSD:ES204610.1,INSD:BP819115.1,
FT                   INSD:ES050452.1,INSD:EH875815.1,INSD:EL986982.1,
FT                   INSD:DR304347.1,INSD:DR304348.1,INSD:EL329731.1,
FT                   INSD:ES133835.1,INSD:BP796372.1,INSD:EL969778.1,
FT                   INSD:BP597523.1,INSD:ES121123.1,INSD:ES196769.1,
FT                   INSD:EL321786.1,INSD:EL999433.1,INSD:BP830155.1,
FT                   INSD:DR304338.1,INSD:CK121074.1,INSD:EL999117.1,
FT                   INSD:EL215060.1,INSD:EH817098.1,INSD:EL983907.1,
FT                   INSD:BP848599.1,INSD:EL139508.1,INSD:EL973242.1,
FT                   INSD:ES190547.1,INSD:EL981566.1,INSD:EH828580.1,
FT                   INSD:EL071979.1,INSD:EH801120.1,INSD:EL172494.1,
FT                   INSD:DR304329.1,INSD:AV542849.1,INSD:ES101029.1,
FT                   INSD:DR304335.1,INSD:BP656099.1,INSD:Z29915.1,
FT                   INSD:BP835133.1,INSD:EL195357.1,INSD:BP846641.1,
FT                   INSD:EL234099.1,INSD:DR304328.1,INSD:EH957859.1,
FT                   INSD:EL988850.1,INSD:T76442.1,INSD:AV535588.1,
FT                   INSD:EH858229.1,INSD:BP662771.1,INSD:EH851444.1,
FT                   INSD:EH889656.1,INSD:ES135964.1,INSD:EH872740.1,
FT                   INSD:DR304336.1,INSD:ES196381.1,INSD:ES177775.1,
FT                   INSD:ES081772.1,INSD:BP630487.1,INSD:EL003526.1,
FT                   INSD:ES115274.1,INSD:Z33787.1,INSD:ES083674.1,
FT                   INSD:ES207044.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827751.1,INSD:BX827841.1,INSD:AF370471.1,
FT                   INSD:AY088038.1,INSD:BX828001.1,INSD:BT006543.1,
FT                   INSD:AB031739.1,INSD:AY057544.1"
FT   CDS_pept        join(37172..37194,37274..37346,37429..37567,37651..37837,
FT                   38090..38123)
FT                   /codon_start=1
FT                   /gene="RPS13A"
FT                   /gene_synonym="ATRPS13A"
FT                   /gene_synonym="F6N15.7"
FT                   /gene_synonym="F6N15_7"
FT                   /gene_synonym="PFL2"
FT                   /gene_synonym="POINTED FIRST LEAF 2"
FT                   /gene_synonym="RIBOSOMAL PROTEIN S13"
FT                   /gene_synonym="ribosomal protein S13A"
FT                   /gene_synonym="RPS13"
FT                   /locus_tag="AT4G00100"
FT                   /product="ribosomal protein S13A"
FT                   /note="ribosomal protein S13A (RPS13A); FUNCTIONS IN:
FT                   structural constituent of ribosome; INVOLVED IN:
FT                   translation, trichome morphogenesis, leaf morphogenesis,
FT                   cytokinesis by cell plate formation; LOCATED IN: cytosolic
FT                   small ribosomal subunit, nucleolus, membrane; EXPRESSED IN:
FT                   24 plant structures; EXPRESSED DURING: 14 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Ribosomal protein S13/S15,
FT                   N-terminal (InterPro:IPR012606), Ribosomal protein S15
FT                   (InterPro:IPR000589), S15/NS1, RNA-binding
FT                   (InterPro:IPR009068); BEST Arabidopsis thaliana protein
FT                   match is: Ribosomal protein S13/S15 (TAIR:AT3G60770.1); Has
FT                   1100 Blast hits to 1100 proteins in 416 species: Archae -
FT                   259; Bacteria - 0; Metazoa - 343; Fungi - 146; Plants -
FT                   139; Viruses - 0; Other Eukaryotes - 213 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:P59224"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59224"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP824697.1,INSD:AV549530.1,INSD:AV786844.1,
FT                   INSD:ES067714.1,INSD:AV549661.1,INSD:DR224781.1,
FT                   INSD:ES166063.1,INSD:AV536626.1,INSD:EL178698.1,
FT                   INSD:DR304326.1,INSD:ES147014.1,INSD:BP838079.1,
FT                   INSD:EL251386.1,INSD:EL282143.1,INSD:ES097327.1,
FT                   INSD:AV549768.1,INSD:BP852968.1,INSD:EL967525.1,
FT                   INSD:BP625685.1,INSD:ES093009.1,INSD:ES033671.1,
FT                   INSD:CK117735.1,INSD:ES031709.1,INSD:EL226416.1,
FT                   INSD:EH891250.1,INSD:ES153028.1,INSD:DR304334.1,
FT                   INSD:BP834856.1,INSD:ES054591.1,INSD:EG500187.1,
FT                   INSD:BP631217.1,INSD:EL256097.1,INSD:ES147468.1,
FT                   INSD:T14099.1,INSD:EH797917.1,INSD:EH906387.1,
FT                   INSD:DR304342.1,INSD:BP654406.1,INSD:DR304356.1,
FT                   INSD:EL156479.1,INSD:EL016644.1,INSD:CF774325.1,
FT                   INSD:BP852526.1,INSD:ES139445.1,INSD:DR224780.1,
FT                   INSD:EL050543.1,INSD:DR304357.1,INSD:CB258050.1,
FT                   INSD:DR233678.1,INSD:BP824293.1,INSD:EL013623.1,
FT                   INSD:EH911180.1,INSD:EH881687.1,INSD:EH937830.1,
FT                   INSD:ES061554.1,INSD:ES115563.1,INSD:BP855636.1,
FT                   INSD:BP836468.1,INSD:CF773247.1,INSD:EH931686.1,
FT                   INSD:EH965505.1,INSD:ES068434.1,INSD:EL143907.1,
FT                   INSD:DR304340.1,INSD:DR304354.1,INSD:DR304359.1,
FT                   INSD:DR304330.1,INSD:BP831928.1,INSD:ES151678.1,
FT                   INSD:DR304358.1,INSD:EL992629.1,INSD:ES147606.1,
FT                   INSD:DR304337.1,INSD:ES173058.1,INSD:DR304331.1,
FT                   INSD:BP836262.1,INSD:ES087345.1,INSD:EL109201.1,
FT                   INSD:EH839786.1,INSD:EG515403.1,INSD:EL080103.1,
FT                   INSD:ES024216.1,INSD:ES031922.1,INSD:ES068017.1,
FT                   INSD:ES209348.1,INSD:AV819808.1,INSD:ES058341.1,
FT                   INSD:AV787854.1,INSD:ES113793.1,INSD:CB260666.1,
FT                   INSD:EL206020.1,INSD:EH969044.1,INSD:ES061931.1,
FT                   INSD:EH976206.1,INSD:ES180462.1,INSD:EL218396.1,
FT                   INSD:ES075100.1,INSD:BP591378.1,INSD:EL060723.1,
FT                   INSD:EL978876.1,INSD:EH824348.1,INSD:ES030994.1,
FT                   INSD:ES189487.1,INSD:DR304350.1,INSD:EG515391.1,
FT                   INSD:EH947432.1,INSD:EL288408.1,INSD:EL237882.1,
FT                   INSD:BP799200.1,INSD:ES116558.1,INSD:ES014539.1,
FT                   INSD:BP863003.1,INSD:BP803235.1,INSD:DR304327.1,
FT                   INSD:EL065863.1,INSD:DR304339.1,INSD:ES006370.1,
FT                   INSD:EL991513.1,INSD:ES060115.1,INSD:BP834223.1,
FT                   INSD:ES095125.1,INSD:DR304343.1,INSD:EL207383.1,
FT                   INSD:EL247820.1,INSD:EL210313.1,INSD:EL155889.1,
FT                   INSD:ES092931.1,INSD:ES189365.1,INSD:ES082246.1,
FT                   INSD:BP858371.1,INSD:DR304353.1,INSD:EL151216.1,
FT                   INSD:ES070820.1,INSD:DR235821.1,INSD:EL137130.1,
FT                   INSD:EH845765.1,INSD:EH842935.1,INSD:EL190719.1,
FT                   INSD:EL983090.1,INSD:EL155598.1,INSD:DR304351.1,
FT                   INSD:AV819151.1,INSD:ES132234.1,INSD:ES214500.1,
FT                   INSD:EH803064.1,INSD:ES182960.1,INSD:EL210311.1,
FT                   INSD:EH822496.1,INSD:BP572958.1,INSD:ES042453.1,
FT                   INSD:BP564674.1,INSD:DR304332.1,INSD:EL095528.1,
FT                   INSD:EL192635.1,INSD:EL299407.1,INSD:ES018687.1,
FT                   INSD:ES063886.1,INSD:ES197572.1,INSD:EL182374.1,
FT                   INSD:BP562325.2,INSD:DR304349.1,INSD:ES188164.1,
FT                   INSD:EL137604.1,INSD:EG500185.1,INSD:EH920779.1,
FT                   INSD:EH979501.1,INSD:AA597802.1,INSD:ES123672.1,
FT                   INSD:ES063885.1,INSD:DR304346.1,INSD:BP583926.1,
FT                   INSD:DR304345.1,INSD:EH923689.1,INSD:ES130448.1,
FT                   INSD:DR304333.1,INSD:EH939484.1,INSD:ES076506.1,
FT                   INSD:ES019754.1,INSD:DR304341.1,INSD:CB260925.1,
FT                   INSD:EL328095.1,INSD:BP623444.1,INSD:BP586799.1,
FT                   INSD:EL240285.1,INSD:ES146564.1,INSD:DR370660.1,
FT                   INSD:ES016659.1,INSD:BP803381.1,INSD:EL071105.1,
FT                   INSD:CK118109.1,INSD:EL275467.1,INSD:ES065669.1,
FT                   INSD:CB074138.1,INSD:BP787136.1,INSD:ES192941.1,
FT                   INSD:R90398.1,INSD:AV787944.1,INSD:ES054574.1,
FT                   INSD:BP634777.1,INSD:EL991423.1,INSD:ES106859.1,
FT                   INSD:AV806992.1,INSD:ES104584.1,INSD:ES129548.1,
FT                   INSD:ES163112.1,INSD:BP847036.2,INSD:EL171902.1,
FT                   INSD:ES051639.1,INSD:EL281913.1,INSD:EG502328.1,
FT                   INSD:EH978700.1,INSD:EH974690.1,INSD:ES142346.1,
FT                   INSD:EL071462.1,INSD:AV829596.1,INSD:BP623779.1,
FT                   INSD:ES071175.1,INSD:ES104529.1,INSD:DR232155.1,
FT                   INSD:EL314792.1,INSD:EH925024.1,INSD:EH894355.1,
FT                   INSD:EL205912.1,INSD:ES056559.1,INSD:AV556093.1,
FT                   INSD:BP842609.1,INSD:AV819270.1,INSD:AV832091.1,
FT                   INSD:AV812777.1,INSD:DR304352.1,INSD:ES215463.1,
FT                   INSD:ES212199.1,INSD:ES082943.1,INSD:BP867712.1,
FT                   INSD:ES150601.1,INSD:EL248397.1,INSD:EH951513.1,
FT                   INSD:EL208085.1,INSD:ES118292.1,INSD:EL994769.1,
FT                   INSD:BP568243.1,INSD:DR304355.1,INSD:ES092193.1,
FT                   INSD:EG440719.1,INSD:BP867413.1,INSD:EL290580.1,
FT                   INSD:DR304344.1,INSD:EL975472.1,INSD:EH928735.1,
FT                   INSD:EL972856.1,INSD:ES204610.1,INSD:BP819115.1,
FT                   INSD:ES050452.1,INSD:EH875815.1,INSD:EL986982.1,
FT                   INSD:DR304347.1,INSD:DR304348.1,INSD:EL329731.1,
FT                   INSD:ES133835.1,INSD:BP796372.1,INSD:EL969778.1,
FT                   INSD:BP597523.1,INSD:ES121123.1,INSD:ES196769.1,
FT                   INSD:EL321786.1,INSD:EL999433.1,INSD:BP830155.1,
FT                   INSD:DR304338.1,INSD:CK121074.1,INSD:EL999117.1,
FT                   INSD:EL215060.1,INSD:EH817098.1,INSD:EL983907.1,
FT                   INSD:BP848599.1,INSD:EL139508.1,INSD:EL973242.1,
FT                   INSD:ES190547.1,INSD:EL981566.1,INSD:EH828580.1,
FT                   INSD:EL071979.1,INSD:EH801120.1,INSD:EL172494.1,
FT                   INSD:DR304329.1,INSD:AV542849.1,INSD:ES101029.1,
FT                   INSD:DR304335.1,INSD:BP656099.1,INSD:Z29915.1,
FT                   INSD:BP835133.1,INSD:EL195357.1,INSD:BP846641.1,
FT                   INSD:EL234099.1,INSD:DR304328.1,INSD:EH957859.1,
FT                   INSD:EL988850.1,INSD:T76442.1,INSD:AV535588.1,
FT                   INSD:EH858229.1,INSD:BP662771.1,INSD:EH851444.1,
FT                   INSD:EH889656.1,INSD:ES135964.1,INSD:EH872740.1,
FT                   INSD:DR304336.1,INSD:ES196381.1,INSD:ES177775.1,
FT                   INSD:ES081772.1,INSD:BP630487.1,INSD:EL003526.1,
FT                   INSD:ES115274.1,INSD:Z33787.1,INSD:ES083674.1,
FT                   INSD:ES207044.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827751.1,INSD:BX827841.1,INSD:AF370471.1,
FT                   INSD:AY088038.1,INSD:BX828001.1,INSD:BT006543.1,
FT                   INSD:AB031739.1,INSD:AY057544.1"
FT                   /protein_id="AEE81823.1"
FT                   /translation="MGRMHSRGKGISASALPYKRSSPSWLKTTSQDVDESICKFAKKGL
FT                   TPSQIGVILRDSHGIPQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLER
FT                   NRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA"
FT   gene            complement(38480..40298)
FT                   /gene="GAE3"
FT                   /gene_synonym="F6N15.16"
FT                   /gene_synonym="F6N15_16"
FT                   /gene_synonym="UDP-D-glucuronate 4-epimerase 3"
FT                   /locus_tag="AT4G00110"
FT                   /note="Encodes a putative membrane-anchored
FT                   UDP-D-glucuronate 4-epimerase."
FT   mRNA            complement(38480..40298)
FT                   /gene="GAE3"
FT                   /gene_synonym="F6N15.16"
FT                   /gene_synonym="F6N15_16"
FT                   /gene_synonym="UDP-D-glucuronate 4-epimerase 3"
FT                   /locus_tag="AT4G00110"
FT                   /product="UDP-D-glucuronate 4-epimerase 3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU239050.2,INSD:ES146337.1,INSD:AV537410.1,
FT                   INSD:DR228762.1,INSD:ES209268.1,INSD:BP819739.1,
FT                   INSD:BP640947.1,INSD:ES049328.1,INSD:ES059686.1,
FT                   INSD:AV531722.1,INSD:EH877662.1,INSD:AA713006.1,
FT                   INSD:DR228763.1,INSD:AI999619.1,INSD:AU230316.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT026487.1,INSD:BX828423.1,INSD:AK118198.1,
FT                   INSD:BX826334.1,INSD:BX828258.1"
FT   CDS_pept        complement(38702..39994)
FT                   /codon_start=1
FT                   /gene="GAE3"
FT                   /gene_synonym="F6N15.16"
FT                   /gene_synonym="F6N15_16"
FT                   /gene_synonym="UDP-D-glucuronate 4-epimerase 3"
FT                   /locus_tag="AT4G00110"
FT                   /product="UDP-D-glucuronate 4-epimerase 3"
FT                   /note="UDP-D-glucuronate 4-epimerase 3 (GAE3); FUNCTIONS
FT                   IN: UDP-glucuronate 4-epimerase activity, catalytic
FT                   activity; INVOLVED IN: cellular metabolic process,
FT                   carbohydrate metabolic process, nucleotide-sugar metabolic
FT                   process, metabolic process; LOCATED IN: membrane; EXPRESSED
FT                   IN: 23 plant structures; EXPRESSED DURING: 15 growth
FT                   stages; CONTAINS InterPro DOMAIN/s: NAD-dependent
FT                   epimerase/dehydratase (InterPro:IPR001509), NAD(P)-binding
FT                   domain (InterPro:IPR016040), Nucleotide sugar epimerase
FT                   (InterPro:IPR008089); BEST Arabidopsis thaliana protein
FT                   match is: UDP-D-glucuronate 4-epimerase 2
FT                   (TAIR:AT1G02000.1); Has 43399 Blast hits to 43389 proteins
FT                   in 2971 species: Archae - 792; Bacteria - 26013; Metazoa -
FT                   773; Fungi - 412; Plants - 1214; Viruses - 37; Other
FT                   Eukaryotes - 14158 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00110"
FT                   /db_xref="GOA:O81312"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:O81312"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU239050.2,INSD:ES146337.1,INSD:AV537410.1,
FT                   INSD:DR228762.1,INSD:ES209268.1,INSD:BP819739.1,
FT                   INSD:BP640947.1,INSD:ES049328.1,INSD:ES059686.1,
FT                   INSD:AV531722.1,INSD:EH877662.1,INSD:AA713006.1,
FT                   INSD:DR228763.1,INSD:AI999619.1,INSD:AU230316.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT026487.1,INSD:BX828423.1,INSD:AK118198.1,
FT                   INSD:BX826334.1,INSD:BX828258.1"
FT                   /protein_id="AEE81824.1"
FT                   /translation="MKQMSHLDDIPSTPGKFKPYFHRTRWQSSVAKLAFWSLVFVGLIF
FT                   IFFYRSPVSSNPADPSRRSLRTYSWGGPAWEKRVRSSARLRTRRGFSVLVTGAAGFVGT
FT                   HVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEV
FT                   VPFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLLEVCKSANPQPAIVWASSSSVYG
FT                   LNTKVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDM
FT                   AYFFFTRDILKGKAISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRG
FT                   AAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQREL
FT                   GYKPTTDLQTGLKKFARWYLGYYNGGKKAAS"
FT   gene            complement(40862..41383)
FT                   /pseudo
FT                   /locus_tag="AT4G00114"
FT                   /note="pseudogene of transketolase"
FT   misc_RNA        complement(40862..41383)
FT                   /pseudo
FT                   /locus_tag="AT4G00114"
FT                   /note="pseudogene of Transketolase; AT4G00114.1"
FT   gene            complement(41665..43197)
FT                   /gene="IND"
FT                   /gene_synonym="EDA33"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 33"
FT                   /gene_synonym="F6N15.18"
FT                   /gene_synonym="F6N15_18"
FT                   /gene_synonym="GT140"
FT                   /gene_synonym="IND1"
FT                   /gene_synonym="INDEHISCENT"
FT                   /locus_tag="AT4G00120"
FT   mRNA            complement(41665..43197)
FT                   /gene="IND"
FT                   /gene_synonym="EDA33"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 33"
FT                   /gene_synonym="F6N15.18"
FT                   /gene_synonym="F6N15_18"
FT                   /gene_synonym="GT140"
FT                   /gene_synonym="IND1"
FT                   /gene_synonym="INDEHISCENT"
FT                   /locus_tag="AT4G00120"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES015557.1,INSD:BX836394.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT029443.1,INSD:AF488578.1"
FT   CDS_pept        complement(42601..43197)
FT                   /codon_start=1
FT                   /gene="IND"
FT                   /gene_synonym="EDA33"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 33"
FT                   /gene_synonym="F6N15.18"
FT                   /gene_synonym="F6N15_18"
FT                   /gene_synonym="GT140"
FT                   /gene_synonym="IND1"
FT                   /gene_synonym="INDEHISCENT"
FT                   /locus_tag="AT4G00120"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /note="INDEHISCENT (IND); FUNCTIONS IN: DNA binding,
FT                   sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: polar nucleus fusion, regulation of
FT                   transcription; LOCATED IN: nucleus; CONTAINS InterPro
FT                   DOMAIN/s: Helix-loop-helix DNA-binding domain
FT                   (InterPro:IPR001092), Helix-loop-helix DNA-binding
FT                   (InterPro:IPR011598); BEST Arabidopsis thaliana protein
FT                   match is: basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein (TAIR:AT5G09750.1); Has 2280 Blast hits
FT                   to 2276 proteins in 91 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 0; Fungi - 0; Plants - 2280; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="GOA:O81313"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/Swiss-Prot:O81313"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES015557.1,INSD:BX836394.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT029443.1,INSD:AF488578.1"
FT                   /protein_id="AEE81825.1"
FT                   /translation="MENGMYKKKGVCDSCVSSKSRSNHSPKRSMMEPQPHHLLMDWNKA
FT                   NDLLTQEHAAFLNDPHHLMLDPPPETLIHLDEDEEYDEDMDAMKEMQYMIAVMQPVDID
FT                   PATVPKPNRRNVRISDDPQTVVARRRRERISEKIRILKRIVPGGAKMDTASMLDEAIRY
FT                   TKFLKRQVRILQPHSQIGAPMANPSYLCYYHNSQP"
FT   gene            48114..49068
FT                   /gene_synonym="F6N15.6"
FT                   /gene_synonym="F6N15_6"
FT                   /locus_tag="AT4G00130"
FT   mRNA            join(48114..48506,48577..49068)
FT                   /gene_synonym="F6N15.6"
FT                   /gene_synonym="F6N15_6"
FT                   /locus_tag="AT4G00130"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG460462.1,INSD:EG460465.1,INSD:EG460471.1,
FT                   INSD:EG460472.1,INSD:EG460464.1,INSD:EG460459.1,
FT                   INSD:EG460475.1,INSD:EG460458.1,INSD:EG460467.1,
FT                   INSD:EG460456.1,INSD:EG460457.1,INSD:EG460466.1,
FT                   INSD:EG460470.1,INSD:EG460460.1,INSD:EG460468.1,
FT                   INSD:EG460473.1,INSD:EG460469.1,INSD:EG460455.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ446786.1"
FT   CDS_pept        join(48414..48506,48577..49068)
FT                   /codon_start=1
FT                   /gene_synonym="F6N15.6"
FT                   /gene_synonym="F6N15_6"
FT                   /locus_tag="AT4G00130"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /note="DNA-binding storekeeper protein-related
FT                   transcriptional regulator; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: mitochondrion; CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF573
FT                   (InterPro:IPR007592); BEST Arabidopsis thaliana protein
FT                   match is: DNA-binding storekeeper protein-related
FT                   transcriptional regulator (TAIR:AT4G25210.1); Has 94 Blast
FT                   hits to 94 proteins in 6 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 0; Fungi - 0; Plants - 93; Viruses - 0; Other
FT                   Eukaryotes - 1 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00130"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00130.1"
FT                   /db_xref="GOA:Q1PED2"
FT                   /db_xref="InterPro:IPR007592"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1PED2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG460462.1,INSD:EG460465.1,INSD:EG460471.1,
FT                   INSD:EG460472.1,INSD:EG460464.1,INSD:EG460459.1,
FT                   INSD:EG460475.1,INSD:EG460458.1,INSD:EG460467.1,
FT                   INSD:EG460456.1,INSD:EG460457.1,INSD:EG460466.1,
FT                   INSD:EG460470.1,INSD:EG460460.1,INSD:EG460468.1,
FT                   INSD:EG460473.1,INSD:EG460469.1,INSD:EG460455.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ446786.1"
FT                   /protein_id="AEE81827.1"
FT                   /translation="MMRLRRLLERMLRRCCFRDCSVRLTKSLCFKKLIEFDATKNQIVT
FT                   KLQRLKKKFNNAVKNARKKGQTEDEVEYAKESEKKRFDLSIMIWGSNGVLVAGKSSKKK
FT                   VAPKEMKPEETDAKVVNEGLSIGREMVPFGSSCGLDESKLTTGWENVEDGAEKREVEEK
FT                   WKKFKDKLFELLYERSVLMNKTEAMMFKAES"
FT   gene            complement(51166..53449)
FT                   /gene="EDA34"
FT                   /gene_synonym="embryo sac development arrest 34"
FT                   /gene_synonym="F6N15.19"
FT                   /gene_synonym="F6N15_19"
FT                   /locus_tag="AT4G00140"
FT   mRNA            complement(join(51166..51464,52320..52523,52760..52859,
FT                   53279..53449))
FT                   /gene="EDA34"
FT                   /gene_synonym="embryo sac development arrest 34"
FT                   /gene_synonym="F6N15.19"
FT                   /gene_synonym="F6N15_19"
FT                   /locus_tag="AT4G00140"
FT                   /product="Calcium-binding EF-hand family protein"
FT   CDS_pept        complement(join(51166..51464,52320..52523,52760..52859,
FT                   53279..53449))
FT                   /codon_start=1
FT                   /gene="EDA34"
FT                   /gene_synonym="embryo sac development arrest 34"
FT                   /gene_synonym="F6N15.19"
FT                   /gene_synonym="F6N15_19"
FT                   /locus_tag="AT4G00140"
FT                   /product="Calcium-binding EF-hand family protein"
FT                   /note="embryo sac development arrest 34 (EDA34); INVOLVED
FT                   IN: polar nucleus fusion; LOCATED IN: chloroplast; BEST
FT                   Arabidopsis thaliana protein match is: calmodulin-related
FT                   (TAIR:AT1G73440.1); Has 80 Blast hits to 56 proteins in 14
FT                   species: Archae - 3; Bacteria - 0; Metazoa - 4; Fungi - 0;
FT                   Plants - 72; Viruses - 0; Other Eukaryotes - 1 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:O81315"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:O81315"
FT                   /protein_id="AEE81828.1"
FT                   /translation="MARGESEGESSGSERESSSSSSGNESEPIKGKISEYEKQRLSRIA
FT                   ENKARLDALGIPAIALSLQGSVAGGSRTKNTRSDKEAATMKKKRQEGGKGFITRRDVAK
FT                   MATVHDFTWTEEELQDMIRSFDMDKDGKVGTKLKVFTFIRETLLLNIFNFGQLSCRSSD
FT                   GTGRTDRSSDGMDREKCSRKHKDKCIRTHPRVAHGCNLTGKGRKHQEWVRNVIHHIGST
FT                   SRPPSCIYLLSHGETDQRSVRPKGDSMDNQRESPR"
FT   gene            complement(57140..59495)
FT                   /gene="HAM3"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HAIRY MERISTEM 3"
FT                   /gene_synonym="ATHAM3"
FT                   /gene_synonym="F6N15.20"
FT                   /gene_synonym="F6N15_20"
FT                   /gene_synonym="HAIRY MERISTEM 3"
FT                   /gene_synonym="LOM3"
FT                   /gene_synonym="LOST MERISTEMS 3"
FT                   /gene_synonym="SCL6-IV"
FT                   /locus_tag="AT4G00150"
FT                   /note="Belongs to one of the LOM (LOST MERISTEMS) genes:
FT                   AT2G45160 (LOM1), AT3G60630 (LOM2) and AT4G00150 (LOM3).
FT                   LOM1 and LOM2 promote cell differentiation at the periphery
FT                   of shoot meristems and help to maintain their polar
FT                   organization."
FT   mRNA            complement(57140..59495)
FT                   /gene="HAM3"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HAIRY MERISTEM 3"
FT                   /gene_synonym="ATHAM3"
FT                   /gene_synonym="F6N15.20"
FT                   /gene_synonym="F6N15_20"
FT                   /gene_synonym="HAIRY MERISTEM 3"
FT                   /gene_synonym="LOM3"
FT                   /gene_synonym="LOST MERISTEMS 3"
FT                   /gene_synonym="SCL6-IV"
FT                   /locus_tag="AT4G00150"
FT                   /product="GRAS family transcription factor"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV784233.1,INSD:EH850304.1,INSD:ES147779.1,
FT                   INSD:AU229264.1,INSD:EH876796.1,INSD:EL155217.1,
FT                   INSD:EL128315.1,INSD:ES143607.1,INSD:AV546622.1,
FT                   INSD:BX840058.1,INSD:AV814723.1,INSD:BX840175.1,
FT                   INSD:AV546623.1,INSD:EG466862.1,INSD:EH853239.1,
FT                   INSD:EL191798.1,INSD:AV803418.1,INSD:EL297121.1,
FT                   INSD:DR750128.1,INSD:EL006586.1,INSD:AU238127.1,
FT                   INSD:DR359301.1,INSD:AI997646.1,INSD:DR750129.1,
FT                   INSD:EL067511.1,INSD:BP777981.1,INSD:EL099453.1,
FT                   INSD:F13949.1,INSD:EL107982.1,INSD:EH873657.1,
FT                   INSD:ES090209.1,INSD:BE530322.1,INSD:AV823294.1,
FT                   INSD:EL244454.1,INSD:ES148257.1,INSD:EL336090.1,
FT                   INSD:BX836127.1,INSD:EL265724.1,INSD:ES128515.1,
FT                   INSD:BP779723.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX826491.1,INSD:AF036303.1,INSD:BX827001.1,
FT                   INSD:AF462831.1,INSD:BX826648.1,INSD:AY133537.1"
FT   CDS_pept        complement(57429..59105)
FT                   /codon_start=1
FT                   /gene="HAM3"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HAIRY MERISTEM 3"
FT                   /gene_synonym="ATHAM3"
FT                   /gene_synonym="F6N15.20"
FT                   /gene_synonym="F6N15_20"
FT                   /gene_synonym="HAIRY MERISTEM 3"
FT                   /gene_synonym="LOM3"
FT                   /gene_synonym="LOST MERISTEMS 3"
FT                   /gene_synonym="SCL6-IV"
FT                   /locus_tag="AT4G00150"
FT                   /product="GRAS family transcription factor"
FT                   /note="HAIRY MERISTEM 3 (HAM3); FUNCTIONS IN:
FT                   sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: regulation of transcription; LOCATED
FT                   IN: chloroplast; EXPRESSED IN: 22 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Transcription factor GRAS (InterPro:IPR005202);
FT                   BEST Arabidopsis thaliana protein match is: GRAS family
FT                   transcription factor (TAIR:AT2G45160.1); Has 2283 Blast
FT                   hits to 2233 proteins in 293 species: Archae - 0; Bacteria
FT                   - 2; Metazoa - 0; Fungi - 0; Plants - 2281; Viruses - 0;
FT                   Other Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="GOA:O81316"
FT                   /db_xref="InterPro:IPR005202"
FT                   /db_xref="UniProtKB/Swiss-Prot:O81316"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV784233.1,INSD:EH850304.1,INSD:ES147779.1,
FT                   INSD:AU229264.1,INSD:EH876796.1,INSD:EL155217.1,
FT                   INSD:EL128315.1,INSD:ES143607.1,INSD:AV546622.1,
FT                   INSD:BX840058.1,INSD:AV814723.1,INSD:BX840175.1,
FT                   INSD:AV546623.1,INSD:EG466862.1,INSD:EH853239.1,
FT                   INSD:EL191798.1,INSD:AV803418.1,INSD:EL297121.1,
FT                   INSD:DR750128.1,INSD:EL006586.1,INSD:AU238127.1,
FT                   INSD:DR359301.1,INSD:AI997646.1,INSD:DR750129.1,
FT                   INSD:EL067511.1,INSD:BP777981.1,INSD:EL099453.1,
FT                   INSD:F13949.1,INSD:EL107982.1,INSD:EH873657.1,
FT                   INSD:ES090209.1,INSD:BE530322.1,INSD:AV823294.1,
FT                   INSD:EL244454.1,INSD:ES148257.1,INSD:EL336090.1,
FT                   INSD:BX836127.1,INSD:EL265724.1,INSD:ES128515.1,
FT                   INSD:BP779723.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX826491.1,INSD:AF036303.1,INSD:BX827001.1,
FT                   INSD:AF462831.1,INSD:BX826648.1,INSD:AY133537.1"
FT                   /protein_id="AEE81829.1"
FT                   /translation="MPLPFEEFQGKGISCFSSFSSSFPQPPSSPLLSHRKARGGEEEEE
FT                   EVPAAEPTSVLDSLISPTSSSTVSSSHGGNSAVGGGGDATTDEQCGAIGLGDWEEQVPH
FT                   DHEQSILGLIMGDSTDPSLELNSILQTSPTFHDSDYSSPGFGVVDTGFGLDHHSVPPSH
FT                   VSGLLINQSQTHYTQNPAAIFYGHHHHTPPPAKRLNPGPVGITEQLVKAAEVIESDTCL
FT                   AQGILARLNQQLSSPVGKPLERAAFYFKEALNNLLHNVSQTLNPYSLIFKIAAYKSFSE
FT                   ISPVLQFANFTSNQALLESFHGFHRLHIIDFDIGYGGQWASLMQELVLRDNAAPLSLKI
FT                   TVFASPANHDQLELGFTQDNLKHFASEINISLDIQVLSLDLLGSISWPNSSEKEAVAVN
FT                   ISAASFSHLPLVLRFVKHLSPTIIVCSDRGCERTDLPFSQQLAHSLHSHTALFESLDAV
FT                   NANLDAMQKIERFLIQPEIEKLVLDRSRPIERPMMTWQAMFLQMGFSPVTHSNFTESQA
FT                   ECLVQRTPVRGFHVEKKHNSLLLCWQRTELVGVSAWRCRSS"
FT   gene            <62235..62567
FT                   /locus_tag="AT4G00155"
FT   mRNA            <62235..62567
FT                   /locus_tag="AT4G00155"
FT                   /product="retrotransposon Gag"
FT   CDS_pept        <62235..62567
FT                   /codon_start=1
FT                   /locus_tag="AT4G00155"
FT                   /product="retrotransposon Gag"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00155"
FT                   /db_xref="InterPro:IPR005162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B386"
FT                   /protein_id="ANM66050.1"
FT                   /translation="QAASWWQQKQKTRKRAGKNPIKSWDKLKEKLCKTFLPPHYTSSVS
FT                   NRLKNVKQRAGFGDDFTRNCHVHVNNFVEKPTYDRDCYVQDNDFVDKPVHVIYDDENND
FT                   LSPICI"
FT   gene            63410..65479
FT                   /gene_synonym="F6N15.5"
FT                   /gene_synonym="F6N15_5"
FT                   /locus_tag="AT4G00160"
FT   mRNA            join(63410..63475,63850..64726,64801..64935,65027..65479)
FT                   /gene_synonym="F6N15.5"
FT                   /gene_synonym="F6N15_5"
FT                   /locus_tag="AT4G00160"
FT                   /product="F-box/RNI-like/FBD-like domains-containing
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR372030.1,INSD:DR327812.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY085107.1"
FT   CDS_pept        join(63465..63475,63850..64726,64801..64935,65027..65365)
FT                   /codon_start=1
FT                   /gene_synonym="F6N15.5"
FT                   /gene_synonym="F6N15_5"
FT                   /locus_tag="AT4G00160"
FT                   /product="F-box/RNI-like/FBD-like domains-containing
FT                   protein"
FT                   /note="F-box/RNI-like/FBD-like domains-containing protein;
FT                   CONTAINS InterPro DOMAIN/s: FBD (InterPro:IPR013596), F-box
FT                   domain, cyclin-like (InterPro:IPR001810), F-box domain,
FT                   Skp2-like (InterPro:IPR022364), FBD-like
FT                   (InterPro:IPR006566), Leucine-rich repeat 2
FT                   (InterPro:IPR013101); BEST Arabidopsis thaliana protein
FT                   match is: F-box/RNI-like/FBD-like domains-containing
FT                   protein (TAIR:AT3G52680.2); Has 2232 Blast hits to 2187
FT                   proteins in 26 species: Archae - 0; Bacteria - 0; Metazoa -
FT                   0; Fungi - 0; Plants - 2232; Viruses - 0; Other Eukaryotes
FT                   - 0 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8LF09"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LF09"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR372030.1,INSD:DR327812.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY085107.1"
FT                   /protein_id="AEE81830.1"
FT                   /translation="MEQGESLRIRVVMGKDRISELPDALLIKILSFLPTKIVVATSVFS
FT                   KQWRPLWKLVPNLEFDSEDYDDKEQYTFSEIVCKSFLSHKAPVLESFRLEFESEKVDPV
FT                   DIGLWVGIAFSRHLRELVLVAADTGTGTAFKFPSSLCTCNTLETLRLVLLILVDISSPV
FT                   VMKSLRTLHLELVSYKDESSIRNLLSGCPILEELLVIRGEDSDIEVFTIDEVPSLKRLT
FT                   INDDHDGQEFWGYVINAPSLKYLLIEDLRCPGFCLNAPELMEANIFDGTSITNDNFLGY
FT                   LTSVKRLLLNLSPWKITYPTGSIFYQLVSLEMYTREIDWWDLLTLMLEHSPKLQVLKLT
FT                   DNCVKFHKNGLPGGKWNEPKYVPECLLSHLETFVWRRFDWGREEEKEIATYILKNARRL
FT                   NKATFSTNPVNSEELDKLKERRKVHNELDGVVRASNSCQFVFKFDTSYHVSDSS"
FT   gene            69145..69877
FT                   /locus_tag="AT4G00163"
FT   mRNA            join(69145..69204,69409..69529,69543..69877)
FT                   /locus_tag="AT4G00163"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(69145..69204,69409..69529,69543..69877)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B630"
FT                   /protein_id="ANM67045.1"
FT                   /translation="MEIAGAHWENLAHFLSSSSLGDRAHIIISADESLRNIFAARVEKQ
FT                   SESNGNFDRSNSENAVHRQTAASKSAKPLMSEQHSWLGGVPMTSLTRPNQLPHTPNLSV
FT                   SLGHFVVACFAGGGGHGLTVAPGVTWPKKNVMLRSSKMRRDRKAFEIPIRFILKLVLCD
FT                   TYEEEERP"
FT   gene            complement(69230..69957)
FT                   /locus_tag="AT4G00165"
FT   mRNA            complement(69230..69957)
FT                   /locus_tag="AT4G00165"
FT                   /product="Bifunctional inhibitor/lipid-transfer
FT                   protein/seed storage 2S albumin superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR314338.1,INSD:DR314346.1,INSD:ES118327.1,
FT                   INSD:CF773045.1,INSD:AV531491.1,INSD:EH951362.1,
FT                   INSD:DR314335.1,INSD:DR359403.1,INSD:DR314331.1,
FT                   INSD:DR314326.1,INSD:DR374964.1,INSD:DR314323.1,
FT                   INSD:EH910250.1,INSD:DR314327.1,INSD:EL281658.1,
FT                   INSD:DR314328.1,INSD:DR314348.1,INSD:EL225340.1,
FT                   INSD:DR314343.1,INSD:DR314324.1,INSD:DR314339.1,
FT                   INSD:DR314333.1,INSD:DR314341.1,INSD:DR314345.1,
FT                   INSD:DR314322.1,INSD:DR314332.1,INSD:DR314336.1,
FT                   INSD:DR382208.1,INSD:EG526286.1,INSD:DR359404.1,
FT                   INSD:EH894680.1,INSD:DR314342.1,INSD:DR314349.1,
FT                   INSD:DR314337.1,INSD:EL228900.1,INSD:EG526287.1,
FT                   INSD:DR314347.1,INSD:EH832732.1,INSD:EL089831.1,
FT                   INSD:DR314330.1,INSD:BP864085.1,INSD:DR314334.1,
FT                   INSD:DR314329.1,INSD:EL310375.1,INSD:DR314325.1,
FT                   INSD:DR314340.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT020288.1"
FT   mRNA            complement(join(69273..69370,69391..69884))
FT                   /locus_tag="AT4G00165"
FT                   /product="Bifunctional inhibitor/lipid-transfer
FT                   protein/seed storage 2S albumin superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR314338.1,INSD:ES118327.1,INSD:CF773045.1,
FT                   INSD:AV531491.1,INSD:EH951362.1,INSD:DR314335.1,
FT                   INSD:DR314331.1,INSD:DR314326.1,INSD:DR314323.1,
FT                   INSD:EH910250.1,INSD:DR314327.1,INSD:EL281658.1,
FT                   INSD:EL086220.1,INSD:DR314328.1,INSD:EL225340.1,
FT                   INSD:DR314343.1,INSD:DR314324.1,INSD:DR314333.1,
FT                   INSD:DR314341.1,INSD:DR314345.1,INSD:DR314332.1,
FT                   INSD:AV824243.2,INSD:DR314336.1,INSD:EL208023.1,
FT                   INSD:EG526286.1,INSD:EL312561.1,INSD:EH894680.1,
FT                   INSD:DR314342.1,INSD:DR314337.1,INSD:EL228900.1,
FT                   INSD:EG526287.1,INSD:DR314347.1,INSD:EH832732.1,
FT                   INSD:EL089831.1,INSD:BP623844.1,INSD:AV785453.1,
FT                   INSD:DR314330.1,INSD:BP864085.1,INSD:DR314344.1,
FT                   INSD:DR314334.1,INSD:EL310375.1,INSD:AV786255.1,
FT                   INSD:DR314340.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX829017.1,INSD:BX826684.1,INSD:AY093771.1,
FT                   INSD:BT020288.1,INSD:BX829207.1"
FT   CDS_pept        complement(69433..69819)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00165"
FT                   /product="Bifunctional inhibitor/lipid-transfer
FT                   protein/seed storage 2S albumin superfamily protein"
FT                   /note="Bifunctional inhibitor/lipid-transfer protein/seed
FT                   storage 2S albumin superfamily protein; FUNCTIONS IN: lipid
FT                   binding; INVOLVED IN: N-terminal protein myristoylation,
FT                   lipid transport; LOCATED IN: endomembrane system; CONTAINS
FT                   InterPro DOMAIN/s: Bifunctional inhibitor/plant lipid
FT                   transfer protein/seed storage (InterPro:IPR016140), Plant
FT                   lipid transfer protein/seed storage/trypsin-alpha amylase
FT                   inhibitor (InterPro:IPR003612), Plant lipid transfer
FT                   protein/hydrophobic protein, helical domain
FT                   (InterPro:IPR013770); BEST Arabidopsis thaliana protein
FT                   match is: Bifunctional inhibitor/lipid-transfer
FT                   protein/seed storage 2S albumin superfamily protein
FT                   (TAIR:AT2G45180.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00165"
FT                   /db_xref="GOA:Q8RW93"
FT                   /db_xref="InterPro:IPR016140"
FT                   /db_xref="InterPro:IPR027923"
FT                   /db_xref="InterPro:IPR036312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RW93"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR314338.1,INSD:ES118327.1,INSD:CF773045.1,
FT                   INSD:AV531491.1,INSD:EH951362.1,INSD:DR314335.1,
FT                   INSD:DR314331.1,INSD:DR314326.1,INSD:DR314323.1,
FT                   INSD:EH910250.1,INSD:DR314327.1,INSD:EL281658.1,
FT                   INSD:EL086220.1,INSD:DR314328.1,INSD:EL225340.1,
FT                   INSD:DR314343.1,INSD:DR314324.1,INSD:DR314333.1,
FT                   INSD:DR314341.1,INSD:DR314345.1,INSD:DR314332.1,
FT                   INSD:AV824243.2,INSD:DR314336.1,INSD:EL208023.1,
FT                   INSD:EG526286.1,INSD:EL312561.1,INSD:EH894680.1,
FT                   INSD:DR314342.1,INSD:DR314337.1,INSD:EL228900.1,
FT                   INSD:EG526287.1,INSD:DR314347.1,INSD:EH832732.1,
FT                   INSD:EL089831.1,INSD:BP623844.1,INSD:AV785453.1,
FT                   INSD:DR314330.1,INSD:BP864085.1,INSD:DR314344.1,
FT                   INSD:DR314334.1,INSD:EL310375.1,INSD:AV786255.1,
FT                   INSD:DR314340.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX829017.1,INSD:BX826684.1,INSD:AY093771.1,
FT                   INSD:BT020288.1,INSD:BX829207.1"
FT                   /protein_id="AEE81831.1"
FT                   /translation="MGISKALRSLLILLLLNITFFFGHVTPGATVKPCPPPPAKQATTK
FT                   CPRDTLKFGVCGSWLGLVSEVIGTPPSQECCSLIKGLADFEAAVCLCTALKTSILGVAP
FT                   VKIPVALTLLLNSCGKNVPQGFVC"
FT   CDS_pept        complement(69433..69819)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00165"
FT                   /product="Bifunctional inhibitor/lipid-transfer
FT                   protein/seed storage 2S albumin superfamily protein"
FT                   /note="Bifunctional inhibitor/lipid-transfer protein/seed
FT                   storage 2S albumin superfamily protein; FUNCTIONS IN: lipid
FT                   binding; INVOLVED IN: lipid transport; LOCATED IN:
FT                   endomembrane system; CONTAINS InterPro DOMAIN/s:
FT                   Bifunctional inhibitor/plant lipid transfer protein/seed
FT                   storage (InterPro:IPR016140), Plant lipid transfer
FT                   protein/seed storage/trypsin-alpha amylase inhibitor
FT                   (InterPro:IPR003612), Plant lipid transfer
FT                   protein/hydrophobic protein, helical domain
FT                   (InterPro:IPR013770); BEST Arabidopsis thaliana protein
FT                   match is: Bifunctional inhibitor/lipid-transfer
FT                   protein/seed storage 2S albumin superfamily protein
FT                   (TAIR:AT2G45180.1); Has 761 Blast hits to 755 proteins in
FT                   61 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 761; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q8RW93"
FT                   /db_xref="InterPro:IPR016140"
FT                   /db_xref="InterPro:IPR027923"
FT                   /db_xref="InterPro:IPR036312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RW93"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR314338.1,INSD:DR314346.1,INSD:ES118327.1,
FT                   INSD:CF773045.1,INSD:AV531491.1,INSD:EH951362.1,
FT                   INSD:DR314335.1,INSD:DR359403.1,INSD:DR314331.1,
FT                   INSD:DR314326.1,INSD:DR374964.1,INSD:DR314323.1,
FT                   INSD:EH910250.1,INSD:DR314327.1,INSD:EL281658.1,
FT                   INSD:DR314328.1,INSD:DR314348.1,INSD:EL225340.1,
FT                   INSD:DR314343.1,INSD:DR314324.1,INSD:DR314339.1,
FT                   INSD:DR314333.1,INSD:DR314341.1,INSD:DR314345.1,
FT                   INSD:DR314322.1,INSD:DR314332.1,INSD:DR314336.1,
FT                   INSD:DR382208.1,INSD:EG526286.1,INSD:DR359404.1,
FT                   INSD:EH894680.1,INSD:DR314342.1,INSD:DR314349.1,
FT                   INSD:DR314337.1,INSD:EL228900.1,INSD:EG526287.1,
FT                   INSD:DR314347.1,INSD:EH832732.1,INSD:EL089831.1,
FT                   INSD:DR314330.1,INSD:BP864085.1,INSD:DR314334.1,
FT                   INSD:DR314329.1,INSD:EL310375.1,INSD:DR314325.1,
FT                   INSD:DR314340.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT020288.1"
FT                   /protein_id="AEE81832.1"
FT                   /translation="MGISKALRSLLILLLLNITFFFGHVTPGATVKPCPPPPAKQATTK
FT                   CPRDTLKFGVCGSWLGLVSEVIGTPPSQECCSLIKGLADFEAAVCLCTALKTSILGVAP
FT                   VKIPVALTLLLNSCGKNVPQGFVC"
FT   gene            complement(69983..72217)
FT                   /gene_synonym="F6N15.21"
FT                   /gene_synonym="F6N15_21"
FT                   /locus_tag="AT4G00170"
FT   mRNA            complement(join(69983..70845,70933..71010,71099..71140,
FT                   71210..71371,71457..71572,71658..71739,71820..71893,
FT                   72034..72217))
FT                   /gene_synonym="F6N15.21"
FT                   /gene_synonym="F6N15_21"
FT                   /locus_tag="AT4G00170"
FT                   /product="Plant VAMP (vesicle-associated membrane protein)
FT                   family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP622330.1,INSD:DR238005.1,INSD:DR238003.1,
FT                   INSD:ES047507.1,INSD:ES075531.1,INSD:DR237997.1,
FT                   INSD:DR237991.1,INSD:DR238006.1,INSD:BP797278.1,
FT                   INSD:DR237996.1,INSD:DR238002.1,INSD:EH983226.1,
FT                   INSD:DR237994.1,INSD:DR237995.1,INSD:DR238004.1,
FT                   INSD:DR238001.1,INSD:R65504.1,INSD:DR237999.1,
FT                   INSD:DR237993.1,INSD:DR238007.1,INSD:BP569277.1,
FT                   INSD:DR375157.1,INSD:ES195950.1,INSD:DR238000.1,
FT                   INSD:DR237998.1,INSD:BP789305.1,INSD:ES171721.1,
FT                   INSD:CB254169.1,INSD:DR237992.1,INSD:BP563554.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY050901.1,INSD:BT001917.1,INSD:BX826486.1,
FT                   INSD:AY087270.1"
FT   mRNA            complement(join(69983..70845,70933..71010,71099..71140,
FT                   71210..71371,71457..71572,71658..71739,71820..72217))
FT                   /gene_synonym="F6N15.21"
FT                   /gene_synonym="F6N15_21"
FT                   /locus_tag="AT4G00170"
FT                   /product="Plant VAMP (vesicle-associated membrane protein)
FT                   family protein"
FT   CDS_pept        complement(join(70732..70845,70933..71010,71099..71140,
FT                   71210..71371,71457..71572,71658..71739,71820..71893,
FT                   72034..72085))
FT                   /codon_start=1
FT                   /gene_synonym="F6N15.21"
FT                   /gene_synonym="F6N15_21"
FT                   /locus_tag="AT4G00170"
FT                   /product="Plant VAMP (vesicle-associated membrane protein)
FT                   family protein"
FT                   /note="Plant VAMP (vesicle-associated membrane protein)
FT                   family protein; FUNCTIONS IN: structural molecule activity;
FT                   INVOLVED IN: biological_process unknown; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: PapD-like (InterPro:IPR008962), Major
FT                   sperm protein (InterPro:IPR000535), Vesicle-associated
FT                   membrane protein (InterPro:IPR016763); BEST Arabidopsis
FT                   thaliana protein match is: vesicle associated protein
FT                   (TAIR:AT3G60600.1); Has 1100 Blast hits to 1071 proteins in
FT                   205 species: Archae - 0; Bacteria - 0; Metazoa - 430; Fungi
FT                   - 141; Plants - 437; Viruses - 0; Other Eukaryotes - 92
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q84WW5"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016763"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84WW5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP622330.1,INSD:DR238005.1,INSD:DR238003.1,
FT                   INSD:ES047507.1,INSD:ES075531.1,INSD:DR237997.1,
FT                   INSD:DR237991.1,INSD:DR238006.1,INSD:BP797278.1,
FT                   INSD:DR237996.1,INSD:DR238002.1,INSD:EH983226.1,
FT                   INSD:DR237994.1,INSD:DR237995.1,INSD:DR238004.1,
FT                   INSD:DR238001.1,INSD:R65504.1,INSD:DR237999.1,
FT                   INSD:DR237993.1,INSD:DR238007.1,INSD:BP569277.1,
FT                   INSD:DR375157.1,INSD:ES195950.1,INSD:DR238000.1,
FT                   INSD:DR237998.1,INSD:BP789305.1,INSD:ES171721.1,
FT                   INSD:CB254169.1,INSD:DR237992.1,INSD:BP563554.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY050901.1,INSD:BT001917.1,INSD:BX826486.1,
FT                   INSD:AY087270.1"
FT                   /protein_id="AEE81833.1"
FT                   /translation="MTTGDLVNIHPTELKFPFELKKQSSCSMQLTNKTTTQCVAFKVKT
FT                   TNPRKYCVRPNTGVVLPGDSCNVTVTMQAQKEAPLDMQCKDKFLVQTVVVSDGTTSKEV
FT                   LAEMFNKEAGRVIEDFKLRVVYIPANPPSPVPEGSEEGNSPMASLNDIASQSASLFDDV
FT                   SRTFEETSEKSSEAWSMISKLTEEKTSATQQSQKLRLELEMLRKETSKKQSGGHSLLLM
FT                   LLVGLLGCVIGYLLNRI"
FT   CDS_pept        complement(join(70732..70845,70933..71010,71099..71140,
FT                   71210..71371,71457..71572,71658..71739,71820..71864))
FT                   /codon_start=1
FT                   /gene_synonym="F6N15.21"
FT                   /gene_synonym="F6N15_21"
FT                   /locus_tag="AT4G00170"
FT                   /product="Plant VAMP (vesicle-associated membrane protein)
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00170"
FT                   /db_xref="GOA:A0A1P8B930"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016763"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B930"
FT                   /protein_id="ANM68115.1"
FT                   /translation="MQLTNKTTTQCVAFKVKTTNPRKYCVRPNTGVVLPGDSCNVTVTM
FT                   QAQKEAPLDMQCKDKFLVQTVVVSDGTTSKEVLAEMFNKEAGRVIEDFKLRVVYIPANP
FT                   PSPVPEGSEEGNSPMASLNDIASQSASLFDDVSRTFEETSEKSSEAWSMISKLTEEKTS
FT                   ATQQSQKLRLELEMLRKETSKKQSGGHSLLLMLLVGLLGCVIGYLLNRI"
FT   gene            complement(72545..75576)
FT                   /gene="YAB3"
FT                   /gene_synonym="F6N15.22"
FT                   /gene_synonym="F6N15_22"
FT                   /gene_synonym="YABBY3"
FT                   /locus_tag="AT4G00180"
FT                   /note="YABBY gene family member, likely has transcription
FT                   factor activity, involved in specifying abaxial cell fate.
FT                   Along with FIL, involved in patterning of the fruit. GUS
FT                   reporter gene expression in seedlings is observed in the
FT                   young leaves and as the leaf matures, expression is
FT                   restricted to the abaxial tissues of leaves, expression is
FT                   also observed on either side of the leaf margin in the
FT                   younger tissues of leaf blades."
FT   mRNA            complement(join(72545..72878,72990..73067,73448..73523,
FT                   73659..73707,74268..74427,74697..74867,74976..75576))
FT                   /gene="YAB3"
FT                   /gene_synonym="F6N15.22"
FT                   /gene_synonym="F6N15_22"
FT                   /gene_synonym="YABBY3"
FT                   /locus_tag="AT4G00180"
FT                   /product="Plant-specific transcription factor YABBY family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR378920.1,INSD:BP660527.1,INSD:BP811220.1,
FT                   INSD:AV535573.1,INSD:DR328190.1,INSD:DR372073.1,
FT                   INSD:DR328189.1,INSD:AI997224.1,INSD:AV781460.1,
FT                   INSD:EH833452.1,INSD:EL169374.1,INSD:EL159097.1,
FT                   INSD:AV788950.1,INSD:AV821170.1,INSD:CB262884.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF136540.1,INSD:BT002662.1,INSD:AY037186.1"
FT   mRNA            complement(join(72548..72878,72990..73067,73448..73523,
FT                   73659..73707,74268..74427,74697..75384))
FT                   /gene="YAB3"
FT                   /gene_synonym="F6N15.22"
FT                   /gene_synonym="F6N15_22"
FT                   /gene_synonym="YABBY3"
FT                   /locus_tag="AT4G00180"
FT                   /product="Plant-specific transcription factor YABBY family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR248005.1,INSD:DR378920.1,INSD:BP660527.1,
FT                   INSD:AV535573.1,INSD:DR328190.1,INSD:DR372073.1,
FT                   INSD:AV824956.1,INSD:AI997224.1,INSD:DR248003.1,
FT                   INSD:AV781460.1,INSD:EH833452.1,INSD:EL169374.1,
FT                   INSD:EL159097.1,INSD:AV788950.1,INSD:CB262884.1,
FT                   INSD:BP856759.1"
FT   CDS_pept        complement(join(72804..72878,72990..73067,73448..73523,
FT                   73659..73707,74268..74427,74697..74867,74976..75089))
FT                   /codon_start=1
FT                   /gene="YAB3"
FT                   /gene_synonym="F6N15.22"
FT                   /gene_synonym="F6N15_22"
FT                   /gene_synonym="YABBY3"
FT                   /locus_tag="AT4G00180"
FT                   /product="Plant-specific transcription factor YABBY family
FT                   protein"
FT                   /note="YABBY3 (YAB3); CONTAINS InterPro DOMAIN/s: High
FT                   mobility group, superfamily (InterPro:IPR009071), YABBY
FT                   protein (InterPro:IPR006780); BEST Arabidopsis thaliana
FT                   protein match is: Plant-specific transcription factor YABBY
FT                   family protein (TAIR:AT2G45190.1); Has 469 Blast hits to
FT                   469 proteins in 131 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 4; Fungi - 6; Plants - 442; Viruses - 2; Other
FT                   Eukaryotes - 15 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00180"
FT                   /db_xref="GOA:Q9XFB1"
FT                   /db_xref="InterPro:IPR006780"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9XFB1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR378920.1,INSD:BP660527.1,INSD:BP811220.1,
FT                   INSD:AV535573.1,INSD:DR328190.1,INSD:DR372073.1,
FT                   INSD:DR328189.1,INSD:AI997224.1,INSD:AV781460.1,
FT                   INSD:EH833452.1,INSD:EL169374.1,INSD:EL159097.1,
FT                   INSD:AV788950.1,INSD:AV821170.1,INSD:CB262884.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF136540.1,INSD:BT002662.1,INSD:AY037186.1"
FT                   /protein_id="AEE81834.1"
FT                   /translation="MSSMSMSSSSAPAFPPDHFSSTDQLCYVHCSFCDTVLAVSVPPSS
FT                   LFKTVTVRCGHCSNLLSVTVSMRALLLPSVSNLGHSFLPPPPPPPPPNLLEEMRSGGQN
FT                   INMNMMMSHHASAHHPNEHLVMATRNGRSVDHLQEMPRPPPANRPPEKRQRVPSAYNRF
FT                   IKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMADHPPTKKANVRQQEGEDGM
FT                   MGREGFYGSAANVGVAHN"
FT   CDS_pept        complement(join(72804..72878,72990..73067,73448..73523,
FT                   73659..73707,74268..74427,74697..74888))
FT                   /codon_start=1
FT                   /gene="YAB3"
FT                   /gene_synonym="F6N15.22"
FT                   /gene_synonym="F6N15_22"
FT                   /gene_synonym="YABBY3"
FT                   /locus_tag="AT4G00180"
FT                   /product="Plant-specific transcription factor YABBY family
FT                   protein"
FT                   /note="YABBY3 (YAB3); FUNCTIONS IN: protein binding,
FT                   sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: fruit development, abaxial cell fate
FT                   specification, regulation of transcription; EXPRESSED IN:
FT                   18 plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: High mobility group,
FT                   superfamily (InterPro:IPR009071), YABBY protein
FT                   (InterPro:IPR006780); BEST Arabidopsis thaliana protein
FT                   match is: Plant-specific transcription factor YABBY family
FT                   protein (TAIR:AT2G45190.1); Has 465 Blast hits to 465
FT                   proteins in 131 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 4; Fungi - 6; Plants - 438; Viruses - 2; Other Eukaryotes
FT                   - 15 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00180"
FT                   /db_xref="GOA:A8MRG7"
FT                   /db_xref="InterPro:IPR006780"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:A8MRG7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR248005.1,INSD:DR378920.1,INSD:BP660527.1,
FT                   INSD:AV535573.1,INSD:DR328190.1,INSD:DR372073.1,
FT                   INSD:AV824956.1,INSD:AI997224.1,INSD:DR248003.1,
FT                   INSD:AV781460.1,INSD:EH833452.1,INSD:EL169374.1,
FT                   INSD:EL159097.1,INSD:AV788950.1,INSD:CB262884.1,
FT                   INSD:BP856759.1"
FT                   /protein_id="AEE81835.1"
FT                   /translation="MCDINWQVSVPPSSLFKTVTVRCGHCSNLLSVTVSMRALLLPSVS
FT                   NLGHSFLPPPPPPPPPNLLEEMRSGGQNINMNMMMSHHASAHHPNEHLVMATRNGRSVD
FT                   HLQEMPRPPPANRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHF
FT                   PHIHFGLMADHPPTKKANVRQQEGEDGMMGREGFYGSAANVGVAHN"
FT   gene            76411..76689
FT                   /locus_tag="AT4G03525"
FT   ncRNA           76411..76689
FT                   /locus_tag="AT4G03525"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(80433..82040)
FT                   /gene="PME38"
FT                   /gene_synonym="A. THALIANA PECTIN METHYLESTERASE 38"
FT                   /gene_synonym="ATPME38"
FT                   /gene_synonym="F6N15.23"
FT                   /gene_synonym="F6N15_23"
FT                   /gene_synonym="pectin methylesterase 38"
FT                   /locus_tag="AT4G00190"
FT   mRNA            complement(join(80433..81115,81188..81515,81627..82040))
FT                   /gene="PME38"
FT                   /gene_synonym="A. THALIANA PECTIN METHYLESTERASE 38"
FT                   /gene_synonym="ATPME38"
FT                   /gene_synonym="F6N15.23"
FT                   /gene_synonym="F6N15_23"
FT                   /gene_synonym="pectin methylesterase 38"
FT                   /locus_tag="AT4G00190"
FT                   /product="pectin methylesterase 38"
FT   CDS_pept        complement(join(80433..81115,81188..81515,81627..82040))
FT                   /codon_start=1
FT                   /gene="PME38"
FT                   /gene_synonym="A. THALIANA PECTIN METHYLESTERASE 38"
FT                   /gene_synonym="ATPME38"
FT                   /gene_synonym="F6N15.23"
FT                   /gene_synonym="F6N15_23"
FT                   /gene_synonym="pectin methylesterase 38"
FT                   /locus_tag="AT4G00190"
FT                   /product="pectin methylesterase 38"
FT                   /note="pectin methylesterase 38 (PME38); FUNCTIONS IN:
FT                   enzyme inhibitor activity, pectinesterase activity;
FT                   INVOLVED IN: cell wall modification; LOCATED IN: cell wall,
FT                   plant-type cell wall; EXPRESSED IN: flower, synergid;
FT                   CONTAINS InterPro DOMAIN/s: Pectinesterase, active site
FT                   (InterPro:IPR018040), Pectin lyase fold/virulence factor
FT                   (InterPro:IPR011050), Pectinesterase, catalytic
FT                   (InterPro:IPR000070), Pectinesterase inhibitor
FT                   (InterPro:IPR006501), Pectin lyase fold
FT                   (InterPro:IPR012334); BEST Arabidopsis thaliana protein
FT                   match is: Plant invertase/pectin methylesterase inhibitor
FT                   superfamily (TAIR:AT2G45220.1); Has 2963 Blast hits to 2921
FT                   proteins in 467 species: Archae - 10; Bacteria - 871;
FT                   Metazoa - 1; Fungi - 198; Plants - 1837; Viruses - 0; Other
FT                   Eukaryotes - 46 (source: NCBI BLink)."
FT                   /db_xref="GOA:O81320"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR006501"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR033131"
FT                   /db_xref="InterPro:IPR035513"
FT                   /db_xref="UniProtKB/Swiss-Prot:O81320"
FT                   /protein_id="AEE81836.1"
FT                   /translation="MVFGNEMCDETPHPGECKTLLIKHKPIRSTTQFLQVSVERTLDGA
FT                   VKAKSDTYFLEPQFGSKQAWEECMDLYEQTIHRLNESVLCPKNVCSRSDVQAWLSTALT
FT                   NLDTCQEEMSELGVSSHSLESITIDVINTLAINKRMEQNGKEFGISKITMKTLSIGEKV
FT                   DVVVAQDGSGDYKTIQEAVNGAGERLKGSPRYVIHVKQGVYEEYVNVGIKSNNIMITGD
FT                   GIGKTIITGDKSKGRGFSTYKSATFVAEGDGFVGRDITIRNTAGPENHQAVALRSNSDM
FT                   SVFYRCSIEGYQDTLYVHSGRQFFRECDIYGTVDFIFGNAAAVLQNCRIFARNPPNGVN
FT                   TITAQSRFNPNQTTGIVIHNSVVKGAPGVQLGGVKTYLGRPWRSYARTVVIGTYLDTLI
FT                   EPNGWIDWDNVTALSTLYYGEYQNSGPGSGTENRVDWAGFHVISDIQEAREFTLPKFID
FT                   SASWLPPTKVPFTINL"
FT   gene            complement(82309..84770)
FT                   /gene_synonym="AHL7"
FT                   /gene_synonym="AT-hook motif nuclear localized protein 7"
FT                   /gene_synonym="F6N15.24"
FT                   /gene_synonym="F6N15_24"
FT                   /locus_tag="AT4G00200"
FT   mRNA            complement(join(82309..82913,83000..83161,83240..83371,
FT                   83470..83555,83789..84123,84466..84770))
FT                   /gene_synonym="AHL7"
FT                   /gene_synonym="AT-hook motif nuclear localized protein 7"
FT                   /gene_synonym="F6N15.24"
FT                   /gene_synonym="F6N15_24"
FT                   /locus_tag="AT4G00200"
FT                   /product="AT hook motif DNA-binding family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU237067.1,INSD:EL980943.1,INSD:ES208626.1,
FT                   INSD:BP634104.1,INSD:AU228088.1,INSD:ES196880.1,
FT                   INSD:ES189965.1,INSD:BP863517.1,INSD:ES064088.1,
FT                   INSD:ES058753.1,INSD:EL024078.1,INSD:ES175395.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT023416.1,INSD:AK228631.1"
FT   mRNA            complement(join(82364..82913,83000..83161,83240..83371,
FT                   83470..83555,83789..84709))
FT                   /gene_synonym="AHL7"
FT                   /gene_synonym="AT-hook motif nuclear localized protein 7"
FT                   /gene_synonym="F6N15.24"
FT                   /gene_synonym="F6N15_24"
FT                   /locus_tag="AT4G00200"
FT                   /product="AT hook motif DNA-binding family protein"
FT   CDS_pept        complement(join(82653..82913,83000..83161,83240..83371,
FT                   83470..83555,83789..84104))
FT                   /codon_start=1
FT                   /gene_synonym="AHL7"
FT                   /gene_synonym="AT-hook motif nuclear localized protein 7"
FT                   /gene_synonym="F6N15.24"
FT                   /gene_synonym="F6N15_24"
FT                   /locus_tag="AT4G00200"
FT                   /product="AT hook motif DNA-binding family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00200"
FT                   /db_xref="GOA:Q4V3E0"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR039605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4V3E0"
FT                   /protein_id="ANM67819.1"
FT                   /translation="METSDRISPGGGIGAEVPSAYHMAPRPSDSPANQFMGLSLPPMEA
FT                   PMPSSGEASGKKRRGRPRKYEANGAPLPSSSVPLVKKRVRGKLNGFDMKKMHKTIGFHS
FT                   SGERFGVGGGVGGGVGSNFTPHVITVNTGEDITMRIISFSQQGPRAICILSANGVISNV
FT                   TLRQPDSCGGTLTYEGRFEILSLSGSFMETENQGSKGRSGGMSVSLAGPDGRVVGGGVA
FT                   GLLIAATPIQVVVGSFITSDQQDHQKPRKQRVEHAPAAVMSVPPPPSPPPPAASVFSPT
FT                   NPDREQPPSSFGISSWTNGQDMPRNSATDINISLPVD"
FT   CDS_pept        complement(join(82653..82913,83000..83161,83240..83371,
FT                   83470..83555,83789..84104))
FT                   /codon_start=1
FT                   /gene_synonym="F6N15.24"
FT                   /gene_synonym="F6N15_24"
FT                   /gene_synonym="AHL7"
FT                   /gene_synonym="AT-hook motif nuclear localized protein 7"
FT                   /locus_tag="AT4G00200"
FT                   /product="AT hook motif DNA-binding family protein"
FT                   /note="AT hook motif DNA-binding family protein; FUNCTIONS
FT                   IN: DNA binding; INVOLVED IN: biological_process unknown;
FT                   LOCATED IN: cellular_component unknown; EXPRESSED IN: 16
FT                   plant structures; EXPRESSED DURING: 7 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Protein of unknown function
FT                   DUF296 (InterPro:IPR005175), AT hook, DNA-binding motif
FT                   (InterPro:IPR017956); BEST Arabidopsis thaliana protein
FT                   match is: AT-hook motif nuclear-localized protein 1
FT                   (TAIR:AT4G12080.1); Has 772 Blast hits to 768 proteins in
FT                   34 species: Archae - 0; Bacteria - 6; Metazoa - 13; Fungi -
FT                   0; Plants - 749; Viruses - 0; Other Eukaryotes - 4 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q4V3E0"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR039605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4V3E0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU237067.1,INSD:EL980943.1,INSD:ES208626.1,
FT                   INSD:BP634104.1,INSD:AU228088.1,INSD:ES196880.1,
FT                   INSD:ES189965.1,INSD:BP863517.1,INSD:ES064088.1,
FT                   INSD:ES058753.1,INSD:EL024078.1,INSD:ES175395.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT023416.1,INSD:AK228631.1"
FT                   /protein_id="AEE81837.1"
FT                   /translation="METSDRISPGGGIGAEVPSAYHMAPRPSDSPANQFMGLSLPPMEA
FT                   PMPSSGEASGKKRRGRPRKYEANGAPLPSSSVPLVKKRVRGKLNGFDMKKMHKTIGFHS
FT                   SGERFGVGGGVGGGVGSNFTPHVITVNTGEDITMRIISFSQQGPRAICILSANGVISNV
FT                   TLRQPDSCGGTLTYEGRFEILSLSGSFMETENQGSKGRSGGMSVSLAGPDGRVVGGGVA
FT                   GLLIAATPIQVVVGSFITSDQQDHQKPRKQRVEHAPAAVMSVPPPPSPPPPAASVFSPT
FT                   NPDREQPPSSFGISSWTNGQDMPRNSATDINISLPVD"
FT   gene            complement(85471..87071)
FT                   /gene="LBD31"
FT                   /gene_synonym="F6N15.25"
FT                   /gene_synonym="F6N15_25"
FT                   /gene_synonym="LOB domain-containing protein 31"
FT                   /locus_tag="AT4G00210"
FT   mRNA            complement(join(85471..86064,86598..87071))
FT                   /gene="LBD31"
FT                   /gene_synonym="F6N15.25"
FT                   /gene_synonym="F6N15_25"
FT                   /gene_synonym="LOB domain-containing protein 31"
FT                   /locus_tag="AT4G00210"
FT                   /product="LOB domain-containing protein 31"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AB473855.1"
FT   CDS_pept        complement(join(85693..86064,86598..86888))
FT                   /codon_start=1
FT                   /gene="LBD31"
FT                   /gene_synonym="F6N15.25"
FT                   /gene_synonym="F6N15_25"
FT                   /gene_synonym="LOB domain-containing protein 31"
FT                   /locus_tag="AT4G00210"
FT                   /product="LOB domain-containing protein 31"
FT                   /note="LOB domain-containing protein 31 (LBD31); CONTAINS
FT                   InterPro DOMAIN/s: Lateral organ boundaries, LOB
FT                   (InterPro:IPR004883); BEST Arabidopsis thaliana protein
FT                   match is: LOB domain-containing protein 19
FT                   (TAIR:AT2G45410.1); Has 416 Blast hits to 414 proteins in
FT                   13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 416; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:O81322"
FT                   /db_xref="InterPro:IPR004883"
FT                   /db_xref="UniProtKB/Swiss-Prot:O81322"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AB473855.1"
FT                   /protein_id="AEE81838.1"
FT                   /translation="MSGSTTGCGGPCGACKFLRRKCVADCVFAPYFDSVEGTSHFTAVH
FT                   KVFGASNASKLLMMIPASRRLDAVVTLTYEALARLRDPVYGCVGHIFALQHQVMNLQAE
FT                   LAYVQTQLSTLQGLPPPNSQNNSRTEAASSSNVPLISSVDSKDNMSSSSSHIPCMSQQQ
FT                   EQEQPKEAIEVPTESVDLSTFFGLENPVDEDGDLNALAREFFTKYLTGGKYRPSSLI"
FT   gene            87717..88476
FT                   /locus_tag="AT4G03535"
FT   ncRNA           join(87717..87889,88238..88476)
FT                   /locus_tag="AT4G03535"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(88123..88476)
FT                   /locus_tag="AT4G03545"
FT   ncRNA           complement(88123..88476)
FT                   /locus_tag="AT4G03545"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            89908..92255
FT                   /gene="JLO"
FT                   /gene_synonym="F6N15.4"
FT                   /gene_synonym="F6N15_4"
FT                   /gene_synonym="JAGGED LATERAL ORGANS"
FT                   /gene_synonym="LBD30"
FT                   /gene_synonym="LOB DOMAIN-CONTAINING PROTEIN 30"
FT                   /locus_tag="AT4G00220"
FT                   /note="Encodes a protein containing a LOB domain that is
FT                   expressed in embryos, flower primordium and lateral floral
FT                   organ boundaries. Overexpression is correlated with
FT                   activation of STM and KNAT1 and down regulation of PIN1 and
FT                   reduced auxin transport levels. Ectopic expression in
FT                   plants results in premature termination of the shoot apical
FT                   meristem and small, lobed leaves. A maternally expressed
FT                   imprinted gene."
FT   mRNA            join(89908..90455,91710..92255)
FT                   /gene="JLO"
FT                   /gene_synonym="F6N15.4"
FT                   /gene_synonym="F6N15_4"
FT                   /gene_synonym="JAGGED LATERAL ORGANS"
FT                   /gene_synonym="LBD30"
FT                   /gene_synonym="LOB DOMAIN-CONTAINING PROTEIN 30"
FT                   /locus_tag="AT4G00220"
FT                   /product="Lateral organ boundaries (LOB) domain family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES106522.1,INSD:N65781.1,INSD:AV563330.1,
FT                   INSD:AI994962.1,INSD:BP826752.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AB473852.1,INSD:BT026407.1,INSD:AF432232.1,
FT                   INSD:DQ446787.1,INSD:DQ653168.1"
FT   CDS_pept        join(90147..90455,91710..92087)
FT                   /codon_start=1
FT                   /gene="JLO"
FT                   /gene_synonym="F6N15.4"
FT                   /gene_synonym="F6N15_4"
FT                   /gene_synonym="JAGGED LATERAL ORGANS"
FT                   /gene_synonym="LBD30"
FT                   /gene_synonym="LOB DOMAIN-CONTAINING PROTEIN 30"
FT                   /locus_tag="AT4G00220"
FT                   /product="Lateral organ boundaries (LOB) domain family
FT                   protein"
FT                   /note="JAGGED LATERAL ORGANS (JLO); CONTAINS InterPro
FT                   DOMAIN/s: Lateral organ boundaries, LOB
FT                   (InterPro:IPR004883); BEST Arabidopsis thaliana protein
FT                   match is: LOB domain-containing protein 18
FT                   (TAIR:AT2G45420.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:O81323"
FT                   /db_xref="InterPro:IPR004883"
FT                   /db_xref="UniProtKB/Swiss-Prot:O81323"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES106522.1,INSD:N65781.1,INSD:AV563330.1,
FT                   INSD:AI994962.1,INSD:BP826752.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AB473852.1,INSD:BT026407.1,INSD:AF432232.1,
FT                   INSD:DQ446787.1,INSD:DQ653168.1"
FT                   /protein_id="AEE81839.1"
FT                   /translation="MSSSGNPSSSSGGGGGPCGACKFLRRKCVAGCIFAPYFDSEQGAA
FT                   HFAAVHKVFGASNVSKLLHHVPEHKRPDAVVSICFEAQARLRDPIYGCVSHIVSLQQQV
FT                   VSLQTELSYLQAHLATLELPQPQPPQVPVSSSGSLQALSITDLPTISPSVYDLSSIFEP
FT                   VMSSTWAMQQQPRPSDHLFGVPSSSNMGGGGELQALAREFIHGGQMPAQPSPGTSGSAS
FT                   SVIKRE"
FT   gene            complement(92644..93147)
FT                   /pseudo
FT                   /locus_tag="AT4G00225"
FT   misc_RNA        complement(92644..93147)
FT                   /pseudo
FT                   /locus_tag="AT4G00225"
FT                   /note="pseudogene of Major facilitator superfamily protein;
FT                   AT4G00225.1"
FT   gene            93743..97467
FT                   /gene="XSP1"
FT                   /gene_synonym="F6N15.3"
FT                   /gene_synonym="F6N15_3"
FT                   /gene_synonym="SUBTILISIN-TYPE SERINE ENDOPEPTIDASE XSP1"
FT                   /gene_synonym="xylem serine peptidase 1"
FT                   /locus_tag="AT4G00230"
FT   mRNA            join(93743..94039,94151..94242,94369..94466,94557..94700,
FT                   94791..94896,95202..95715,95790..95887,95966..96190,
FT                   96273..96381,96460..96673,96745..97467)
FT                   /gene="XSP1"
FT                   /gene_synonym="F6N15.3"
FT                   /gene_synonym="F6N15_3"
FT                   /gene_synonym="SUBTILISIN-TYPE SERINE ENDOPEPTIDASE XSP1"
FT                   /gene_synonym="xylem serine peptidase 1"
FT                   /locus_tag="AT4G00230"
FT                   /product="xylem serine peptidase 1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR365967.1,INSD:DR365975.1,INSD:BP576922.1,
FT                   INSD:DR365972.1,INSD:BP640349.1,INSD:BP656857.1,
FT                   INSD:DR365978.1,INSD:DR365977.1,INSD:DR365971.1,
FT                   INSD:DR365990.1,INSD:DR365987.1,INSD:DR262082.1,
FT                   INSD:DR365980.1,INSD:EL262397.1,INSD:AV784453.1,
FT                   INSD:DR365964.1,INSD:BP838149.2,INSD:EH846829.1,
FT                   INSD:DR365979.1,INSD:AV791310.1,INSD:BP561022.1,
FT                   INSD:DR365970.1,INSD:BP830893.2,INSD:BP795235.1,
FT                   INSD:DR365976.1,INSD:DR365989.1,INSD:BP794285.1,
FT                   INSD:DR365981.1,INSD:DR365983.1,INSD:EH799987.1,
FT                   INSD:BP791883.1,INSD:DR365991.1,INSD:EL075225.1,
FT                   INSD:DR365985.1,INSD:DR365984.1,INSD:DR365969.1,
FT                   INSD:DR365973.1,INSD:DR365986.1,INSD:AV543686.1,
FT                   INSD:DR365982.1,INSD:DR262083.1,INSD:DR365968.1,
FT                   INSD:DR365965.1,INSD:DR365974.1,INSD:EH926179.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF190794.1,INSD:BX827771.1,INSD:BX828760.1"
FT   mRNA            join(93894..94039,94151..94242,94369..94466,94557..94700,
FT                   94791..94896,95202..95715,95790..95887,95966..96190,
FT                   96273..96381,96460..97454)
FT                   /gene="XSP1"
FT                   /gene_synonym="F6N15.3"
FT                   /gene_synonym="F6N15_3"
FT                   /gene_synonym="SUBTILISIN-TYPE SERINE ENDOPEPTIDASE XSP1"
FT                   /gene_synonym="xylem serine peptidase 1"
FT                   /locus_tag="AT4G00230"
FT                   /product="xylem serine peptidase 1"
FT   CDS_pept        join(93935..94039,94151..94242,94369..94466,94557..94700,
FT                   94791..94896,95202..95715,95790..95887,95966..96190,
FT                   96273..96381,96460..96673,96745..97289)
FT                   /codon_start=1
FT                   /gene="XSP1"
FT                   /gene_synonym="F6N15.3"
FT                   /gene_synonym="F6N15_3"
FT                   /gene_synonym="SUBTILISIN-TYPE SERINE ENDOPEPTIDASE XSP1"
FT                   /gene_synonym="xylem serine peptidase 1"
FT                   /locus_tag="AT4G00230"
FT                   /product="xylem serine peptidase 1"
FT                   /note="xylem serine peptidase 1 (XSP1); FUNCTIONS IN:
FT                   identical protein binding, serine-type endopeptidase
FT                   activity; INVOLVED IN: proteolysis, negative regulation of
FT                   catalytic activity; LOCATED IN: cell wall, plant-type cell
FT                   wall; EXPRESSED IN: 24 plant structures; EXPRESSED DURING:
FT                   15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Protease-associated PA (InterPro:IPR003137), Peptidase
FT                   S8/S53, subtilisin/kexin/sedolisin (InterPro:IPR000209),
FT                   Peptidase S8, subtilisin-related (InterPro:IPR015500),
FT                   Peptidase S8/S53, subtilisin, active site
FT                   (InterPro:IPR022398), Proteinase inhibitor I9, subtilisin
FT                   propeptide (InterPro:IPR010259); BEST Arabidopsis thaliana
FT                   protein match is: Subtilisin-like serine endopeptidase
FT                   family protein (TAIR:AT5G03620.1); Has 8915 Blast hits to
FT                   7721 proteins in 1255 species: Archae - 263; Bacteria -
FT                   5173; Metazoa - 170; Fungi - 606; Plants - 1952; Viruses -
FT                   0; Other Eukaryotes - 751 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LLL8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034197"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LLL8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR365967.1,INSD:DR365975.1,INSD:BP576922.1,
FT                   INSD:DR365972.1,INSD:BP640349.1,INSD:BP656857.1,
FT                   INSD:DR365978.1,INSD:DR365977.1,INSD:DR365971.1,
FT                   INSD:DR365990.1,INSD:DR365987.1,INSD:DR262082.1,
FT                   INSD:DR365980.1,INSD:EL262397.1,INSD:AV784453.1,
FT                   INSD:DR365964.1,INSD:BP838149.2,INSD:EH846829.1,
FT                   INSD:DR365979.1,INSD:AV791310.1,INSD:BP561022.1,
FT                   INSD:DR365970.1,INSD:BP830893.2,INSD:BP795235.1,
FT                   INSD:DR365976.1,INSD:DR365989.1,INSD:BP794285.1,
FT                   INSD:DR365981.1,INSD:DR365983.1,INSD:EH799987.1,
FT                   INSD:BP791883.1,INSD:DR365991.1,INSD:EL075225.1,
FT                   INSD:DR365985.1,INSD:DR365984.1,INSD:DR365969.1,
FT                   INSD:DR365973.1,INSD:DR365986.1,INSD:AV543686.1,
FT                   INSD:DR365982.1,INSD:DR262083.1,INSD:DR365968.1,
FT                   INSD:DR365965.1,INSD:DR365974.1,INSD:EH926179.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF190794.1,INSD:BX827771.1,INSD:BX828760.1"
FT                   /protein_id="AEE81840.1"
FT                   /translation="MIRSKCSCHHHLLVLVMVVLWISPRYASAEDEHAKDFYIIYLGDR
FT                   PDNTEETIKTHINLLSSLNISQEEAKERKVYSYTKAFNAFAAKLSPHEAKKMMEMEEVV
FT                   SVSRNQYRKLHTTKSWDFVGLPLTAKRHLKAERDVIIGVLDTGITPDSESFLDHGLGPP
FT                   PAKWKGSCGPYKNFTGCNNKIIGAKYFKHDGNVPAGEVRSPIDIDGHGTHTSSTVAGVL
FT                   VANASLYGIANGTARGAVPSARLAMYKVCWARSGCADMDILAGFEAAIHDGVEIISISI
FT                   GGPIADYSSDSISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGIDRTF
FT                   KSKIDLGNGKSFSGMGISMFSPKAKSYPLVSGVDAAKNTDDKYLARYCFSDSLDRKKVK
FT                   GKVMVCRMGGGGVESTIKSYGGAGAIIVSDQYLDNAQIFMAPATSVNSSVGDIIYRYIN
FT                   STRSASAVIQKTRQVTIPAPFVASFSSRGPNPGSIRLLKPDIAAPGIDILAAFTLKRSL
FT                   TGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPISRRV
FT                   NKDAEFAYGGGQINPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGTRSVSCSS
FT                   IVPGLGHDSLNYPTIQLTLRSAKTSTLAVFRRRVTNVGPPSSVYTATVRAPKGVEITVE
FT                   PQSLSFSKASQKRSFKVVVKAKQMTPGKIVSGLLVWKSPRHSVRSPIVIYSPTSD"
FT   CDS_pept        join(93935..94039,94151..94242,94369..94466,94557..94700,
FT                   94791..94896,95202..95715,95790..95887,95966..96190,
FT                   96273..96381,96460..96756)
FT                   /codon_start=1
FT                   /gene="XSP1"
FT                   /gene_synonym="F6N15.3"
FT                   /gene_synonym="F6N15_3"
FT                   /gene_synonym="SUBTILISIN-TYPE SERINE ENDOPEPTIDASE XSP1"
FT                   /gene_synonym="xylem serine peptidase 1"
FT                   /locus_tag="AT4G00230"
FT                   /product="xylem serine peptidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00230"
FT                   /db_xref="GOA:A0A1P8B4Y8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034197"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B4Y8"
FT                   /protein_id="ANM66658.1"
FT                   /translation="MIRSKCSCHHHLLVLVMVVLWISPRYASAEDEHAKDFYIIYLGDR
FT                   PDNTEETIKTHINLLSSLNISQEEAKERKVYSYTKAFNAFAAKLSPHEAKKMMEMEEVV
FT                   SVSRNQYRKLHTTKSWDFVGLPLTAKRHLKAERDVIIGVLDTGITPDSESFLDHGLGPP
FT                   PAKWKGSCGPYKNFTGCNNKIIGAKYFKHDGNVPAGEVRSPIDIDGHGTHTSSTVAGVL
FT                   VANASLYGIANGTARGAVPSARLAMYKVCWARSGCADMDILAGFEAAIHDGVEIISISI
FT                   GGPIADYSSDSISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGIDRTF
FT                   KSKIDLGNGKSFSGMGISMFSPKAKSYPLVSGVDAAKNTDDKYLARYCFSDSLDRKKVK
FT                   GKVMVCRMGGGGVESTIKSYGGAGAIIVSDQYLDNAQIFMAPATSVNSSVGDIIYRYIN
FT                   STRSASAVIQKTRQVTIPAPFVASFSSRGPNPGSIRLLKPDIAAPGIDILAAFTLKRSL
FT                   TGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSGNSRQVLV
FT                   KLKAEKAVIIYLFVTQQNR"
FT   gene            97476..99593
FT                   /gene="MEE50"
FT                   /gene_synonym="maternal effect embryo arrest 50"
FT                   /locus_tag="AT4G00231"
FT   mRNA            join(97476..98107,98203..99593)
FT                   /gene="MEE50"
FT                   /gene_synonym="maternal effect embryo arrest 50"
FT                   /locus_tag="AT4G00231"
FT                   /product="ARM repeat superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP563053.2,INSD:BX838596.1,INSD:AU230405.1,
FT                   INSD:EL280195.1,INSD:EL194201.1,INSD:EL052269.1,
FT                   INSD:ES172029.1,INSD:ES061253.1,INSD:ES008054.1,
FT                   INSD:N96291.1,INSD:ES072622.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK118272.1,INSD:BT005533.1,INSD:BX827809.1"
FT   CDS_pept        join(97528..98107,98203..99050)
FT                   /codon_start=1
FT                   /gene="MEE50"
FT                   /gene_synonym="maternal effect embryo arrest 50"
FT                   /locus_tag="AT4G00231"
FT                   /product="ARM repeat superfamily protein"
FT                   /note="maternal effect embryo arrest 50 (MEE50); FUNCTIONS
FT                   IN: binding; INVOLVED IN: embryo development ending in seed
FT                   dormancy; LOCATED IN: cellular_component unknown; EXPRESSED
FT                   IN: 24 plant structures; EXPRESSED DURING: 14 growth
FT                   stages; CONTAINS InterPro DOMAIN/s: Armadillo-like helical
FT                   (InterPro:IPR011989), Ataxin-10 domain
FT                   (InterPro:IPR019156), Armadillo-type fold
FT                   (InterPro:IPR016024); Has 293 Blast hits to 290 proteins in
FT                   137 species: Archae - 0; Bacteria - 0; Metazoa - 115; Fungi
FT                   - 110; Plants - 41; Viruses - 0; Other Eukaryotes - 27
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:O81325"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019156"
FT                   /db_xref="UniProtKB/TrEMBL:O81325"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP563053.2,INSD:BX838596.1,INSD:AU230405.1,
FT                   INSD:EL280195.1,INSD:EL194201.1,INSD:EL052269.1,
FT                   INSD:ES172029.1,INSD:ES061253.1,INSD:ES008054.1,
FT                   INSD:N96291.1,INSD:ES072622.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK118272.1,INSD:BT005533.1,INSD:BX827809.1"
FT                   /protein_id="AEE81841.1"
FT                   /translation="MEASLPEEVLQPLLHASDLSYSLEDCLKFLLESSKTDSGRSDLAS
FT                   KSILPSILRLLQLLPYPSSRHYLNLSLKVLRNLCAGEVSNQNSFVDHDGSAIVSDLLDS
FT                   AIADFETVRFGLQVLANVVLFGEKRQRDVWLRFYPERFLSIAKIRKRETFDPLCMILYT
FT                   CVDGSSEIASELCSCQGLTIIAETLRTSSSVGSVEDYWLKLLVSRICVEDGYFLKLFSK
FT                   LYEDAENEIFSSEQAFLVRMVSDIANERIGKVSIPKDTACSILGLFRQSVDVFDFVSGE
FT                   RSELPTGSTIVDVMGYSLVIIRDACAGGRLEELKEDNKDSGDTVELLLSSGLIELLLDL
FT                   LSKLDPPTTIKKALNQSPSSSSSSLKPCPYRGFRRDIVSVIGNCAYRRKEVQDEIRERD
FT                   GLFLMLQQCVTDDENPFLREWGLWCIRNLLEGNPENQEVVAELEIKGSVDVPQLREIGL
FT                   RVEIDPKTARPKLVNDT"
FT   gene            complement(100257..100844)
FT                   /locus_tag="AT4G00232"
FT   mRNA            complement(100257..100844)
FT                   /locus_tag="AT4G00232"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG454210.1,INSD:EG454202.1,INSD:EG454207.1"
FT   CDS_pept        complement(100257..100721)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00232"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /note="DNA-binding storekeeper protein-related
FT                   transcriptional regulator; CONTAINS InterPro DOMAIN/s:
FT                   Protein of unknown function DUF573 (InterPro:IPR007592);
FT                   BEST Arabidopsis thaliana protein match is: DNA-binding
FT                   storekeeper protein-related transcriptional regulator
FT                   (TAIR:AT5G41765.1); Has 109 Blast hits to 109 proteins in 7
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 108; Viruses - 0; Other Eukaryotes - 1 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00232.1"
FT                   /db_xref="GOA:Q3EAE7"
FT                   /db_xref="InterPro:IPR007592"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3EAE7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG454210.1,INSD:EG454202.1,INSD:EG454207.1"
FT                   /protein_id="AEE81842.1"
FT                   /translation="MDKANTNRSKVCGGSGEAKLTGKKRKNVSAKQSKKDAKKENSQML
FT                   KWSSKDEVLVLQGMLDFKSVTGKNPVDDINGAYEFVVHEYISTVIDEDFIEKMKSLKKK
FT                   LKKKQRIYDKDPSSSEPLYQKSSEWLKMIWGYDVESALEKPRKSKRIIKL"
FT   gene            100919..101788
FT                   /locus_tag="AT4G00234"
FT   mRNA            join(100919..101436,101515..101788)
FT                   /locus_tag="AT4G00234"
FT                   /product="mechanosensitive ion channel-like protein"
FT   CDS_pept        join(100919..101436,101515..101788)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00234"
FT                   /product="mechanosensitive ion channel-like protein"
FT                   /note="BEST Arabidopsis thaliana protein match is:
FT                   Mechanosensitive ion channel protein (TAIR:AT4G00290.1);
FT                   Has 57 Blast hits to 57 proteins in 12 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 56; Viruses
FT                   - 0; Other Eukaryotes - 1 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00234"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00234.1"
FT                   /db_xref="GOA:F4JH25"
FT                   /db_xref="UniProtKB/TrEMBL:F4JH25"
FT                   /protein_id="AEE81843.1"
FT                   /translation="MISFSSNIRLHSDAKPFNYLSHSSYARAFSSKSDDFGSIVASGVT
FT                   GSGDGNGNDWVEKAKDVVQTSVNAVAETAKKTKDVSDEMIPHVQQFLDSNPYLKDVIVP
FT                   VSLTVTGTLFAWIVMPRILRRFHTYAMQSSAKLLPVGFSNEDIPYEKSFWGALEDPARY
FT                   LVTFIAFAQIAAMVAPTTIAAQYFSPTVKGAVILSVVWFLYRWKTNVITRMLSAKSFGG
FT                   LDRDKVLTLDKVSSVGLFAIGLMASAEACGVAVQSILTVGE"
FT   gene            102068..103766
FT                   /pseudo
FT                   /locus_tag="AT4G00236"
FT   misc_RNA        join(102068..102142,102581..102761,102849..103063,
FT                   103150..103276,103414..103766)
FT                   /pseudo
FT                   /locus_tag="AT4G00236"
FT                   /note="pseudogene of Leucine-rich repeat transmembrane
FT                   protein kinase protein; AT4G00236.1"
FT   gene            complement(103823..105221)
FT                   /locus_tag="AT4G00238"
FT   mRNA            complement(103823..105221)
FT                   /locus_tag="AT4G00238"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR343221.1,INSD:EL974106.1,INSD:DR343231.1,
FT                   INSD:AU231165.1,INSD:DR343229.1,INSD:DR343226.1,
FT                   INSD:AV534043.1,INSD:ES047363.1,INSD:DR343228.1,
FT                   INSD:DR343223.1,INSD:DR343222.1,INSD:ES092329.1,
FT                   INSD:DR343219.1,INSD:EG515198.1,INSD:ES048930.1,
FT                   INSD:BE525264.1,INSD:ES152917.1,INSD:BP625096.1,
FT                   INSD:DR343225.1,INSD:DR343230.1,INSD:ES173175.1,
FT                   INSD:AU239813.1,INSD:EH981061.1,INSD:DR343220.1,
FT                   INSD:ES187987.1,INSD:AV559886.1,INSD:DR343218.1,
FT                   INSD:DR343227.1,INSD:ES146512.1,INSD:DR343216.1,
FT                   INSD:DR371745.1,INSD:DR343224.1,INSD:AV556463.1,
FT                   INSD:DR378030.1,INSD:DR343217.1,INSD:BP849269.1,
FT                   INSD:ES208804.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827091.1,INSD:AY084536.1,INSD:BT005630.1,
FT                   INSD:BX827808.1,INSD:AK118935.1"
FT   CDS_pept        complement(104092..105129)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00238"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /note="DNA-binding storekeeper protein-related
FT                   transcriptional regulator; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: nucleolus; EXPRESSED IN: cultured
FT                   cell; CONTAINS InterPro DOMAIN/s: Protein of unknown
FT                   function DUF573 (InterPro:IPR007592); BEST Arabidopsis
FT                   thaliana protein match is: DNA-binding storekeeper
FT                   protein-related transcriptional regulator
FT                   (TAIR:AT4G00250.1); Has 934 Blast hits to 678 proteins in
FT                   131 species: Archae - 0; Bacteria - 25; Metazoa - 209;
FT                   Fungi - 135; Plants - 261; Viruses - 3; Other Eukaryotes -
FT                   301 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00238"
FT                   /db_xref="GOA:Q8LG05"
FT                   /db_xref="InterPro:IPR007592"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LG05"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR343221.1,INSD:EL974106.1,INSD:DR343231.1,
FT                   INSD:AU231165.1,INSD:DR343229.1,INSD:DR343226.1,
FT                   INSD:AV534043.1,INSD:ES047363.1,INSD:DR343228.1,
FT                   INSD:DR343223.1,INSD:DR343222.1,INSD:ES092329.1,
FT                   INSD:DR343219.1,INSD:EG515198.1,INSD:ES048930.1,
FT                   INSD:BE525264.1,INSD:ES152917.1,INSD:BP625096.1,
FT                   INSD:DR343225.1,INSD:DR343230.1,INSD:ES173175.1,
FT                   INSD:AU239813.1,INSD:EH981061.1,INSD:DR343220.1,
FT                   INSD:ES187987.1,INSD:AV559886.1,INSD:DR343218.1,
FT                   INSD:DR343227.1,INSD:ES146512.1,INSD:DR343216.1,
FT                   INSD:DR371745.1,INSD:DR343224.1,INSD:AV556463.1,
FT                   INSD:DR378030.1,INSD:DR343217.1,INSD:BP849269.1,
FT                   INSD:ES208804.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827091.1,INSD:AY084536.1,INSD:BT005630.1,
FT                   INSD:BX827808.1,INSD:AK118935.1"
FT                   /protein_id="AEE81844.1"
FT                   /translation="MASLENPAIDSSSEFESSSEEISSSKESKPKEAPVTVPSTKTLNS
FT                   PSAAVAVSDDSESEKQSFVLTRRKKKEGAAESPAVKSGKKEGAAESPAVKSGNNEGATE
FT                   SPAVKSGKKRASEGTTSRDMHVKRIKKEGDNKKGHAQRVWSEEDEISLLQAMIDFKAET
FT                   GTSPWDHKDRFFDIAKKSISFDVSKVQFFDKIRSFKRKYFGDRKVRSVESDHDKKCLGL
FT                   AVSFWGSDGVSLETPVKKKVKDESVLVKANSKEKNVKPLVKEDEQVVILGEDSEWFEES
FT                   FLVPVIASLGLDEYSVKKKWSKVSVETKKRIQEKMKLVDAKKCELLLANMDVLKEVTSV
FT                   LTQTN"
FT   gene            complement(106250..111005)
FT                   /gene="PLDBETA2"
FT                   /gene_synonym="F5I10.13"
FT                   /gene_synonym="phospholipase D beta 2"
FT                   /locus_tag="AT4G00240"
FT                   /note="member of C2-PLD subfamily"
FT   mRNA            complement(join(106250..106673,106752..106949,
FT                   107032..107208,107383..107531,107838..107985,
FT                   108075..108143,108299..108547,108794..108988,
FT                   109059..109175,109531..110264,110370..111005))
FT                   /gene="PLDBETA2"
FT                   /gene_synonym="F5I10.13"
FT                   /gene_synonym="phospholipase D beta 2"
FT                   /locus_tag="AT4G00240"
FT                   /product="phospholipase D beta 2"
FT   mRNA            complement(join(106250..106673,106752..106949,
FT                   107032..107208,107383..107531,107838..107985,
FT                   108075..108143,108299..108547,108794..108988,
FT                   109059..109175,109531..111005))
FT                   /gene="PLDBETA2"
FT                   /gene_synonym="F5I10.13"
FT                   /gene_synonym="phospholipase D beta 2"
FT                   /locus_tag="AT4G00240"
FT                   /product="phospholipase D beta 2"
FT   mRNA            complement(join(106255..106673,106752..106949,
FT                   107032..107208,107383..107531,107838..107985,
FT                   108075..108143,108299..108547,108794..108988,
FT                   109059..109175,109531..110259,110370..110833))
FT                   /gene="PLDBETA2"
FT                   /gene_synonym="F5I10.13"
FT                   /gene_synonym="phospholipase D beta 2"
FT                   /locus_tag="AT4G00240"
FT                   /product="phospholipase D beta 2"
FT   CDS_pept        complement(join(106380..106673,106752..106949,
FT                   107032..107208,107383..107531,107838..107985,
FT                   108075..108143,108299..108547,108794..108988,
FT                   109059..109175,109531..110264,110370..110718))
FT                   /codon_start=1
FT                   /gene="PLDBETA2"
FT                   /gene_synonym="F5I10.13"
FT                   /gene_synonym="phospholipase D beta 2"
FT                   /locus_tag="AT4G00240"
FT                   /product="phospholipase D beta 2"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00240"
FT                   /db_xref="GOA:A0A1P8B8P2"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR011402"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR024632"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B8P2"
FT                   /protein_id="ANM67959.1"
FT                   /translation="MENYGWNYPYYPYRPPRPNPPYPAPPHHHGSMSHSGPLDHHHPPM
FT                   SYYASFDYQHQPPPPYPPVSYYASFSSHSDLSYSGRLDSSGHGFTSTASPHSPGMHIVP
FT                   FGKASLKVLLLHGQLSKKITSDPYVSISVAGAVIGRTYVISNSENPVWQQHFYVPVAHH
FT                   AAEVHFVVKDSDAVGSQLIGIVTIPVEQIYSGARIEGTYSIRDSNGKPCKPGATLSLSI
FT                   QYTSMNKLSVYHSGVGAGPYYQGVPGTYFPLREGGSVTLYQDAHVPEGMLPGIKLGNGM
FT                   CYEHGKCWHDMFHAICQARRLIYITGWSVWHNVRLVRDKEDPSSECRLGELLRSKSQEG
FT                   VRVLLLVWDDPTSQNILGYMTDGVMGTHDEETRRFFKDSSVQVLLCPRNAGKRHSWVKQ
FT                   REVGTIYTHHQKNLIVDADAGGNRRKIVAFVGGLDLCDGRYDTPQHPLFRTLQTDHNGD
FT                   YHNPTFTGNVSGCPREPWHDLHSKIDGPAAYDVLTNFEERWLKAAKPHRINKLKTSYDD
FT                   ALLRIDRIPDILRVLDAPTVSANDPEAWHVQIFRSIDSNSVKGFPKDPKYATSKNLVCG
FT                   KNVLIDMSIHTAYVKAIRAAQHFIYIENQYFIGSSYDWNAHKDIGANNLIPMEIALKIA
FT                   DKIRAKERFAAYIVIPMWPEGVPTGAATQRILYWQHKTMQMMYGTIYNALVEAGLEDEY
FT                   SPQDYLNFFCLGNREMVNGNNESGTGSASNENTPQGLCRKSRRFMIYVHSKGMVVDDEY
FT                   VVIGSANINQRSMEGTRDTEIAMGAYQPQHTWARRQSGPRGQIYGYRMSLWAEHMALLD
FT                   DCFVEPESLGCVRKVRTVAEENWEQFRSEEVSEMRGHLMKYPVEVDRKGKVRPLPGSEE
FT                   FPDVGGNVVGSFLAIQENLTI"
FT   CDS_pept        complement(join(106380..106673,106752..106949,
FT                   107032..107208,107383..107531,107838..107985,
FT                   108075..108143,108299..108547,108794..108988,
FT                   109059..109175,109531..110718))
FT                   /codon_start=1
FT                   /gene="PLDBETA2"
FT                   /gene_synonym="F5I10.13"
FT                   /gene_synonym="phospholipase D beta 2"
FT                   /locus_tag="AT4G00240"
FT                   /product="phospholipase D beta 2"
FT                   /note="phospholipase D beta 2 (PLDBETA2); FUNCTIONS IN:
FT                   phospholipase D activity; INVOLVED IN: phosphatidylcholine
FT                   metabolic process, metabolic process; LOCATED IN: membrane;
FT                   EXPRESSED IN: 8 plant structures; EXPRESSED DURING: L
FT                   mature pollen stage, M germinated pollen stage, 4 anthesis,
FT                   petal differentiation and expansion stage, LP.08 eight
FT                   leaves visible; CONTAINS InterPro DOMAIN/s: C2 membrane
FT                   targeting protein (InterPro:IPR018029), Phospholipase D
FT                   (InterPro:IPR015679), C2 calcium/lipid-binding domain, CaLB
FT                   (InterPro:IPR008973), Phospholipase D, plant
FT                   (InterPro:IPR011402), C2 calcium-dependent membrane
FT                   targeting (InterPro:IPR000008), Phospholipase
FT                   D/Transphosphatidylase (InterPro:IPR001736); BEST
FT                   Arabidopsis thaliana protein match is: phospholipase D beta
FT                   1 (TAIR:AT2G42010.1); Has 2407 Blast hits to 1935 proteins
FT                   in 427 species: Archae - 0; Bacteria - 522; Metazoa - 526;
FT                   Fungi - 534; Plants - 642; Viruses - 3; Other Eukaryotes -
FT                   180 (source: NCBI BLink)."
FT                   /db_xref="GOA:O23078"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR011402"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR024632"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23078"
FT                   /protein_id="AEE81845.1"
FT                   /translation="MENYGWNYPYYPYRPPRPNPPYPAPPHHHGSMSHSGPLDHHHPPM
FT                   SYYASFDYQHQPPPPYPPVSYYASFSSHSDLSYSGRLDSSGHGFTSTASPHSPGMHIVP
FT                   FGKASLKVLLLHGNLDIWVSCANNLPNLDLFHKTLGVVFGGMTNMIEGQLSKKITSDPY
FT                   VSISVAGAVIGRTYVISNSENPVWQQHFYVPVAHHAAEVHFVVKDSDAVGSQLIGIVTI
FT                   PVEQIYSGARIEGTYSIRDSNGKPCKPGATLSLSIQYTSMNKLSVYHSGVGAGPYYQGV
FT                   PGTYFPLREGGSVTLYQDAHVPEGMLPGIKLGNGMCYEHGKCWHDMFHAICQARRLIYI
FT                   TGWSVWHNVRLVRDKEDPSSECRLGELLRSKSQEGVRVLLLVWDDPTSQNILGYMTDGV
FT                   MGTHDEETRRFFKDSSVQVLLCPRNAGKRHSWVKQREVGTIYTHHQKNLIVDADAGGNR
FT                   RKIVAFVGGLDLCDGRYDTPQHPLFRTLQTDHNGDYHNPTFTGNVSGCPREPWHDLHSK
FT                   IDGPAAYDVLTNFEERWLKAAKPHRINKLKTSYDDALLRIDRIPDILRVLDAPTVSAND
FT                   PEAWHVQIFRSIDSNSVKGFPKDPKYATSKNLVCGKNVLIDMSIHTAYVKAIRAAQHFI
FT                   YIENQYFIGSSYDWNAHKDIGANNLIPMEIALKIADKIRAKERFAAYIVIPMWPEGVPT
FT                   GAATQRILYWQHKTMQMMYGTIYNALVEAGLEDEYSPQDYLNFFCLGNREMVNGNNESG
FT                   TGSASNENTPQGLCRKSRRFMIYVHSKGMVVDDEYVVIGSANINQRSMEGTRDTEIAMG
FT                   AYQPQHTWARRQSGPRGQIYGYRMSLWAEHMALLDDCFVEPESLGCVRKVRTVAEENWE
FT                   QFRSEEVSEMRGHLMKYPVEVDRKGKVRPLPGSEEFPDVGGNVVGSFLAIQENLTI"
FT   CDS_pept        complement(join(106380..106673,106752..106949,
FT                   107032..107208,107383..107531,107838..107985,
FT                   108075..108143,108299..108547,108794..108988,
FT                   109059..109175,109531..110259,110370..110372))
FT                   /codon_start=1
FT                   /gene="PLDBETA2"
FT                   /gene_synonym="F5I10.13"
FT                   /gene_synonym="phospholipase D beta 2"
FT                   /locus_tag="AT4G00240"
FT                   /product="phospholipase D beta 2"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00240"
FT                   /db_xref="GOA:A0A1P8B8N7"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR011402"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR024632"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B8N7"
FT                   /protein_id="ANM67958.1"
FT                   /translation="MLSKKITSDPYVSISVAGAVIGRTYVISNSENPVWQQHFYVPVAH
FT                   HAAEVHFVVKDSDAVGSQLIGIVTIPVEQIYSGARIEGTYSIRDSNGKPCKPGATLSLS
FT                   IQYTSMNKLSVYHSGVGAGPYYQGVPGTYFPLREGGSVTLYQDAHVPEGMLPGIKLGNG
FT                   MCYEHGKCWHDMFHAICQARRLIYITGWSVWHNVRLVRDKEDPSSECRLGELLRSKSQE
FT                   GVRVLLLVWDDPTSQNILGYMTDGVMGTHDEETRRFFKDSSVQVLLCPRNAGKRHSWVK
FT                   QREVGTIYTHHQKNLIVDADAGGNRRKIVAFVGGLDLCDGRYDTPQHPLFRTLQTDHNG
FT                   DYHNPTFTGNVSGCPREPWHDLHSKIDGPAAYDVLTNFEERWLKAAKPHRINKLKTSYD
FT                   DALLRIDRIPDILRVLDAPTVSANDPEAWHVQIFRSIDSNSVKGFPKDPKYATSKNLVC
FT                   GKNVLIDMSIHTAYVKAIRAAQHFIYIENQYFIGSSYDWNAHKDIGANNLIPMEIALKI
FT                   ADKIRAKERFAAYIVIPMWPEGVPTGAATQRILYWQHKTMQMMYGTIYNALVEAGLEDE
FT                   YSPQDYLNFFCLGNREMVNGNNESGTGSASNENTPQGLCRKSRRFMIYVHSKGMVVDDE
FT                   YVVIGSANINQRSMEGTRDTEIAMGAYQPQHTWARRQSGPRGQIYGYRMSLWAEHMALL
FT                   DDCFVEPESLGCVRKVRTVAEENWEQFRSEEVSEMRGHLMKYPVEVDRKGKVRPLPGSE
FT                   EFPDVGGNVVGSFLAIQENLTI"
FT   gene            complement(112705..113982)
FT                   /gene_synonym="A_IG005I10.12"
FT                   /gene_synonym="A_IG005I10_12"
FT                   /gene_synonym="F5I10.12"
FT                   /gene_synonym="F5I10_12"
FT                   /locus_tag="AT4G00250"
FT   mRNA            complement(112705..113982)
FT                   /gene_synonym="A_IG005I10.12"
FT                   /gene_synonym="A_IG005I10_12"
FT                   /gene_synonym="F5I10.12"
FT                   /gene_synonym="F5I10_12"
FT                   /locus_tag="AT4G00250"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU227743.1,INSD:AU236766.1,INSD:BE530637.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT005666.1,INSD:BT003961.1"
FT   CDS_pept        complement(112951..113910)
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.12"
FT                   /gene_synonym="A_IG005I10_12"
FT                   /gene_synonym="F5I10.12"
FT                   /gene_synonym="F5I10_12"
FT                   /locus_tag="AT4G00250"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /note="DNA-binding storekeeper protein-related
FT                   transcriptional regulator; FUNCTIONS IN: transcription
FT                   regulator activity; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: chloroplast; CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF573
FT                   (InterPro:IPR007592); BEST Arabidopsis thaliana protein
FT                   match is: DNA-binding storekeeper protein-related
FT                   transcriptional regulator (TAIR:AT4G00238.1); Has 626 Blast
FT                   hits to 580 proteins in 96 species: Archae - 0; Bacteria -
FT                   6; Metazoa - 135; Fungi - 97; Plants - 294; Viruses - 0;
FT                   Other Eukaryotes - 94 (source: NCBI BLink)."
FT                   /db_xref="GOA:O23077"
FT                   /db_xref="InterPro:IPR007592"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23077"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU227743.1,INSD:AU236766.1,INSD:BE530637.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT005666.1,INSD:BT003961.1"
FT                   /protein_id="AEE81846.1"
FT                   /translation="MAPLESPATASSSEVESSSEEIFKSSSEESKPKDPVTVPSSKTLK
FT                   SPSAAVNSKTDSSDDSEKQSFVLTRRKKKEGAAESPAVKSGKKRAGEGSTSRDMHVKRV
FT                   KKEDDNKKANPQRVWSEEDEISLLQAVIDFKAETGTSPWDHKNAFFDIAKKSISFDVSH
FT                   VQFFDKIRRLKNKYFVNRKNKSGESNHDKKCLGLAVLIWGSDGMNVESPVKKDESILVK
FT                   GKANSKEKKVEKPLVIEDEQVILGADSEWFEESFLVPVIANLGLDEYSVKKKWSKVSLE
FT                   TKKKIQEKMKVVDAKKCELLLAEMDVLKDVTSVLAQTN"
FT   gene            114971..117051
FT                   /gene="MEE45"
FT                   /gene_synonym="A_IG005I10.15"
FT                   /gene_synonym="A_IG005I10_15"
FT                   /gene_synonym="F5I10.15"
FT                   /gene_synonym="F5I10_15"
FT                   /gene_synonym="maternal effect embryo arrest 45"
FT                   /locus_tag="AT4G00260"
FT   mRNA            join(114971..115024,115122..115407,115514..115623,
FT                   115703..116012,116106..116227,116303..116707,
FT                   116752..117051)
FT                   /gene="MEE45"
FT                   /gene_synonym="A_IG005I10.15"
FT                   /gene_synonym="A_IG005I10_15"
FT                   /gene_synonym="F5I10.15"
FT                   /gene_synonym="F5I10_15"
FT                   /gene_synonym="maternal effect embryo arrest 45"
FT                   /locus_tag="AT4G00260"
FT                   /product="Transcriptional factor B3 family protein"
FT   CDS_pept        join(114971..115024,115122..115407,115514..115623,
FT                   115703..116012,116106..116227,116303..116707,
FT                   116752..117051)
FT                   /codon_start=1
FT                   /gene="MEE45"
FT                   /gene_synonym="A_IG005I10.15"
FT                   /gene_synonym="A_IG005I10_15"
FT                   /gene_synonym="F5I10.15"
FT                   /gene_synonym="F5I10_15"
FT                   /gene_synonym="maternal effect embryo arrest 45"
FT                   /locus_tag="AT4G00260"
FT                   /product="Transcriptional factor B3 family protein"
FT                   /note="maternal effect embryo arrest 45 (MEE45); FUNCTIONS
FT                   IN: DNA binding, sequence-specific DNA binding
FT                   transcription factor activity; INVOLVED IN: regulation of
FT                   transcription, DNA-dependent, embryo development ending in
FT                   seed dormancy; LOCATED IN: endomembrane system; CONTAINS
FT                   InterPro DOMAIN/s: Transcriptional factor B3
FT                   (InterPro:IPR003340); BEST Arabidopsis thaliana protein
FT                   match is: Transcriptional factor B3 family protein
FT                   (TAIR:AT2G24645.1); Has 539 Blast hits to 263 proteins in
FT                   14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 539; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:O23076"
FT                   /db_xref="InterPro:IPR003340"
FT                   /db_xref="InterPro:IPR015300"
FT                   /db_xref="InterPro:IPR039218"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23076"
FT                   /protein_id="AEE81847.1"
FT                   /translation="MAHQHFFKPLLPGFHASLTIPVAFFLKYIEGRYEQKTAKLRSDAS
FT                   KRTWEVKIDGQRLTDGWKEFAVSHDLRIGDIVVFRQESDLAFHVTLLGPSCCGIQYGSC
FT                   SVEKNNLGDEKKKVKENPNGEAESSSRDPSCFVANVAPSSLRYDLMRFPRGFVRDNGVV
FT                   GSGEIVLMNEKGRSWNFNLRQKPSNGTVYVRGGWVSFCDANGLKAGDNYTFKLIKRAGT
FT                   LVLRLLPNEPKEEANEVSLPEEPESDAERNLEKIQRKEKVKKNVTREAESSSQDPSCFV
FT                   ANVSPSSLRYDTLYLPKRFMRENGVDKRCGEMILINEKGKSWTLDLKVKKSSGTSLIKR
FT                   GWRSFCSANGLRAGSIITLKLIKKRATLVLRLIPNEPEEANEVVSLSTEQESDEESIHD
FT                   EKISRRKSLLSENRFVTLTLTPYTIQSSLLNENLLCESMFQRLPVPFTRMNGINEETKM
FT                   TLLDKHGVKWLTTLRFEDDKRKRLRMVGGWQGFIQANDVKANESIMLELIWEEETSCVL
FT                   KFCSKVKLEIK"
FT   gene            complement(117085..118643)
FT                   /gene_synonym="A_IG005I10.11"
FT                   /gene_synonym="A_IG005I10_11"
FT                   /gene_synonym="F5I10.11"
FT                   /gene_synonym="F5I10_11"
FT                   /locus_tag="AT4G00270"
FT   mRNA            complement(join(117085..118151,118235..118643))
FT                   /gene_synonym="A_IG005I10.11"
FT                   /gene_synonym="A_IG005I10_11"
FT                   /gene_synonym="F5I10.11"
FT                   /gene_synonym="F5I10_11"
FT                   /locus_tag="AT4G00270"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR186058.1,INSD:EG493512.1,INSD:BP613420.1,
FT                   INSD:EG493513.1,INSD:EH815073.1,INSD:EL127691.1,
FT                   INSD:EL292796.1,INSD:ES067261.1,INSD:ES006625.1,
FT                   INSD:EL236225.1,INSD:EH957356.1,INSD:EL259892.1,
FT                   INSD:EL080290.1,INSD:EL102946.1,INSD:ES154615.1,
FT                   INSD:DR186059.1,INSD:BG459389.1,INSD:EL273370.1,
FT                   INSD:BP601417.1,INSD:EL276459.1,INSD:ES029208.1,
FT                   INSD:EG493511.1,INSD:ES132150.1,INSD:AV440466.1,
FT                   INSD:EH871201.1,INSD:ES031550.1,INSD:EH796203.1,
FT                   INSD:EH922175.1,INSD:ES098514.1,INSD:AV827153.1,
FT                   INSD:EH858153.1,INSD:DR186055.1,INSD:EH867297.1,
FT                   INSD:EL116124.1,INSD:EH865497.1,INSD:EL020271.1,
FT                   INSD:AV809661.1,INSD:EH920490.1,INSD:DR186056.1,
FT                   INSD:EL310891.1,INSD:DR186057.1,INSD:BP646079.1,
FT                   INSD:EH990823.1,INSD:ES162179.1,INSD:EH851191.1,
FT                   INSD:EL275904.1,INSD:DR374731.1,INSD:EH945524.1,
FT                   INSD:EL989548.1,INSD:EH844014.1,INSD:EL999803.1,
FT                   INSD:AV797385.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF361590.1,INSD:AY074837.1"
FT   CDS_pept        complement(join(117477..118151,118235..118468))
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.11"
FT                   /gene_synonym="A_IG005I10_11"
FT                   /gene_synonym="F5I10.11"
FT                   /gene_synonym="F5I10_11"
FT                   /locus_tag="AT4G00270"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /note="DNA-binding storekeeper protein-related
FT                   transcriptional regulator; FUNCTIONS IN: transcription
FT                   regulator activity; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF573
FT                   (InterPro:IPR007592); BEST Arabidopsis thaliana protein
FT                   match is: DNA-binding storekeeper protein-related
FT                   transcriptional regulator (TAIR:AT2G25650.1); Has 282 Blast
FT                   hits to 277 proteins in 23 species: Archae - 0; Bacteria -
FT                   0; Metazoa - 3; Fungi - 2; Plants - 255; Viruses - 0; Other
FT                   Eukaryotes - 22 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00270"
FT                   /db_xref="GOA:Q9ASZ1"
FT                   /db_xref="InterPro:IPR007592"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ASZ1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR186058.1,INSD:EG493512.1,INSD:BP613420.1,
FT                   INSD:EG493513.1,INSD:EH815073.1,INSD:EL127691.1,
FT                   INSD:EL292796.1,INSD:ES067261.1,INSD:ES006625.1,
FT                   INSD:EL236225.1,INSD:EH957356.1,INSD:EL259892.1,
FT                   INSD:EL080290.1,INSD:EL102946.1,INSD:ES154615.1,
FT                   INSD:DR186059.1,INSD:BG459389.1,INSD:EL273370.1,
FT                   INSD:BP601417.1,INSD:EL276459.1,INSD:ES029208.1,
FT                   INSD:EG493511.1,INSD:ES132150.1,INSD:AV440466.1,
FT                   INSD:EH871201.1,INSD:ES031550.1,INSD:EH796203.1,
FT                   INSD:EH922175.1,INSD:ES098514.1,INSD:AV827153.1,
FT                   INSD:EH858153.1,INSD:DR186055.1,INSD:EH867297.1,
FT                   INSD:EL116124.1,INSD:EH865497.1,INSD:EL020271.1,
FT                   INSD:AV809661.1,INSD:EH920490.1,INSD:DR186056.1,
FT                   INSD:EL310891.1,INSD:DR186057.1,INSD:BP646079.1,
FT                   INSD:EH990823.1,INSD:ES162179.1,INSD:EH851191.1,
FT                   INSD:EL275904.1,INSD:DR374731.1,INSD:EH945524.1,
FT                   INSD:EL989548.1,INSD:EH844014.1,INSD:EL999803.1,
FT                   INSD:AV797385.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF361590.1,INSD:AY074837.1"
FT                   /protein_id="AEE81848.1"
FT                   /translation="MVTPKQIDFSSCVGADNSNGTLSHRRSPRNIPSSKRAASVAEEET
FT                   MKKKMKMKKKKKKLDPPLIVRIWNEEDELSILKGLVDYRAKTGFNPKIDWDAFCSFLGS
FT                   SIVERFSKDQVLSKIRKLKRRFHVHSEKINQGNDPKFTRSSDSEAFGFSSMIWGQGDDD
FT                   GMDKEHEVNGNGAAENRTNESGEEMLKEHEEEVANTELLNENGAAKTTENGTSSGKERH
FT                   DEDNDDDDELCAVQDAFEAVMSQGLSGYQKKLQLEKLMNLGNGKRRELSDEWKALCVEE
FT                   TRFNIKKLRFSAKLAEAANDS"
FT   gene            complement(122409..122851)
FT                   /gene_synonym="A_IG005I10.10"
FT                   /gene_synonym="A_IG005I10_10"
FT                   /gene_synonym="F5I10.10"
FT                   /gene_synonym="F5I10_10"
FT                   /locus_tag="AT4G00280"
FT   mRNA            complement(join(122409..122523,122651..122712,
FT                   122813..122851))
FT                   /gene_synonym="A_IG005I10.10"
FT                   /gene_synonym="A_IG005I10_10"
FT                   /gene_synonym="F5I10.10"
FT                   /gene_synonym="F5I10_10"
FT                   /locus_tag="AT4G00280"
FT                   /product="ER protein carbohydrate-binding protein"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK176761.1,INSD:AK176579.1"
FT   CDS_pept        complement(join(122409..122523,122651..122712,
FT                   122813..122851))
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.10"
FT                   /gene_synonym="A_IG005I10_10"
FT                   /gene_synonym="F5I10.10"
FT                   /gene_synonym="F5I10_10"
FT                   /locus_tag="AT4G00280"
FT                   /product="ER protein carbohydrate-binding protein"
FT                   /note="BEST Arabidopsis thaliana protein match is:
FT                   Leucine-rich repeat transmembrane protein kinase protein
FT                   (TAIR:AT2G19210.1); Has 19 Blast hits to 19 proteins in 2
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 19; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:O23074"
FT                   /db_xref="UniProtKB/TrEMBL:O23074"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK176761.1,INSD:AK176579.1"
FT                   /protein_id="AEE81849.1"
FT                   /translation="MARLMWFAVHDQLEDLEEGREVSSLVPSLQPMKTSFPQGNRNCYN
FT                   VQPPQGKGFEYLIITRFVNEVEPITI"
FT   gene            complement(122851..125591)
FT                   /gene_synonym="A_IG005I10.9"
FT                   /gene_synonym="A_IG005I10_9"
FT                   /gene_synonym="F5I10.9"
FT                   /gene_synonym="F5I10_9"
FT                   /locus_tag="AT4G00290"
FT   mRNA            complement(join(122851..123207,123362..123583,
FT                   123730..123837,123966..124066,124271..124548,
FT                   124627..125304,125477..125591))
FT                   /gene_synonym="A_IG005I10.9"
FT                   /gene_synonym="A_IG005I10_9"
FT                   /gene_synonym="F5I10.9"
FT                   /gene_synonym="F5I10_9"
FT                   /locus_tag="AT4G00290"
FT                   /product="Mechanosensitive ion channel protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH927416.1,INSD:ES103510.1,INSD:BP849947.1,
FT                   INSD:BP810239.1,INSD:BP825625.1,INSD:AV824288.1,
FT                   INSD:BP856622.1,INSD:EL220700.1,INSD:EH879295.1,
FT                   INSD:EL214750.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827920.1,INSD:AK176579.1,INSD:AY096611.1,
FT                   INSD:BX827319.1,INSD:AK222015.1,INSD:AY064027.1,
FT                   INSD:AK176463.1"
FT   CDS_pept        complement(join(123097..123207,123362..123583,
FT                   123730..123837,123966..124066,124271..124548,
FT                   124627..125300))
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.9"
FT                   /gene_synonym="A_IG005I10_9"
FT                   /gene_synonym="F5I10.9"
FT                   /gene_synonym="F5I10_9"
FT                   /locus_tag="AT4G00290"
FT                   /product="Mechanosensitive ion channel protein"
FT                   /note="Mechanosensitive ion channel protein; INVOLVED IN:
FT                   transmembrane transport; LOCATED IN: chloroplast, membrane,
FT                   chloroplast envelope; CONTAINS InterPro DOMAIN/s:
FT                   Mechanosensitive ion channel MscS, transmembrane-2
FT                   (InterPro:IPR011014), Mechanosensitive ion channel MscS
FT                   (InterPro:IPR006685), Like-Sm ribonucleoprotein
FT                   (LSM)-related domain (InterPro:IPR010920); BEST Arabidopsis
FT                   thaliana protein match is: unknown protein
FT                   (TAIR:AT4G00234.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8VZL4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VZL4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH927416.1,INSD:ES103510.1,INSD:BP849947.1,
FT                   INSD:BP810239.1,INSD:BP825625.1,INSD:AV824288.1,
FT                   INSD:BP856622.1,INSD:EL220700.1,INSD:EH879295.1,
FT                   INSD:EL214750.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827920.1,INSD:AK176579.1,INSD:AY096611.1,
FT                   INSD:BX827319.1,INSD:AK222015.1,INSD:AY064027.1,
FT                   INSD:AK176463.1"
FT                   /protein_id="AEE81850.1"
FT                   /translation="MAGVRLSLLKSIQRSIKPHATAKSCSGLLNSHARAFTCGNLLDGP
FT                   KASPSMISFSSNIRLHNDAKPFNYLGHSSYARAFSSKSDDFGSIVASGVTGSGDGNGNG
FT                   NDWVEKAKDVLQTSVDAVTETAKKTKDVSDEMIPHVQQFLDSNPYLKDVIVPVSLTMTG
FT                   TLFAWVVMPRILRRFHTYAMQSSAKLLPVGFSNEDVPYEKSFWGALEDPARYLVTFIAF
FT                   AQIAAMVAPTTIAAQYFSPTVKGAVILSLVWFLYRWKTNVITRMLSAKSFGGLDREKVL
FT                   TLDKVSSVGLFAIGLMASAEACGVAVQSILTVGGVGGVATAFAARDILGNVLSGLSMQF
FT                   SRPFSMGDTIKAGSVEGQVIEMGLTTTSLLNAEKFPVLVPNSLFSSQVIVNKSRAQWRA
FT                   IASKIPLQIDDLDMIPQISNEIKEMLRSNTKVFLGKEAPHCYLSRVEKSFAELTIGCNL
FT                   IRMGKEELYNTQQEVLLEAVKIIKKHGVSLGTTWDNSTL"
FT   gene            126509..>128060
FT                   /locus_tag="AT4G00295"
FT   mRNA            join(126509..127360,127512..>128060)
FT                   /locus_tag="AT4G00295"
FT                   /product="fringe-like protein"
FT   CDS_pept        join(126509..127360,127512..>128060)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00295"
FT                   /product="fringe-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00295"
FT                   /db_xref="GOA:A0A1P8B4K0"
FT                   /db_xref="InterPro:IPR006740"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B4K0"
FT                   /protein_id="ANM66519.1"
FT                   /translation="MGDQKTLSYDKSNKPFYSSSSSPCSFTAIVVFLIFVSYLLYSFSF
FT                   ISFLNPYSPSKSPNSLLVPVIRLGSGQTPEEQTELKHIVFGIAASSDLWKHRREYVKTW
FT                   WKPNGVMNGAVWLDKPINDTVSSSSALPQIRISSDTSSFKYRYRNGHRSAIRITRIVSE
FT                   TVRMLNGTEAERNVRWVVMGDDDTVFFTENLVRVLRKYDHKQFYYIGAPSESHLQNLHQ
FT                   FSYGMAYGGGGFAISYPLAKVLEKMQDRCIERYSDLYGSDDRIHACMAELGVPLTKEVG
FT                   FHQFDVYGNLLGLLSVHPQAPIVSIHHLDVVDPIFPKTNRVNALKKLMIPAKLDSASLV
FT                   QQSVCYDKSHQWTMSISWGYTVQITRTYMPARMMEVPTRTFNDWHLRSDFTNLAFNTRP
FT                   VTWTDCQRPRVFYFSHAFSNSSSSDTTTISQYLRHDEWYPKCEWGIADPSEINQIFVYK
FT                   KPTPDRWSK"
FT   gene            128581..130331
FT                   /gene_synonym="A_IG005I10.16"
FT                   /gene_synonym="A_IG005I10_16"
FT                   /gene_synonym="F5I10.16"
FT                   /gene_synonym="F5I10_16"
FT                   /locus_tag="AT4G00300"
FT                   /note="AT4G00300 has been split into two loci based on new
FT                   cDNA evidence provided by Aleksander Riise Hansen of
FT                   University of Copenhagen: AT4G00300.2 becomes AT4G00300.1;
FT                   a new locus AT4G00295 is created. See comments field for
FT                   AT4G00295 annotation."
FT   mRNA            128581..130331
FT                   /gene_synonym="A_IG005I10.16"
FT                   /gene_synonym="A_IG005I10_16"
FT                   /gene_synonym="F5I10.16"
FT                   /gene_synonym="F5I10_16"
FT                   /locus_tag="AT4G00300"
FT                   /product="receptor-like kinase"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH813409.1,INSD:EL214914.1,INSD:EL138754.1,
FT                   INSD:BP781413.1,INSD:ES106092.1,INSD:ES063637.1,
FT                   INSD:EL074563.1,INSD:EL309444.1,INSD:AU228223.1,
FT                   INSD:EL179352.1,INSD:EL267095.1,INSD:EH829142.1,
FT                   INSD:EL124749.1,INSD:ES110332.1,INSD:EH880952.1,
FT                   INSD:AV808302.1,INSD:EH825278.1,INSD:ES184879.1,
FT                   INSD:EL177899.1,INSD:BP637884.1,INSD:EL980779.1,
FT                   INSD:ES175080.1,INSD:EL043076.1,INSD:EL000827.1,
FT                   INSD:EH804884.1,INSD:ES042603.1,INSD:EL254499.1,
FT                   INSD:EL046740.1,INSD:EH804676.1,INSD:EL286893.1,
FT                   INSD:EL251384.1,INSD:ES188057.1,INSD:ES180305.1,
FT                   INSD:EL984994.1,INSD:ES096427.1,INSD:EL105210.1,
FT                   INSD:EL340710.1,INSD:BP662343.1,INSD:EL104410.1,
FT                   INSD:EL043792.1,INSD:EL253014.1"
FT   CDS_pept        128690..130126
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.16"
FT                   /gene_synonym="A_IG005I10_16"
FT                   /gene_synonym="F5I10.16"
FT                   /gene_synonym="F5I10_16"
FT                   /locus_tag="AT4G00300"
FT                   /product="receptor-like kinase"
FT                   /note="fringe-related protein; CONTAINS InterPro DOMAIN/s:
FT                   Malectin/receptor-like protein kinase (InterPro:IPR021720),
FT                   Protein of unknown function DUF604 (InterPro:IPR006740);
FT                   BEST Arabidopsis thaliana protein match is: Protein of
FT                   unknown function (DUF604) (TAIR:AT1G01570.1); Has 958 Blast
FT                   hits to 946 proteins in 99 species: Archae - 0; Bacteria -
FT                   2; Metazoa - 87; Fungi - 151; Plants - 707; Viruses - 0;
FT                   Other Eukaryotes - 11 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00300"
FT                   /db_xref="GOA:Q0WQL0"
FT                   /db_xref="InterPro:IPR024788"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WQL0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH813409.1,INSD:EL214914.1,INSD:EL138754.1,
FT                   INSD:BP781413.1,INSD:ES106092.1,INSD:ES063637.1,
FT                   INSD:EL074563.1,INSD:EL309444.1,INSD:AU228223.1,
FT                   INSD:EL179352.1,INSD:EL267095.1,INSD:EH829142.1,
FT                   INSD:EL124749.1,INSD:ES110332.1,INSD:EH880952.1,
FT                   INSD:AV808302.1,INSD:EH825278.1,INSD:ES184879.1,
FT                   INSD:EL177899.1,INSD:BP637884.1,INSD:EL980779.1,
FT                   INSD:ES175080.1,INSD:EL043076.1,INSD:EL000827.1,
FT                   INSD:EH804884.1,INSD:ES042603.1,INSD:EL254499.1,
FT                   INSD:EL046740.1,INSD:EH804676.1,INSD:EL286893.1,
FT                   INSD:EL251384.1,INSD:ES188057.1,INSD:ES180305.1,
FT                   INSD:EL984994.1,INSD:ES096427.1,INSD:EL105210.1,
FT                   INSD:EL340710.1,INSD:BP662343.1,INSD:EL104410.1,
FT                   INSD:EL043792.1,INSD:EL253014.1"
FT                   /protein_id="AEE81851.2"
FT                   /translation="MAILYTRIVFLLFVFLVSSSAFASFSPVDEYLVNCGSDVDSTVDN
FT                   RRFVGDASSSNVQFFSSEGSIALKGENLPQNVPQIYRTARIFAQQAKYKFNVNEKGTHM
FT                   VRLHFNRLYSSRIDLNDALFHVTVNGHVVLRNFSGDSSSDFESRVREFLIWVDVGEVVI
FT                   RFVPSKDSNFAFVNAIEVISAPKDLIGDVATSVSHDGTEKFNGLAKQAMEVVYRVNVGG
FT                   RKVTPFNDTLWRTWVTDEGFLKTGDGSSEKSYFTGRIKYRRGGASREVGPDNVYNTARV
FT                   GKRSNGLVDMSWGFKVNVGYKYLIRMHFCDIASKSLGRLYFNVYINGNLAYEDFDISYA
FT                   ADNVLASPYYIDFVVDATADDNNPSGSSITVSVGPSNKTSVDGNGVDAILNGVEIMKMN
FT                   NSMGSLDGYVSTEMILSTCPNRRNLSIFIAMLAFMCIFMSFYIVTQRKRVKDQYGWTKL
FT                   SMDVLEDNSKSGNQFTARKA"
FT   gene            131422..132018
FT                   /locus_tag="AT4G00305"
FT   mRNA            131422..132018
FT                   /locus_tag="AT4G00305"
FT                   /product="RING/U-box superfamily protein"
FT   CDS_pept        131550..131930
FT                   /codon_start=1
FT                   /locus_tag="AT4G00305"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; LOCATED IN: endomembrane system; CONTAINS
FT                   InterPro DOMAIN/s: Zinc finger, RING-type
FT                   (InterPro:IPR001841), Zinc finger, C3HC4 RING-type
FT                   (InterPro:IPR018957); BEST Arabidopsis thaliana protein
FT                   match is: brassinosteroid-responsive RING-H2
FT                   (TAIR:AT3G61460.1); Has 6452 Blast hits to 6437 proteins in
FT                   243 species: Archae - 0; Bacteria - 0; Metazoa - 1579;
FT                   Fungi - 466; Plants - 3776; Viruses - 3; Other Eukaryotes -
FT                   628 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00305"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00305.1"
FT                   /db_xref="GOA:Q3EAE6"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q3EAE6"
FT                   /protein_id="AEE81853.1"
FT                   /translation="MGLSYSGAGVIIAGVILNDFIKSVRSFLDIRRLFGSASSGSTIID
FT                   KIPMDDMLPATKFEDISSRVNPPESCRICQDEFDGGDEVRCLRNCVHVYHKTCIDRWIQ
FT                   DDKMTCPLCRTPIVPDFYFFRL"
FT   gene            132712..133253
FT                   /locus_tag="AT4G03555"
FT   ncRNA           132712..133253
FT                   /locus_tag="AT4G03555"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(132963..133179)
FT                   /locus_tag="AT4G03575"
FT   ncRNA           complement(132963..133179)
FT                   /locus_tag="AT4G03575"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            133643..135502
FT                   /gene="EDA8"
FT                   /gene_synonym="A_IG005I10.17"
FT                   /gene_synonym="A_IG005I10_17"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 8"
FT                   /gene_synonym="F5I10.17"
FT                   /gene_synonym="F5I10_17"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 46"
FT                   /gene_synonym="MEE46"
FT                   /locus_tag="AT4G00310"
FT   mRNA            join(133643..134081,134367..134434,134620..135502)
FT                   /gene="EDA8"
FT                   /gene_synonym="A_IG005I10.17"
FT                   /gene_synonym="A_IG005I10_17"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 8"
FT                   /gene_synonym="F5I10.17"
FT                   /gene_synonym="F5I10_17"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 46"
FT                   /gene_synonym="MEE46"
FT                   /locus_tag="AT4G00310"
FT                   /product="Putative membrane lipoprotein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG442993.1,INSD:EL006968.1,INSD:EL180391.1,
FT                   INSD:EG435784.1,INSD:ES165344.1,INSD:EG442991.1,
FT                   INSD:EG442995.1,INSD:Z35744.1,INSD:EG442997.1,
FT                   INSD:AV825962.1,INSD:ES139335.1,INSD:AV793086.1,
FT                   INSD:EG435862.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY090270.1,INSD:AY049241.1"
FT   mRNA            join(133647..133737,133839..134081,134367..134434,
FT                   134620..135502)
FT                   /gene="EDA8"
FT                   /gene_synonym="A_IG005I10.17"
FT                   /gene_synonym="A_IG005I10_17"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 8"
FT                   /gene_synonym="F5I10.17"
FT                   /gene_synonym="F5I10_17"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 46"
FT                   /gene_synonym="MEE46"
FT                   /locus_tag="AT4G00310"
FT                   /product="Putative membrane lipoprotein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG442993.1,INSD:EL180391.1,INSD:EG435784.1,
FT                   INSD:ES165344.1,INSD:DR288667.1,INSD:EG442997.1,
FT                   INSD:Z35744.1,INSD:BP838388.1,INSD:ES139335.1,
FT                   INSD:AV793086.1,INSD:BP825859.1,INSD:EG435862.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY090270.1"
FT   CDS_pept        join(133857..134081,134367..134434,134620..135235)
FT                   /codon_start=1
FT                   /gene="EDA8"
FT                   /gene_synonym="A_IG005I10.17"
FT                   /gene_synonym="A_IG005I10_17"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 8"
FT                   /gene_synonym="F5I10.17"
FT                   /gene_synonym="F5I10_17"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 46"
FT                   /gene_synonym="MEE46"
FT                   /locus_tag="AT4G00310"
FT                   /product="Putative membrane lipoprotein"
FT                   /note="EMBRYO SAC DEVELOPMENT ARREST 8 (EDA8); Has 49 Blast
FT                   hits to 49 proteins in 16 species: Archae - 0; Bacteria -
FT                   0; Metazoa - 3; Fungi - 8; Plants - 36; Viruses - 0; Other
FT                   Eukaryotes - 2 (source: NCBI BLink)."
FT                   /db_xref="GOA:O23071"
FT                   /db_xref="UniProtKB/TrEMBL:O23071"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG442993.1,INSD:EL006968.1,INSD:EL180391.1,
FT                   INSD:EG435784.1,INSD:ES165344.1,INSD:EG442991.1,
FT                   INSD:EG442995.1,INSD:Z35744.1,INSD:EG442997.1,
FT                   INSD:AV825962.1,INSD:ES139335.1,INSD:AV793086.1,
FT                   INSD:EG435862.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY090270.1,INSD:AY049241.1"
FT                   /protein_id="AEE81854.1"
FT                   /translation="MRIRKNTKLSSVLLSTAGCGGERPDTYVCHLNQSPWDVIPVSSSG
FT                   DCELTNLVDSSWFLPLSSSSSSSSPPLIHKFIGEEDSFNGNVSLGDCNDTAQRFNSSVS
FT                   SNQSLVSVEKLNLNAAEEDKYAISPEVEDPMDQSDDYDKKSEALEPNSPVKTSGDDEKV
FT                   VVTIPTAPKRGRPRGSGKKVSAPALKNPYEFYYYSGFGPRWGRKRGGSDDEKMVINDSK
FT                   KSRSSASSSSDEDGHKTAAFGGGSVSFDEFDFVDEDYDVMEQDQGSDHGRKKKNEKMIM
FT                   MKKTMKKGRKPVKERSLKSLM"
FT   CDS_pept        join(133857..134081,134367..134434,134620..135235)
FT                   /codon_start=1
FT                   /gene="EDA8"
FT                   /gene_synonym="A_IG005I10.17"
FT                   /gene_synonym="A_IG005I10_17"
FT                   /gene_synonym="EMBRYO SAC DEVELOPMENT ARREST 8"
FT                   /gene_synonym="F5I10.17"
FT                   /gene_synonym="F5I10_17"
FT                   /gene_synonym="MATERNAL EFFECT EMBRYO ARREST 46"
FT                   /gene_synonym="MEE46"
FT                   /locus_tag="AT4G00310"
FT                   /product="Putative membrane lipoprotein"
FT                   /note="EMBRYO SAC DEVELOPMENT ARREST 8 (EDA8); Has 35333
FT                   Blast hits to 34131 proteins in 2444 species: Archae - 798;
FT                   Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531;
FT                   Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="GOA:O23071"
FT                   /db_xref="UniProtKB/TrEMBL:O23071"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG442993.1,INSD:EL180391.1,INSD:EG435784.1,
FT                   INSD:ES165344.1,INSD:DR288667.1,INSD:EG442997.1,
FT                   INSD:Z35744.1,INSD:BP838388.1,INSD:ES139335.1,
FT                   INSD:AV793086.1,INSD:BP825859.1,INSD:EG435862.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY090270.1"
FT                   /protein_id="AEE81855.1"
FT                   /translation="MRIRKNTKLSSVLLSTAGCGGERPDTYVCHLNQSPWDVIPVSSSG
FT                   DCELTNLVDSSWFLPLSSSSSSSSPPLIHKFIGEEDSFNGNVSLGDCNDTAQRFNSSVS
FT                   SNQSLVSVEKLNLNAAEEDKYAISPEVEDPMDQSDDYDKKSEALEPNSPVKTSGDDEKV
FT                   VVTIPTAPKRGRPRGSGKKVSAPALKNPYEFYYYSGFGPRWGRKRGGSDDEKMVINDSK
FT                   KSRSSASSSSDEDGHKTAAFGGGSVSFDEFDFVDEDYDVMEQDQGSDHGRKKKNEKMIM
FT                   MKKTMKKGRKPVKERSLKSLM"
FT   gene            137404..138888
FT                   /locus_tag="AT4G00315"
FT   mRNA            join(137404..138300,138379..138519,138601..138888)
FT                   /locus_tag="AT4G00315"
FT                   /product="F-box/RNI-like/FBD-like domains-containing
FT                   protein"
FT   CDS_pept        join(137404..138300,138379..138519,138601..138888)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00315"
FT                   /product="F-box/RNI-like/FBD-like domains-containing
FT                   protein"
FT                   /note="F-box/RNI-like/FBD-like domains-containing protein;
FT                   CONTAINS InterPro DOMAIN/s: F-box domain, cyclin-like
FT                   (InterPro:IPR001810), FBD (InterPro:IPR013596), F-box
FT                   domain, Skp2-like (InterPro:IPR022364), FBD-like
FT                   (InterPro:IPR006566), Leucine-rich repeat 2
FT                   (InterPro:IPR013101); BEST Arabidopsis thaliana protein
FT                   match is: FBD, F-box and Leucine Rich Repeat domains
FT                   containing protein (TAIR:AT1G55660.1); Has 2332 Blast hits
FT                   to 2280 proteins in 33 species: Archae - 0; Bacteria - 2;
FT                   Metazoa - 5; Fungi - 4; Plants - 2320; Viruses - 0; Other
FT                   Eukaryotes - 1 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q3EAE5"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3EAE5"
FT                   /protein_id="AEE81856.1"
FT                   /translation="MDKTSQLPDELLVKVLSFLPTKDAVRTSLLSMRWKSLWMWLPKLE
FT                   YDFRHYSVSEGQGLARFITLSLLGHKAPAIESLSLKLRYGAIGSIKPEDIYLWVSLAVH
FT                   DSNVRELSLKLCTFAERPTKLPKSLYKCKSIVILKLKDEILVDVPRKVCLPSLKTLFLG
FT                   RVTYSDEDSLHRLLSNCPVLEDLVVERDRIDNLGKLSVVVKSLQRLTLKMSCPCHLDGI
FT                   MMNTPSLKYLKVTDERQESDSDNESDSDSPRYFYDFEDMPKLEEADFVLTFQNIKKFFK
FT                   FVTSIKRLSLCLGVYTEESLYHEGLVFNQLEQLKICSCDSDWSILLSRLLESSPNLREL
FT                   EAYVIEDHPDRRVDLPNQWGNQLNCVPKCLLSSLETFKWSEMYGLLQNQMDVAKYILRN
FT                   ARCLKSATIFFPTTYAKETRDEMIEELSLSFQGPETCQVFFH"
FT   gene            139939..141643
FT                   /gene_synonym="A_IG005I10.18"
FT                   /gene_synonym="A_IG005I10_18"
FT                   /gene_synonym="F5I10.18"
FT                   /gene_synonym="F5I10_18"
FT                   /locus_tag="AT4G00320"
FT   mRNA            join(139939..140916,141010..141150,141239..141643)
FT                   /gene_synonym="A_IG005I10.18"
FT                   /gene_synonym="A_IG005I10_18"
FT                   /gene_synonym="F5I10.18"
FT                   /gene_synonym="F5I10_18"
FT                   /locus_tag="AT4G00320"
FT                   /product="F-box/RNI-like superfamily protein"
FT   CDS_pept        join(139939..140916,141010..141150,141239..141643)
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.18"
FT                   /gene_synonym="A_IG005I10_18"
FT                   /gene_synonym="F5I10.18"
FT                   /gene_synonym="F5I10_18"
FT                   /locus_tag="AT4G00320"
FT                   /product="F-box/RNI-like superfamily protein"
FT                   /note="F-box/RNI-like superfamily protein; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: membrane; EXPRESSED IN: leaf; CONTAINS
FT                   InterPro DOMAIN/s: F-box domain, Skp2-like
FT                   (InterPro:IPR022364), FBD-like (InterPro:IPR006566),
FT                   Leucine-rich repeat 2 (InterPro:IPR013101); BEST
FT                   Arabidopsis thaliana protein match is: RNI-like superfamily
FT                   protein (TAIR:AT5G41830.1); Has 1728 Blast hits to 1676
FT                   proteins in 22 species: Archae - 0; Bacteria - 0; Metazoa -
FT                   0; Fungi - 0; Plants - 1728; Viruses - 0; Other Eukaryotes
FT                   - 0 (source: NCBI BLink)."
FT                   /db_xref="GOA:P0C2G6"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C2G6"
FT                   /protein_id="AEE81857.1"
FT                   /translation="MGSKKKCFDGSRDGISGLPDAMICHILSFLPTKVAASTTVLAKRW
FT                   KPLLAFMPNLDFDESFRFDPRMTCEERRKGSESFMLVVDSVLALQAEANATLNKFYVKC
FT                   EGVEQNSVLEWIPKVLKRGVLDIDLQIPSSRGFGSNSTFYPLPSEIFVSKTLVRLKIQF
FT                   QDGANVNVEGDVSLPMLKTLHLDYVKMDTRMLQKLLSGCHTLEELLLMNLIWKESSEPE
FT                   PCFVSVSVRTLKILKFSRFENFMKAKDFKPIVLLSFDIPNLVYLEYLDTIADKYEQVRF
FT                   DSLVKASIGLCKTSKQIENDNNNVTKLFMGICNVTILYLTEDTLKVLGCCRETMPVFEN
FT                   LIHLTIRTGVHIGWKSLPHLLKNCPNLQTLVFEGMHHIYRKGRACGDVDEDGTCMCKNL
FT                   DNMRVKKDIDACLSSSPVKVIKILNFGELCGFCEFCDVEEDVAGQIKQVKQFLETMPDL
FT                   EKVILYYNTPEDEDVMKVFKKLKKLPRVASAKCEVQIISDNINLSFTFR"
FT   gene            complement(142570..145719)
FT                   /gene="CRCK2"
FT                   /gene_synonym="A_IG005I10.8"
FT                   /gene_synonym="A_IG005I10_8"
FT                   /gene_synonym="calmodulin-binding receptor-like cytoplasmic
FT                   kinase 2"
FT                   /gene_synonym="F5I10.8"
FT                   /gene_synonym="F5I10_8"
FT                   /locus_tag="AT4G00330"
FT                   /note="high overall homology to CRCK1"
FT   mRNA            complement(join(142570..143002,143085..143386,
FT                   143475..143564,143644..143818,143891..144114,
FT                   144199..144561))
FT                   /gene="CRCK2"
FT                   /gene_synonym="A_IG005I10.8"
FT                   /gene_synonym="A_IG005I10_8"
FT                   /gene_synonym="calmodulin-binding receptor-like cytoplasmic
FT                   kinase 2"
FT                   /gene_synonym="F5I10.8"
FT                   /gene_synonym="F5I10_8"
FT                   /locus_tag="AT4G00330"
FT                   /product="calmodulin-binding receptor-like cytoplasmic
FT                   kinase 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH943604.1,INSD:EL125060.1,INSD:EL299863.1,
FT                   INSD:EL235775.1,INSD:BP861992.1,INSD:EL268198.1,
FT                   INSD:EH838496.1,INSD:EL312400.1,INSD:CB074326.1,
FT                   INSD:BP806473.1,INSD:EH810946.1,INSD:BE662881.1,
FT                   INSD:EL117406.1,INSD:AV828156.1,INSD:EL242494.1,
FT                   INSD:EL170178.1,INSD:EH815639.1,INSD:EL172837.1,
FT                   INSD:BP669924.1,INSD:EL191349.1,INSD:EL262053.1,
FT                   INSD:EL069900.1,INSD:EL280982.1,INSD:EL274050.1,
FT                   INSD:EH843831.1,INSD:EH980698.1,INSD:BP611582.1,
FT                   INSD:EL341590.1,INSD:EL003067.1,INSD:EL092928.1,
FT                   INSD:EH847609.1,INSD:EH954350.1,INSD:EL017289.1,
FT                   INSD:EL059184.1,INSD:EL130185.1,INSD:EL255123.1,
FT                   INSD:EL210305.1,INSD:BP622935.1,INSD:EL319038.1,
FT                   INSD:EH933004.1,INSD:EL095202.1,INSD:EL252284.1,
FT                   INSD:EH995036.1,INSD:AV527494.1,INSD:EH857514.1,
FT                   INSD:EL286639.1,INSD:EL002666.1,INSD:EH842566.1,
FT                   INSD:CB253832.1,INSD:EH961774.1,INSD:BP865687.1,
FT                   INSD:EL285993.1,INSD:EL165213.1,INSD:EL255274.1,
FT                   INSD:EH994088.1,INSD:EL077749.1,INSD:EH933764.1,
FT                   INSD:EL325535.1,INSD:EL175626.1,INSD:CB253828.1,
FT                   INSD:EH935565.1,INSD:R30513.1,INSD:EL284515.1,
FT                   INSD:ES176576.1,INSD:EL292977.1,INSD:AV562508.1,
FT                   INSD:EL128578.1,INSD:EL303645.1,INSD:BP786914.1,
FT                   INSD:EL193107.1,INSD:EL301533.1,INSD:EH852291.1,
FT                   INSD:EL044594.1,INSD:AV800534.1,INSD:BP807492.1,
FT                   INSD:EL186101.1,INSD:EL239937.1,INSD:EL166341.1,
FT                   INSD:EL276522.1,INSD:EH967615.1,INSD:EH936150.1,
FT                   INSD:EH845119.1,INSD:EL122107.1,INSD:EL293703.1,
FT                   INSD:EL302661.1,INSD:EH896018.1,INSD:EL307031.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY064064.1,INSD:AK227113.1,INSD:AY133754.1"
FT   mRNA            complement(join(142583..143002,143085..143386,
FT                   143475..143564,143644..143818,143891..144114,
FT                   144199..144582,145705..145719))
FT                   /gene="CRCK2"
FT                   /gene_synonym="A_IG005I10.8"
FT                   /gene_synonym="A_IG005I10_8"
FT                   /gene_synonym="calmodulin-binding receptor-like cytoplasmic
FT                   kinase 2"
FT                   /gene_synonym="F5I10.8"
FT                   /gene_synonym="F5I10_8"
FT                   /locus_tag="AT4G00330"
FT                   /product="calmodulin-binding receptor-like cytoplasmic
FT                   kinase 2"
FT   CDS_pept        complement(join(142787..143002,143085..143386,
FT                   143475..143564,143644..143818,143891..144114,
FT                   144199..144427))
FT                   /codon_start=1
FT                   /gene="CRCK2"
FT                   /gene_synonym="A_IG005I10.8"
FT                   /gene_synonym="A_IG005I10_8"
FT                   /gene_synonym="calmodulin-binding receptor-like cytoplasmic
FT                   kinase 2"
FT                   /gene_synonym="F5I10.8"
FT                   /gene_synonym="F5I10_8"
FT                   /locus_tag="AT4G00330"
FT                   /product="calmodulin-binding receptor-like cytoplasmic
FT                   kinase 2"
FT                   /db_xref="GOA:Q8VZJ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VZJ9"
FT                   /protein_id="ANM67233.1"
FT                   /translation="MPSRRRHSYTVGSPATTSSNYSNTTFTDRSFPTTPARTSTDTTTS
FT                   IARRISGIFINCFTPPDSVSSNYIDNSKSSSDNNIRSRRSSTGSSSVQRSYGNANETEH
FT                   TRFTFDEIYDATKNFSPSFRIGQGGFGTVYKVKLRDGKTFAVKRAKKSMHDDRQGADAE
FT                   FMSEIQTLAQVTHLSLVKYYGFVVHNDEKILVVEYVANGTLRDHLDCKEGKTLDMATRL
FT                   DIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATH
FT                   VSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRW
FT                   AIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKKCSEILWGI
FT                   RKDYRELLNTSL"
FT   CDS_pept        complement(join(142787..143002,143085..143386,
FT                   143475..143564,143644..143818,143891..144114,
FT                   144199..144427))
FT                   /codon_start=1
FT                   /gene="CRCK2"
FT                   /gene_synonym="A_IG005I10.8"
FT                   /gene_synonym="A_IG005I10_8"
FT                   /gene_synonym="calmodulin-binding receptor-like cytoplasmic
FT                   kinase 2"
FT                   /gene_synonym="F5I10.8"
FT                   /gene_synonym="F5I10_8"
FT                   /locus_tag="AT4G00330"
FT                   /product="calmodulin-binding receptor-like cytoplasmic
FT                   kinase 2"
FT                   /note="calmodulin-binding receptor-like cytoplasmic kinase
FT                   2 (CRCK2); FUNCTIONS IN: protein serine/threonine kinase
FT                   activity, protein kinase activity, kinase activity, ATP
FT                   binding; INVOLVED IN: pollen development; EXPRESSED IN: 22
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Protein kinase, ATP binding
FT                   site (InterPro:IPR017441), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271); BEST Arabidopsis thaliana
FT                   protein match is: calmodulin-binding receptor-like
FT                   cytoplasmic kinase 1 (TAIR:AT5G58940.1); Has 30201 Blast
FT                   hits to 17322 proteins in 780 species: Archae - 12;
FT                   Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants -
FT                   5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q8VZJ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VZJ9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH943604.1,INSD:EL125060.1,INSD:EL299863.1,
FT                   INSD:EL235775.1,INSD:BP861992.1,INSD:EL268198.1,
FT                   INSD:EH838496.1,INSD:EL312400.1,INSD:CB074326.1,
FT                   INSD:BP806473.1,INSD:EH810946.1,INSD:BE662881.1,
FT                   INSD:EL117406.1,INSD:AV828156.1,INSD:EL242494.1,
FT                   INSD:EL170178.1,INSD:EH815639.1,INSD:EL172837.1,
FT                   INSD:BP669924.1,INSD:EL191349.1,INSD:EL262053.1,
FT                   INSD:EL069900.1,INSD:EL280982.1,INSD:EL274050.1,
FT                   INSD:EH843831.1,INSD:EH980698.1,INSD:BP611582.1,
FT                   INSD:EL341590.1,INSD:EL003067.1,INSD:EL092928.1,
FT                   INSD:EH847609.1,INSD:EH954350.1,INSD:EL017289.1,
FT                   INSD:EL059184.1,INSD:EL130185.1,INSD:EL255123.1,
FT                   INSD:EL210305.1,INSD:BP622935.1,INSD:EL319038.1,
FT                   INSD:EH933004.1,INSD:EL095202.1,INSD:EL252284.1,
FT                   INSD:EH995036.1,INSD:AV527494.1,INSD:EH857514.1,
FT                   INSD:EL286639.1,INSD:EL002666.1,INSD:EH842566.1,
FT                   INSD:CB253832.1,INSD:EH961774.1,INSD:BP865687.1,
FT                   INSD:EL285993.1,INSD:EL165213.1,INSD:EL255274.1,
FT                   INSD:EH994088.1,INSD:EL077749.1,INSD:EH933764.1,
FT                   INSD:EL325535.1,INSD:EL175626.1,INSD:CB253828.1,
FT                   INSD:EH935565.1,INSD:R30513.1,INSD:EL284515.1,
FT                   INSD:ES176576.1,INSD:EL292977.1,INSD:AV562508.1,
FT                   INSD:EL128578.1,INSD:EL303645.1,INSD:BP786914.1,
FT                   INSD:EL193107.1,INSD:EL301533.1,INSD:EH852291.1,
FT                   INSD:EL044594.1,INSD:AV800534.1,INSD:BP807492.1,
FT                   INSD:EL186101.1,INSD:EL239937.1,INSD:EL166341.1,
FT                   INSD:EL276522.1,INSD:EH967615.1,INSD:EH936150.1,
FT                   INSD:EH845119.1,INSD:EL122107.1,INSD:EL293703.1,
FT                   INSD:EL302661.1,INSD:EH896018.1,INSD:EL307031.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY064064.1,INSD:AK227113.1,INSD:AY133754.1"
FT                   /protein_id="AEE81858.1"
FT                   /translation="MPSRRRHSYTVGSPATTSSNYSNTTFTDRSFPTTPARTSTDTTTS
FT                   IARRISGIFINCFTPPDSVSSNYIDNSKSSSDNNIRSRRSSTGSSSVQRSYGNANETEH
FT                   TRFTFDEIYDATKNFSPSFRIGQGGFGTVYKVKLRDGKTFAVKRAKKSMHDDRQGADAE
FT                   FMSEIQTLAQVTHLSLVKYYGFVVHNDEKILVVEYVANGTLRDHLDCKEGKTLDMATRL
FT                   DIATDVAHAITYLHMYTQPPIIHRDIKSSNILLTENYRAKVADFGFARLAPDTDSGATH
FT                   VSTQVKGTAGYLDPEYLTTYQLTEKSDVYSFGVLLVELLTGRRPIELSRGQKERITIRW
FT                   AIKKFTSGDTISVLDPKLEQNSANNLALEKVLEMAFQCLAPHRRSRPSMKKCSEILWGI
FT                   RKDYRELLNTSL"
FT   gene            145887..148424
FT                   /gene="RHB1A"
FT                   /gene_synonym="RING-H2 finger B1A"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHB1A"
FT                   /locus_tag="AT4G00335"
FT   mRNA            join(145887..146055,146773..146928,147195..147564,
FT                   147654..147763,147933..148424)
FT                   /gene="RHB1A"
FT                   /gene_synonym="RING-H2 finger B1A"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHB1A"
FT                   /locus_tag="AT4G00335"
FT                   /product="RING-H2 finger B1A"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES098332.1,INSD:BP611436.1,INSD:BP585023.1,
FT                   INSD:DR375707.1,INSD:BP614456.1,INSD:EL234847.1,
FT                   INSD:EL213252.1,INSD:EL261863.1,INSD:BP587093.1,
FT                   INSD:EH994294.1,INSD:ES024002.1,INSD:EL198120.1,
FT                   INSD:EH947689.1,INSD:EL975744.1,INSD:ES161429.1,
FT                   INSD:EL244936.1,INSD:EH807367.1,INSD:EH932738.1,
FT                   INSD:EL338448.1,INSD:BP595050.1,INSD:EL197020.1,
FT                   INSD:CB263226.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT024583.1"
FT   mRNA            join(145887..146055,146791..146928,147195..147564,
FT                   147654..147763,147933..148424)
FT                   /gene="RHB1A"
FT                   /gene_synonym="RING-H2 finger B1A"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHB1A"
FT                   /locus_tag="AT4G00335"
FT                   /product="RING-H2 finger B1A"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP861237.1,INSD:ES098332.1,INSD:BP585023.1,
FT                   INSD:DR375707.1,INSD:BP614456.1,INSD:EL213252.1,
FT                   INSD:EL234847.1,INSD:EL261863.1,INSD:BP587093.1,
FT                   INSD:AU239008.1,INSD:BP846677.1,INSD:ES024002.1,
FT                   INSD:EH947689.1,INSD:EL244936.1,INSD:ES161429.1,
FT                   INSD:EH932738.1,INSD:EL338448.1,INSD:BP818865.1,
FT                   INSD:BP595050.1,INSD:EL197020.1,INSD:DR206257.1,
FT                   INSD:BP611436.1,INSD:T21499.1,INSD:EH994294.1,
FT                   INSD:EL198120.1,INSD:DR206258.1,INSD:EL975744.1,
FT                   INSD:BP869000.1,INSD:EH807367.1,INSD:BP860931.1,
FT                   INSD:AI992992.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT024583.1,INSD:AF079179.1,INSD:AY087523.1,
FT                   INSD:AK118155.2,INSD:AK228408.1"
FT   mRNA            join(145928..146055,146797..146928,147195..147564,
FT                   147654..147763,147933..148339)
FT                   /gene="RHB1A"
FT                   /gene_synonym="RING-H2 finger B1A"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHB1A"
FT                   /locus_tag="AT4G00335"
FT                   /product="RING-H2 finger B1A"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP861237.1,INSD:ES098332.1,INSD:EL213252.1,
FT                   INSD:EL234847.1,INSD:EL261863.1,INSD:AU239008.1,
FT                   INSD:ES024002.1,INSD:BP846677.1,INSD:EH947689.1,
FT                   INSD:ES161429.1,INSD:EL244936.1,INSD:EH932738.1,
FT                   INSD:EL338448.1,INSD:BP818865.1,INSD:EL197020.1,
FT                   INSD:DR206257.1,INSD:T21499.1,INSD:EH994294.1,
FT                   INSD:DR206258.1,INSD:EL975744.1,INSD:AA586296.1,
FT                   INSD:BP869000.1,INSD:EH807367.1,INSD:BP860931.1,
FT                   INSD:AI992992.1"
FT   CDS_pept        join(146866..146928,147195..147564,147654..147763,
FT                   147933..147962)
FT                   /codon_start=1
FT                   /gene="RHB1A"
FT                   /gene_synonym="RING-H2 finger B1A"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHB1A"
FT                   /locus_tag="AT4G00335"
FT                   /product="RING-H2 finger B1A"
FT                   /note="RING-H2 finger B1A (RHB1A); FUNCTIONS IN: zinc ion
FT                   binding; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc
FT                   finger, RING-type (InterPro:IPR001841), Zinc finger, C3HC4
FT                   RING-type (InterPro:IPR018957); BEST Arabidopsis thaliana
FT                   protein match is: RING/U-box superfamily protein
FT                   (TAIR:AT5G41350.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00335.3"
FT                   /db_xref="GOA:Q2HIJ8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2HIJ8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP861237.1,INSD:ES098332.1,INSD:EL213252.1,
FT                   INSD:EL234847.1,INSD:EL261863.1,INSD:AU239008.1,
FT                   INSD:ES024002.1,INSD:BP846677.1,INSD:EH947689.1,
FT                   INSD:ES161429.1,INSD:EL244936.1,INSD:EH932738.1,
FT                   INSD:EL338448.1,INSD:BP818865.1,INSD:EL197020.1,
FT                   INSD:DR206257.1,INSD:T21499.1,INSD:EH994294.1,
FT                   INSD:DR206258.1,INSD:EL975744.1,INSD:AA586296.1,
FT                   INSD:BP869000.1,INSD:EH807367.1,INSD:BP860931.1,
FT                   INSD:AI992992.1"
FT                   /protein_id="AEE81861.2"
FT                   /translation="MGGCCSSSRKSHLVGTPVYYYCPESFEELVPSGTRAGVGSAFTTG
FT                   LLVDIGLETSIPDTFCAPAPLPYDLLLGRPQCTDSESIKGRMSGSSFETLATCEDLGES
FT                   DCKTLASSVILSPRKSDFSKHQGLKILVDEEEDCCPICFEDYDVENPRLTTKCEHEFHL
FT                   SCLLEWIERSDRCPICDKEVVFDDRLN"
FT   CDS_pept        join(146866..146928,147195..147564,147654..147763,
FT                   147933..147962)
FT                   /codon_start=1
FT                   /gene="RHB1A"
FT                   /gene_synonym="RING-H2 finger B1A"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHB1A"
FT                   /locus_tag="AT4G00335"
FT                   /product="RING-H2 finger B1A"
FT                   /note="RING-H2 finger B1A (RHB1A); FUNCTIONS IN: zinc ion
FT                   binding; INVOLVED IN: N-terminal protein myristoylation;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Zinc finger,
FT                   RING-type (InterPro:IPR001841), Zinc finger, C3HC4
FT                   RING-type (InterPro:IPR018957); BEST Arabidopsis thaliana
FT                   protein match is: RING/U-box superfamily protein
FT                   (TAIR:AT5G41350.1); Has 5425 Blast hits to 5419 proteins in
FT                   245 species: Archae - 0; Bacteria - 0; Metazoa - 1535;
FT                   Fungi - 417; Plants - 2568; Viruses - 6; Other Eukaryotes -
FT                   899 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q2HIJ8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2HIJ8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP861237.1,INSD:ES098332.1,INSD:BP585023.1,
FT                   INSD:DR375707.1,INSD:BP614456.1,INSD:EL213252.1,
FT                   INSD:EL234847.1,INSD:EL261863.1,INSD:BP587093.1,
FT                   INSD:AU239008.1,INSD:BP846677.1,INSD:ES024002.1,
FT                   INSD:EH947689.1,INSD:EL244936.1,INSD:ES161429.1,
FT                   INSD:EH932738.1,INSD:EL338448.1,INSD:BP818865.1,
FT                   INSD:BP595050.1,INSD:EL197020.1,INSD:DR206257.1,
FT                   INSD:BP611436.1,INSD:T21499.1,INSD:EH994294.1,
FT                   INSD:EL198120.1,INSD:DR206258.1,INSD:EL975744.1,
FT                   INSD:BP869000.1,INSD:EH807367.1,INSD:BP860931.1,
FT                   INSD:AI992992.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT024583.1,INSD:AF079179.1,INSD:AY087523.1,
FT                   INSD:AK118155.2,INSD:AK228408.1"
FT                   /protein_id="AEE81859.1"
FT                   /translation="MGGCCSSSRKSHLVGTPVYYYCPESFEELVPSGTRAGVGSAFTTG
FT                   LLVDIGLETSIPDTFCAPAPLPYDLLLGRPQCTDSESIKGRMSGSSFETLATCEDLGES
FT                   DCKTLASSVILSPRKSDFSKHQGLKILVDEEEDCCPICFEDYDVENPRLTTKCEHEFHL
FT                   SCLLEWIERSDRCPICDKEVVFDDRLN"
FT   CDS_pept        join(146866..146928,147195..147564,147654..147763,
FT                   147933..147962)
FT                   /codon_start=1
FT                   /gene="RHB1A"
FT                   /gene_synonym="RING-H2 finger B1A"
FT                   /gene_synonym="RING-H2 FINGER PROTEIN RHB1A"
FT                   /locus_tag="AT4G00335"
FT                   /product="RING-H2 finger B1A"
FT                   /note="RING-H2 finger B1A (RHB1A); FUNCTIONS IN: zinc ion
FT                   binding; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Zinc
FT                   finger, RING-type (InterPro:IPR001841), Zinc finger, C3HC4
FT                   RING-type (InterPro:IPR018957); BEST Arabidopsis thaliana
FT                   protein match is: RING/U-box superfamily protein
FT                   (TAIR:AT5G41350.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00335"
FT                   /db_xref="GOA:Q2HIJ8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2HIJ8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES098332.1,INSD:BP611436.1,INSD:BP585023.1,
FT                   INSD:DR375707.1,INSD:BP614456.1,INSD:EL234847.1,
FT                   INSD:EL213252.1,INSD:EL261863.1,INSD:BP587093.1,
FT                   INSD:EH994294.1,INSD:ES024002.1,INSD:EL198120.1,
FT                   INSD:EH947689.1,INSD:EL975744.1,INSD:ES161429.1,
FT                   INSD:EL244936.1,INSD:EH807367.1,INSD:EH932738.1,
FT                   INSD:EL338448.1,INSD:BP595050.1,INSD:EL197020.1,
FT                   INSD:CB263226.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT024583.1"
FT                   /protein_id="AEE81860.1"
FT                   /translation="MGGCCSSSRKSHLVGTPVYYYCPESFEELVPSGTRAGVGSAFTTG
FT                   LLVDIGLETSIPDTFCAPAPLPYDLLLGRPQCTDSESIKGRMSGSSFETLATCEDLGES
FT                   DCKTLASSVILSPRKSDFSKHQGLKILVDEEEDCCPICFEDYDVENPRLTTKCEHEFHL
FT                   SCLLEWIERSDRCPICDKEVVFDDRLN"
FT   gene            148612..151739
FT                   /gene="RLK4"
FT                   /gene_synonym="A_IG005I10.19"
FT                   /gene_synonym="A_IG005I10_19"
FT                   /gene_synonym="receptor-like protein kinase 4"
FT                   /locus_tag="AT4G00340"
FT                   /note="Encodes a receptor-like protein kinase that is
FT                   expressed in roots."
FT   mRNA            join(148612..151053,151136..151739)
FT                   /gene="RLK4"
FT                   /gene_synonym="A_IG005I10.19"
FT                   /gene_synonym="A_IG005I10_19"
FT                   /gene_synonym="receptor-like protein kinase 4"
FT                   /locus_tag="AT4G00340"
FT                   /product="receptor-like protein kinase 4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP816800.1,INSD:AI999273.1,INSD:EL999818.1,
FT                   INSD:EL022072.1,INSD:BP839023.1,INSD:EL026748.1,
FT                   INSD:EL319362.1,INSD:EL987548.1,INSD:ES044039.1,
FT                   INSD:EL236112.1,INSD:ES022586.1,INSD:EL320786.1,
FT                   INSD:EG525271.1,INSD:EL054016.1,INSD:EH986005.1,
FT                   INSD:ES006246.1,INSD:EH818744.1,INSD:ES013578.1,
FT                   INSD:AU230473.1,INSD:ES017318.1,INSD:AU239195.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK118333.1"
FT   mRNA            join(148958..150127,150191..151053,151136..151496)
FT                   /gene="RLK4"
FT                   /gene_synonym="A_IG005I10.19"
FT                   /gene_synonym="A_IG005I10_19"
FT                   /gene_synonym="receptor-like protein kinase 4"
FT                   /locus_tag="AT4G00340"
FT                   /product="receptor-like protein kinase 4"
FT   CDS_pept        join(148958..151053,151136..151496)
FT                   /codon_start=1
FT                   /gene="RLK4"
FT                   /gene_synonym="A_IG005I10.19"
FT                   /gene_synonym="A_IG005I10_19"
FT                   /gene_synonym="receptor-like protein kinase 4"
FT                   /locus_tag="AT4G00340"
FT                   /product="receptor-like protein kinase 4"
FT                   /note="receptor-like protein kinase 4 (RLK4); FUNCTIONS IN:
FT                   sugar binding, protein kinase activity; INVOLVED IN:
FT                   protein amino acid phosphorylation; LOCATED IN: plasma
FT                   membrane, membrane; EXPRESSED IN: 7 plant structures;
FT                   EXPRESSED DURING: 4 anthesis, C globular stage, petal
FT                   differentiation and expansion stage, E expanded cotyledon
FT                   stage; CONTAINS InterPro DOMAIN/s: Curculin-like
FT                   (mannose-binding) lectin (InterPro:IPR001480), Protein
FT                   kinase, ATP binding site (InterPro:IPR017441),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Serine/threonine-protein
FT                   kinase, active site (InterPro:IPR008271), Protein
FT                   kinase-like domain (InterPro:IPR011009), Protein kinase,
FT                   catalytic domain (InterPro:IPR000719), S-locus glycoprotein
FT                   (InterPro:IPR000858), Tyrosine-protein kinase, catalytic
FT                   domain (InterPro:IPR020635); BEST Arabidopsis thaliana
FT                   protein match is: S-locus lectin protein kinase family
FT                   protein (TAIR:AT2G19130.1); Has 118915 Blast hits to 117390
FT                   proteins in 4385 species: Archae - 97; Bacteria - 13085;
FT                   Metazoa - 43904; Fungi - 9417; Plants - 35014; Viruses -
FT                   433; Other Eukaryotes - 16965 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q39203"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000858"
FT                   /db_xref="InterPro:IPR001480"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR024171"
FT                   /db_xref="InterPro:IPR036426"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39203"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP816800.1,INSD:AI999273.1,INSD:EL999818.1,
FT                   INSD:EL022072.1,INSD:BP839023.1,INSD:EL026748.1,
FT                   INSD:EL319362.1,INSD:EL987548.1,INSD:ES044039.1,
FT                   INSD:EL236112.1,INSD:ES022586.1,INSD:EL320786.1,
FT                   INSD:EG525271.1,INSD:EL054016.1,INSD:EH986005.1,
FT                   INSD:ES006246.1,INSD:EH818744.1,INSD:ES013578.1,
FT                   INSD:AU230473.1,INSD:ES017318.1,INSD:AU239195.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK118333.1"
FT                   /protein_id="AEE81862.1"
FT                   /translation="MPCTTYLPLLLLLFLLPPPSVQSKVIIKGNQTILSFKAIFRLGFF
FT                   STTNGSSNWYLGISYASMPTPTHVWVANRIRPVSDPDSSTLELTSTGYLIVSNLRDGVV
FT                   WQTDNKQPGTDFRFSETGNLILINDDGSPVWQSFDNPTDTWLPGMNVTGLTAMTSWRSL
FT                   FDPSPGFYSLRLSPSFNEFQLVYKGTTPYWSTGNWTGEAFVGVPEMTIPYIYRFHFVNP
FT                   YTPTASFWYIVPPLDSVSEPRLTRFMVGANGQLKQYTWDPQTQSWNMFWLQPEDPCRVY
FT                   NLCGQLGFCSSELLKPCACIRGFRPRNDAAWRSDDYSDGCRRENGDSGEKSDTFEAVGD
FT                   LRYDGDVKMSRLQVSKSSCAKTCLGNSSCVGFYHKEKSNLCKILLESPNNLKNSSSWTG
FT                   VSEDVLYIREPKKGNSKGNISKSIIILCSVVGSISVLGFTLLVPLILLKRSRKRKKTRK
FT                   QDEDGFAVLNLKVFSFKELQSATNGFSDKVGHGGFGAVFKGTLPGSSTFVAVKRLERPG
FT                   SGESEFRAEVCTIGNIQHVNLVRLRGFCSENLHRLLVYDYMPQGSLSSYLSRTSPKLLS
FT                   WETRFRIALGTAKGIAYLHEGCRDCIIHCDIKPENILLDSDYNAKVSDFGLAKLLGRDF
FT                   SRVLATMRGTWGYVAPEWISGLPITTKADVYSFGMTLLELIGGRRNVIVNSDTLGEKET
FT                   EPEKWFFPPWAAREIIQGNVDSVVDSRLNGEYNTEEVTRMATVAIWCIQDNEEIRPAMG
FT                   TVVKMLEGVVEVTVPPPPKLIQALVSGDSYRGVSGTSCSEGHGCSDLNTGLSSPGSRSS
FT                   FGRPSP"
FT   CDS_pept        join(148958..150127,150191..151053,151136..151496)
FT                   /codon_start=1
FT                   /gene="RLK4"
FT                   /gene_synonym="A_IG005I10.19"
FT                   /gene_synonym="A_IG005I10_19"
FT                   /gene_synonym="receptor-like protein kinase 4"
FT                   /locus_tag="AT4G00340"
FT                   /product="receptor-like protein kinase 4"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00340"
FT                   /db_xref="GOA:A0A1P8B912"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000858"
FT                   /db_xref="InterPro:IPR001480"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR024171"
FT                   /db_xref="InterPro:IPR036426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B912"
FT                   /protein_id="ANM68059.1"
FT                   /translation="MPCTTYLPLLLLLFLLPPPSVQSKVIIKGNQTILSFKAIFRLGFF
FT                   STTNGSSNWYLGISYASMPTPTHVWVANRIRPVSDPDSSTLELTSTGYLIVSNLRDGVV
FT                   WQTDNKQPGTDFRFSETGNLILINDDGSPVWQSFDNPTDTWLPGMNVTGLTAMTSWRSL
FT                   FDPSPGFYSLRLSPSFNEFQLVYKGTTPYWSTGNWTGEAFVGVPEMTIPYIYRFHFVNP
FT                   YTPTASFWYIVPPLDSVSEPRLTRFMVGANGQLKQYTWDPQTQSWNMFWLQPEDPCRVY
FT                   NLCGQLGFCSSELLKPCACIRGFRPRNDAAWRSDDYSDGCRRENGDSGEKSDTFEAVGD
FT                   LRYDGDVKMSRLQVSKSSCAKTCLGNSSCVGFYHKEKSNLCKILLESPNNKGNSKGNIS
FT                   KSIIILCSVVGSISVLGFTLLVPLILLKRSRKRKKTRKQDEDGFAVLNLKVFSFKELQS
FT                   ATNGFSDKVGHGGFGAVFKGTLPGSSTFVAVKRLERPGSGESEFRAEVCTIGNIQHVNL
FT                   VRLRGFCSENLHRLLVYDYMPQGSLSSYLSRTSPKLLSWETRFRIALGTAKGIAYLHEG
FT                   CRDCIIHCDIKPENILLDSDYNAKVSDFGLAKLLGRDFSRVLATMRGTWGYVAPEWISG
FT                   LPITTKADVYSFGMTLLELIGGRRNVIVNSDTLGEKETEPEKWFFPPWAAREIIQGNVD
FT                   SVVDSRLNGEYNTEEVTRMATVAIWCIQDNEEIRPAMGTVVKMLEGVVEVTVPPPPKLI
FT                   QALVSGDSYRGVSGTSCSEGHGCSDLNTGLSSPGSRSSFGRPSP"
FT   gene            complement(151733..151912)
FT                   /locus_tag="AT4G00342"
FT   mRNA            complement(151733..151912)
FT                   /locus_tag="AT4G00342"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(151733..151912)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00342"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; LOCATED IN: endomembrane system;
FT                   Has 30201 Blast hits to 17322 proteins in 780 species:
FT                   Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi -
FT                   3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00342"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00342.1"
FT                   /db_xref="UniProtKB/TrEMBL:B3H6F3"
FT                   /protein_id="AEE81863.1"
FT                   /translation="MRIESRQDKRFFFMFVLVICVSGLPKIKVSRGVEEERTWVYCDRS
FT                   YSLKYRHGFIDSIT"
FT   gene            151849..154178
FT                   /gene_synonym="A_IG005I10.20"
FT                   /gene_synonym="A_IG005I10_20"
FT                   /gene_synonym="F5I10.20"
FT                   /gene_synonym="F5I10_20"
FT                   /locus_tag="AT4G00350"
FT   mRNA            join(151849..152406,152491..153116,153194..153250,
FT                   153320..153677,153749..153835,153917..154178)
FT                   /gene_synonym="A_IG005I10.20"
FT                   /gene_synonym="A_IG005I10_20"
FT                   /gene_synonym="F5I10.20"
FT                   /gene_synonym="F5I10_20"
FT                   /locus_tag="AT4G00350"
FT                   /product="MATE efflux family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU227962.1,INSD:AU236954.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX826468.1,INSD:BX826625.1"
FT   CDS_pept        join(151978..152406,152491..153116,153194..153250,
FT                   153320..153677,153749..153835,153917..153988)
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.20"
FT                   /gene_synonym="A_IG005I10_20"
FT                   /gene_synonym="F5I10.20"
FT                   /gene_synonym="F5I10_20"
FT                   /locus_tag="AT4G00350"
FT                   /product="MATE efflux family protein"
FT                   /note="MATE efflux family protein; FUNCTIONS IN: antiporter
FT                   activity, drug transmembrane transporter activity,
FT                   transporter activity; INVOLVED IN: drug transmembrane
FT                   transport, transmembrane transport; LOCATED IN: membrane;
FT                   EXPRESSED IN: 9 plant structures; EXPRESSED DURING: L
FT                   mature pollen stage, M germinated pollen stage, 4 anthesis,
FT                   C globular stage, petal differentiation and expansion
FT                   stage; CONTAINS InterPro DOMAIN/s: Multi antimicrobial
FT                   extrusion protein MatE (InterPro:IPR002528); BEST
FT                   Arabidopsis thaliana protein match is: detoxifying efflux
FT                   carrier 35 (TAIR:AT4G25640.1); Has 10139 Blast hits to
FT                   10053 proteins in 1934 species: Archae - 181; Bacteria -
FT                   7281; Metazoa - 140; Fungi - 324; Plants - 1355; Viruses -
FT                   0; Other Eukaryotes - 858 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00350"
FT                   /db_xref="GOA:F4JH46"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4JH46"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU227962.1,INSD:AU236954.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX826468.1,INSD:BX826625.1"
FT                   /protein_id="AEE81864.1"
FT                   /translation="MEIPVREERRSSSSSAGPLQQTISLAADDAIDSGPSSPLVVKVSV
FT                   FETEHETTKLIHAPSTLLGETTGDADFPPIQSFRDAKLVCVVETSKLWEIAAPIAFNIL
FT                   CNYGVNSFTSIFVGHIGDLELSAVAIALSVVSNFSFGFLLGMASALETLCGQAFGAGQM
FT                   DMLGVYMQRSWLILLGTSVCLLPLYIYATPLLILLGQEPEIAEISGKFTTQIIPQMFAL
FT                   AINFPTQKFLQSQSKVGIMAWIGFFALTLHIFILYLFINVFKWGLNGAAAAFDVSAWGI
FT                   AIAQVVYVVGWCKDGWKGLSWLAFQDVWPFLKLSFASAVMLCLEIWYFMTIIVLTGHLE
FT                   DPVIAVGSLSICMNINGWEGMLFIGINAAISVRVSNELGSGHPRAAKYSVIVTVIESLV
FT                   IGVVCAIVILITRDDFAVIFTESEEMRKAVADLAYLLGITMILNSLQPVISGVAVGGGW
FT                   QAPVAYINLFCYYAFGLPLGFLLGYKTSLGVQGIWIGMICGTSLQTLILLYMIYITNWN
FT                   KEVEQASERMKQWGAGYEKLEKIAT"
FT   gene            154635..156376
FT                   /gene="ATI2"
FT                   /gene_synonym="ATG8-interacting protein 2"
FT                   /locus_tag="AT4G00355"
FT                   /note="Encodes an Atg8-interacting protein that is
FT                   partially associated with the ER during favorable growth
FT                   conditions and becomes mainly associated with a spherical
FT                   compartment that dynamically moves along the ER network."
FT   mRNA            join(154635..154895,155192..155902,155986..156376)
FT                   /gene="ATI2"
FT                   /gene_synonym="ATG8-interacting protein 2"
FT                   /locus_tag="AT4G00355"
FT                   /product="mesoderm induction early response protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL049980.1,INSD:T46065.1,INSD:AV784979.1,
FT                   INSD:DR199096.1,INSD:EH850631.1,INSD:EL985276.1,
FT                   INSD:AV810359.1,INSD:BP630392.1,INSD:EH868723.1,
FT                   INSD:BP855425.1,INSD:AV786318.1,INSD:EL021066.1,
FT                   INSD:AV558452.1,INSD:EG453665.1,INSD:AI995143.1,
FT                   INSD:BP563618.1,INSD:ES100291.1,INSD:EL040957.1,
FT                   INSD:EL054123.1,INSD:ES054426.1,INSD:AV788028.1,
FT                   INSD:EL335459.1,INSD:BP631809.1,INSD:EL058311.1,
FT                   INSD:EL992721.1,INSD:EL203006.1,INSD:EL009938.1,
FT                   INSD:BP671351.1,INSD:EH884149.1,INSD:ES104810.1,
FT                   INSD:DR376454.1,INSD:ES137419.1,INSD:BP636825.1,
FT                   INSD:EG459476.1,INSD:ES112991.1,INSD:ES140941.1,
FT                   INSD:H76978.1,INSD:EL053476.1,INSD:CB260209.1,
FT                   INSD:BP786588.1,INSD:DR287694.1,INSD:H76622.1,
FT                   INSD:ES009107.1,INSD:EL128266.1,INSD:ES024856.1,
FT                   INSD:EL098085.1,INSD:ES021614.1,INSD:ES004920.1,
FT                   INSD:AA597343.1,INSD:ES210611.1,INSD:EL339519.1,
FT                   INSD:EH855781.1,INSD:EL231545.1,INSD:Z34734.1,
FT                   INSD:EH982956.1,INSD:ES108425.1,INSD:BP589648.1,
FT                   INSD:DR287696.1,INSD:EL309425.1,INSD:EG459477.1,
FT                   INSD:EH938304.1,INSD:DR287693.1,INSD:AV561332.1,
FT                   INSD:ES059451.1,INSD:BP571044.1,INSD:ES055900.1,
FT                   INSD:BP588908.1,INSD:EG453667.1,INSD:BP637176.1,
FT                   INSD:ES200384.1,INSD:EH834584.1,INSD:EH918728.1,
FT                   INSD:ES090425.1,INSD:BP662191.1,INSD:DR379439.1,
FT                   INSD:Z34748.1,INSD:DR287695.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY089153.1,INSD:BT001202.1"
FT   mRNA            join(154635..154895,155203..155902,155986..156376)
FT                   /gene="ATI2"
FT                   /gene_synonym="ATG8-interacting protein 2"
FT                   /locus_tag="AT4G00355"
FT                   /product="mesoderm induction early response protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL049980.1,INSD:DR256643.1,INSD:AV784979.1,
FT                   INSD:EH850631.1,INSD:EL985276.1,INSD:BP851652.1,
FT                   INSD:EH868723.1,INSD:EL021066.1,INSD:AI995143.1,
FT                   INSD:ES100291.1,INSD:EL040957.1,INSD:AV813521.1,
FT                   INSD:DR256647.1,INSD:EL054123.1,INSD:ES054426.1,
FT                   INSD:AV788028.1,INSD:EL335459.1,INSD:BP814236.1,
FT                   INSD:EL058311.1,INSD:EL992721.1,INSD:BP803887.1,
FT                   INSD:EL203006.1,INSD:BP856697.1,INSD:BP864029.1,
FT                   INSD:EL009938.1,INSD:EH884149.1,INSD:ES104810.1,
FT                   INSD:DR256650.1,INSD:BE039179.1,INSD:ES137419.1,
FT                   INSD:DR256644.1,INSD:EG459476.1,INSD:ES112991.1,
FT                   INSD:ES140941.1,INSD:H76978.1,INSD:EL053476.1,
FT                   INSD:EL320270.1,INSD:DR256645.1,INSD:ES009107.1,
FT                   INSD:EL128266.1,INSD:ES024856.1,INSD:EL098085.1,
FT                   INSD:ES021614.1,INSD:DR256649.1,INSD:ES004920.1,
FT                   INSD:AA597343.1,INSD:ES210611.1,INSD:EL339519.1,
FT                   INSD:DR256642.1,INSD:EH855781.1,INSD:EL231545.1,
FT                   INSD:EH982956.1,INSD:ES108425.1,INSD:DR256646.1,
FT                   INSD:DR256651.1,INSD:EL309425.1,INSD:EG459477.1,
FT                   INSD:EH938304.1,INSD:BP654161.1,INSD:ES059451.1,
FT                   INSD:DR256648.1,INSD:ES055900.1,INSD:BP604710.1,
FT                   INSD:EH967537.1,INSD:ES200384.1,INSD:T76776.1,
FT                   INSD:EH834584.1,INSD:EH918728.1,INSD:ES090425.1,
FT                   INSD:BP857433.1,INSD:EL105774.1,INSD:AV823899.1"
FT   mRNA            join(154721..154895,155192..156376)
FT                   /gene="ATI2"
FT                   /gene_synonym="ATG8-interacting protein 2"
FT                   /locus_tag="AT4G00355"
FT                   /product="mesoderm induction early response protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV784979.1,INSD:EH850631.1,INSD:EL985276.1,
FT                   INSD:AV810359.1,INSD:BP630392.1,INSD:AV786318.1,
FT                   INSD:EL021066.1,INSD:AV558452.1,INSD:EG453665.1,
FT                   INSD:AI995143.1,INSD:BP563618.1,INSD:ES100291.1,
FT                   INSD:EL054123.1,INSD:ES054426.1,INSD:AV788028.1,
FT                   INSD:BP631809.1,INSD:EL058311.1,INSD:EL992721.1,
FT                   INSD:EL203006.1,INSD:EL009938.1,INSD:BP671351.1,
FT                   INSD:EH884149.1,INSD:ES104810.1,INSD:DR376454.1,
FT                   INSD:ES137419.1,INSD:BP636825.1,INSD:BP857891.1,
FT                   INSD:EG459476.1,INSD:ES112991.1,INSD:ES140941.1,
FT                   INSD:EL053476.1,INSD:H76978.1,INSD:CB260209.1,
FT                   INSD:BP786588.1,INSD:H76622.1,INSD:ES009107.1,
FT                   INSD:EL128266.1,INSD:ES024856.1,INSD:BP863870.1,
FT                   INSD:EL098085.1,INSD:ES021614.1,INSD:ES004920.1,
FT                   INSD:AA597343.1,INSD:ES210611.1,INSD:EL339519.1,
FT                   INSD:EH855781.1,INSD:EL231545.1,INSD:Z34734.1,
FT                   INSD:EH982956.1,INSD:ES108425.1,INSD:BP589648.1,
FT                   INSD:DR287696.1,INSD:EG459477.1,INSD:EH938304.1,
FT                   INSD:AV561332.1,INSD:ES059451.1,INSD:ES055900.1,
FT                   INSD:BP571044.1,INSD:BP588908.1,INSD:EG453667.1,
FT                   INSD:BP637176.1,INSD:ES200384.1,INSD:ES090425.1,
FT                   INSD:EH918728.1,INSD:BP662191.1,INSD:DR379439.1,
FT                   INSD:Z34748.1,INSD:DR287695.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT001202.1"
FT   mRNA            join(154872..155902,155986..156376)
FT                   /gene="ATI2"
FT                   /gene_synonym="ATG8-interacting protein 2"
FT                   /locus_tag="AT4G00355"
FT                   /product="mesoderm induction early response protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL049980.1,INSD:DR256643.1,INSD:AV784979.1,
FT                   INSD:AV810359.1,INSD:EH850631.1,INSD:EL985276.1,
FT                   INSD:BP851652.1,INSD:BP630392.1,INSD:EH868723.1,
FT                   INSD:AV786318.1,INSD:EL021066.1,INSD:AV558452.1,
FT                   INSD:EG453665.1,INSD:AI995143.1,INSD:BP563618.1,
FT                   INSD:ES100291.1,INSD:EL040957.1,INSD:DR256647.1,
FT                   INSD:EL054123.1,INSD:ES054426.1,INSD:AV788028.1,
FT                   INSD:EL335459.1,INSD:BP631809.1,INSD:BP814236.1,
FT                   INSD:EL058311.1,INSD:EL992721.1,INSD:BP803887.1,
FT                   INSD:EL203006.1,INSD:BP856697.1,INSD:BP864029.1,
FT                   INSD:EL009938.1,INSD:BP671351.1,INSD:EH884149.1,
FT                   INSD:ES104810.1,INSD:DR256650.1,INSD:DR376454.1,
FT                   INSD:BE039179.1,INSD:ES137419.1,INSD:DR256644.1,
FT                   INSD:BP636825.1,INSD:EG459476.1,INSD:ES112991.1,
FT                   INSD:ES140941.1,INSD:H76978.1,INSD:EL053476.1,
FT                   INSD:CB260209.1,INSD:BP786588.1,INSD:DR256645.1,
FT                   INSD:H76622.1,INSD:ES009107.1,INSD:EL128266.1,
FT                   INSD:ES024856.1,INSD:EL098085.1,INSD:ES021614.1,
FT                   INSD:DR256649.1,INSD:ES004920.1,INSD:AA597343.1,
FT                   INSD:ES210611.1,INSD:EL339519.1,INSD:DR256642.1,
FT                   INSD:EH855781.1,INSD:EL231545.1,INSD:Z34734.1,
FT                   INSD:EH982956.1,INSD:ES108425.1,INSD:BP589648.1,
FT                   INSD:DR256646.1,INSD:DR287696.1,INSD:DR256651.1,
FT                   INSD:EL309425.1,INSD:EG459477.1,INSD:EH938304.1,
FT                   INSD:AV561332.1,INSD:ES059451.1,INSD:DR256648.1,
FT                   INSD:BP571044.1,INSD:ES055900.1,INSD:BP588908.1,
FT                   INSD:EH967537.1,INSD:EG453667.1,INSD:BP637176.1,
FT                   INSD:ES200384.1,INSD:T76776.1,INSD:EH834584.1,
FT                   INSD:EH918728.1,INSD:ES090425.1,INSD:BP857433.1,
FT                   INSD:EL105774.1,INSD:BP662191.1,INSD:DR379439.1,
FT                   INSD:AV823899.1,INSD:Z34748.1,INSD:DR287695.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY072334.1,INSD:BT001202.1,INSD:BX827128.1"
FT   CDS_pept        join(155207..155902,155986..156090)
FT                   /codon_start=1
FT                   /gene="ATI2"
FT                   /gene_synonym="ATG8-interacting protein 2"
FT                   /locus_tag="AT4G00355"
FT                   /product="mesoderm induction early response protein"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT2G45980.1); Has 100 Blast
FT                   hits to 97 proteins in 16 species: Archae - 0; Bacteria -
FT                   0; Metazoa - 0; Fungi - 0; Plants - 100; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8VY98"
FT                   /db_xref="InterPro:IPR040304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VY98"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV784979.1,INSD:EH850631.1,INSD:EL985276.1,
FT                   INSD:AV810359.1,INSD:BP630392.1,INSD:AV786318.1,
FT                   INSD:EL021066.1,INSD:AV558452.1,INSD:EG453665.1,
FT                   INSD:AI995143.1,INSD:BP563618.1,INSD:ES100291.1,
FT                   INSD:EL054123.1,INSD:ES054426.1,INSD:AV788028.1,
FT                   INSD:BP631809.1,INSD:EL058311.1,INSD:EL992721.1,
FT                   INSD:EL203006.1,INSD:EL009938.1,INSD:BP671351.1,
FT                   INSD:EH884149.1,INSD:ES104810.1,INSD:DR376454.1,
FT                   INSD:ES137419.1,INSD:BP636825.1,INSD:BP857891.1,
FT                   INSD:EG459476.1,INSD:ES112991.1,INSD:ES140941.1,
FT                   INSD:EL053476.1,INSD:H76978.1,INSD:CB260209.1,
FT                   INSD:BP786588.1,INSD:H76622.1,INSD:ES009107.1,
FT                   INSD:EL128266.1,INSD:ES024856.1,INSD:BP863870.1,
FT                   INSD:EL098085.1,INSD:ES021614.1,INSD:ES004920.1,
FT                   INSD:AA597343.1,INSD:ES210611.1,INSD:EL339519.1,
FT                   INSD:EH855781.1,INSD:EL231545.1,INSD:Z34734.1,
FT                   INSD:EH982956.1,INSD:ES108425.1,INSD:BP589648.1,
FT                   INSD:DR287696.1,INSD:EG459477.1,INSD:EH938304.1,
FT                   INSD:AV561332.1,INSD:ES059451.1,INSD:ES055900.1,
FT                   INSD:BP571044.1,INSD:BP588908.1,INSD:EG453667.1,
FT                   INSD:BP637176.1,INSD:ES200384.1,INSD:ES090425.1,
FT                   INSD:EH918728.1,INSD:BP662191.1,INSD:DR379439.1,
FT                   INSD:Z34748.1,INSD:DR287695.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT001202.1"
FT                   /protein_id="AEE81865.1"
FT                   /translation="MADKDEAATRGNDWEVVSLTASAYAAAPGPKPVVDSKDDDHKEVT
FT                   PCYEAETSHPLYMSRHFVFPPTGQLENTSDLTEASLTGSHCKEGSDLSLKGLDLSDDFG
FT                   GLEFSEDKGKKEENIYTTAMSSLDDERAIGGSHVYEPVEEPTEPVSPSDVTLDLNPIKD
FT                   DEVANSPPSEEAWWKRSVASLIAQAKETNTVWSICIAAAVMGIVILGQHWQQERWQILQ
FT                   QKWESSIGNEKAGRLMGPISRLKQAFVGGQRRDSFIRASAQNDR"
FT   CDS_pept        join(155207..155902,155986..156090)
FT                   /codon_start=1
FT                   /gene="ATI2"
FT                   /gene_synonym="ATG8-interacting protein 2"
FT                   /locus_tag="AT4G00355"
FT                   /product="mesoderm induction early response protein"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT2G45980.1); Has 100 Blast
FT                   hits to 97 proteins in 16 species: Archae - 0; Bacteria -
FT                   0; Metazoa - 0; Fungi - 0; Plants - 100; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8VY98"
FT                   /db_xref="InterPro:IPR040304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VY98"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL049980.1,INSD:T46065.1,INSD:AV784979.1,
FT                   INSD:DR199096.1,INSD:EH850631.1,INSD:EL985276.1,
FT                   INSD:AV810359.1,INSD:BP630392.1,INSD:EH868723.1,
FT                   INSD:BP855425.1,INSD:AV786318.1,INSD:EL021066.1,
FT                   INSD:AV558452.1,INSD:EG453665.1,INSD:AI995143.1,
FT                   INSD:BP563618.1,INSD:ES100291.1,INSD:EL040957.1,
FT                   INSD:EL054123.1,INSD:ES054426.1,INSD:AV788028.1,
FT                   INSD:EL335459.1,INSD:BP631809.1,INSD:EL058311.1,
FT                   INSD:EL992721.1,INSD:EL203006.1,INSD:EL009938.1,
FT                   INSD:BP671351.1,INSD:EH884149.1,INSD:ES104810.1,
FT                   INSD:DR376454.1,INSD:ES137419.1,INSD:BP636825.1,
FT                   INSD:EG459476.1,INSD:ES112991.1,INSD:ES140941.1,
FT                   INSD:H76978.1,INSD:EL053476.1,INSD:CB260209.1,
FT                   INSD:BP786588.1,INSD:DR287694.1,INSD:H76622.1,
FT                   INSD:ES009107.1,INSD:EL128266.1,INSD:ES024856.1,
FT                   INSD:EL098085.1,INSD:ES021614.1,INSD:ES004920.1,
FT                   INSD:AA597343.1,INSD:ES210611.1,INSD:EL339519.1,
FT                   INSD:EH855781.1,INSD:EL231545.1,INSD:Z34734.1,
FT                   INSD:EH982956.1,INSD:ES108425.1,INSD:BP589648.1,
FT                   INSD:DR287696.1,INSD:EL309425.1,INSD:EG459477.1,
FT                   INSD:EH938304.1,INSD:DR287693.1,INSD:AV561332.1,
FT                   INSD:ES059451.1,INSD:BP571044.1,INSD:ES055900.1,
FT                   INSD:BP588908.1,INSD:EG453667.1,INSD:BP637176.1,
FT                   INSD:ES200384.1,INSD:EH834584.1,INSD:EH918728.1,
FT                   INSD:ES090425.1,INSD:BP662191.1,INSD:DR379439.1,
FT                   INSD:Z34748.1,INSD:DR287695.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY089153.1,INSD:BT001202.1"
FT                   /protein_id="AEE81866.1"
FT                   /translation="MADKDEAATRGNDWEVVSLTASAYAAAPGPKPVVDSKDDDHKEVT
FT                   PCYEAETSHPLYMSRHFVFPPTGQLENTSDLTEASLTGSHCKEGSDLSLKGLDLSDDFG
FT                   GLEFSEDKGKKEENIYTTAMSSLDDERAIGGSHVYEPVEEPTEPVSPSDVTLDLNPIKD
FT                   DEVANSPPSEEAWWKRSVASLIAQAKETNTVWSICIAAAVMGIVILGQHWQQERWQILQ
FT                   QKWESSIGNEKAGRLMGPISRLKQAFVGGQRRDSFIRASAQNDR"
FT   CDS_pept        join(155207..155902,155986..156090)
FT                   /codon_start=1
FT                   /gene="ATI2"
FT                   /gene_synonym="ATG8-interacting protein 2"
FT                   /locus_tag="AT4G00355"
FT                   /product="mesoderm induction early response protein"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT2G45980.1); Has 100 Blast
FT                   hits to 97 proteins in 16 species: Archae - 0; Bacteria -
FT                   0; Metazoa - 0; Fungi - 0; Plants - 100; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8VY98"
FT                   /db_xref="InterPro:IPR040304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VY98"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL049980.1,INSD:DR256643.1,INSD:AV784979.1,
FT                   INSD:AV810359.1,INSD:EH850631.1,INSD:EL985276.1,
FT                   INSD:BP851652.1,INSD:BP630392.1,INSD:EH868723.1,
FT                   INSD:AV786318.1,INSD:EL021066.1,INSD:AV558452.1,
FT                   INSD:EG453665.1,INSD:AI995143.1,INSD:BP563618.1,
FT                   INSD:ES100291.1,INSD:EL040957.1,INSD:DR256647.1,
FT                   INSD:EL054123.1,INSD:ES054426.1,INSD:AV788028.1,
FT                   INSD:EL335459.1,INSD:BP631809.1,INSD:BP814236.1,
FT                   INSD:EL058311.1,INSD:EL992721.1,INSD:BP803887.1,
FT                   INSD:EL203006.1,INSD:BP856697.1,INSD:BP864029.1,
FT                   INSD:EL009938.1,INSD:BP671351.1,INSD:EH884149.1,
FT                   INSD:ES104810.1,INSD:DR256650.1,INSD:DR376454.1,
FT                   INSD:BE039179.1,INSD:ES137419.1,INSD:DR256644.1,
FT                   INSD:BP636825.1,INSD:EG459476.1,INSD:ES112991.1,
FT                   INSD:ES140941.1,INSD:H76978.1,INSD:EL053476.1,
FT                   INSD:CB260209.1,INSD:BP786588.1,INSD:DR256645.1,
FT                   INSD:H76622.1,INSD:ES009107.1,INSD:EL128266.1,
FT                   INSD:ES024856.1,INSD:EL098085.1,INSD:ES021614.1,
FT                   INSD:DR256649.1,INSD:ES004920.1,INSD:AA597343.1,
FT                   INSD:ES210611.1,INSD:EL339519.1,INSD:DR256642.1,
FT                   INSD:EH855781.1,INSD:EL231545.1,INSD:Z34734.1,
FT                   INSD:EH982956.1,INSD:ES108425.1,INSD:BP589648.1,
FT                   INSD:DR256646.1,INSD:DR287696.1,INSD:DR256651.1,
FT                   INSD:EL309425.1,INSD:EG459477.1,INSD:EH938304.1,
FT                   INSD:AV561332.1,INSD:ES059451.1,INSD:DR256648.1,
FT                   INSD:BP571044.1,INSD:ES055900.1,INSD:BP588908.1,
FT                   INSD:EH967537.1,INSD:EG453667.1,INSD:BP637176.1,
FT                   INSD:ES200384.1,INSD:T76776.1,INSD:EH834584.1,
FT                   INSD:EH918728.1,INSD:ES090425.1,INSD:BP857433.1,
FT                   INSD:EL105774.1,INSD:BP662191.1,INSD:DR379439.1,
FT                   INSD:AV823899.1,INSD:Z34748.1,INSD:DR287695.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY072334.1,INSD:BT001202.1,INSD:BX827128.1"
FT                   /protein_id="AEE81867.1"
FT                   /translation="MADKDEAATRGNDWEVVSLTASAYAAAPGPKPVVDSKDDDHKEVT
FT                   PCYEAETSHPLYMSRHFVFPPTGQLENTSDLTEASLTGSHCKEGSDLSLKGLDLSDDFG
FT                   GLEFSEDKGKKEENIYTTAMSSLDDERAIGGSHVYEPVEEPTEPVSPSDVTLDLNPIKD
FT                   DEVANSPPSEEAWWKRSVASLIAQAKETNTVWSICIAAAVMGIVILGQHWQQERWQILQ
FT                   QKWESSIGNEKAGRLMGPISRLKQAFVGGQRRDSFIRASAQNDR"
FT   CDS_pept        155207..156001
FT                   /codon_start=1
FT                   /gene="ATI2"
FT                   /gene_synonym="ATG8-interacting protein 2"
FT                   /locus_tag="AT4G00355"
FT                   /product="mesoderm induction early response protein"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT2G45980.1); Has 35333
FT                   Blast hits to 34131 proteins in 2444 species: Archae - 798;
FT                   Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531;
FT                   Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00355"
FT                   /db_xref="GOA:Q8VY98"
FT                   /db_xref="InterPro:IPR040304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VY98"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL049980.1,INSD:DR256643.1,INSD:AV784979.1,
FT                   INSD:EH850631.1,INSD:EL985276.1,INSD:BP851652.1,
FT                   INSD:EH868723.1,INSD:EL021066.1,INSD:AI995143.1,
FT                   INSD:ES100291.1,INSD:EL040957.1,INSD:AV813521.1,
FT                   INSD:DR256647.1,INSD:EL054123.1,INSD:ES054426.1,
FT                   INSD:AV788028.1,INSD:EL335459.1,INSD:BP814236.1,
FT                   INSD:EL058311.1,INSD:EL992721.1,INSD:BP803887.1,
FT                   INSD:EL203006.1,INSD:BP856697.1,INSD:BP864029.1,
FT                   INSD:EL009938.1,INSD:EH884149.1,INSD:ES104810.1,
FT                   INSD:DR256650.1,INSD:BE039179.1,INSD:ES137419.1,
FT                   INSD:DR256644.1,INSD:EG459476.1,INSD:ES112991.1,
FT                   INSD:ES140941.1,INSD:H76978.1,INSD:EL053476.1,
FT                   INSD:EL320270.1,INSD:DR256645.1,INSD:ES009107.1,
FT                   INSD:EL128266.1,INSD:ES024856.1,INSD:EL098085.1,
FT                   INSD:ES021614.1,INSD:DR256649.1,INSD:ES004920.1,
FT                   INSD:AA597343.1,INSD:ES210611.1,INSD:EL339519.1,
FT                   INSD:DR256642.1,INSD:EH855781.1,INSD:EL231545.1,
FT                   INSD:EH982956.1,INSD:ES108425.1,INSD:DR256646.1,
FT                   INSD:DR256651.1,INSD:EL309425.1,INSD:EG459477.1,
FT                   INSD:EH938304.1,INSD:BP654161.1,INSD:ES059451.1,
FT                   INSD:DR256648.1,INSD:ES055900.1,INSD:BP604710.1,
FT                   INSD:EH967537.1,INSD:ES200384.1,INSD:T76776.1,
FT                   INSD:EH834584.1,INSD:EH918728.1,INSD:ES090425.1,
FT                   INSD:BP857433.1,INSD:EL105774.1,INSD:AV823899.1"
FT                   /protein_id="AEE81868.1"
FT                   /translation="MADKDEAATRGNDWEVVSLTASAYAAAPGPKPVVDSKDDDHKEVT
FT                   PCYEAETSHPLYMSRHFVFPPTGQLENTSDLTEASLTGSHCKEGSDLSLKGLDLSDDFG
FT                   GLEFSEDKGKKEENIYTTAMSSLDDERAIGGSHVYEPVEEPTEPVSPSDVTLDLNPIKD
FT                   DEVANSPPSEEAWWKRSVASLIAQAKETNTVWSICIAAAVMGIVILGQHWQQERWQILQ
FT                   QKWESSIGNEVFSLGSLFFEPPWYDVSLNYVTTLFGCRKLED"
FT   gene            complement(156574..156729)
FT                   /pseudo
FT                   /locus_tag="AT4G00356"
FT                   /note="Encodes a defensin-like (DEFL) family protein."
FT   misc_RNA        complement(156574..156729)
FT                   /pseudo
FT                   /locus_tag="AT4G00356"
FT                   /note="pseudogene of Defensin-like (DEFL) family protein;
FT                   AT4G00356.1"
FT   gene            160643..163023
FT                   /gene="CYP86A2"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="ABERRANT INDUCTION OF TYPE THREE 1"
FT                   /gene_synonym="ATT1"
FT                   /gene_synonym="A_IG005I10.21"
FT                   /gene_synonym="A_IG005I10_21"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F5I10.21"
FT                   /gene_synonym="F5I10_21"
FT                   /gene_synonym="family 86"
FT                   /gene_synonym="polypeptide 2"
FT                   /gene_synonym="polypeptide 2''"
FT                   /gene_synonym="subfamily A"
FT                   /locus_tag="AT4G00360"
FT                   /note="Encodes a member of the CYP86A subfamily of
FT                   cytochrome p450 genes. Expressed at moderate levels in
FT                   flowers, leaves, roots and stems."
FT   mRNA            join(160643..161372,161539..163023)
FT                   /gene="CYP86A2"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="ABERRANT INDUCTION OF TYPE THREE 1"
FT                   /gene_synonym="ATT1"
FT                   /gene_synonym="A_IG005I10.21"
FT                   /gene_synonym="A_IG005I10_21"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F5I10.21"
FT                   /gene_synonym="F5I10_21"
FT                   /gene_synonym="family 86"
FT                   /gene_synonym="polypeptide 2"
FT                   /gene_synonym="polypeptide 2''"
FT                   /gene_synonym="subfamily A"
FT                   /locus_tag="AT4G00360"
FT                   /product="cytochrome P450, family 86, subfamily A,
FT                   polypeptide 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL090422.1,INSD:EH975058.1,INSD:BP598777.1,
FT                   INSD:EH829392.1,INSD:AV566814.1,INSD:EH857818.1,
FT                   INSD:BP790425.1,INSD:AV524955.2,INSD:EL151335.1,
FT                   INSD:BP801084.1,INSD:EH834437.1,INSD:AV792149.1,
FT                   INSD:EL309784.1,INSD:EL061796.1,INSD:AV524971.2,
FT                   INSD:EL102027.1,INSD:BP598146.1,INSD:BP806072.1,
FT                   INSD:DR375550.1,INSD:AV439895.1,INSD:EL245054.1,
FT                   INSD:BP615262.1,INSD:T04172.1,INSD:EL087332.1,
FT                   INSD:EL070255.1,INSD:BX835972.1,INSD:EH801254.1,
FT                   INSD:AV798596.1,INSD:EH993017.1,INSD:EH926324.1,
FT                   INSD:EL259834.1,INSD:BP603519.1,INSD:BP622029.1,
FT                   INSD:EL243871.1,INSD:EH957675.1,INSD:BP606729.1,
FT                   INSD:BP816793.1,INSD:EL059723.1,INSD:BU636480.1,
FT                   INSD:EL263335.1,INSD:EL120346.1,INSD:EL214031.1,
FT                   INSD:EH850381.1,INSD:EL270449.1,INSD:EH827591.1,
FT                   INSD:EL137588.1,INSD:AV784115.1,INSD:BP612454.1,
FT                   INSD:BP850929.1,INSD:EH908636.1,INSD:EL027379.1,
FT                   INSD:BP813022.1,INSD:EL994411.1,INSD:BP782458.1,
FT                   INSD:EH894085.1,INSD:AV565676.1,INSD:EH839477.1,
FT                   INSD:EL222566.1,INSD:EL135748.1,INSD:BP784920.1,
FT                   INSD:AU230540.1,INSD:EH922881.1,INSD:EH988531.1,
FT                   INSD:EL105630.1,INSD:BP633885.1,INSD:EL138135.1,
FT                   INSD:EL102961.1,INSD:AV440485.1,INSD:BU635385.1,
FT                   INSD:EH823015.1,INSD:BP785297.1,INSD:BP809645.1,
FT                   INSD:EL295321.1,INSD:BP620865.1,INSD:AV789887.1,
FT                   INSD:EH834657.1,INSD:BP617125.1,INSD:EL229340.1,
FT                   INSD:BP836898.1,INSD:EL044186.1,INSD:EH801048.1,
FT                   INSD:BP607820.1,INSD:BE521722.1,INSD:EH964861.1,
FT                   INSD:T46373.1,INSD:BP615668.1,INSD:EH810248.1,
FT                   INSD:EL275085.1,INSD:EL102130.1,INSD:BP600360.1,
FT                   INSD:EH934446.1,INSD:EL218472.1,INSD:BP573683.1,
FT                   INSD:BP611249.1,INSD:BP622946.1,INSD:EL017973.1,
FT                   INSD:BP635521.1,INSD:DR234129.1,INSD:BP805551.1,
FT                   INSD:EL088509.1,INSD:H76762.1,INSD:EL334797.1,
FT                   INSD:EH933093.1,INSD:EL320031.1,INSD:BP813346.1,
FT                   INSD:BP617591.1,INSD:BP809205.1,INSD:BP672185.1,
FT                   INSD:BP793064.1,INSD:BP798122.1,INSD:EL011140.1,
FT                   INSD:EL251310.1,INSD:EH957798.1,INSD:N95869.1,
FT                   INSD:AV816914.1,INSD:EL099822.1,INSD:EL238807.1,
FT                   INSD:EL154281.1,INSD:BP614199.1,INSD:BP612185.1,
FT                   INSD:EL189679.1,INSD:EH921267.1,INSD:AV795405.1,
FT                   INSD:BP644164.1,INSD:Z25705.1,INSD:BP824609.1,
FT                   INSD:AI995872.1,INSD:BP598482.1,INSD:EL280073.1,
FT                   INSD:BP833635.1,INSD:EL996888.1,INSD:EH810648.1,
FT                   INSD:BP826842.1,INSD:EH968029.1,INSD:BP807147.1,
FT                   INSD:AV526000.1,INSD:EL097456.1,INSD:EL002370.1,
FT                   INSD:EL309493.1,INSD:BP615276.1,INSD:BP835822.1,
FT                   INSD:EL021679.1,INSD:BX840525.1,INSD:AV522348.1,
FT                   INSD:AV518625.1,INSD:CF774246.1,INSD:EH928292.1,
FT                   INSD:BP603405.1,INSD:BP633102.1,INSD:EL333424.1,
FT                   INSD:BE526773.1,INSD:EL112978.1,INSD:EL244529.1,
FT                   INSD:BE521721.1,INSD:BX835701.1,INSD:EH815524.1,
FT                   INSD:EL185411.1,INSD:EG449489.1,INSD:BP602277.1,
FT                   INSD:BP819149.1,INSD:BP602489.1,INSD:BP628190.1,
FT                   INSD:BP839669.1,INSD:BP646187.1,INSD:EL292384.1,
FT                   INSD:BP661328.1,INSD:AV816267.1,INSD:BP816237.1,
FT                   INSD:BP664477.1,INSD:AV823188.1,INSD:EL029107.1,
FT                   INSD:EH812341.1,INSD:EL031490.1,INSD:BP844192.2,
FT                   INSD:EH834365.1,INSD:CK118892.1,INSD:EH898010.1,
FT                   INSD:AV565669.1,INSD:EL145964.1,INSD:EL335649.1,
FT                   INSD:BP613013.1,INSD:BP609085.1,INSD:EL244957.1,
FT                   INSD:BP819185.1,INSD:EH960088.1,INSD:CF652772.1,
FT                   INSD:BP614883.1,INSD:BP567440.1,INSD:BP652155.1,
FT                   INSD:AV518238.1,INSD:BP647824.1,INSD:EL146359.1,
FT                   INSD:EL016288.1,INSD:AV564368.1,INSD:AV797979.1,
FT                   INSD:AV812417.1,INSD:BP777886.1,INSD:EL171049.1,
FT                   INSD:AV807486.1,INSD:BP613514.1,INSD:BP820238.1,
FT                   INSD:BP611428.1,INSD:DR235461.1,INSD:EL263251.1,
FT                   INSD:EH961892.1,INSD:BP599562.1,INSD:EL149471.1,
FT                   INSD:EL114257.1,INSD:AV802524.1,INSD:T46372.1,
FT                   INSD:BP616889.1,INSD:EL017731.1,INSD:EL166683.1,
FT                   INSD:BP821520.1,INSD:EH854065.1,INSD:AV811037.1,
FT                   INSD:BP828575.1,INSD:BP785516.1,INSD:AV441584.1,
FT                   INSD:AV810464.1,INSD:EL264253.1,INSD:EH818450.1,
FT                   INSD:EL068618.1,INSD:BP825015.1,INSD:AV793064.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827611.1,INSD:AY074851.1,INSD:AY133539.1,
FT                   INSD:AK220928.1"
FT   CDS_pept        join(160951..161372,161539..162778)
FT                   /codon_start=1
FT                   /gene="CYP86A2"
FT                   /gene_synonym="ABERRANT INDUCTION OF TYPE THREE 1"
FT                   /gene_synonym="ATT1"
FT                   /gene_synonym="A_IG005I10.21"
FT                   /gene_synonym="A_IG005I10_21"
FT                   /gene_synonym="cytochrome P450"
FT                   /gene_synonym="F5I10.21"
FT                   /gene_synonym="F5I10_21"
FT                   /gene_synonym="family 86"
FT                   /gene_synonym="polypeptide 2"
FT                   /gene_synonym="subfamily A"
FT                   /gene_synonym="''cytochrome P450"
FT                   /gene_synonym="polypeptide 2''"
FT                   /locus_tag="AT4G00360"
FT                   /product="cytochrome P450, family 86, subfamily A,
FT                   polypeptide 2"
FT                   /note="''cytochrome P450, family 86, subfamily A,
FT                   polypeptide 2'' (CYP86A2); CONTAINS InterPro DOMAIN/s:
FT                   Cytochrome P450 (InterPro:IPR001128), Cytochrome P450,
FT                   E-class, group I (InterPro:IPR002401), Cytochrome P450,
FT                   conserved site (InterPro:IPR017972); BEST Arabidopsis
FT                   thaliana protein match is: cytochrome P450, family 86,
FT                   subfamily A, polypeptide 4 (TAIR:AT1G01600.1); Has 1807
FT                   Blast hits to 1807 proteins in 277 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:O23066"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23066"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL090422.1,INSD:EH975058.1,INSD:BP598777.1,
FT                   INSD:EH829392.1,INSD:AV566814.1,INSD:EH857818.1,
FT                   INSD:BP790425.1,INSD:AV524955.2,INSD:EL151335.1,
FT                   INSD:BP801084.1,INSD:EH834437.1,INSD:AV792149.1,
FT                   INSD:EL309784.1,INSD:EL061796.1,INSD:AV524971.2,
FT                   INSD:EL102027.1,INSD:BP598146.1,INSD:BP806072.1,
FT                   INSD:DR375550.1,INSD:AV439895.1,INSD:EL245054.1,
FT                   INSD:BP615262.1,INSD:T04172.1,INSD:EL087332.1,
FT                   INSD:EL070255.1,INSD:BX835972.1,INSD:EH801254.1,
FT                   INSD:AV798596.1,INSD:EH993017.1,INSD:EH926324.1,
FT                   INSD:EL259834.1,INSD:BP603519.1,INSD:BP622029.1,
FT                   INSD:EL243871.1,INSD:EH957675.1,INSD:BP606729.1,
FT                   INSD:BP816793.1,INSD:EL059723.1,INSD:BU636480.1,
FT                   INSD:EL263335.1,INSD:EL120346.1,INSD:EL214031.1,
FT                   INSD:EH850381.1,INSD:EL270449.1,INSD:EH827591.1,
FT                   INSD:EL137588.1,INSD:AV784115.1,INSD:BP612454.1,
FT                   INSD:BP850929.1,INSD:EH908636.1,INSD:EL027379.1,
FT                   INSD:BP813022.1,INSD:EL994411.1,INSD:BP782458.1,
FT                   INSD:EH894085.1,INSD:AV565676.1,INSD:EH839477.1,
FT                   INSD:EL222566.1,INSD:EL135748.1,INSD:BP784920.1,
FT                   INSD:AU230540.1,INSD:EH922881.1,INSD:EH988531.1,
FT                   INSD:EL105630.1,INSD:BP633885.1,INSD:EL138135.1,
FT                   INSD:EL102961.1,INSD:AV440485.1,INSD:BU635385.1,
FT                   INSD:EH823015.1,INSD:BP785297.1,INSD:BP809645.1,
FT                   INSD:EL295321.1,INSD:BP620865.1,INSD:AV789887.1,
FT                   INSD:EH834657.1,INSD:BP617125.1,INSD:EL229340.1,
FT                   INSD:BP836898.1,INSD:EL044186.1,INSD:EH801048.1,
FT                   INSD:BP607820.1,INSD:BE521722.1,INSD:EH964861.1,
FT                   INSD:T46373.1,INSD:BP615668.1,INSD:EH810248.1,
FT                   INSD:EL275085.1,INSD:EL102130.1,INSD:BP600360.1,
FT                   INSD:EH934446.1,INSD:EL218472.1,INSD:BP573683.1,
FT                   INSD:BP611249.1,INSD:BP622946.1,INSD:EL017973.1,
FT                   INSD:BP635521.1,INSD:DR234129.1,INSD:BP805551.1,
FT                   INSD:EL088509.1,INSD:H76762.1,INSD:EL334797.1,
FT                   INSD:EH933093.1,INSD:EL320031.1,INSD:BP813346.1,
FT                   INSD:BP617591.1,INSD:BP809205.1,INSD:BP672185.1,
FT                   INSD:BP793064.1,INSD:BP798122.1,INSD:EL011140.1,
FT                   INSD:EL251310.1,INSD:EH957798.1,INSD:N95869.1,
FT                   INSD:AV816914.1,INSD:EL099822.1,INSD:EL238807.1,
FT                   INSD:EL154281.1,INSD:BP614199.1,INSD:BP612185.1,
FT                   INSD:EL189679.1,INSD:EH921267.1,INSD:AV795405.1,
FT                   INSD:BP644164.1,INSD:Z25705.1,INSD:BP824609.1,
FT                   INSD:AI995872.1,INSD:BP598482.1,INSD:EL280073.1,
FT                   INSD:BP833635.1,INSD:EL996888.1,INSD:EH810648.1,
FT                   INSD:BP826842.1,INSD:EH968029.1,INSD:BP807147.1,
FT                   INSD:AV526000.1,INSD:EL097456.1,INSD:EL002370.1,
FT                   INSD:EL309493.1,INSD:BP615276.1,INSD:BP835822.1,
FT                   INSD:EL021679.1,INSD:BX840525.1,INSD:AV522348.1,
FT                   INSD:AV518625.1,INSD:CF774246.1,INSD:EH928292.1,
FT                   INSD:BP603405.1,INSD:BP633102.1,INSD:EL333424.1,
FT                   INSD:BE526773.1,INSD:EL112978.1,INSD:EL244529.1,
FT                   INSD:BE521721.1,INSD:BX835701.1,INSD:EH815524.1,
FT                   INSD:EL185411.1,INSD:EG449489.1,INSD:BP602277.1,
FT                   INSD:BP819149.1,INSD:BP602489.1,INSD:BP628190.1,
FT                   INSD:BP839669.1,INSD:BP646187.1,INSD:EL292384.1,
FT                   INSD:BP661328.1,INSD:AV816267.1,INSD:BP816237.1,
FT                   INSD:BP664477.1,INSD:AV823188.1,INSD:EL029107.1,
FT                   INSD:EH812341.1,INSD:EL031490.1,INSD:BP844192.2,
FT                   INSD:EH834365.1,INSD:CK118892.1,INSD:EH898010.1,
FT                   INSD:AV565669.1,INSD:EL145964.1,INSD:EL335649.1,
FT                   INSD:BP613013.1,INSD:BP609085.1,INSD:EL244957.1,
FT                   INSD:BP819185.1,INSD:EH960088.1,INSD:CF652772.1,
FT                   INSD:BP614883.1,INSD:BP567440.1,INSD:BP652155.1,
FT                   INSD:AV518238.1,INSD:BP647824.1,INSD:EL146359.1,
FT                   INSD:EL016288.1,INSD:AV564368.1,INSD:AV797979.1,
FT                   INSD:AV812417.1,INSD:BP777886.1,INSD:EL171049.1,
FT                   INSD:AV807486.1,INSD:BP613514.1,INSD:BP820238.1,
FT                   INSD:BP611428.1,INSD:DR235461.1,INSD:EL263251.1,
FT                   INSD:EH961892.1,INSD:BP599562.1,INSD:EL149471.1,
FT                   INSD:EL114257.1,INSD:AV802524.1,INSD:T46372.1,
FT                   INSD:BP616889.1,INSD:EL017731.1,INSD:EL166683.1,
FT                   INSD:BP821520.1,INSD:EH854065.1,INSD:AV811037.1,
FT                   INSD:BP828575.1,INSD:BP785516.1,INSD:AV441584.1,
FT                   INSD:AV810464.1,INSD:EL264253.1,INSD:EH818450.1,
FT                   INSD:EL068618.1,INSD:BP825015.1,INSD:AV793064.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827611.1,INSD:AY074851.1,INSD:AY133539.1,
FT                   INSD:AK220928.1"
FT                   /protein_id="AEE81869.1"
FT                   /translation="MDVSNTMLLVAVVAAYWLWFQRISRWLKGPRVWPVLGSLPGLIEQ
FT                   RDRMHDWITENLRACGGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKG
FT                   PTWQAVFHDFLGQGIFNSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRGIKLRFCPIL
FT                   ETAQNNYEPVDLQDLILRLTFDNICGLAFGKDTRTCAPGLPENGFASAFDRATEASLQR
FT                   FILPEFLWRLKKWLGLGLEVSLSRSLGEIDGYLDAVINTRKQELLSQRESGVQRHDDLL
FT                   SRFMKKKDQSYSETFLRHVALNFILAGRDTSSVALSWFFWLITTHPTVEDKIVREICSV
FT                   LIETRGTDVSSWTAEPLEFDEVDRLVYLKAALSETLRLYPSVPEDSKHVVNDDILPDGT
FT                   FVPAGSSVTYSIYAAGRMKSTWGEDCLEFKPERWISPDDGKFVNHDQYRFVAFNAGPRI
FT                   CLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKMSLTLFMKNGLLVNVHKRDLEVMM
FT                   KSLVPKERNDVVVLNGKCNGGIGEGVAVNAAVAVAV"
FT   gene            complement(162041..162822)
FT                   /locus_tag="AT4G03585"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT4G00360"
FT   ncRNA           complement(162041..162822)
FT                   /locus_tag="AT4G03585"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(162897..166357)
FT                   /gene="ANTR2"
FT                   /gene_synonym="anion transporter 2"
FT                   /gene_synonym="A_IG005I10.NN"
FT                   /gene_synonym="A_IG005I10_NN"
FT                   /gene_synonym="F5I10.7"
FT                   /gene_synonym="F5I10_7"
FT                   /gene_synonym="PHT4;4"
FT                   /locus_tag="AT4G00370"
FT                   /note="Encodes an inorganic phosphate transporter
FT                   (PHT4;4)."
FT   mRNA            complement(join(162897..163250,163356..163440,
FT                   163523..163588,163838..163939,164127..164264,
FT                   164363..164572,164667..164882,164974..165129,
FT                   165233..165340,165423..165754,165835..165894,
FT                   166057..166357))
FT                   /gene="ANTR2"
FT                   /gene_synonym="anion transporter 2"
FT                   /gene_synonym="A_IG005I10.NN"
FT                   /gene_synonym="A_IG005I10_NN"
FT                   /gene_synonym="F5I10.7"
FT                   /gene_synonym="F5I10_7"
FT                   /gene_synonym="PHT4;4"
FT                   /locus_tag="AT4G00370"
FT                   /product="Major facilitator superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV795405.1,INSD:BP644164.1,INSD:AI995872.1,
FT                   INSD:BP598777.1,INSD:BP598482.1,INSD:EL276040.1,
FT                   INSD:BG459505.1,INSD:AV566814.1,INSD:BP858014.1,
FT                   INSD:BP790425.1,INSD:EH858662.1,INSD:EH813087.1,
FT                   INSD:EL996888.1,INSD:EL338256.1,INSD:AV792149.1,
FT                   INSD:EL232093.1,INSD:BP598146.1,INSD:DR375550.1,
FT                   INSD:AV439895.1,INSD:EL245054.1,INSD:BP615262.1,
FT                   INSD:EL278603.1,INSD:EL070255.1,INSD:BX835972.1,
FT                   INSD:AV798596.1,INSD:BP615276.1,INSD:EH926324.1,
FT                   INSD:BP603519.1,INSD:EL130123.1,INSD:BP622029.1,
FT                   INSD:EH957675.1,INSD:BP849939.1,INSD:BP606729.1,
FT                   INSD:AV525797.1,INSD:AV522348.1,INSD:AV518625.1,
FT                   INSD:EL999559.1,INSD:DR279062.1,INSD:BP603405.1,
FT                   INSD:BP633102.1,INSD:EH818619.1,INSD:AV784115.1,
FT                   INSD:BP612454.1,INSD:BX835701.1,INSD:ES029764.1,
FT                   INSD:EL987099.1,INSD:EH908636.1,INSD:EG449489.1,
FT                   INSD:EL027379.1,INSD:BP602277.1,INSD:BP602489.1,
FT                   INSD:BP628190.1,INSD:BP782458.1,INSD:BP646187.1,
FT                   INSD:ES211353.1,INSD:BP817479.1,INSD:AV565676.1,
FT                   INSD:EH941954.1,INSD:BP661328.1,INSD:AV816267.1,
FT                   INSD:BP784920.1,INSD:BP664477.1,INSD:AU230540.1,
FT                   INSD:EH903459.1,INSD:BP836734.1,INSD:EL310530.1,
FT                   INSD:BX839997.1,INSD:EL289956.1,INSD:EL017015.1,
FT                   INSD:BP633885.1,INSD:EL223177.1,INSD:BP785297.1,
FT                   INSD:AV565669.1,INSD:BP613013.1,INSD:EL974129.1,
FT                   INSD:EH798871.1,INSD:BX839512.1,INSD:BP620865.1,
FT                   INSD:AV789887.1,INSD:BP614883.1,INSD:BP617125.1,
FT                   INSD:BP567440.1,INSD:BP607820.1,INSD:AV518238.1,
FT                   INSD:BP647824.1,INSD:BE521722.1,INSD:EL016288.1,
FT                   INSD:AV564368.1,INSD:AV797979.1,INSD:BP777886.1,
FT                   INSD:AV812417.1,INSD:BP615668.1,INSD:EL973615.1,
FT                   INSD:BP600360.1,INSD:AV807486.1,INSD:BP573683.1,
FT                   INSD:BX835646.1,INSD:BP611249.1,INSD:BP622946.1,
FT                   INSD:BP635521.1,INSD:EL103061.1,INSD:ES023929.1,
FT                   INSD:EL096556.1,INSD:BP611428.1,INSD:EL981966.1,
FT                   INSD:BP599562.1,INSD:AV802524.1,INSD:BP617591.1,
FT                   INSD:BP672185.1,INSD:BP616889.1,INSD:DR279063.1,
FT                   INSD:EL190721.1,INSD:AU239252.1,INSD:ES037672.1,
FT                   INSD:BP821886.1,INSD:BP793064.1,INSD:BP670023.1,
FT                   INSD:BP619550.1,INSD:AV816914.1,INSD:ES163826.1,
FT                   INSD:AV811037.1,INSD:BP663740.1,INSD:BP785516.1,
FT                   INSD:EL271574.1,INSD:BX839622.1,INSD:BP614199.1,
FT                   INSD:AV810464.1,INSD:BP612185.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT009663.1,INSD:AK118390.1,INSD:BX826481.1,
FT                   INSD:BX827325.1"
FT   CDS_pept        complement(join(163153..163250,163356..163440,
FT                   163523..163588,163838..163939,164127..164264,
FT                   164363..164572,164667..164882,164974..165129,
FT                   165233..165340,165423..165754,165835..165894,
FT                   166057..166111))
FT                   /codon_start=1
FT                   /gene="ANTR2"
FT                   /gene_synonym="anion transporter 2"
FT                   /gene_synonym="A_IG005I10.NN"
FT                   /gene_synonym="A_IG005I10_NN"
FT                   /gene_synonym="F5I10.7"
FT                   /gene_synonym="F5I10_7"
FT                   /gene_synonym="PHT4;4"
FT                   /locus_tag="AT4G00370"
FT                   /product="Major facilitator superfamily protein"
FT                   /note="ANTR2; FUNCTIONS IN: organic anion transmembrane
FT                   transporter activity, inorganic phosphate transmembrane
FT                   transporter activity; INVOLVED IN: transmembrane transport;
FT                   LOCATED IN: chloroplast, plastid; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Major facilitator superfamily
FT                   (InterPro:IPR020846), Major facilitator superfamily MFS-1
FT                   (InterPro:IPR011701), Major facilitator superfamily,
FT                   general substrate transporter (InterPro:IPR016196); BEST
FT                   Arabidopsis thaliana protein match is: phosphate
FT                   transporter 4;1 (TAIR:AT2G29650.1); Has 37886 Blast hits to
FT                   37799 proteins in 2473 species: Archae - 506; Bacteria -
FT                   30466; Metazoa - 2514; Fungi - 1637; Plants - 427; Viruses
FT                   - 0; Other Eukaryotes - 2336 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8GX78"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GX78"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV795405.1,INSD:BP644164.1,INSD:AI995872.1,
FT                   INSD:BP598777.1,INSD:BP598482.1,INSD:EL276040.1,
FT                   INSD:BG459505.1,INSD:AV566814.1,INSD:BP858014.1,
FT                   INSD:BP790425.1,INSD:EH858662.1,INSD:EH813087.1,
FT                   INSD:EL996888.1,INSD:EL338256.1,INSD:AV792149.1,
FT                   INSD:EL232093.1,INSD:BP598146.1,INSD:DR375550.1,
FT                   INSD:AV439895.1,INSD:EL245054.1,INSD:BP615262.1,
FT                   INSD:EL278603.1,INSD:EL070255.1,INSD:BX835972.1,
FT                   INSD:AV798596.1,INSD:BP615276.1,INSD:EH926324.1,
FT                   INSD:BP603519.1,INSD:EL130123.1,INSD:BP622029.1,
FT                   INSD:EH957675.1,INSD:BP849939.1,INSD:BP606729.1,
FT                   INSD:AV525797.1,INSD:AV522348.1,INSD:AV518625.1,
FT                   INSD:EL999559.1,INSD:DR279062.1,INSD:BP603405.1,
FT                   INSD:BP633102.1,INSD:EH818619.1,INSD:AV784115.1,
FT                   INSD:BP612454.1,INSD:BX835701.1,INSD:ES029764.1,
FT                   INSD:EL987099.1,INSD:EH908636.1,INSD:EG449489.1,
FT                   INSD:EL027379.1,INSD:BP602277.1,INSD:BP602489.1,
FT                   INSD:BP628190.1,INSD:BP782458.1,INSD:BP646187.1,
FT                   INSD:ES211353.1,INSD:BP817479.1,INSD:AV565676.1,
FT                   INSD:EH941954.1,INSD:BP661328.1,INSD:AV816267.1,
FT                   INSD:BP784920.1,INSD:BP664477.1,INSD:AU230540.1,
FT                   INSD:EH903459.1,INSD:BP836734.1,INSD:EL310530.1,
FT                   INSD:BX839997.1,INSD:EL289956.1,INSD:EL017015.1,
FT                   INSD:BP633885.1,INSD:EL223177.1,INSD:BP785297.1,
FT                   INSD:AV565669.1,INSD:BP613013.1,INSD:EL974129.1,
FT                   INSD:EH798871.1,INSD:BX839512.1,INSD:BP620865.1,
FT                   INSD:AV789887.1,INSD:BP614883.1,INSD:BP617125.1,
FT                   INSD:BP567440.1,INSD:BP607820.1,INSD:AV518238.1,
FT                   INSD:BP647824.1,INSD:BE521722.1,INSD:EL016288.1,
FT                   INSD:AV564368.1,INSD:AV797979.1,INSD:BP777886.1,
FT                   INSD:AV812417.1,INSD:BP615668.1,INSD:EL973615.1,
FT                   INSD:BP600360.1,INSD:AV807486.1,INSD:BP573683.1,
FT                   INSD:BX835646.1,INSD:BP611249.1,INSD:BP622946.1,
FT                   INSD:BP635521.1,INSD:EL103061.1,INSD:ES023929.1,
FT                   INSD:EL096556.1,INSD:BP611428.1,INSD:EL981966.1,
FT                   INSD:BP599562.1,INSD:AV802524.1,INSD:BP617591.1,
FT                   INSD:BP672185.1,INSD:BP616889.1,INSD:DR279063.1,
FT                   INSD:EL190721.1,INSD:AU239252.1,INSD:ES037672.1,
FT                   INSD:BP821886.1,INSD:BP793064.1,INSD:BP670023.1,
FT                   INSD:BP619550.1,INSD:AV816914.1,INSD:ES163826.1,
FT                   INSD:AV811037.1,INSD:BP663740.1,INSD:BP785516.1,
FT                   INSD:EL271574.1,INSD:BX839622.1,INSD:BP614199.1,
FT                   INSD:AV810464.1,INSD:BP612185.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT009663.1,INSD:AK118390.1,INSD:BX826481.1,
FT                   INSD:BX827325.1"
FT                   /protein_id="AEE81870.1"
FT                   /translation="MALGGLISNRNFGSFIGSGNGCQRLGKSGAEVSKLFPNALLCRNH
FT                   QPLQASLHHESGHMRRSFGCFLQPRMDSVIRFRNSIKINRSRAYYKSEESDITEGVVPS
FT                   ADGSAEAILVEGNLQNASPWWQQFPRRWVIVLLCFSSFLLCNMDRVNMSIAILPMSQEY
FT                   NWSSATVGLIQSSFFWGYLLTQILGGIWADKFGGKVVLGFGVVWWSFATIMTPIAARLG
FT                   LPFLLVVRAFMGIGEGVAMPAMNNMLSKWIPVSERSRSLALVYSGMYLGSVTGLAFSPM
FT                   LITKFGWPSVFYSFGSLGSIWFLLWLKFAYSSPKDDPDLSEEEKKVILGGSKPREPVTV
FT                   IPWKLILSKPPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCVLPWLTM
FT                   AVFANIGGWIADTLVSRGLSITNVRKIMQSIGFLGPAFFLSQLSHVKTPAMAVLCMACS
FT                   QGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTAATGYILQRGSWDDVFK
FT                   VAVALYLIGTLVWNLFATGEKILD"
FT   gene            163569..163860
FT                   /locus_tag="AT4G03595"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT4G00370"
FT   ncRNA           163569..163860
FT                   /locus_tag="AT4G03595"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            167497..171010
FT                   /gene="FDM2"
FT                   /gene_synonym="A_IG005I10.22"
FT                   /gene_synonym="A_IG005I10_22"
FT                   /gene_synonym="F5I10.22"
FT                   /gene_synonym="F5I10_22"
FT                   /gene_synonym="factor of DNA methylation 2"
FT                   /gene_synonym="IDN2 PARALOG 2"
FT                   /gene_synonym="IDP2"
FT                   /gene_synonym="INDL2"
FT                   /gene_synonym="INVOLVED IN DE NOVO 2 (IDN2) - LIKE 2"
FT                   /locus_tag="AT4G00380"
FT                   /note="Belongs to a subgroup of SGS3-like proteins that act
FT                   redundantly in RNA-directed DNA methylation: AT1G15910
FT                   (FDM1), AT4G00380 (FDM2), AT3G12550 (FDM3), AT1G13790
FT                   (FDM4), AT1G80790 (FDM5)."
FT   mRNA            join(167497..167594,167945..168160,168245..168862,
FT                   168946..169127,169242..169331,169417..169704,
FT                   169807..170019,170218..170450,170715..170974)
FT                   /gene="FDM2"
FT                   /gene_synonym="A_IG005I10.22"
FT                   /gene_synonym="A_IG005I10_22"
FT                   /gene_synonym="F5I10.22"
FT                   /gene_synonym="F5I10_22"
FT                   /gene_synonym="factor of DNA methylation 2"
FT                   /gene_synonym="IDN2 PARALOG 2"
FT                   /gene_synonym="IDP2"
FT                   /gene_synonym="INDL2"
FT                   /gene_synonym="INVOLVED IN DE NOVO 2 (IDN2) - LIKE 2"
FT                   /locus_tag="AT4G00380"
FT                   /product="XH/XS domain-containing protein"
FT   mRNA            join(167499..167594,167945..168862,168946..169127,
FT                   169242..169331,169417..169704,169807..170019,
FT                   170218..170450,170715..171010)
FT                   /gene="FDM2"
FT                   /gene_synonym="A_IG005I10.22"
FT                   /gene_synonym="A_IG005I10_22"
FT                   /gene_synonym="F5I10.22"
FT                   /gene_synonym="F5I10_22"
FT                   /gene_synonym="factor of DNA methylation 2"
FT                   /gene_synonym="IDN2 PARALOG 2"
FT                   /gene_synonym="IDP2"
FT                   /gene_synonym="INDL2"
FT                   /gene_synonym="INVOLVED IN DE NOVO 2 (IDN2) - LIKE 2"
FT                   /locus_tag="AT4G00380"
FT                   /product="XH/XS domain-containing protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES053675.1,INSD:ES045625.1,INSD:ES017023.1,
FT                   INSD:AV530580.1,INSD:ES129201.1,INSD:ES029018.1,
FT                   INSD:EL289046.1,INSD:ES032564.1,INSD:ES041705.1,
FT                   INSD:ES188704.1,INSD:EH876426.1,INSD:ES181647.1,
FT                   INSD:EL179920.1,INSD:EL091107.1,INSD:EL049113.1,
FT                   INSD:ES065446.1,INSD:F14071.1,INSD:EG521914.1,
FT                   INSD:ES067895.1,INSD:AI995530.1,INSD:ES071385.1,
FT                   INSD:ES097432.1,INSD:EL008743.1,INSD:EG521915.1,
FT                   INSD:ES062072.1,INSD:ES078047.1,INSD:ES174499.1"
FT   mRNA            join(167959..168862,168946..169127,169242..169331,
FT                   169417..169704,169807..170019,170218..170450,
FT                   170715..170974)
FT                   /gene="FDM2"
FT                   /gene_synonym="A_IG005I10.22"
FT                   /gene_synonym="A_IG005I10_22"
FT                   /gene_synonym="F5I10.22"
FT                   /gene_synonym="F5I10_22"
FT                   /gene_synonym="factor of DNA methylation 2"
FT                   /gene_synonym="IDN2 PARALOG 2"
FT                   /gene_synonym="IDP2"
FT                   /gene_synonym="INDL2"
FT                   /gene_synonym="INVOLVED IN DE NOVO 2 (IDN2) - LIKE 2"
FT                   /locus_tag="AT4G00380"
FT                   /product="XH/XS domain-containing protein"
FT   CDS_pept        join(167959..168862,168946..169127,169242..169331,
FT                   169417..169704,169807..170019,170218..170448)
FT                   /codon_start=1
FT                   /gene="FDM2"
FT                   /gene_synonym="A_IG005I10.22"
FT                   /gene_synonym="A_IG005I10_22"
FT                   /gene_synonym="F5I10.22"
FT                   /gene_synonym="F5I10_22"
FT                   /gene_synonym="factor of DNA methylation 2"
FT                   /gene_synonym="IDN2 PARALOG 2"
FT                   /gene_synonym="IDP2"
FT                   /gene_synonym="INDL2"
FT                   /gene_synonym="INVOLVED IN DE NOVO 2 (IDN2) - LIKE 2"
FT                   /locus_tag="AT4G00380"
FT                   /product="XH/XS domain-containing protein"
FT                   /db_xref="GOA:F4JH53"
FT                   /db_xref="InterPro:IPR005379"
FT                   /db_xref="InterPro:IPR005380"
FT                   /db_xref="InterPro:IPR005381"
FT                   /db_xref="InterPro:IPR038588"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4JH53"
FT                   /protein_id="ANM67981.1"
FT                   /translation="MDISDEESEISESEIEEYSKTPYHLLRSETYYKVKVNGRLRCPFC
FT                   VGKKKQDYKYKELHAHATGVSKGSATRSALQKSNHLALAKFLENDLAGYAEPLPRPPVV
FT                   PPLLDETEPNPHNVYVWPWMGIVVNPLKETDDKELLLDSVYWLQTLSKFKPVEVNAFWV
FT                   EQDSIVGVIAKFDSDWSGFAAATELEKEFETQGSCKKEWTERSGDSESKAYGWCARADD
FT                   FQSQGPIGEYLSKEGTLRTVSDILQNNVQDRNTLLDVLSNMIDMTNEDLNKAQHSYNRT
FT                   AMSLQRVLDEKKNLHQAFAEETKKMQQMSLRHIQRILYDKEKLRNELDRKMRDLESRAK
FT                   QLEKHEALTELERQKLDEDKRKSDAMNKSLQLASREQKKADESVLRLVEEHQRQKEDAL
FT                   NKILLLEKQLDTKQTLEMEIQELKGKLQVMKHLGDDDDEAVQTKMKEMNDELDDKKAEL
FT                   EDLESMNSVLMTKERQSNDEIQAARQKMIAGLTGLLGAESDIGVKRMGELDEKPFLDVC
FT                   KLRYSANEARVEAATLCSTWKENLKNPSWQPFKREGTGDGAEEVVDEDDEQLKKLKREW
FT                   GKEVHNAVKAALVEMNEYNASGRYPTSELWNFKEGRKATLKEVITFISTDIKNLKRKRT
FT                   "
FT   CDS_pept        join(167959..168862,168946..169127,169242..169331,
FT                   169417..169704,169807..170019,170218..170448)
FT                   /codon_start=1
FT                   /gene="FDM2"
FT                   /gene_synonym="A_IG005I10.22"
FT                   /gene_synonym="A_IG005I10_22"
FT                   /gene_synonym="F5I10.22"
FT                   /gene_synonym="F5I10_22"
FT                   /gene_synonym="factor of DNA methylation 2"
FT                   /gene_synonym="IDN2 PARALOG 2"
FT                   /gene_synonym="IDP2"
FT                   /gene_synonym="INDL2"
FT                   /gene_synonym="INVOLVED IN DE NOVO 2 (IDN2) - LIKE 2"
FT                   /locus_tag="AT4G00380"
FT                   /product="XH/XS domain-containing protein"
FT                   /note="XH/XS domain-containing protein; CONTAINS InterPro
FT                   DOMAIN/s: Domain of unknown function XS
FT                   (InterPro:IPR005380), Domain of unknown function XH
FT                   (InterPro:IPR005379), Domain of unknown function, putative
FT                   Zinc finger, XS/XH (InterPro:IPR005381); BEST Arabidopsis
FT                   thaliana protein match is: XH/XS domain-containing protein
FT                   (TAIR:AT1G15910.1); Has 52398 Blast hits to 32322 proteins
FT                   in 2074 species: Archae - 615; Bacteria - 6626; Metazoa -
FT                   25839; Fungi - 3724; Plants - 1961; Viruses - 202; Other
FT                   Eukaryotes - 13431 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00380.1"
FT                   /db_xref="GOA:F4JH53"
FT                   /db_xref="InterPro:IPR005379"
FT                   /db_xref="InterPro:IPR005380"
FT                   /db_xref="InterPro:IPR005381"
FT                   /db_xref="InterPro:IPR038588"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4JH53"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES053675.1,INSD:ES045625.1,INSD:ES017023.1,
FT                   INSD:AV530580.1,INSD:ES129201.1,INSD:ES029018.1,
FT                   INSD:EL289046.1,INSD:ES032564.1,INSD:ES041705.1,
FT                   INSD:ES188704.1,INSD:EH876426.1,INSD:ES181647.1,
FT                   INSD:EL179920.1,INSD:EL091107.1,INSD:EL049113.1,
FT                   INSD:ES065446.1,INSD:F14071.1,INSD:EG521914.1,
FT                   INSD:ES067895.1,INSD:AI995530.1,INSD:ES071385.1,
FT                   INSD:ES097432.1,INSD:EL008743.1,INSD:EG521915.1,
FT                   INSD:ES062072.1,INSD:ES078047.1,INSD:ES174499.1"
FT                   /protein_id="AEE81871.1"
FT                   /translation="MDISDEESEISESEIEEYSKTPYHLLRSETYYKVKVNGRLRCPFC
FT                   VGKKKQDYKYKELHAHATGVSKGSATRSALQKSNHLALAKFLENDLAGYAEPLPRPPVV
FT                   PPLLDETEPNPHNVYVWPWMGIVVNPLKETDDKELLLDSVYWLQTLSKFKPVEVNAFWV
FT                   EQDSIVGVIAKFDSDWSGFAAATELEKEFETQGSCKKEWTERSGDSESKAYGWCARADD
FT                   FQSQGPIGEYLSKEGTLRTVSDILQNNVQDRNTLLDVLSNMIDMTNEDLNKAQHSYNRT
FT                   AMSLQRVLDEKKNLHQAFAEETKKMQQMSLRHIQRILYDKEKLRNELDRKMRDLESRAK
FT                   QLEKHEALTELERQKLDEDKRKSDAMNKSLQLASREQKKADESVLRLVEEHQRQKEDAL
FT                   NKILLLEKQLDTKQTLEMEIQELKGKLQVMKHLGDDDDEAVQTKMKEMNDELDDKKAEL
FT                   EDLESMNSVLMTKERQSNDEIQAARQKMIAGLTGLLGAESDIGVKRMGELDEKPFLDVC
FT                   KLRYSANEARVEAATLCSTWKENLKNPSWQPFKREGTGDGAEEVVDEDDEQLKKLKREW
FT                   GKEVHNAVKAALVEMNEYNASGRYPTSELWNFKEGRKATLKEVITFISTDIKNLKRKRT
FT                   "
FT   CDS_pept        join(167959..168160,168245..168862,168946..169127,
FT                   169242..169331,169417..169704,169807..170019,
FT                   170218..170448)
FT                   /codon_start=1
FT                   /gene="FDM2"
FT                   /gene_synonym="A_IG005I10.22"
FT                   /gene_synonym="A_IG005I10_22"
FT                   /gene_synonym="F5I10.22"
FT                   /gene_synonym="F5I10_22"
FT                   /gene_synonym="factor of DNA methylation 2"
FT                   /gene_synonym="IDN2 PARALOG 2"
FT                   /gene_synonym="IDP2"
FT                   /gene_synonym="INDL2"
FT                   /gene_synonym="INVOLVED IN DE NOVO 2 (IDN2) - LIKE 2"
FT                   /locus_tag="AT4G00380"
FT                   /product="XH/XS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00380"
FT                   /db_xref="GOA:A0A1P8B8T3"
FT                   /db_xref="InterPro:IPR005379"
FT                   /db_xref="InterPro:IPR005380"
FT                   /db_xref="InterPro:IPR005381"
FT                   /db_xref="InterPro:IPR038588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B8T3"
FT                   /protein_id="ANM67980.1"
FT                   /translation="MDISDEESEISESEIEEYSKTPYHLLRSETYYKVKVNGRLRCPFC
FT                   VGKKKQDYKYKELHAHATGVSKEPLPRPPVVPPLLDETEPNPHNVYVWPWMGIVVNPLK
FT                   ETDDKELLLDSVYWLQTLSKFKPVEVNAFWVEQDSIVGVIAKFDSDWSGFAAATELEKE
FT                   FETQGSCKKEWTERSGDSESKAYGWCARADDFQSQGPIGEYLSKEGTLRTVSDILQNNV
FT                   QDRNTLLDVLSNMIDMTNEDLNKAQHSYNRTAMSLQRVLDEKKNLHQAFAEETKKMQQM
FT                   SLRHIQRILYDKEKLRNELDRKMRDLESRAKQLEKHEALTELERQKLDEDKRKSDAMNK
FT                   SLQLASREQKKADESVLRLVEEHQRQKEDALNKILLLEKQLDTKQTLEMEIQELKGKLQ
FT                   VMKHLGDDDDEAVQTKMKEMNDELDDKKAELEDLESMNSVLMTKERQSNDEIQAARQKM
FT                   IAGLTGLLGAESDIGVKRMGELDEKPFLDVCKLRYSANEARVEAATLCSTWKENLKNPS
FT                   WQPFKREGTGDGAEEVVDEDDEQLKKLKREWGKEVHNAVKAALVEMNEYNASGRYPTSE
FT                   LWNFKEGRKATLKEVITFISTDIKNLKRKRT"
FT   gene            complement(171487..172845)
FT                   /gene_synonym="A_IG005I10.6"
FT                   /gene_synonym="A_IG005I10_6"
FT                   /gene_synonym="F5I10.6"
FT                   /gene_synonym="F5I10_6"
FT                   /locus_tag="AT4G00390"
FT   mRNA            complement(171487..172845)
FT                   /gene_synonym="A_IG005I10.6"
FT                   /gene_synonym="A_IG005I10_6"
FT                   /gene_synonym="F5I10.6"
FT                   /gene_synonym="F5I10_6"
FT                   /locus_tag="AT4G00390"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR348793.1,INSD:ES072453.1,INSD:DR348791.1,
FT                   INSD:DR381282.1,INSD:DR348792.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY085566.1,INSD:DQ446789.1"
FT   CDS_pept        complement(171650..172744)
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.6"
FT                   /gene_synonym="A_IG005I10_6"
FT                   /gene_synonym="F5I10.6"
FT                   /gene_synonym="F5I10_6"
FT                   /locus_tag="AT4G00390"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /note="DNA-binding storekeeper protein-related
FT                   transcriptional regulator; FUNCTIONS IN: transcription
FT                   regulator activity; LOCATED IN: nucleolus; EXPRESSED IN:
FT                   seed; EXPRESSED DURING: E expanded cotyledon stage;
FT                   CONTAINS InterPro DOMAIN/s: Protein of unknown function
FT                   DUF573 (InterPro:IPR007592); BEST Arabidopsis thaliana
FT                   protein match is: DNA-binding storekeeper protein-related
FT                   transcriptional regulator (TAIR:AT1G61730.1); Has 1807
FT                   Blast hits to 1807 proteins in 277 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:O23063"
FT                   /db_xref="InterPro:IPR007592"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23063"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR348793.1,INSD:ES072453.1,INSD:DR348791.1,
FT                   INSD:DR381282.1,INSD:DR348792.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY085566.1,INSD:DQ446789.1"
FT                   /protein_id="AEE81872.1"
FT                   /translation="MTKKLDPPTAPSSDEDDVETSEDDSSSSEEDEPIKSLPATTAAAP
FT                   AKSTAVSAATPAKSTSVSAAAPSKSTAVSAAADSDSGSESETDSDSESTDPPKSGSGKT
FT                   IASKKKDDPSSSTATLALPAVKSGAKRAASEAATTSTKRVKKDEESVKKPALFQRLWSD
FT                   DDEISMLQGMIDYHADTGKSPSADTNAFYEFQKKSISFEVSKSQFSDKVRSLRKKYRAK
FT                   EGKDEPRFVKAHDKKAFELSKFIWGPKGIALDSNAKSNGVSKKSASKTKEKLDSVKQDL
FT                   AFVGVSSTNGDDWFEKSSLARMIAGSGIDEYYVRQKWSSFTLETKKIVEEKFQLMQAKE
FT                   LEAMLDKSVRLTDLTSYFVDASKN"
FT   gene            complement(173953..176870)
FT                   /gene="GPAT8"
FT                   /gene_synonym="AtGPAT8"
FT                   /gene_synonym="A_IG005I10.4"
FT                   /gene_synonym="A_IG005I10_4"
FT                   /gene_synonym="F5I10.4"
FT                   /gene_synonym="F5I10_4"
FT                   /gene_synonym="glycerol-3-phosphate acyltransferase 8"
FT                   /gene_synonym="GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 8"
FT                   /locus_tag="AT4G00400"
FT                   /note="bifunctional sn-glycerol-3-phosphate
FT                   2-O-acyltransferase/phosphatase. Involved in cutin assembly
FT                   and is functionally redundant with GPAT4."
FT   mRNA            complement(join(173953..174715,175062..175536,
FT                   176039..176351,176424..176870))
FT                   /gene="GPAT8"
FT                   /gene_synonym="AtGPAT8"
FT                   /gene_synonym="A_IG005I10.4"
FT                   /gene_synonym="A_IG005I10_4"
FT                   /gene_synonym="F5I10.4"
FT                   /gene_synonym="F5I10_4"
FT                   /gene_synonym="glycerol-3-phosphate acyltransferase 8"
FT                   /gene_synonym="GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 8"
FT                   /locus_tag="AT4G00400"
FT                   /product="glycerol-3-phosphate acyltransferase 8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL112440.1,INSD:EL213366.1,INSD:EL968514.1,
FT                   INSD:EL262864.1,INSD:EL288212.1,INSD:EL987122.1,
FT                   INSD:EL259589.1,INSD:EL083509.1,INSD:EH813138.1,
FT                   INSD:EL022804.1,INSD:ES187391.1,INSD:EH901897.1,
FT                   INSD:BX835398.1,INSD:DR235878.1,INSD:EL167305.1,
FT                   INSD:DR299763.1,INSD:EL088551.1,INSD:EL985695.1,
FT                   INSD:EH934770.1,INSD:ES213853.1,INSD:BP600933.1,
FT                   INSD:EH827513.1,INSD:BX839034.1,INSD:DR354983.1,
FT                   INSD:DR352412.1,INSD:EL250795.1,INSD:ES094880.1,
FT                   INSD:EL065096.1,INSD:EH878407.1,INSD:EL084512.1,
FT                   INSD:EL047858.1,INSD:EH848771.1,INSD:EL123099.1,
FT                   INSD:ES004196.1,INSD:EH993650.1,INSD:EL071649.1,
FT                   INSD:EH809893.1,INSD:ES191720.1,INSD:EL156628.1,
FT                   INSD:AU237381.1,INSD:EH873787.1,INSD:EH874115.1,
FT                   INSD:EL330188.1,INSD:EL076709.1,INSD:ES030596.1,
FT                   INSD:EH947759.1,INSD:EL250114.1,INSD:DR299765.1,
FT                   INSD:EL114992.1,INSD:EL105704.1,INSD:DR352405.1,
FT                   INSD:DR299760.1,INSD:BP600914.1,INSD:CB264471.1,
FT                   INSD:BP781594.1,INSD:EL172166.1,INSD:EL143335.1,
FT                   INSD:DR299766.1,INSD:EL123112.1,INSD:EL106672.1,
FT                   INSD:EH870119.1,INSD:EL091943.1,INSD:EL202121.1,
FT                   INSD:DR299764.1,INSD:EL129183.1,INSD:EL232690.1,
FT                   INSD:EL990695.1,INSD:DR363379.1,INSD:EL191174.1,
FT                   INSD:DR352407.1,INSD:AV534225.1,INSD:AU228427.1,
FT                   INSD:ES190275.1,INSD:EL117455.1,INSD:EL256016.1,
FT                   INSD:DR299762.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX842342.1,INSD:BT015813.1,INSD:BX842310.1,
FT                   INSD:AK228870.1"
FT   CDS_pept        complement(join(174312..174715,175062..175536,
FT                   176039..176351,176424..176734))
FT                   /codon_start=1
FT                   /gene="GPAT8"
FT                   /gene_synonym="AtGPAT8"
FT                   /gene_synonym="A_IG005I10.4"
FT                   /gene_synonym="A_IG005I10_4"
FT                   /gene_synonym="F5I10.4"
FT                   /gene_synonym="F5I10_4"
FT                   /gene_synonym="glycerol-3-phosphate acyltransferase 8"
FT                   /gene_synonym="GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 8"
FT                   /locus_tag="AT4G00400"
FT                   /product="glycerol-3-phosphate acyltransferase 8"
FT                   /note="glycerol-3-phosphate acyltransferase 8 (GPAT8);
FT                   FUNCTIONS IN: glycerol-3-phosphate O-acyltransferase
FT                   activity, acyltransferase activity; INVOLVED IN: metabolic
FT                   process, cutin biosynthetic process; LOCATED IN:
FT                   endoplasmic reticulum; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Phospholipid/glycerol acyltransferase
FT                   (InterPro:IPR002123); BEST Arabidopsis thaliana protein
FT                   match is: glycerol-3-phosphate acyltransferase 4
FT                   (TAIR:AT1G01610.1); Has 380 Blast hits to 369 proteins in
FT                   27 species: Archae - 0; Bacteria - 6; Metazoa - 8; Fungi -
FT                   0; Plants - 360; Viruses - 0; Other Eukaryotes - 6 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q5XF03"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XF03"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL112440.1,INSD:EL213366.1,INSD:EL968514.1,
FT                   INSD:EL262864.1,INSD:EL288212.1,INSD:EL987122.1,
FT                   INSD:EL259589.1,INSD:EL083509.1,INSD:EH813138.1,
FT                   INSD:EL022804.1,INSD:ES187391.1,INSD:EH901897.1,
FT                   INSD:BX835398.1,INSD:DR235878.1,INSD:EL167305.1,
FT                   INSD:DR299763.1,INSD:EL088551.1,INSD:EL985695.1,
FT                   INSD:EH934770.1,INSD:ES213853.1,INSD:BP600933.1,
FT                   INSD:EH827513.1,INSD:BX839034.1,INSD:DR354983.1,
FT                   INSD:DR352412.1,INSD:EL250795.1,INSD:ES094880.1,
FT                   INSD:EL065096.1,INSD:EH878407.1,INSD:EL084512.1,
FT                   INSD:EL047858.1,INSD:EH848771.1,INSD:EL123099.1,
FT                   INSD:ES004196.1,INSD:EH993650.1,INSD:EL071649.1,
FT                   INSD:EH809893.1,INSD:ES191720.1,INSD:EL156628.1,
FT                   INSD:AU237381.1,INSD:EH873787.1,INSD:EH874115.1,
FT                   INSD:EL330188.1,INSD:EL076709.1,INSD:ES030596.1,
FT                   INSD:EH947759.1,INSD:EL250114.1,INSD:DR299765.1,
FT                   INSD:EL114992.1,INSD:EL105704.1,INSD:DR352405.1,
FT                   INSD:DR299760.1,INSD:BP600914.1,INSD:CB264471.1,
FT                   INSD:BP781594.1,INSD:EL172166.1,INSD:EL143335.1,
FT                   INSD:DR299766.1,INSD:EL123112.1,INSD:EL106672.1,
FT                   INSD:EH870119.1,INSD:EL091943.1,INSD:EL202121.1,
FT                   INSD:DR299764.1,INSD:EL129183.1,INSD:EL232690.1,
FT                   INSD:EL990695.1,INSD:DR363379.1,INSD:EL191174.1,
FT                   INSD:DR352407.1,INSD:AV534225.1,INSD:AU228427.1,
FT                   INSD:ES190275.1,INSD:EL117455.1,INSD:EL256016.1,
FT                   INSD:DR299762.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX842342.1,INSD:BT015813.1,INSD:BX842310.1,
FT                   INSD:AK228870.1"
FT                   /protein_id="AEE81873.1"
FT                   /translation="MSPEKKSQNFPPITECRDGEYDSIAADLDGTLLLSRSSFPYFMLV
FT                   AVEAGSLLRGLILLLSLPFVIISYLFVSESLGIQILIFISFAGLKIRDIELVSRAVLPR
FT                   FYAADVRKDSFEVFDKCKRKVVVTANPIVMVEAFVKDYLGGDKVLGTEIEVNPKTNRAT
FT                   GFVKKPGVLVGDLKRLAILKEFGNESPDLGLGDRTSDHDFMSLCKKGYMVHATKSATTI
FT                   PKERLKNRIVFHDGRLAQRPTPLNAIITYLWLPFGFILSIIRVYFNLPLPERFVRYTYE
FT                   MLGIHLTIRGHRPPPPSPGTLGNLYVLNHRTALDPIIVAIALGRKICCVTYSVSRLSLM
FT                   LSPIPAVALTRDRATDAANMRKLLEKGDLVICPEGTTCREEYLLRFSALFAELSDRIVP
FT                   VAMNCKQGMFNGTTVRGVKFWDPYFFFMNPRPSYEATFLDRLPEEMTVNGGGKTPIEVA
FT                   NYVQKVIGAVLGFECTELTRKDKYLLLGGNDGKVESINNTKK"
FT   gene            complement(178039..178161)
FT                   /pseudo
FT                   /locus_tag="AT4G00413"
FT   misc_RNA        complement(178039..178161)
FT                   /pseudo
FT                   /locus_tag="AT4G00413"
FT                   /note="pseudogene of plasma membrane intrinsic protein 1;4;
FT                   AT4G00413.1"
FT   gene            178519..178717
FT                   /locus_tag="AT4G03605"
FT   ncRNA           178519..178717
FT                   /locus_tag="AT4G03605"
FT                   /product="other RNA"
FT                   /ncRNA_class="other"
FT   gene            179022..179513
FT                   /gene="MBD3"
FT                   /gene_synonym="methyl-CPG-binding domain 3"
FT                   /locus_tag="AT4G00416"
FT                   /note="Protein containing methyl-CpG-binding domain.Has
FT                   sequence similarity to human MBD proteins."
FT   mRNA            179022..179513
FT                   /gene="MBD3"
FT                   /gene_synonym="methyl-CPG-binding domain 3"
FT                   /locus_tag="AT4G00416"
FT                   /product="methyl-CPG-binding domain 3"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ056635.1"
FT   CDS_pept        179022..179513
FT                   /codon_start=1
FT                   /gene="MBD3"
FT                   /gene_synonym="methyl-CPG-binding domain 3"
FT                   /locus_tag="AT4G00416"
FT                   /product="methyl-CPG-binding domain 3"
FT                   /note="methyl-CPG-binding domain 3 (MBD3); FUNCTIONS IN:
FT                   methyl-CpG binding, DNA binding; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: nucleus; CONTAINS
FT                   InterPro DOMAIN/s: DNA-binding, integrase-type
FT                   (InterPro:IPR016177), Methyl-CpG DNA binding
FT                   (InterPro:IPR001739), Zinc finger, CW-type
FT                   (InterPro:IPR011124); BEST Arabidopsis thaliana protein
FT                   match is: methyl-CPG-binding domain 4 (TAIR:AT3G63030.1);
FT                   Has 103 Blast hits to 103 proteins in 14 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 103;
FT                   Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00416"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00416.1"
FT                   /db_xref="GOA:Q4PSK1"
FT                   /db_xref="InterPro:IPR001739"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4PSK1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ056635.1"
FT                   /protein_id="AEE81874.1"
FT                   /translation="MCVVKTTLIDSYAAQCWKCLKVRSIESQEDYEEIRSKTLEKFFEC
FT                   KRCEEPGDMVMNFDSLTMRWFQDEHSIPKTPQGLKRVLVVRTNCVKVDVYYESLAPRRK
FT                   RFKSIKEVATFIEDKEEFKDMTLEEVSFAAPKRLKLKKKPVDSHSSSRNTEEDGVSRDA
FT                   "
FT   gene            complement(181267..184469)
FT                   /gene_synonym="A_IG005I10.3"
FT                   /gene_synonym="A_IG005I10_3"
FT                   /gene_synonym="F5I10.3"
FT                   /gene_synonym="F5I10_3"
FT                   /locus_tag="AT4G00420"
FT   mRNA            complement(join(181267..181746,181841..181952,
FT                   182243..182420,182576..182695,183300..183379,
FT                   183982..184393))
FT                   /gene_synonym="A_IG005I10.3"
FT                   /gene_synonym="A_IG005I10_3"
FT                   /gene_synonym="F5I10.3"
FT                   /gene_synonym="F5I10_3"
FT                   /locus_tag="AT4G00420"
FT                   /product="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein"
FT   mRNA            complement(join(181274..181746,181841..181952,
FT                   182243..182420,182576..182695,183300..183379,
FT                   184250..184469))
FT                   /gene_synonym="A_IG005I10.3"
FT                   /gene_synonym="A_IG005I10_3"
FT                   /gene_synonym="F5I10.3"
FT                   /gene_synonym="F5I10_3"
FT                   /locus_tag="AT4G00420"
FT                   /product="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL075524.1,INSD:ES129776.1,INSD:AU227384.1,
FT                   INSD:EL027692.1,INSD:ES029072.1,INSD:EL075785.1,
FT                   INSD:ES209522.1,INSD:ES182567.1,INSD:BP643122.1,
FT                   INSD:BP562834.2,INSD:CF773739.1,INSD:BP788119.1,
FT                   INSD:ES173697.1,INSD:EL991550.1,INSD:ES005453.1,
FT                   INSD:EL110517.1,INSD:DR341671.1,INSD:BP653861.1,
FT                   INSD:ES033135.1,INSD:EL995019.1,INSD:ES046755.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT002942.1,INSD:BT004377.1"
FT   mRNA            complement(join(181274..181746,181841..181952,
FT                   182243..182420,182576..182695,183300..183379,
FT                   184052..184469))
FT                   /gene_synonym="A_IG005I10.3"
FT                   /gene_synonym="A_IG005I10_3"
FT                   /gene_synonym="F5I10.3"
FT                   /gene_synonym="F5I10_3"
FT                   /locus_tag="AT4G00420"
FT                   /product="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein"
FT   mRNA            complement(join(181323..181746,181841..181952,
FT                   182243..182420,183300..183379,184250..184387))
FT                   /gene_synonym="A_IG005I10.3"
FT                   /gene_synonym="A_IG005I10_3"
FT                   /gene_synonym="F5I10.3"
FT                   /gene_synonym="F5I10_3"
FT                   /locus_tag="AT4G00420"
FT                   /product="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL075524.1,INSD:ES129776.1,INSD:CO048505.1,
FT                   INSD:AU227384.1,INSD:CO048495.1,INSD:ES029072.1,
FT                   INSD:EL075785.1,INSD:CO048484.1,INSD:CO048485.1,
FT                   INSD:AI999410.1,INSD:BP643122.1,INSD:BP562834.2,
FT                   INSD:CF773739.1,INSD:ES173697.1,INSD:DR376342.1,
FT                   INSD:EL110517.1,INSD:CO048764.1,INSD:CO048509.1,
FT                   INSD:BP653861.1,INSD:CO048490.1,INSD:ES046755.1,
FT                   INSD:BP814782.1,INSD:EL027692.1,INSD:ES182567.1,
FT                   INSD:ES209522.1,INSD:CO048491.1,INSD:CO871575.1,
FT                   INSD:BP788119.1,INSD:ES005453.1,INSD:EL991550.1,
FT                   INSD:DR341671.1,INSD:ES033135.1,INSD:EL995019.1"
FT   mRNA            complement(join(181323..181746,181841..181949,
FT                   182243..182420,182576..182695,183300..183379,
FT                   184052..184219))
FT                   /gene_synonym="A_IG005I10.3"
FT                   /gene_synonym="A_IG005I10_3"
FT                   /gene_synonym="F5I10.3"
FT                   /gene_synonym="F5I10_3"
FT                   /locus_tag="AT4G00420"
FT                   /product="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL075524.1,INSD:ES129776.1,INSD:CO048505.1,
FT                   INSD:AU227384.1,INSD:CO048495.1,INSD:ES029072.1,
FT                   INSD:EL075785.1,INSD:CO048484.1,INSD:CO048485.1,
FT                   INSD:AI999410.1,INSD:BP643122.1,INSD:CF773739.1,
FT                   INSD:EL110517.1,INSD:CO048764.1,INSD:CO048509.1,
FT                   INSD:BP653861.1,INSD:CO048490.1,INSD:ES046755.1,
FT                   INSD:EG513766.1,INSD:BP814782.1,INSD:EL027692.1,
FT                   INSD:ES182567.1,INSD:ES209522.1,INSD:CO048491.1,
FT                   INSD:CO871575.1,INSD:BP788119.1,INSD:ES005453.1,
FT                   INSD:EL991550.1,INSD:EG513677.1,INSD:ES033135.1,
FT                   INSD:EL995019.1"
FT   CDS_pept        complement(join(181518..181746,181841..181949,
FT                   182243..182420,182576..182629))
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.3"
FT                   /gene_synonym="A_IG005I10_3"
FT                   /gene_synonym="F5I10.3"
FT                   /gene_synonym="F5I10_3"
FT                   /locus_tag="AT4G00420"
FT                   /product="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein"
FT                   /note="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein; FUNCTIONS IN: double-stranded
FT                   RNA binding, RNA binding; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: intracellular, chloroplast; EXPRESSED
FT                   IN: 23 plant structures; EXPRESSED DURING: 13 growth
FT                   stages; CONTAINS InterPro DOMAIN/s: Double-stranded
FT                   RNA-binding (InterPro:IPR001159), Double-stranded
FT                   RNA-binding-like (InterPro:IPR014720); BEST Arabidopsis
FT                   thaliana protein match is: RNAse THREE-like protein 1
FT                   (TAIR:AT1G80650.1); Has 64 Blast hits to 64 proteins in 12
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 64; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00420"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00420.1"
FT                   /db_xref="GOA:Q84JN8"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:Q84JN8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL075524.1,INSD:ES129776.1,INSD:AU227384.1,
FT                   INSD:EL027692.1,INSD:ES029072.1,INSD:EL075785.1,
FT                   INSD:ES209522.1,INSD:ES182567.1,INSD:BP643122.1,
FT                   INSD:BP562834.2,INSD:CF773739.1,INSD:BP788119.1,
FT                   INSD:ES173697.1,INSD:EL991550.1,INSD:ES005453.1,
FT                   INSD:EL110517.1,INSD:DR341671.1,INSD:BP653861.1,
FT                   INSD:ES033135.1,INSD:EL995019.1,INSD:ES046755.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT002942.1,INSD:BT004377.1"
FT                   /protein_id="AEE81876.1"
FT                   /translation="MDLPPPESSSNPISSFSVAQKRMLLQRCESKFKIRKLNDTVEEDN
FT                   VTQMEPNFTLENTLVSEPEADLRPHTTEPTTEETQRSSAKSQLYNLCSVRHWKAPLYEY
FT                   IAEGPCHMKIFTGKVTVEMKEDSRITVLECFGNPQYKKKIAAEQAAEAALWYLKNVGYT
FT                   LQTEKASGRKGRSKPISKMMVTGEPV"
FT   CDS_pept        complement(join(181518..181746,181841..181952,
FT                   182243..182420,182576..182629))
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.3"
FT                   /gene_synonym="A_IG005I10_3"
FT                   /gene_synonym="F5I10.3"
FT                   /gene_synonym="F5I10_3"
FT                   /locus_tag="AT4G00420"
FT                   /product="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00420"
FT                   /db_xref="GOA:F4JHB3"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHB3"
FT                   /protein_id="ANM66100.1"
FT                   /translation="MDLPPPESSSNPISSFSVAQKRMLLQRCESKFKIRKLNDTVEEDN
FT                   VTQMEPNFTLENTLVSEPEADLRPHTTEPTTEEETQRSSAKSQLYNLCSVRHWKAPLYE
FT                   YIAEGPCHMKIFTGKVTVEMKEDSRITVLECFGNPQYKKKIAAEQAAEAALWYLKNVGY
FT                   TLQTEKASGRKGRSKPISKMMVTGEPV"
FT   CDS_pept        complement(join(181518..181746,181841..181952,
FT                   182243..182420,182576..182629))
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.3"
FT                   /gene_synonym="A_IG005I10_3"
FT                   /gene_synonym="F5I10.3"
FT                   /gene_synonym="F5I10_3"
FT                   /locus_tag="AT4G00420"
FT                   /product="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein"
FT                   /db_xref="GOA:F4JHB3"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHB3"
FT                   /protein_id="ANM66101.1"
FT                   /translation="MDLPPPESSSNPISSFSVAQKRMLLQRCESKFKIRKLNDTVEEDN
FT                   VTQMEPNFTLENTLVSEPEADLRPHTTEPTTEEETQRSSAKSQLYNLCSVRHWKAPLYE
FT                   YIAEGPCHMKIFTGKVTVEMKEDSRITVLECFGNPQYKKKIAAEQAAEAALWYLKNVGY
FT                   TLQTEKASGRKGRSKPISKMMVTGEPV"
FT   CDS_pept        complement(join(181518..181746,181841..181952,
FT                   182243..182420,182576..182629))
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.3"
FT                   /gene_synonym="A_IG005I10_3"
FT                   /gene_synonym="F5I10.3"
FT                   /gene_synonym="F5I10_3"
FT                   /locus_tag="AT4G00420"
FT                   /product="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein"
FT                   /note="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein; FUNCTIONS IN: double-stranded
FT                   RNA binding, RNA binding; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: intracellular, chloroplast; EXPRESSED
FT                   IN: 23 plant structures; EXPRESSED DURING: 13 growth
FT                   stages; CONTAINS InterPro DOMAIN/s: Double-stranded
FT                   RNA-binding (InterPro:IPR001159), Double-stranded
FT                   RNA-binding-like (InterPro:IPR014720); BEST Arabidopsis
FT                   thaliana protein match is: RNAse THREE-like protein 1
FT                   (TAIR:AT1G80650.1); Has 72 Blast hits to 72 proteins in 15
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 71; Viruses - 0; Other Eukaryotes - 1 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:F4JHB3"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHB3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL075524.1,INSD:ES129776.1,INSD:CO048505.1,
FT                   INSD:AU227384.1,INSD:CO048495.1,INSD:ES029072.1,
FT                   INSD:EL075785.1,INSD:CO048484.1,INSD:CO048485.1,
FT                   INSD:AI999410.1,INSD:BP643122.1,INSD:BP562834.2,
FT                   INSD:CF773739.1,INSD:ES173697.1,INSD:DR376342.1,
FT                   INSD:EL110517.1,INSD:CO048764.1,INSD:CO048509.1,
FT                   INSD:BP653861.1,INSD:CO048490.1,INSD:ES046755.1,
FT                   INSD:BP814782.1,INSD:EL027692.1,INSD:ES182567.1,
FT                   INSD:ES209522.1,INSD:CO048491.1,INSD:CO871575.1,
FT                   INSD:BP788119.1,INSD:ES005453.1,INSD:EL991550.1,
FT                   INSD:DR341671.1,INSD:ES033135.1,INSD:EL995019.1"
FT                   /protein_id="AEE81875.1"
FT                   /translation="MDLPPPESSSNPISSFSVAQKRMLLQRCESKFKIRKLNDTVEEDN
FT                   VTQMEPNFTLENTLVSEPEADLRPHTTEPTTEEETQRSSAKSQLYNLCSVRHWKAPLYE
FT                   YIAEGPCHMKIFTGKVTVEMKEDSRITVLECFGNPQYKKKIAAEQAAEAALWYLKNVGY
FT                   TLQTEKASGRKGRSKPISKMMVTGEPV"
FT   CDS_pept        complement(join(181518..181746,181841..181952,
FT                   182243..182408))
FT                   /codon_start=1
FT                   /gene_synonym="A_IG005I10.3"
FT                   /gene_synonym="A_IG005I10_3"
FT                   /gene_synonym="F5I10.3"
FT                   /gene_synonym="F5I10_3"
FT                   /locus_tag="AT4G00420"
FT                   /product="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein"
FT                   /note="Double-stranded RNA-binding domain
FT                   (DsRBD)-containing protein; FUNCTIONS IN: double-stranded
FT                   RNA binding; INVOLVED IN: biological_process unknown;
FT                   LOCATED IN: intracellular; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Double-stranded RNA-binding
FT                   (InterPro:IPR001159); BEST Arabidopsis thaliana protein
FT                   match is: RNAse THREE-like protein 1 (TAIR:AT1G80650.1);
FT                   Has 30201 Blast hits to 17322 proteins in 780 species:
FT                   Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi -
FT                   3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00420"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00420.2"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00420.3"
FT                   /db_xref="GOA:B3H7E2"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:B3H7E2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL075524.1,INSD:ES129776.1,INSD:CO048505.1,
FT                   INSD:AU227384.1,INSD:CO048495.1,INSD:ES029072.1,
FT                   INSD:EL075785.1,INSD:CO048484.1,INSD:CO048485.1,
FT                   INSD:AI999410.1,INSD:BP643122.1,INSD:CF773739.1,
FT                   INSD:EL110517.1,INSD:CO048764.1,INSD:CO048509.1,
FT                   INSD:BP653861.1,INSD:CO048490.1,INSD:ES046755.1,
FT                   INSD:EG513766.1,INSD:BP814782.1,INSD:EL027692.1,
FT                   INSD:ES182567.1,INSD:ES209522.1,INSD:CO048491.1,
FT                   INSD:CO871575.1,INSD:BP788119.1,INSD:ES005453.1,
FT                   INSD:EL991550.1,INSD:EG513677.1,INSD:ES033135.1,
FT                   INSD:EL995019.1"
FT                   /protein_id="AEE81877.1"
FT                   /translation="MLLQRCESKFKIRKLNDTVEEDNVTQMEPNFTLENTLVSEPEADL
FT                   RPHTTEPTTEEETQRSSAKSQLYNLCSVRHWKAPLYEYIAEGPCHMKIFTGKVTVEMKE
FT                   DSRITVLECFGNPQYKKKIAAEQAAEAALWYLKNVGYTLQTEKASGRKGRSKPISKMMV
FT                   TGEPV"
FT   gene            complement(185285..187680)
FT                   /gene="PIP1;4"
FT                   /gene_synonym="A_IG005I10.2"
FT                   /gene_synonym="A_IG005I10_2"
FT                   /gene_synonym="F5I10.2"
FT                   /gene_synonym="F5I10_2"
FT                   /gene_synonym="PIP1E"
FT                   /gene_synonym="plasma membrane intrinsic protein 1;4"
FT                   /gene_synonym="PLASMA MEMBRANE INTRINSIC PROTEIN 1E"
FT                   /gene_synonym="TMP-C"
FT                   /gene_synonym="TRANSMEMBRANE PROTEIN C"
FT                   /locus_tag="AT4G00430"
FT                   /note="a member of the plasma membrane intrinsic protein
FT                   subfamily PIP1."
FT   mRNA            complement(join(185285..186238,186333..186473,
FT                   186602..186897,187201..187680))
FT                   /gene="PIP1;4"
FT                   /gene_synonym="A_IG005I10.2"
FT                   /gene_synonym="A_IG005I10_2"
FT                   /gene_synonym="F5I10.2"
FT                   /gene_synonym="F5I10_2"
FT                   /gene_synonym="PIP1E"
FT                   /gene_synonym="plasma membrane intrinsic protein 1;4"
FT                   /gene_synonym="PLASMA MEMBRANE INTRINSIC PROTEIN 1E"
FT                   /gene_synonym="TMP-C"
FT                   /gene_synonym="TRANSMEMBRANE PROTEIN C"
FT                   /locus_tag="AT4G00430"
FT                   /product="plasma membrane intrinsic protein 1;4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV533763.1,INSD:DR247184.1,INSD:EL976125.1,
FT                   INSD:EH987340.1,INSD:EL170687.1,INSD:DR247227.1,
FT                   INSD:EH890324.1,INSD:EH798481.1,INSD:CB264486.1,
FT                   INSD:DR247117.1,INSD:EL296969.1,INSD:EL141963.1,
FT                   INSD:EL082052.1,INSD:ES075552.1,INSD:DR247181.1,
FT                   INSD:DR247204.1,INSD:EL156540.1,INSD:EH797149.1,
FT                   INSD:EG456158.1,INSD:DR247249.1,INSD:DR247082.1,
FT                   INSD:EL174351.1,INSD:DR247164.1,INSD:EL143871.1,
FT                   INSD:BP591542.1,INSD:BP646645.1,INSD:EL073685.1,
FT                   INSD:DR247139.1,INSD:Z18386.1,INSD:DR247059.1,
FT                   INSD:EL997504.1,INSD:DR247198.1,INSD:DR247283.1,
FT                   INSD:DR247219.1,INSD:EH863746.1,INSD:EH933454.1,
FT                   INSD:DR247201.1,INSD:T13717.1,INSD:EH955401.1,
FT                   INSD:ES181413.1,INSD:BP630611.1,INSD:EH973904.1,
FT                   INSD:EH800696.1,INSD:EL317938.1,INSD:EL017949.1,
FT                   INSD:DR247111.1,INSD:DR247130.1,INSD:EH874901.1,
FT                   INSD:DR247309.1,INSD:ES013685.1,INSD:DR247239.1,
FT                   INSD:EL075579.1,INSD:EL981115.1,INSD:EH908623.1,
FT                   INSD:DR247268.1,INSD:DR358813.1,INSD:CB074464.1,
FT                   INSD:EL327642.1,INSD:EL021238.1,INSD:EL981956.1,
FT                   INSD:EH846905.1,INSD:EL246337.1,INSD:EL190081.1,
FT                   INSD:DR247271.1,INSD:DR247152.1,INSD:DR247255.1,
FT                   INSD:ES058724.1,INSD:AV794446.1,INSD:EH943371.1,
FT                   INSD:AV556533.1,INSD:EG500318.1,INSD:DR247214.1,
FT                   INSD:EL992620.1,INSD:EL309548.1,INSD:DR247138.1,
FT                   INSD:EL140523.1,INSD:DR247101.1,INSD:DR297675.1,
FT                   INSD:DR247185.1,INSD:DR247229.1,INSD:DR247223.1,
FT                   INSD:DR247084.1,INSD:EL132170.1,INSD:ES178975.1,
FT                   INSD:ES058582.1,INSD:BP641974.1,INSD:DR247292.1,
FT                   INSD:EL238741.1,INSD:EL227964.1,INSD:EL046013.1,
FT                   INSD:DR247149.1,INSD:EL088852.1,INSD:DR247153.1,
FT                   INSD:BP660077.1,INSD:EG450258.1,INSD:EL082906.1,
FT                   INSD:BP624649.1,INSD:EL337892.1,INSD:DR247241.1,
FT                   INSD:EL088720.1,INSD:ES012047.1,INSD:EL205146.1,
FT                   INSD:ES062671.1,INSD:EH831699.1,INSD:EL317817.1,
FT                   INSD:DR247143.1,INSD:DR247258.1,INSD:DR247235.1,
FT                   INSD:EH922167.1,INSD:DR247119.1,INSD:CO048572.1,
FT                   INSD:DR247102.1,INSD:AV538052.1,INSD:DR247073.1,
FT                   INSD:EL324780.1,INSD:ES181388.1,INSD:DR247159.1,
FT                   INSD:EL316659.1,INSD:DR247118.1,INSD:DR247107.1,
FT                   INSD:AV525115.1,INSD:BP667922.1,INSD:EL038957.1,
FT                   INSD:DR247301.1,INSD:EL272122.1,INSD:DR247250.1,
FT                   INSD:BP576357.1,INSD:BP862249.1,INSD:BP637133.1,
FT                   INSD:EL133899.1,INSD:DR247299.1,INSD:EL019237.1,
FT                   INSD:EL214821.1,INSD:EL202887.1,INSD:BP633533.1,
FT                   INSD:EG506781.1,INSD:DR247281.1,INSD:ES003351.1,
FT                   INSD:ES173537.1,INSD:DR247277.1,INSD:EH923943.1,
FT                   INSD:EH817725.1,INSD:EH798546.1,INSD:DR247142.1,
FT                   INSD:DR247195.1,INSD:DR247289.1,INSD:ES100751.1,
FT                   INSD:EH836131.1,INSD:EL152257.1,INSD:EH936952.1,
FT                   INSD:DR247146.1,INSD:EH920985.1,INSD:DR247305.1,
FT                   INSD:EL316509.1,INSD:EL116417.1,INSD:EL052927.1,
FT                   INSD:DR247166.1,INSD:DR247207.1,INSD:N37205.1,
FT                   INSD:DR247061.1,INSD:ES176389.1,INSD:ES125378.1,
FT                   INSD:DR247066.1,INSD:ES051454.1,INSD:ES098749.1,
FT                   INSD:EL302427.1,INSD:EH815248.1,INSD:DR247221.1,
FT                   INSD:ES144100.1,INSD:EL074095.1,INSD:BP661427.1,
FT                   INSD:DR247109.1,INSD:EH956252.1,INSD:EL270425.1,
FT                   INSD:EL335557.1,INSD:EH968985.1,INSD:ES013047.1,
FT                   INSD:EG506160.1,INSD:EL979838.1,INSD:R84071.1,
FT                   INSD:AV789717.1,INSD:AV567180.1,INSD:EL980445.1,
FT                   INSD:DR247151.1,INSD:EL295575.1,INSD:EH958408.1,
FT                   INSD:DR381318.1,INSD:DR247307.1,INSD:EL069438.1,
FT                   INSD:ES012100.1,INSD:ES186483.1,INSD:DR247278.1,
FT                   INSD:EL160527.1,INSD:DR247137.1,INSD:DR247154.1,
FT                   INSD:ES110468.1,INSD:EH857688.1,INSD:AI993618.1,
FT                   INSD:ES014653.1,INSD:ES039759.1,INSD:BP650820.1,
FT                   INSD:AV800590.1,INSD:EL119803.1,INSD:EL228551.1,
FT                   INSD:EL323361.1,INSD:BP643011.1,INSD:DR247266.1,
FT                   INSD:EL152142.1,INSD:EH837632.1,INSD:ES150704.1,
FT                   INSD:EL091750.1,INSD:EH980667.1,INSD:DR247083.1,
FT                   INSD:DR247276.1,INSD:ES089396.1,INSD:EL997610.1,
FT                   INSD:DR247104.1,INSD:EL981741.1,INSD:AV567462.1,
FT                   INSD:EL221806.1,INSD:CO048559.1,INSD:ES138665.1,
FT                   INSD:EH955939.1,INSD:DR247243.1,INSD:DR247267.1,
FT                   INSD:DR247264.1,INSD:EH845828.1,INSD:AV804359.1,
FT                   INSD:DR354975.1,INSD:AV519133.1,INSD:EL203912.1,
FT                   INSD:EH802797.1,INSD:EL238313.1,INSD:DR247080.1,
FT                   INSD:EL320507.1,INSD:DR247262.1,INSD:ES089750.1,
FT                   INSD:BP855206.1,INSD:DR354979.1,INSD:EG492680.1,
FT                   INSD:DR247076.1,INSD:DR247174.1,INSD:EL212507.1,
FT                   INSD:EL210743.1,INSD:EH883430.1,INSD:DR247270.1,
FT                   INSD:ES182705.1,INSD:EL221598.1,INSD:EL986830.1,
FT                   INSD:DR247081.1,INSD:EL332244.1,INSD:ES016126.1,
FT                   INSD:DR247234.1,INSD:AV793269.1,INSD:EL062496.1,
FT                   INSD:DR247120.1,INSD:EL037201.1,INSD:DR247306.1,
FT                   INSD:EH812004.1,INSD:DR358814.1,INSD:EL976247.1,
FT                   INSD:EL104218.1,INSD:DR247099.1,INSD:DR247129.1,
FT                   INSD:BP592671.1,INSD:EH822596.1,INSD:DR247208.1,
FT                   INSD:ES061646.1,INSD:EH855470.1,INSD:AV552809.1,
FT                   INSD:DR247078.1,INSD:EL302245.1,INSD:EL337294.1,
FT                   INSD:EH981680.1,INSD:T75794.1,INSD:EL281188.1,
FT                   INSD:DR247176.1,INSD:AV558770.1,INSD:CF774367.1,
FT                   INSD:EH847850.1,INSD:EL073297.1,INSD:DR247279.1,
FT                   INSD:DR247256.1,INSD:BP814073.1,INSD:DR247064.1,
FT                   INSD:EH929944.1,INSD:BP646428.1,INSD:EL123815.1,
FT                   INSD:BP632407.1,INSD:ES205957.1,INSD:AV810231.1,
FT                   INSD:ES201488.1,INSD:BP828672.2,INSD:DR247090.1,
FT                   INSD:BP594305.1,INSD:AV541679.1,INSD:EH852996.1,
FT                   INSD:AJ609311.1,INSD:BP660735.1,INSD:ES046039.1,
FT                   INSD:EH967129.1,INSD:EL250123.1,INSD:EL100343.1,
FT                   INSD:EH904326.1,INSD:EL207957.1,INSD:DR247162.1,
FT                   INSD:EH848350.1,INSD:DR247245.1,INSD:ES030708.1,
FT                   INSD:DR247191.1,INSD:EL069625.1,INSD:EL989362.1,
FT                   INSD:DR247211.1,INSD:DR354976.1,INSD:EH928686.1,
FT                   INSD:ES062900.1,INSD:BP614643.1,INSD:EL290774.1,
FT                   INSD:DR247055.1,INSD:EL140076.1,INSD:DR247171.1,
FT                   INSD:BP650632.1,INSD:EL306002.1,INSD:DR247273.1,
FT                   INSD:EH951449.1,INSD:ES162715.1,INSD:EL010067.1,
FT                   INSD:DR247157.1,INSD:DR247190.1,INSD:ES047952.1,
FT                   INSD:EH811940.1,INSD:EH976017.1,INSD:DR247145.1,
FT                   INSD:EL309240.1,INSD:DR247057.1,INSD:EL041000.1,
FT                   INSD:AV550479.1,INSD:DR247072.1,INSD:ES077938.1,
FT                   INSD:EL115268.1,INSD:BP819623.1,INSD:DR247126.1,
FT                   INSD:DR247150.1,INSD:DR247240.1,INSD:BP638356.1,
FT                   INSD:EL042052.1,INSD:DR247237.1,INSD:EL253026.1,
FT                   INSD:DR247302.1,INSD:DR247141.1,INSD:EH963084.1,
FT                   INSD:BE528754.1,INSD:DR247265.1,INSD:ES059735.1,
FT                   INSD:BP584368.1,INSD:ES202671.1,INSD:EL249012.1,
FT                   INSD:EL178826.1,INSD:DR247108.1,INSD:BE039043.1,
FT                   INSD:ES211851.1,INSD:EH804445.1,INSD:ES017521.1,
FT                   INSD:DR247122.1,INSD:DR247156.1,INSD:DR383070.1,
FT                   INSD:EL034920.1,INSD:CB259029.1,INSD:DR247215.1,
FT                   INSD:BX840069.1,INSD:BP788530.1,INSD:BP642866.1,
FT                   INSD:EL009648.1,INSD:EL099733.1,INSD:DR247260.1,
FT                   INSD:EL101413.1,INSD:EL254723.1,INSD:ES188616.1,
FT                   INSD:DR247232.1,INSD:BP562488.2,INSD:EH834868.1,
FT                   INSD:EL023876.1,INSD:EH919462.1,INSD:EH898373.1,
FT                   INSD:EL313951.1,INSD:ES134107.1,INSD:DR247263.1,
FT                   INSD:DR247259.1,INSD:EL211145.1,INSD:EL223281.1,
FT                   INSD:DR247128.1,INSD:AV560950.1,INSD:BP588056.1,
FT                   INSD:DR247127.1,INSD:EL032798.1,INSD:EH826964.1,
FT                   INSD:DR247113.1,INSD:EL139697.1,INSD:EH934896.1,
FT                   INSD:EH956072.1,INSD:BP853121.1,INSD:EL191306.1,
FT                   INSD:CF652102.1,INSD:ES069251.1,INSD:DR247300.1,
FT                   INSD:DR247093.1,INSD:T43789.1,INSD:DR247286.1,
FT                   INSD:EL223413.1,INSD:EL141946.1,INSD:DR247071.1,
FT                   INSD:EH819539.1,INSD:DR247272.1,INSD:EL294795.1,
FT                   INSD:DR358817.1,INSD:DR247147.1,INSD:ES177731.1,
FT                   INSD:DR247183.1,INSD:DR247170.1,INSD:EL273429.1,
FT                   INSD:ES126308.1,INSD:AV560623.1,INSD:ES186121.1,
FT                   INSD:ES084660.1,INSD:AV806677.1,INSD:AV539357.1,
FT                   INSD:EL314028.1,INSD:EL339130.1,INSD:DR247275.1,
FT                   INSD:BP590482.1,INSD:EL080020.1,INSD:AV540978.1,
FT                   INSD:DR247114.1,INSD:EL101304.1,INSD:EH993055.1,
FT                   INSD:DR247304.1,INSD:DR247199.1,INSD:EH921732.1,
FT                   INSD:DR247251.1,INSD:BU635559.1,INSD:DR247216.1,
FT                   INSD:CF774283.1,INSD:BP627730.1,INSD:CK119580.1,
FT                   INSD:ES090315.1,INSD:DR247244.1,INSD:ES131646.1,
FT                   INSD:EL307807.1,INSD:EL207571.1,INSD:DR247105.1,
FT                   INSD:DR358824.1,INSD:EL230730.1,INSD:EL335413.1,
FT                   INSD:DR247096.1,INSD:BP575426.1,INSD:ES151068.1,
FT                   INSD:EH897483.1,INSD:ES127688.1,INSD:DR247252.1,
FT                   INSD:EL320727.1,INSD:DR247210.1,INSD:ES188615.1,
FT                   INSD:DR354981.1,INSD:DR358821.1,INSD:EH976696.1,
FT                   INSD:DR247233.1,INSD:DR247069.1,INSD:EH906828.1,
FT                   INSD:DR247089.1,INSD:AV784901.1,INSD:EL215195.1,
FT                   INSD:EL029761.1,INSD:DR247196.1,INSD:DR247095.1,
FT                   INSD:EL045212.1,INSD:ES133317.1,INSD:DR247087.1,
FT                   INSD:EL215492.1,INSD:EL229370.1,INSD:ES163304.1,
FT                   INSD:EH855865.1,INSD:DR247194.1,INSD:DR354977.1,
FT                   INSD:DR247140.1,INSD:DR247168.1,INSD:EL106892.1,
FT                   INSD:DR247074.1,INSD:EL106770.1,INSD:EL277498.1,
FT                   INSD:AV441231.1,INSD:DR247088.1,INSD:DR247226.1,
FT                   INSD:DR247068.1,INSD:EL146883.1,INSD:AV806035.1,
FT                   INSD:DR247065.1,INSD:ES105560.1,INSD:EL129553.1,
FT                   INSD:ES201599.1,INSD:EL330130.1,INSD:DR247136.1,
FT                   INSD:EH804203.1,INSD:EL090918.1,INSD:EL229599.1,
FT                   INSD:DR247121.1,INSD:AV556163.1,INSD:DR247284.1,
FT                   INSD:BP657061.1,INSD:DR247242.1,INSD:BP862717.1,
FT                   INSD:EH875978.1,INSD:EL005042.1,INSD:DR247163.1,
FT                   INSD:DR247169.1,INSD:DR247097.1,INSD:DR358818.1,
FT                   INSD:EH808926.1,INSD:ES094907.1,INSD:EL335888.1,
FT                   INSD:AV784518.1,INSD:EH890517.1,INSD:AV559687.1,
FT                   INSD:DR247192.1,INSD:EL254223.1,INSD:ES176795.1,
FT                   INSD:EH857664.1,INSD:DR247291.1,INSD:DR247086.1,
FT                   INSD:AV551952.1,INSD:DR247224.1,INSD:EH889522.1,
FT                   INSD:EL073014.1,INSD:DR247212.1,INSD:ES215122.1,
FT                   INSD:ES198467.1,INSD:AV820606.1,INSD:EL238991.1,
FT                   INSD:CF773493.1,INSD:EL283457.1,INSD:EL059381.1,
FT                   INSD:BP830016.1,INSD:DR247287.1,INSD:DR247261.1,
FT                   INSD:DR247148.1,INSD:DR247308.1,INSD:EL196403.1,
FT                   INSD:EH801496.1,INSD:AI099997.1,INSD:EL226194.1,
FT                   INSD:DR247303.1,INSD:EH880700.1,INSD:DR247297.1,
FT                   INSD:ES025947.1,INSD:DR358819.1,INSD:EG506780.1,
FT                   INSD:BP656322.1,INSD:DR247220.1,INSD:DR247180.1,
FT                   INSD:BP629738.1,INSD:DR247225.1,INSD:EL288137.1,
FT                   INSD:EL152121.1,INSD:ES104892.1,INSD:EH857860.1,
FT                   INSD:EG506157.1,INSD:CK119833.1,INSD:EL078021.1,
FT                   INSD:DR247236.1,INSD:EL327787.1,INSD:ES115949.1,
FT                   INSD:ES179899.1,INSD:EL280448.1,INSD:BP586036.1,
FT                   INSD:EH795466.1,INSD:EL324581.1,INSD:EL326382.1,
FT                   INSD:EH941926.1,INSD:DR247173.1,INSD:DR354980.1,
FT                   INSD:EL188246.1,INSD:EL076688.1,INSD:DR247295.1,
FT                   INSD:AV557323.1,INSD:DR247091.1,INSD:DR247231.1,
FT                   INSD:AV518347.1,INSD:ES105348.1,INSD:BP827850.1,
FT                   INSD:BP654481.1,INSD:BP845290.1,INSD:DR358810.1,
FT                   INSD:EL207077.1,INSD:DR247197.1,INSD:EL296033.1,
FT                   INSD:EL256742.1,INSD:DR358815.1,INSD:EL211198.1,
FT                   INSD:ES020354.1,INSD:EL176145.1,INSD:EG481336.1,
FT                   INSD:EH993906.1,INSD:DR358823.1,INSD:BP781035.1,
FT                   INSD:DR247280.1,INSD:EH802445.1,INSD:AV531014.1,
FT                   INSD:EH867825.1,INSD:DR247238.1,INSD:DR247067.1,
FT                   INSD:AV526595.1,INSD:EH930082.1,INSD:DR247172.1,
FT                   INSD:EH969324.1,INSD:DR247079.1,INSD:EL286783.1,
FT                   INSD:EH919103.1,INSD:EH987853.1,INSD:DR247288.1,
FT                   INSD:EH975317.1,INSD:ES122321.1,INSD:EL120615.1,
FT                   INSD:EL996101.1,INSD:AV823836.1,INSD:EL236918.1,
FT                   INSD:DR247218.1,INSD:DR247112.1,INSD:DR247175.1,
FT                   INSD:EG492679.1,INSD:CA782002.1,INSD:DR247206.1,
FT                   INSD:ES045621.1,INSD:AV550197.1,INSD:EH810928.1,
FT                   INSD:EL275688.1,INSD:EL038284.1,INSD:ES121416.1,
FT                   INSD:ES092555.1,INSD:BP853235.1,INSD:DR247070.1,
FT                   INSD:DR247158.1,INSD:EL198416.1,INSD:EH848415.1,
FT                   INSD:DR247193.1,INSD:EL131256.1,INSD:DR247160.1,
FT                   INSD:DR247134.1,INSD:DR247155.1,INSD:DR247200.1,
FT                   INSD:EL117636.1,INSD:EL970249.1,INSD:EL002561.1,
FT                   INSD:DR247186.1,INSD:EH974733.1,INSD:EH982669.1,
FT                   INSD:DR247203.1,INSD:EL194417.1,INSD:ES116202.1,
FT                   INSD:DR247213.1,INSD:DR247063.1,INSD:EH978783.1,
FT                   INSD:DR247254.1,INSD:EL273877.1,INSD:T41850.1,
FT                   INSD:EL089267.1,INSD:DR354978.1,INSD:EG481332.1,
FT                   INSD:DR247125.1,INSD:DR247177.1,INSD:AV564838.1,
FT                   INSD:EG476827.1,INSD:ES138620.1,INSD:EH959971.1,
FT                   INSD:EL093572.1,INSD:EG439449.1,INSD:EL110173.1,
FT                   INSD:EL061438.1,INSD:EL243186.1,INSD:EL214344.1,
FT                   INSD:EL108560.1,INSD:EH853413.1,INSD:DR247182.1,
FT                   INSD:DR247269.1,INSD:DR247124.1,INSD:ES151083.1,
FT                   INSD:EH908130.1,INSD:T43049.1,INSD:DR247189.1,
FT                   INSD:BP562606.1,INSD:DR358822.1,INSD:DR247060.1,
FT                   INSD:EL068097.1,INSD:EL036233.1,INSD:EH987111.1,
FT                   INSD:DR247092.1,INSD:BP621044.1,INSD:DR247209.1,
FT                   INSD:DR358812.1,INSD:DR247077.1,INSD:EL202238.1,
FT                   INSD:EH903973.1,INSD:DR358825.1,INSD:CB185607.1,
FT                   INSD:DR247056.1,INSD:EL318672.1,INSD:DR247290.1,
FT                   INSD:DR247247.1,INSD:DR247106.1,INSD:DR358820.1,
FT                   INSD:EH797739.1,INSD:ES033411.1,INSD:EL126423.1,
FT                   INSD:DR378148.1,INSD:EL240791.1,INSD:EH859726.1,
FT                   INSD:EL185957.1,INSD:EH917601.1,INSD:AV557226.1,
FT                   INSD:ES012488.1,INSD:BP567064.1,INSD:EG486414.1,
FT                   INSD:ES080142.1,INSD:DR247205.1,INSD:EL210092.1,
FT                   INSD:EL041909.1,INSD:BP622949.1,INSD:EL296474.1,
FT                   INSD:DR247085.1,INSD:DR247293.1,INSD:DR247248.1,
FT                   INSD:EH947602.1,INSD:BP864526.1,INSD:EL078538.1,
FT                   INSD:ES214898.1,INSD:EH808943.1,INSD:EL191027.1,
FT                   INSD:DR247222.1,INSD:EL277103.1,INSD:H36862.1,
FT                   INSD:EL088768.1,INSD:EL287680.1,INSD:EL239840.1,
FT                   INSD:DR247135.1,INSD:DR247098.1,INSD:EL028114.1,
FT                   INSD:EL207862.1,INSD:AV530330.1,INSD:EL334993.1,
FT                   INSD:DR247246.1,INSD:DR247123.1,INSD:EL165351.1,
FT                   INSD:DR247296.1,INSD:DR247116.1,INSD:ES039642.1,
FT                   INSD:BP821466.1,INSD:ES113638.1,INSD:EL083742.1,
FT                   INSD:DR247202.1,INSD:DR247058.1,INSD:ES158880.1,
FT                   INSD:EL300908.1,INSD:DR247103.1,INSD:EL274413.1,
FT                   INSD:EH888137.1,INSD:EG500319.1,INSD:EH837490.1,
FT                   INSD:DR247282.1,INSD:AV810215.1,INSD:BP828729.1,
FT                   INSD:AV442107.1,INSD:DR247228.1,INSD:AA721872.1,
FT                   INSD:DR358811.1,INSD:EG486415.1,INSD:EL228719.1,
FT                   INSD:EL329863.1,INSD:EL001909.1,INSD:AV563055.1,
FT                   INSD:BP561031.2,INSD:BP659181.1,INSD:EL219395.1,
FT                   INSD:EL155385.1,INSD:BP825904.1,INSD:BP823642.1,
FT                   INSD:ES053280.1,INSD:EL014651.1,INSD:EL238314.1,
FT                   INSD:EL236672.1,INSD:EH873291.1,INSD:DR247131.1,
FT                   INSD:EL230264.1,INSD:ES101352.1,INSD:DR247230.1,
FT                   INSD:DR247257.1,INSD:DR247062.1,INSD:EL079929.1,
FT                   INSD:DR247115.1,INSD:AV550722.1,INSD:DR247285.1,
FT                   INSD:EL982148.1,INSD:BP637325.1,INSD:ES129323.1,
FT                   INSD:EH867088.1,INSD:DR247075.1,INSD:DR247294.1,
FT                   INSD:EL284939.1,INSD:CO048575.1,INSD:AV551779.1,
FT                   INSD:AV793906.1,INSD:DR247133.1,INSD:DR247165.1,
FT                   INSD:EL988883.1,INSD:EH797212.1,INSD:DR247179.1,
FT                   INSD:DR358816.1,INSD:AV562006.1,INSD:EH948813.1,
FT                   INSD:DR247100.1,INSD:BP601016.1,INSD:ES181240.1,
FT                   INSD:DR247167.1,INSD:EL319161.1,INSD:BP627344.1,
FT                   INSD:EL997000.1,INSD:BP827833.1,INSD:EL029898.1,
FT                   INSD:DR247178.1,INSD:AV560818.1,INSD:DR247187.1,
FT                   INSD:EL173309.1,INSD:EG476828.1,INSD:ES104273.1,
FT                   INSD:BP828952.1,INSD:EL023437.1,INSD:EG439445.1,
FT                   INSD:EL976525.1,INSD:ES196076.1,INSD:DR247253.1,
FT                   INSD:EL289765.1,INSD:DR247094.1,INSD:AV812529.1,
FT                   INSD:ES046060.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY120785.1,INSD:AY099825.1,INSD:BT000330.1,
FT                   INSD:D85192.1,INSD:BT006313.1,INSD:D26609.1,
FT                   INSD:BX829233.1"
FT   mRNA            complement(join(185853..186238,186333..186897,
FT                   187201..187627))
FT                   /gene="PIP1;4"
FT                   /gene_synonym="A_IG005I10.2"
FT                   /gene_synonym="A_IG005I10_2"
FT                   /gene_synonym="F5I10.2"
FT                   /gene_synonym="F5I10_2"
FT                   /gene_synonym="PIP1E"
FT                   /gene_synonym="plasma membrane intrinsic protein 1;4"
FT                   /gene_synonym="PLASMA MEMBRANE INTRINSIC PROTEIN 1E"
FT                   /gene_synonym="TMP-C"
FT                   /gene_synonym="TRANSMEMBRANE PROTEIN C"
FT                   /locus_tag="AT4G00430"
FT                   /product="plasma membrane intrinsic protein 1;4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR247184.1,INSD:EL976125.1,INSD:EL170687.1,
FT                   INSD:DR247227.1,INSD:EH890324.1,INSD:CB264486.1,
FT                   INSD:DR247117.1,INSD:EL296969.1,INSD:EL082052.1,
FT                   INSD:EL141963.1,INSD:ES075552.1,INSD:DR247181.1,
FT                   INSD:DR247204.1,INSD:EL156540.1,INSD:EH797149.1,
FT                   INSD:DR247249.1,INSD:DR247082.1,INSD:EL174351.1,
FT                   INSD:DR247164.1,INSD:EL143871.1,INSD:BP591542.1,
FT                   INSD:BP646645.1,INSD:EL073685.1,INSD:DR247139.1,
FT                   INSD:Z18386.1,INSD:DR247059.1,INSD:EL997504.1,
FT                   INSD:DR247198.1,INSD:DR247283.1,INSD:DR247219.1,
FT                   INSD:EH933454.1,INSD:EH863746.1,INSD:ES037929.1,
FT                   INSD:DR247201.1,INSD:T13717.1,INSD:EH973904.1,
FT                   INSD:EL317938.1,INSD:EL017949.1,INSD:DR247111.1,
FT                   INSD:DR247130.1,INSD:EH874901.1,INSD:DR247309.1,
FT                   INSD:ES013685.1,INSD:DR247239.1,INSD:EL075579.1,
FT                   INSD:EL981115.1,INSD:EH908623.1,INSD:DR247268.1,
FT                   INSD:DR358813.1,INSD:CB074464.1,INSD:EL327642.1,
FT                   INSD:EL021238.1,INSD:EL981956.1,INSD:EH846905.1,
FT                   INSD:EL246337.1,INSD:EL190081.1,INSD:DR247271.1,
FT                   INSD:DR247152.1,INSD:DR247255.1,INSD:ES058724.1,
FT                   INSD:AV794446.1,INSD:EH943371.1,INSD:EG500318.1,
FT                   INSD:AV556533.1,INSD:DR247214.1,INSD:EL992620.1,
FT                   INSD:EL309548.1,INSD:DR247138.1,INSD:EL140523.1,
FT                   INSD:DR247101.1,INSD:DR297675.1,INSD:DR247185.1,
FT                   INSD:DR247229.1,INSD:DR247223.1,INSD:DR247084.1,
FT                   INSD:ES178975.1,INSD:EL132170.1,INSD:ES058582.1,
FT                   INSD:DR247292.1,INSD:EL238741.1,INSD:EL046013.1,
FT                   INSD:DR247149.1,INSD:EL088852.1,INSD:DR247153.1,
FT                   INSD:BP660077.1,INSD:ES058426.1,INSD:EL082906.1,
FT                   INSD:DR247241.1,INSD:EL088720.1,INSD:ES012047.1,
FT                   INSD:EL205146.1,INSD:ES062671.1,INSD:EL317817.1,
FT                   INSD:DR247143.1,INSD:DR247258.1,INSD:DR247235.1,
FT                   INSD:EH922167.1,INSD:DR247119.1,INSD:DR247102.1,
FT                   INSD:DR247073.1,INSD:EL324780.1,INSD:ES181388.1,
FT                   INSD:DR247159.1,INSD:EL316659.1,INSD:DR247107.1,
FT                   INSD:AV525115.1,INSD:EL038957.1,INSD:DR247301.1,
FT                   INSD:BP607825.1,INSD:EL272122.1,INSD:DR247250.1,
FT                   INSD:BP576357.1,INSD:BP862249.1,INSD:EL133899.1,
FT                   INSD:DR247299.1,INSD:EL019237.1,INSD:EL202887.1,
FT                   INSD:EG506781.1,INSD:DR247281.1,INSD:ES173537.1,
FT                   INSD:ES003351.1,INSD:DR247277.1,INSD:EH923943.1,
FT                   INSD:EH817725.1,INSD:DR247142.1,INSD:DR247195.1,
FT                   INSD:DR247289.1,INSD:ES100751.1,INSD:EH836131.1,
FT                   INSD:EL152257.1,INSD:EH936952.1,INSD:DR247146.1,
FT                   INSD:EH920985.1,INSD:DR247305.1,INSD:EL316509.1,
FT                   INSD:DR247166.1,INSD:DR247207.1,INSD:N37205.1,
FT                   INSD:DR247061.1,INSD:ES125378.1,INSD:ES051454.1,
FT                   INSD:DR247066.1,INSD:ES098749.1,INSD:EL302427.1,
FT                   INSD:EH815248.1,INSD:DR247221.1,INSD:ES144100.1,
FT                   INSD:EL074095.1,INSD:BP661427.1,INSD:DR247109.1,
FT                   INSD:EH956252.1,INSD:EL270425.1,INSD:EL335557.1,
FT                   INSD:EH968985.1,INSD:ES013047.1,INSD:EG506160.1,
FT                   INSD:EL979838.1,INSD:R84071.1,INSD:AV789717.1,
FT                   INSD:BP601295.1,INSD:EL980445.1,INSD:DR247151.1,
FT                   INSD:EL295575.1,INSD:EH958408.1,INSD:DR247307.1,
FT                   INSD:EL069438.1,INSD:ES012100.1,INSD:ES186483.1,
FT                   INSD:DR247278.1,INSD:EL160527.1,INSD:DR247137.1,
FT                   INSD:DR247154.1,INSD:ES110468.1,INSD:EH857688.1,
FT                   INSD:AI993618.1,INSD:ES014653.1,INSD:ES039759.1,
FT                   INSD:BP650820.1,INSD:EL009863.1,INSD:AV800590.1,
FT                   INSD:EL119803.1,INSD:EL228551.1,INSD:EL323361.1,
FT                   INSD:BP643011.1,INSD:DR247266.1,INSD:EL152142.1,
FT                   INSD:EH837632.1,INSD:ES150704.1,INSD:EL091750.1,
FT                   INSD:EH980667.1,INSD:DR247083.1,INSD:DR247276.1,
FT                   INSD:ES089396.1,INSD:EL997610.1,INSD:DR247104.1,
FT                   INSD:EL981741.1,INSD:EL221806.1,INSD:ES138665.1,
FT                   INSD:EH955939.1,INSD:DR247243.1,INSD:DR247267.1,
FT                   INSD:BP788757.1,INSD:DR247264.1,INSD:EH845828.1,
FT                   INSD:AV804359.1,INSD:DR354975.1,INSD:AV519133.1,
FT                   INSD:EL203912.1,INSD:EH802797.1,INSD:EL238313.1,
FT                   INSD:DR247080.1,INSD:EL320507.1,INSD:DR247262.1,
FT                   INSD:ES089750.1,INSD:BP855206.1,INSD:DR354979.1,
FT                   INSD:EG492680.1,INSD:DR247076.1,INSD:DR247174.1,
FT                   INSD:EL212507.1,INSD:EL210743.1,INSD:EH883430.1,
FT                   INSD:DR247270.1,INSD:ES182705.1,INSD:EL221598.1,
FT                   INSD:EL986830.1,INSD:DR247081.1,INSD:EL332244.1,
FT                   INSD:ES016126.1,INSD:DR247234.1,INSD:EL062496.1,
FT                   INSD:DR247120.1,INSD:EL037201.1,INSD:DR247306.1,
FT                   INSD:EL976247.1,INSD:DR358814.1,INSD:EL104218.1,
FT                   INSD:DR247099.1,INSD:DR247129.1,INSD:DR247208.1,
FT                   INSD:ES061646.1,INSD:EH855470.1,INSD:DR247078.1,
FT                   INSD:AV552809.1,INSD:EL302245.1,INSD:EL337294.1,
FT                   INSD:EH981680.1,INSD:T75794.1,INSD:EL281188.1,
FT                   INSD:DR247176.1,INSD:EL157283.1,INSD:CF774367.1,
FT                   INSD:EH847850.1,INSD:EL073297.1,INSD:DR247279.1,
FT                   INSD:DR247256.1,INSD:BP814073.1,INSD:EH929944.1,
FT                   INSD:DR247064.1,INSD:BP646428.1,INSD:EL123815.1,
FT                   INSD:BP632407.1,INSD:ES205957.1,INSD:AV810231.1,
FT                   INSD:ES201488.1,INSD:BP828672.2,INSD:DR247090.1,
FT                   INSD:AV541679.1,INSD:EH852996.1,INSD:AJ609311.1,
FT                   INSD:BP660735.1,INSD:ES046039.1,INSD:EH967129.1,
FT                   INSD:EL250123.1,INSD:EL100343.1,INSD:EH904326.1,
FT                   INSD:EL207957.1,INSD:DR247162.1,INSD:ES067524.1,
FT                   INSD:EH848350.1,INSD:DR247245.1,INSD:ES030708.1,
FT                   INSD:DR247191.1,INSD:EL069625.1,INSD:EL989362.1,
FT                   INSD:DR247211.1,INSD:EH928686.1,INSD:DR354976.1,
FT                   INSD:ES062900.1,INSD:BP614643.1,INSD:EL290774.1,
FT                   INSD:DR247055.1,INSD:EL140076.1,INSD:DR247171.1,
FT                   INSD:BP650632.1,INSD:EL306002.1,INSD:DR247273.1,
FT                   INSD:EH951449.1,INSD:ES162715.1,INSD:EL010067.1,
FT                   INSD:DR247157.1,INSD:DR247190.1,INSD:ES047952.1,
FT                   INSD:EH811940.1,INSD:EH976017.1,INSD:AV818238.1,
FT                   INSD:DR247145.1,INSD:EL309240.1,INSD:DR247057.1,
FT                   INSD:EL041000.1,INSD:AV550479.1,INSD:DR247072.1,
FT                   INSD:ES077938.1,INSD:EL115268.1,INSD:BP819623.1,
FT                   INSD:DR247126.1,INSD:DR247150.1,INSD:DR247240.1,
FT                   INSD:BP638356.1,INSD:DR247237.1,INSD:EL253026.1,
FT                   INSD:DR247302.1,INSD:DR247141.1,INSD:EH963084.1,
FT                   INSD:BE528754.1,INSD:DR247265.1,INSD:ES059735.1,
FT                   INSD:BP584368.1,INSD:ES202671.1,INSD:EL249012.1,
FT                   INSD:EL178826.1,INSD:DR247108.1,INSD:ES211851.1,
FT                   INSD:EH804445.1,INSD:ES017521.1,INSD:DR247122.1,
FT                   INSD:DR247156.1,INSD:EL034920.1,INSD:DR247215.1,
FT                   INSD:BP788530.1,INSD:EL009648.1,INSD:EL099733.1,
FT                   INSD:DR247260.1,INSD:EL101413.1,INSD:EL254723.1,
FT                   INSD:DR247232.1,INSD:BP562488.2,INSD:EH834868.1,
FT                   INSD:EL023876.1,INSD:EH919462.1,INSD:EH898373.1,
FT                   INSD:EL313951.1,INSD:ES134107.1,INSD:DR247263.1,
FT                   INSD:DR247259.1,INSD:EL211145.1,INSD:EL223281.1,
FT                   INSD:DR247128.1,INSD:BP588056.1,INSD:EG456157.1,
FT                   INSD:DR247127.1,INSD:EL032798.1,INSD:EH826964.1,
FT                   INSD:DR247113.1,INSD:EL139697.1,INSD:EH934896.1,
FT                   INSD:EH956072.1,INSD:ES148031.1,INSD:BP853121.1,
FT                   INSD:EL191306.1,INSD:DR247093.1,INSD:T43789.1,
FT                   INSD:DR247286.1,INSD:EL223413.1,INSD:EL141946.1,
FT                   INSD:DR247071.1,INSD:EH819539.1,INSD:DR247272.1,
FT                   INSD:EL294795.1,INSD:DR358817.1,INSD:DR247147.1,
FT                   INSD:ES177731.1,INSD:DR247183.1,INSD:DR247170.1,
FT                   INSD:EL273429.1,INSD:ES126308.1,INSD:AV560623.1,
FT                   INSD:ES186121.1,INSD:ES084660.1,INSD:EL314028.1,
FT                   INSD:EL339130.1,INSD:DR247275.1,INSD:EL080020.1,
FT                   INSD:DR247114.1,INSD:EL101304.1,INSD:EH993055.1,
FT                   INSD:DR247304.1,INSD:DR247199.1,INSD:DR247251.1,
FT                   INSD:DR247216.1,INSD:BP627730.1,INSD:CK119580.1,
FT                   INSD:ES090315.1,INSD:DR247244.1,INSD:ES131646.1,
FT                   INSD:EL307807.1,INSD:EL207571.1,INSD:DR247105.1,
FT                   INSD:DR358824.1,INSD:EL230730.1,INSD:DR247096.1,
FT                   INSD:BP575426.1,INSD:ES151068.1,INSD:EL006122.1,
FT                   INSD:ES127688.1,INSD:DR247252.1,INSD:EL320727.1,
FT                   INSD:DR247210.1,INSD:ES188615.1,INSD:DR354981.1,
FT                   INSD:EH976696.1,INSD:DR247233.1,INSD:DR358821.1,
FT                   INSD:DR247069.1,INSD:EH906828.1,INSD:DR247089.1,
FT                   INSD:N96552.1,INSD:EL215195.1,INSD:DR247196.1,
FT                   INSD:DR247095.1,INSD:EL045212.1,INSD:ES133317.1,
FT                   INSD:ES163389.1,INSD:DR247087.1,INSD:AV789014.1,
FT                   INSD:EL215492.1,INSD:ES163304.1,INSD:EL229370.1,
FT                   INSD:EH855865.1,INSD:DR247194.1,INSD:DR247140.1,
FT                   INSD:DR354977.1,INSD:DR247168.1,INSD:EL106892.1,
FT                   INSD:EL106770.1,INSD:DR247074.1,INSD:EL277498.1,
FT                   INSD:DR247226.1,INSD:DR247088.1,INSD:EL146883.1,
FT                   INSD:AV806035.1,INSD:DR247068.1,INSD:ES105560.1,
FT                   INSD:DR247065.1,INSD:EL129553.1,INSD:ES201599.1,
FT                   INSD:EL330130.1,INSD:DR247136.1,INSD:EH804203.1,
FT                   INSD:EL090918.1,INSD:EL229599.1,INSD:DR247121.1,
FT                   INSD:AV556163.1,INSD:DR247284.1,INSD:BP657061.1,
FT                   INSD:DR247242.1,INSD:BP862717.1,INSD:EH875978.1,
FT                   INSD:EL005042.1,INSD:DR247163.1,INSD:DR247169.1,
FT                   INSD:DR247097.1,INSD:EH808926.1,INSD:DR358818.1,
FT                   INSD:ES094907.1,INSD:EL335888.1,INSD:EH890517.1,
FT                   INSD:AV559687.1,INSD:DR247192.1,INSD:EL254223.1,
FT                   INSD:ES176795.1,INSD:EH857664.1,INSD:DR247291.1,
FT                   INSD:DR247086.1,INSD:DR247224.1,INSD:EH889522.1,
FT                   INSD:EL073014.1,INSD:DR247212.1,INSD:ES215122.1,
FT                   INSD:ES198467.1,INSD:AV820606.1,INSD:EL238991.1,
FT                   INSD:CF773493.1,INSD:EL283457.1,INSD:EL059381.1,
FT                   INSD:BP830016.1,INSD:DR247287.1,INSD:DR247261.1,
FT                   INSD:DR247148.1,INSD:DR247308.1,INSD:EL196403.1,
FT                   INSD:EL043392.1,INSD:EL026787.1,INSD:AI099997.1,
FT                   INSD:EL226194.1,INSD:DR247303.1,INSD:EH880700.1,
FT                   INSD:DR247297.1,INSD:ES025947.1,INSD:EG506780.1,
FT                   INSD:DR358819.1,INSD:DR247220.1,INSD:DR247180.1,
FT                   INSD:BP629738.1,INSD:DR247225.1,INSD:EL288137.1,
FT                   INSD:EL152121.1,INSD:ES104892.1,INSD:EH857860.1,
FT                   INSD:EG506157.1,INSD:EL078021.1,INSD:DR247236.1,
FT                   INSD:EL327787.1,INSD:ES115949.1,INSD:ES179899.1,
FT                   INSD:EL280448.1,INSD:BP586036.1,INSD:EH795466.1,
FT                   INSD:EL324581.1,INSD:EL326382.1,INSD:EH941926.1,
FT                   INSD:DR247173.1,INSD:DR354980.1,INSD:EL188246.1,
FT                   INSD:EL076688.1,INSD:DR247295.1,INSD:DR247091.1,
FT                   INSD:DR247231.1,INSD:ES105348.1,INSD:BP827850.1,
FT                   INSD:BP654481.1,INSD:BP845290.1,INSD:DR358810.1,
FT                   INSD:EL207077.1,INSD:DR247197.1,INSD:EL296033.1,
FT                   INSD:EL256742.1,INSD:DR358815.1,INSD:EL211198.1,
FT                   INSD:ES020354.1,INSD:EH993906.1,INSD:EG481336.1,
FT                   INSD:DR358823.1,INSD:BP781035.1,INSD:DR247280.1,
FT                   INSD:EH802445.1,INSD:DR247238.1,INSD:DR247067.1,
FT                   INSD:EH930082.1,INSD:DR247172.1,INSD:AV526595.1,
FT                   INSD:EH969324.1,INSD:DR247079.1,INSD:EL286783.1,
FT                   INSD:EH987853.1,INSD:EH919103.1,INSD:DR247288.1,
FT                   INSD:EH975317.1,INSD:ES122321.1,INSD:EL120615.1,
FT                   INSD:EL996101.1,INSD:AV823836.1,INSD:EL236918.1,
FT                   INSD:DR247218.1,INSD:DR247112.1,INSD:DR247175.1,
FT                   INSD:EG492679.1,INSD:DR247206.1,INSD:ES045621.1,
FT                   INSD:AV550197.1,INSD:EH810928.1,INSD:EL275688.1,
FT                   INSD:EL038284.1,INSD:ES121416.1,INSD:ES092555.1,
FT                   INSD:BP853235.1,INSD:DR247158.1,INSD:DR247070.1,
FT                   INSD:EL198416.1,INSD:DR247193.1,INSD:EL131256.1,
FT                   INSD:DR247160.1,INSD:DR247134.1,INSD:DR247155.1,
FT                   INSD:DR247200.1,INSD:EL117636.1,INSD:EL970249.1,
FT                   INSD:EL002561.1,INSD:DR247186.1,INSD:EH974733.1,
FT                   INSD:EH982669.1,INSD:DR247203.1,INSD:EL194417.1,
FT                   INSD:ES116202.1,INSD:DR247213.1,INSD:DR247063.1,
FT                   INSD:EH978783.1,INSD:DR247254.1,INSD:EL273877.1,
FT                   INSD:T41850.1,INSD:EL089267.1,INSD:DR354978.1,
FT                   INSD:EG481332.1,INSD:DR247125.1,INSD:DR247177.1,
FT                   INSD:AV564838.1,INSD:ES138620.1,INSD:EH959971.1,
FT                   INSD:EG439449.1,INSD:EL093572.1,INSD:EL110173.1,
FT                   INSD:EL061438.1,INSD:EL243186.1,INSD:EL214344.1,
FT                   INSD:EL108560.1,INSD:EH853413.1,INSD:DR247182.1,
FT                   INSD:DR247269.1,INSD:DR247124.1,INSD:ES151083.1,
FT                   INSD:EH908130.1,INSD:T43049.1,INSD:DR247189.1,
FT                   INSD:BP562606.1,INSD:DR358822.1,INSD:DR247060.1,
FT                   INSD:EL068097.1,INSD:EL036233.1,INSD:DR247092.1,
FT                   INSD:DR247209.1,INSD:DR358812.1,INSD:EL202238.1,
FT                   INSD:EH903973.1,INSD:DR247077.1,INSD:EL293444.1,
FT                   INSD:DR358825.1,INSD:CB185607.1,INSD:DR247056.1,
FT                   INSD:EL318672.1,INSD:DR247290.1,INSD:ES054425.1,
FT                   INSD:DR247247.1,INSD:DR247106.1,INSD:EH797739.1,
FT                   INSD:DR358820.1,INSD:ES033411.1,INSD:EL126423.1,
FT                   INSD:EL240791.1,INSD:EH859726.1,INSD:EL185957.1,
FT                   INSD:EH917601.1,INSD:AV557226.1,INSD:ES012488.1,
FT                   INSD:BP567064.1,INSD:ES080142.1,INSD:DR247205.1,
FT                   INSD:EL210092.1,INSD:EL041909.1,INSD:BP622949.1,
FT                   INSD:EL296474.1,INSD:DR247085.1,INSD:DR247293.1,
FT                   INSD:ES102440.1,INSD:DR247248.1,INSD:EH947602.1,
FT                   INSD:BP864526.1,INSD:ES205884.1,INSD:ES214898.1,
FT                   INSD:EH808943.1,INSD:EL191027.1,INSD:DR247222.1,
FT                   INSD:EL277103.1,INSD:H36862.1,INSD:EL088768.1,
FT                   INSD:EL287680.1,INSD:EL239840.1,INSD:DR247135.1,
FT                   INSD:DR247098.1,INSD:EL028114.1,INSD:EL207862.1,
FT                   INSD:EL334993.1,INSD:AV530330.1,INSD:DR247246.1,
FT                   INSD:DR247123.1,INSD:EL165351.1,INSD:DR247296.1,
FT                   INSD:DR247116.1,INSD:ES039642.1,INSD:BP821466.1,
FT                   INSD:ES113638.1,INSD:EL083742.1,INSD:DR247202.1,
FT                   INSD:DR247058.1,INSD:ES158880.1,INSD:EL300908.1,
FT                   INSD:DR247103.1,INSD:EL274413.1,INSD:EH888137.1,
FT                   INSD:EG500319.1,INSD:EH837490.1,INSD:DR247282.1,
FT                   INSD:AV810215.1,INSD:BP828729.1,INSD:AV442107.1,
FT                   INSD:DR247228.1,INSD:AA721872.1,INSD:DR358811.1,
FT                   INSD:EL228719.1,INSD:EL329863.1,INSD:EL001909.1,
FT                   INSD:AV563055.1,INSD:BP561031.2,INSD:BP659181.1,
FT                   INSD:EL219395.1,INSD:EL155385.1,INSD:BP825904.1,
FT                   INSD:BP823642.1,INSD:ES053280.1,INSD:EL014651.1,
FT                   INSD:EL238314.1,INSD:EL236672.1,INSD:EH873291.1,
FT                   INSD:DR247131.1,INSD:EL230264.1,INSD:DR247230.1,
FT                   INSD:DR247257.1,INSD:DR247062.1,INSD:EL079929.1,
FT                   INSD:DR247115.1,INSD:AV550722.1,INSD:DR247285.1,
FT                   INSD:EL982148.1,INSD:BP637325.1,INSD:ES129323.1,
FT                   INSD:EH867088.1,INSD:DR247294.1,INSD:DR247075.1,
FT                   INSD:EL284939.1,INSD:AV551779.1,INSD:DR247133.1,
FT                   INSD:DR247165.1,INSD:EL988883.1,INSD:EH797212.1,
FT                   INSD:DR247179.1,INSD:DR358816.1,INSD:EH948813.1,
FT                   INSD:DR247100.1,INSD:ES181240.1,INSD:DR247167.1,
FT                   INSD:EL319161.1,INSD:EL997000.1,INSD:EL029898.1,
FT                   INSD:DR247178.1,INSD:DR247187.1,INSD:EL173309.1,
FT                   INSD:ES104273.1,INSD:EL023437.1,INSD:EG439445.1,
FT                   INSD:EL976525.1,INSD:ES196076.1,INSD:DR247253.1,
FT                   INSD:EL289765.1,INSD:DR247094.1,INSD:AV812529.1,
FT                   INSD:ES046060.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX827573.1"
FT   CDS_pept        complement(join(186143..186238,186333..186473,
FT                   186602..186897,187201..187531))
FT                   /codon_start=1
FT                   /gene="PIP1;4"
FT                   /gene_synonym="A_IG005I10.2"
FT                   /gene_synonym="A_IG005I10_2"
FT                   /gene_synonym="F5I10.2"
FT                   /gene_synonym="F5I10_2"
FT                   /gene_synonym="PIP1E"
FT                   /gene_synonym="plasma membrane intrinsic protein 1;4"
FT                   /gene_synonym="PLASMA MEMBRANE INTRINSIC PROTEIN 1E"
FT                   /gene_synonym="TMP-C"
FT                   /gene_synonym="TRANSMEMBRANE PROTEIN C"
FT                   /locus_tag="AT4G00430"
FT                   /product="plasma membrane intrinsic protein 1;4"
FT                   /note="plasma membrane intrinsic protein 1;4 (PIP1;4);
FT                   FUNCTIONS IN: water channel activity; INVOLVED IN: response
FT                   to water deprivation, transport; LOCATED IN: plasma
FT                   membrane, membrane; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Major intrinsic protein, conserved site
FT                   (InterPro:IPR022357), Aquaporin (InterPro:IPR012269), Major
FT                   intrinsic protein (InterPro:IPR000425); BEST Arabidopsis
FT                   thaliana protein match is: plasma membrane intrinsic
FT                   protein 1B (TAIR:AT2G45960.1); Has 10702 Blast hits to
FT                   10683 proteins in 2216 species: Archae - 88; Bacteria -
FT                   5147; Metazoa - 1472; Fungi - 442; Plants - 2512; Viruses -
FT                   2; Other Eukaryotes - 1039 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00430"
FT                   /db_xref="GOA:Q39196"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39196"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV533763.1,INSD:DR247184.1,INSD:EL976125.1,
FT                   INSD:EH987340.1,INSD:EL170687.1,INSD:DR247227.1,
FT                   INSD:EH890324.1,INSD:EH798481.1,INSD:CB264486.1,
FT                   INSD:DR247117.1,INSD:EL296969.1,INSD:EL141963.1,
FT                   INSD:EL082052.1,INSD:ES075552.1,INSD:DR247181.1,
FT                   INSD:DR247204.1,INSD:EL156540.1,INSD:EH797149.1,
FT                   INSD:EG456158.1,INSD:DR247249.1,INSD:DR247082.1,
FT                   INSD:EL174351.1,INSD:DR247164.1,INSD:EL143871.1,
FT                   INSD:BP591542.1,INSD:BP646645.1,INSD:EL073685.1,
FT                   INSD:DR247139.1,INSD:Z18386.1,INSD:DR247059.1,
FT                   INSD:EL997504.1,INSD:DR247198.1,INSD:DR247283.1,
FT                   INSD:DR247219.1,INSD:EH863746.1,INSD:EH933454.1,
FT                   INSD:DR247201.1,INSD:T13717.1,INSD:EH955401.1,
FT                   INSD:ES181413.1,INSD:BP630611.1,INSD:EH973904.1,
FT                   INSD:EH800696.1,INSD:EL317938.1,INSD:EL017949.1,
FT                   INSD:DR247111.1,INSD:DR247130.1,INSD:EH874901.1,
FT                   INSD:DR247309.1,INSD:ES013685.1,INSD:DR247239.1,
FT                   INSD:EL075579.1,INSD:EL981115.1,INSD:EH908623.1,
FT                   INSD:DR247268.1,INSD:DR358813.1,INSD:CB074464.1,
FT                   INSD:EL327642.1,INSD:EL021238.1,INSD:EL981956.1,
FT                   INSD:EH846905.1,INSD:EL246337.1,INSD:EL190081.1,
FT                   INSD:DR247271.1,INSD:DR247152.1,INSD:DR247255.1,
FT                   INSD:ES058724.1,INSD:AV794446.1,INSD:EH943371.1,
FT                   INSD:AV556533.1,INSD:EG500318.1,INSD:DR247214.1,
FT                   INSD:EL992620.1,INSD:EL309548.1,INSD:DR247138.1,
FT                   INSD:EL140523.1,INSD:DR247101.1,INSD:DR297675.1,
FT                   INSD:DR247185.1,INSD:DR247229.1,INSD:DR247223.1,
FT                   INSD:DR247084.1,INSD:EL132170.1,INSD:ES178975.1,
FT                   INSD:ES058582.1,INSD:BP641974.1,INSD:DR247292.1,
FT                   INSD:EL238741.1,INSD:EL227964.1,INSD:EL046013.1,
FT                   INSD:DR247149.1,INSD:EL088852.1,INSD:DR247153.1,
FT                   INSD:BP660077.1,INSD:EG450258.1,INSD:EL082906.1,
FT                   INSD:BP624649.1,INSD:EL337892.1,INSD:DR247241.1,
FT                   INSD:EL088720.1,INSD:ES012047.1,INSD:EL205146.1,
FT                   INSD:ES062671.1,INSD:EH831699.1,INSD:EL317817.1,
FT                   INSD:DR247143.1,INSD:DR247258.1,INSD:DR247235.1,
FT                   INSD:EH922167.1,INSD:DR247119.1,INSD:CO048572.1,
FT                   INSD:DR247102.1,INSD:AV538052.1,INSD:DR247073.1,
FT                   INSD:EL324780.1,INSD:ES181388.1,INSD:DR247159.1,
FT                   INSD:EL316659.1,INSD:DR247118.1,INSD:DR247107.1,
FT                   INSD:AV525115.1,INSD:BP667922.1,INSD:EL038957.1,
FT                   INSD:DR247301.1,INSD:EL272122.1,INSD:DR247250.1,
FT                   INSD:BP576357.1,INSD:BP862249.1,INSD:BP637133.1,
FT                   INSD:EL133899.1,INSD:DR247299.1,INSD:EL019237.1,
FT                   INSD:EL214821.1,INSD:EL202887.1,INSD:BP633533.1,
FT                   INSD:EG506781.1,INSD:DR247281.1,INSD:ES003351.1,
FT                   INSD:ES173537.1,INSD:DR247277.1,INSD:EH923943.1,
FT                   INSD:EH817725.1,INSD:EH798546.1,INSD:DR247142.1,
FT                   INSD:DR247195.1,INSD:DR247289.1,INSD:ES100751.1,
FT                   INSD:EH836131.1,INSD:EL152257.1,INSD:EH936952.1,
FT                   INSD:DR247146.1,INSD:EH920985.1,INSD:DR247305.1,
FT                   INSD:EL316509.1,INSD:EL116417.1,INSD:EL052927.1,
FT                   INSD:DR247166.1,INSD:DR247207.1,INSD:N37205.1,
FT                   INSD:DR247061.1,INSD:ES176389.1,INSD:ES125378.1,
FT                   INSD:DR247066.1,INSD:ES051454.1,INSD:ES098749.1,
FT                   INSD:EL302427.1,INSD:EH815248.1,INSD:DR247221.1,
FT                   INSD:ES144100.1,INSD:EL074095.1,INSD:BP661427.1,
FT                   INSD:DR247109.1,INSD:EH956252.1,INSD:EL270425.1,
FT                   INSD:EL335557.1,INSD:EH968985.1,INSD:ES013047.1,
FT                   INSD:EG506160.1,INSD:EL979838.1,INSD:R84071.1,
FT                   INSD:AV789717.1,INSD:AV567180.1,INSD:EL980445.1,
FT                   INSD:DR247151.1,INSD:EL295575.1,INSD:EH958408.1,
FT                   INSD:DR381318.1,INSD:DR247307.1,INSD:EL069438.1,
FT                   INSD:ES012100.1,INSD:ES186483.1,INSD:DR247278.1,
FT                   INSD:EL160527.1,INSD:DR247137.1,INSD:DR247154.1,
FT                   INSD:ES110468.1,INSD:EH857688.1,INSD:AI993618.1,
FT                   INSD:ES014653.1,INSD:ES039759.1,INSD:BP650820.1,
FT                   INSD:AV800590.1,INSD:EL119803.1,INSD:EL228551.1,
FT                   INSD:EL323361.1,INSD:BP643011.1,INSD:DR247266.1,
FT                   INSD:EL152142.1,INSD:EH837632.1,INSD:ES150704.1,
FT                   INSD:EL091750.1,INSD:EH980667.1,INSD:DR247083.1,
FT                   INSD:DR247276.1,INSD:ES089396.1,INSD:EL997610.1,
FT                   INSD:DR247104.1,INSD:EL981741.1,INSD:AV567462.1,
FT                   INSD:EL221806.1,INSD:CO048559.1,INSD:ES138665.1,
FT                   INSD:EH955939.1,INSD:DR247243.1,INSD:DR247267.1,
FT                   INSD:DR247264.1,INSD:EH845828.1,INSD:AV804359.1,
FT                   INSD:DR354975.1,INSD:AV519133.1,INSD:EL203912.1,
FT                   INSD:EH802797.1,INSD:EL238313.1,INSD:DR247080.1,
FT                   INSD:EL320507.1,INSD:DR247262.1,INSD:ES089750.1,
FT                   INSD:BP855206.1,INSD:DR354979.1,INSD:EG492680.1,
FT                   INSD:DR247076.1,INSD:DR247174.1,INSD:EL212507.1,
FT                   INSD:EL210743.1,INSD:EH883430.1,INSD:DR247270.1,
FT                   INSD:ES182705.1,INSD:EL221598.1,INSD:EL986830.1,
FT                   INSD:DR247081.1,INSD:EL332244.1,INSD:ES016126.1,
FT                   INSD:DR247234.1,INSD:AV793269.1,INSD:EL062496.1,
FT                   INSD:DR247120.1,INSD:EL037201.1,INSD:DR247306.1,
FT                   INSD:EH812004.1,INSD:DR358814.1,INSD:EL976247.1,
FT                   INSD:EL104218.1,INSD:DR247099.1,INSD:DR247129.1,
FT                   INSD:BP592671.1,INSD:EH822596.1,INSD:DR247208.1,
FT                   INSD:ES061646.1,INSD:EH855470.1,INSD:AV552809.1,
FT                   INSD:DR247078.1,INSD:EL302245.1,INSD:EL337294.1,
FT                   INSD:EH981680.1,INSD:T75794.1,INSD:EL281188.1,
FT                   INSD:DR247176.1,INSD:AV558770.1,INSD:CF774367.1,
FT                   INSD:EH847850.1,INSD:EL073297.1,INSD:DR247279.1,
FT                   INSD:DR247256.1,INSD:BP814073.1,INSD:DR247064.1,
FT                   INSD:EH929944.1,INSD:BP646428.1,INSD:EL123815.1,
FT                   INSD:BP632407.1,INSD:ES205957.1,INSD:AV810231.1,
FT                   INSD:ES201488.1,INSD:BP828672.2,INSD:DR247090.1,
FT                   INSD:BP594305.1,INSD:AV541679.1,INSD:EH852996.1,
FT                   INSD:AJ609311.1,INSD:BP660735.1,INSD:ES046039.1,
FT                   INSD:EH967129.1,INSD:EL250123.1,INSD:EL100343.1,
FT                   INSD:EH904326.1,INSD:EL207957.1,INSD:DR247162.1,
FT                   INSD:EH848350.1,INSD:DR247245.1,INSD:ES030708.1,
FT                   INSD:DR247191.1,INSD:EL069625.1,INSD:EL989362.1,
FT                   INSD:DR247211.1,INSD:DR354976.1,INSD:EH928686.1,
FT                   INSD:ES062900.1,INSD:BP614643.1,INSD:EL290774.1,
FT                   INSD:DR247055.1,INSD:EL140076.1,INSD:DR247171.1,
FT                   INSD:BP650632.1,INSD:EL306002.1,INSD:DR247273.1,
FT                   INSD:EH951449.1,INSD:ES162715.1,INSD:EL010067.1,
FT                   INSD:DR247157.1,INSD:DR247190.1,INSD:ES047952.1,
FT                   INSD:EH811940.1,INSD:EH976017.1,INSD:DR247145.1,
FT                   INSD:EL309240.1,INSD:DR247057.1,INSD:EL041000.1,
FT                   INSD:AV550479.1,INSD:DR247072.1,INSD:ES077938.1,
FT                   INSD:EL115268.1,INSD:BP819623.1,INSD:DR247126.1,
FT                   INSD:DR247150.1,INSD:DR247240.1,INSD:BP638356.1,
FT                   INSD:EL042052.1,INSD:DR247237.1,INSD:EL253026.1,
FT                   INSD:DR247302.1,INSD:DR247141.1,INSD:EH963084.1,
FT                   INSD:BE528754.1,INSD:DR247265.1,INSD:ES059735.1,
FT                   INSD:BP584368.1,INSD:ES202671.1,INSD:EL249012.1,
FT                   INSD:EL178826.1,INSD:DR247108.1,INSD:BE039043.1,
FT                   INSD:ES211851.1,INSD:EH804445.1,INSD:ES017521.1,
FT                   INSD:DR247122.1,INSD:DR247156.1,INSD:DR383070.1,
FT                   INSD:EL034920.1,INSD:CB259029.1,INSD:DR247215.1,
FT                   INSD:BX840069.1,INSD:BP788530.1,INSD:BP642866.1,
FT                   INSD:EL009648.1,INSD:EL099733.1,INSD:DR247260.1,
FT                   INSD:EL101413.1,INSD:EL254723.1,INSD:ES188616.1,
FT                   INSD:DR247232.1,INSD:BP562488.2,INSD:EH834868.1,
FT                   INSD:EL023876.1,INSD:EH919462.1,INSD:EH898373.1,
FT                   INSD:EL313951.1,INSD:ES134107.1,INSD:DR247263.1,
FT                   INSD:DR247259.1,INSD:EL211145.1,INSD:EL223281.1,
FT                   INSD:DR247128.1,INSD:AV560950.1,INSD:BP588056.1,
FT                   INSD:DR247127.1,INSD:EL032798.1,INSD:EH826964.1,
FT                   INSD:DR247113.1,INSD:EL139697.1,INSD:EH934896.1,
FT                   INSD:EH956072.1,INSD:BP853121.1,INSD:EL191306.1,
FT                   INSD:CF652102.1,INSD:ES069251.1,INSD:DR247300.1,
FT                   INSD:DR247093.1,INSD:T43789.1,INSD:DR247286.1,
FT                   INSD:EL223413.1,INSD:EL141946.1,INSD:DR247071.1,
FT                   INSD:EH819539.1,INSD:DR247272.1,INSD:EL294795.1,
FT                   INSD:DR358817.1,INSD:DR247147.1,INSD:ES177731.1,
FT                   INSD:DR247183.1,INSD:DR247170.1,INSD:EL273429.1,
FT                   INSD:ES126308.1,INSD:AV560623.1,INSD:ES186121.1,
FT                   INSD:ES084660.1,INSD:AV806677.1,INSD:AV539357.1,
FT                   INSD:EL314028.1,INSD:EL339130.1,INSD:DR247275.1,
FT                   INSD:BP590482.1,INSD:EL080020.1,INSD:AV540978.1,
FT                   INSD:DR247114.1,INSD:EL101304.1,INSD:EH993055.1,
FT                   INSD:DR247304.1,INSD:DR247199.1,INSD:EH921732.1,
FT                   INSD:DR247251.1,INSD:BU635559.1,INSD:DR247216.1,
FT                   INSD:CF774283.1,INSD:BP627730.1,INSD:CK119580.1,
FT                   INSD:ES090315.1,INSD:DR247244.1,INSD:ES131646.1,
FT                   INSD:EL307807.1,INSD:EL207571.1,INSD:DR247105.1,
FT                   INSD:DR358824.1,INSD:EL230730.1,INSD:EL335413.1,
FT                   INSD:DR247096.1,INSD:BP575426.1,INSD:ES151068.1,
FT                   INSD:EH897483.1,INSD:ES127688.1,INSD:DR247252.1,
FT                   INSD:EL320727.1,INSD:DR247210.1,INSD:ES188615.1,
FT                   INSD:DR354981.1,INSD:DR358821.1,INSD:EH976696.1,
FT                   INSD:DR247233.1,INSD:DR247069.1,INSD:EH906828.1,
FT                   INSD:DR247089.1,INSD:AV784901.1,INSD:EL215195.1,
FT                   INSD:EL029761.1,INSD:DR247196.1,INSD:DR247095.1,
FT                   INSD:EL045212.1,INSD:ES133317.1,INSD:DR247087.1,
FT                   INSD:EL215492.1,INSD:EL229370.1,INSD:ES163304.1,
FT                   INSD:EH855865.1,INSD:DR247194.1,INSD:DR354977.1,
FT                   INSD:DR247140.1,INSD:DR247168.1,INSD:EL106892.1,
FT                   INSD:DR247074.1,INSD:EL106770.1,INSD:EL277498.1,
FT                   INSD:AV441231.1,INSD:DR247088.1,INSD:DR247226.1,
FT                   INSD:DR247068.1,INSD:EL146883.1,INSD:AV806035.1,
FT                   INSD:DR247065.1,INSD:ES105560.1,INSD:EL129553.1,
FT                   INSD:ES201599.1,INSD:EL330130.1,INSD:DR247136.1,
FT                   INSD:EH804203.1,INSD:EL090918.1,INSD:EL229599.1,
FT                   INSD:DR247121.1,INSD:AV556163.1,INSD:DR247284.1,
FT                   INSD:BP657061.1,INSD:DR247242.1,INSD:BP862717.1,
FT                   INSD:EH875978.1,INSD:EL005042.1,INSD:DR247163.1,
FT                   INSD:DR247169.1,INSD:DR247097.1,INSD:DR358818.1,
FT                   INSD:EH808926.1,INSD:ES094907.1,INSD:EL335888.1,
FT                   INSD:AV784518.1,INSD:EH890517.1,INSD:AV559687.1,
FT                   INSD:DR247192.1,INSD:EL254223.1,INSD:ES176795.1,
FT                   INSD:EH857664.1,INSD:DR247291.1,INSD:DR247086.1,
FT                   INSD:AV551952.1,INSD:DR247224.1,INSD:EH889522.1,
FT                   INSD:EL073014.1,INSD:DR247212.1,INSD:ES215122.1,
FT                   INSD:ES198467.1,INSD:AV820606.1,INSD:EL238991.1,
FT                   INSD:CF773493.1,INSD:EL283457.1,INSD:EL059381.1,
FT                   INSD:BP830016.1,INSD:DR247287.1,INSD:DR247261.1,
FT                   INSD:DR247148.1,INSD:DR247308.1,INSD:EL196403.1,
FT                   INSD:EH801496.1,INSD:AI099997.1,INSD:EL226194.1,
FT                   INSD:DR247303.1,INSD:EH880700.1,INSD:DR247297.1,
FT                   INSD:ES025947.1,INSD:DR358819.1,INSD:EG506780.1,
FT                   INSD:BP656322.1,INSD:DR247220.1,INSD:DR247180.1,
FT                   INSD:BP629738.1,INSD:DR247225.1,INSD:EL288137.1,
FT                   INSD:EL152121.1,INSD:ES104892.1,INSD:EH857860.1,
FT                   INSD:EG506157.1,INSD:CK119833.1,INSD:EL078021.1,
FT                   INSD:DR247236.1,INSD:EL327787.1,INSD:ES115949.1,
FT                   INSD:ES179899.1,INSD:EL280448.1,INSD:BP586036.1,
FT                   INSD:EH795466.1,INSD:EL324581.1,INSD:EL326382.1,
FT                   INSD:EH941926.1,INSD:DR247173.1,INSD:DR354980.1,
FT                   INSD:EL188246.1,INSD:EL076688.1,INSD:DR247295.1,
FT                   INSD:AV557323.1,INSD:DR247091.1,INSD:DR247231.1,
FT                   INSD:AV518347.1,INSD:ES105348.1,INSD:BP827850.1,
FT                   INSD:BP654481.1,INSD:BP845290.1,INSD:DR358810.1,
FT                   INSD:EL207077.1,INSD:DR247197.1,INSD:EL296033.1,
FT                   INSD:EL256742.1,INSD:DR358815.1,INSD:EL211198.1,
FT                   INSD:ES020354.1,INSD:EL176145.1,INSD:EG481336.1,
FT                   INSD:EH993906.1,INSD:DR358823.1,INSD:BP781035.1,
FT                   INSD:DR247280.1,INSD:EH802445.1,INSD:AV531014.1,
FT                   INSD:EH867825.1,INSD:DR247238.1,INSD:DR247067.1,
FT                   INSD:AV526595.1,INSD:EH930082.1,INSD:DR247172.1,
FT                   INSD:EH969324.1,INSD:DR247079.1,INSD:EL286783.1,
FT                   INSD:EH919103.1,INSD:EH987853.1,INSD:DR247288.1,
FT                   INSD:EH975317.1,INSD:ES122321.1,INSD:EL120615.1,
FT                   INSD:EL996101.1,INSD:AV823836.1,INSD:EL236918.1,
FT                   INSD:DR247218.1,INSD:DR247112.1,INSD:DR247175.1,
FT                   INSD:EG492679.1,INSD:CA782002.1,INSD:DR247206.1,
FT                   INSD:ES045621.1,INSD:AV550197.1,INSD:EH810928.1,
FT                   INSD:EL275688.1,INSD:EL038284.1,INSD:ES121416.1,
FT                   INSD:ES092555.1,INSD:BP853235.1,INSD:DR247070.1,
FT                   INSD:DR247158.1,INSD:EL198416.1,INSD:EH848415.1,
FT                   INSD:DR247193.1,INSD:EL131256.1,INSD:DR247160.1,
FT                   INSD:DR247134.1,INSD:DR247155.1,INSD:DR247200.1,
FT                   INSD:EL117636.1,INSD:EL970249.1,INSD:EL002561.1,
FT                   INSD:DR247186.1,INSD:EH974733.1,INSD:EH982669.1,
FT                   INSD:DR247203.1,INSD:EL194417.1,INSD:ES116202.1,
FT                   INSD:DR247213.1,INSD:DR247063.1,INSD:EH978783.1,
FT                   INSD:DR247254.1,INSD:EL273877.1,INSD:T41850.1,
FT                   INSD:EL089267.1,INSD:DR354978.1,INSD:EG481332.1,
FT                   INSD:DR247125.1,INSD:DR247177.1,INSD:AV564838.1,
FT                   INSD:EG476827.1,INSD:ES138620.1,INSD:EH959971.1,
FT                   INSD:EL093572.1,INSD:EG439449.1,INSD:EL110173.1,
FT                   INSD:EL061438.1,INSD:EL243186.1,INSD:EL214344.1,
FT                   INSD:EL108560.1,INSD:EH853413.1,INSD:DR247182.1,
FT                   INSD:DR247269.1,INSD:DR247124.1,INSD:ES151083.1,
FT                   INSD:EH908130.1,INSD:T43049.1,INSD:DR247189.1,
FT                   INSD:BP562606.1,INSD:DR358822.1,INSD:DR247060.1,
FT                   INSD:EL068097.1,INSD:EL036233.1,INSD:EH987111.1,
FT                   INSD:DR247092.1,INSD:BP621044.1,INSD:DR247209.1,
FT                   INSD:DR358812.1,INSD:DR247077.1,INSD:EL202238.1,
FT                   INSD:EH903973.1,INSD:DR358825.1,INSD:CB185607.1,
FT                   INSD:DR247056.1,INSD:EL318672.1,INSD:DR247290.1,
FT                   INSD:DR247247.1,INSD:DR247106.1,INSD:DR358820.1,
FT                   INSD:EH797739.1,INSD:ES033411.1,INSD:EL126423.1,
FT                   INSD:DR378148.1,INSD:EL240791.1,INSD:EH859726.1,
FT                   INSD:EL185957.1,INSD:EH917601.1,INSD:AV557226.1,
FT                   INSD:ES012488.1,INSD:BP567064.1,INSD:EG486414.1,
FT                   INSD:ES080142.1,INSD:DR247205.1,INSD:EL210092.1,
FT                   INSD:EL041909.1,INSD:BP622949.1,INSD:EL296474.1,
FT                   INSD:DR247085.1,INSD:DR247293.1,INSD:DR247248.1,
FT                   INSD:EH947602.1,INSD:BP864526.1,INSD:EL078538.1,
FT                   INSD:ES214898.1,INSD:EH808943.1,INSD:EL191027.1,
FT                   INSD:DR247222.1,INSD:EL277103.1,INSD:H36862.1,
FT                   INSD:EL088768.1,INSD:EL287680.1,INSD:EL239840.1,
FT                   INSD:DR247135.1,INSD:DR247098.1,INSD:EL028114.1,
FT                   INSD:EL207862.1,INSD:AV530330.1,INSD:EL334993.1,
FT                   INSD:DR247246.1,INSD:DR247123.1,INSD:EL165351.1,
FT                   INSD:DR247296.1,INSD:DR247116.1,INSD:ES039642.1,
FT                   INSD:BP821466.1,INSD:ES113638.1,INSD:EL083742.1,
FT                   INSD:DR247202.1,INSD:DR247058.1,INSD:ES158880.1,
FT                   INSD:EL300908.1,INSD:DR247103.1,INSD:EL274413.1,
FT                   INSD:EH888137.1,INSD:EG500319.1,INSD:EH837490.1,
FT                   INSD:DR247282.1,INSD:AV810215.1,INSD:BP828729.1,
FT                   INSD:AV442107.1,INSD:DR247228.1,INSD:AA721872.1,
FT                   INSD:DR358811.1,INSD:EG486415.1,INSD:EL228719.1,
FT                   INSD:EL329863.1,INSD:EL001909.1,INSD:AV563055.1,
FT                   INSD:BP561031.2,INSD:BP659181.1,INSD:EL219395.1,
FT                   INSD:EL155385.1,INSD:BP825904.1,INSD:BP823642.1,
FT                   INSD:ES053280.1,INSD:EL014651.1,INSD:EL238314.1,
FT                   INSD:EL236672.1,INSD:EH873291.1,INSD:DR247131.1,
FT                   INSD:EL230264.1,INSD:ES101352.1,INSD:DR247230.1,
FT                   INSD:DR247257.1,INSD:DR247062.1,INSD:EL079929.1,
FT                   INSD:DR247115.1,INSD:AV550722.1,INSD:DR247285.1,
FT                   INSD:EL982148.1,INSD:BP637325.1,INSD:ES129323.1,
FT                   INSD:EH867088.1,INSD:DR247075.1,INSD:DR247294.1,
FT                   INSD:EL284939.1,INSD:CO048575.1,INSD:AV551779.1,
FT                   INSD:AV793906.1,INSD:DR247133.1,INSD:DR247165.1,
FT                   INSD:EL988883.1,INSD:EH797212.1,INSD:DR247179.1,
FT                   INSD:DR358816.1,INSD:AV562006.1,INSD:EH948813.1,
FT                   INSD:DR247100.1,INSD:BP601016.1,INSD:ES181240.1,
FT                   INSD:DR247167.1,INSD:EL319161.1,INSD:BP627344.1,
FT                   INSD:EL997000.1,INSD:BP827833.1,INSD:EL029898.1,
FT                   INSD:DR247178.1,INSD:AV560818.1,INSD:DR247187.1,
FT                   INSD:EL173309.1,INSD:EG476828.1,INSD:ES104273.1,
FT                   INSD:BP828952.1,INSD:EL023437.1,INSD:EG439445.1,
FT                   INSD:EL976525.1,INSD:ES196076.1,INSD:DR247253.1,
FT                   INSD:EL289765.1,INSD:DR247094.1,INSD:AV812529.1,
FT                   INSD:ES046060.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY120785.1,INSD:AY099825.1,INSD:BT000330.1,
FT                   INSD:D85192.1,INSD:BT006313.1,INSD:D26609.1,
FT                   INSD:BX829233.1"
FT                   /protein_id="AEE81879.1"
FT                   /translation="MEGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGE
FT                   LSSWSFYRAGIAEFIATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVY
FT                   CTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLG
FT                   GGANTVAHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFL
FT                   VHLATIPITGTGINPARSLGAAIIYNKDHSWDDHWIFWVGPFIGAALAALYHQIVIRAI
FT                   PFKSKS"
FT   CDS_pept        complement(join(186569..186897,187201..187531))
FT                   /codon_start=1
FT                   /gene="PIP1;4"
FT                   /gene_synonym="A_IG005I10.2"
FT                   /gene_synonym="A_IG005I10_2"
FT                   /gene_synonym="F5I10.2"
FT                   /gene_synonym="F5I10_2"
FT                   /gene_synonym="PIP1E"
FT                   /gene_synonym="plasma membrane intrinsic protein 1;4"
FT                   /gene_synonym="PLASMA MEMBRANE INTRINSIC PROTEIN 1E"
FT                   /gene_synonym="TMP-C"
FT                   /gene_synonym="TRANSMEMBRANE PROTEIN C"
FT                   /locus_tag="AT4G00430"
FT                   /product="plasma membrane intrinsic protein 1;4"
FT                   /note="TRANSMEMBRANE PROTEIN C (TMP-C); FUNCTIONS IN: water
FT                   channel activity; INVOLVED IN: response to water
FT                   deprivation, transport; LOCATED IN: membrane; EXPRESSED IN:
FT                   23 plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Major intrinsic protein,
FT                   conserved site (InterPro:IPR022357), Major intrinsic
FT                   protein (InterPro:IPR000425); BEST Arabidopsis thaliana
FT                   protein match is: plasma membrane intrinsic protein 1B
FT                   (TAIR:AT2G45960.2); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00430"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00430.2"
FT                   /db_xref="GOA:F4JHB6"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHB6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR247184.1,INSD:EL976125.1,INSD:EL170687.1,
FT                   INSD:DR247227.1,INSD:EH890324.1,INSD:CB264486.1,
FT                   INSD:DR247117.1,INSD:EL296969.1,INSD:EL082052.1,
FT                   INSD:EL141963.1,INSD:ES075552.1,INSD:DR247181.1,
FT                   INSD:DR247204.1,INSD:EL156540.1,INSD:EH797149.1,
FT                   INSD:DR247249.1,INSD:DR247082.1,INSD:EL174351.1,
FT                   INSD:DR247164.1,INSD:EL143871.1,INSD:BP591542.1,
FT                   INSD:BP646645.1,INSD:EL073685.1,INSD:DR247139.1,
FT                   INSD:Z18386.1,INSD:DR247059.1,INSD:EL997504.1,
FT                   INSD:DR247198.1,INSD:DR247283.1,INSD:DR247219.1,
FT                   INSD:EH933454.1,INSD:EH863746.1,INSD:ES037929.1,
FT                   INSD:DR247201.1,INSD:T13717.1,INSD:EH973904.1,
FT                   INSD:EL317938.1,INSD:EL017949.1,INSD:DR247111.1,
FT                   INSD:DR247130.1,INSD:EH874901.1,INSD:DR247309.1,
FT                   INSD:ES013685.1,INSD:DR247239.1,INSD:EL075579.1,
FT                   INSD:EL981115.1,INSD:EH908623.1,INSD:DR247268.1,
FT                   INSD:DR358813.1,INSD:CB074464.1,INSD:EL327642.1,
FT                   INSD:EL021238.1,INSD:EL981956.1,INSD:EH846905.1,
FT                   INSD:EL246337.1,INSD:EL190081.1,INSD:DR247271.1,
FT                   INSD:DR247152.1,INSD:DR247255.1,INSD:ES058724.1,
FT                   INSD:AV794446.1,INSD:EH943371.1,INSD:EG500318.1,
FT                   INSD:AV556533.1,INSD:DR247214.1,INSD:EL992620.1,
FT                   INSD:EL309548.1,INSD:DR247138.1,INSD:EL140523.1,
FT                   INSD:DR247101.1,INSD:DR297675.1,INSD:DR247185.1,
FT                   INSD:DR247229.1,INSD:DR247223.1,INSD:DR247084.1,
FT                   INSD:ES178975.1,INSD:EL132170.1,INSD:ES058582.1,
FT                   INSD:DR247292.1,INSD:EL238741.1,INSD:EL046013.1,
FT                   INSD:DR247149.1,INSD:EL088852.1,INSD:DR247153.1,
FT                   INSD:BP660077.1,INSD:ES058426.1,INSD:EL082906.1,
FT                   INSD:DR247241.1,INSD:EL088720.1,INSD:ES012047.1,
FT                   INSD:EL205146.1,INSD:ES062671.1,INSD:EL317817.1,
FT                   INSD:DR247143.1,INSD:DR247258.1,INSD:DR247235.1,
FT                   INSD:EH922167.1,INSD:DR247119.1,INSD:DR247102.1,
FT                   INSD:DR247073.1,INSD:EL324780.1,INSD:ES181388.1,
FT                   INSD:DR247159.1,INSD:EL316659.1,INSD:DR247107.1,
FT                   INSD:AV525115.1,INSD:EL038957.1,INSD:DR247301.1,
FT                   INSD:BP607825.1,INSD:EL272122.1,INSD:DR247250.1,
FT                   INSD:BP576357.1,INSD:BP862249.1,INSD:EL133899.1,
FT                   INSD:DR247299.1,INSD:EL019237.1,INSD:EL202887.1,
FT                   INSD:EG506781.1,INSD:DR247281.1,INSD:ES173537.1,
FT                   INSD:ES003351.1,INSD:DR247277.1,INSD:EH923943.1,
FT                   INSD:EH817725.1,INSD:DR247142.1,INSD:DR247195.1,
FT                   INSD:DR247289.1,INSD:ES100751.1,INSD:EH836131.1,
FT                   INSD:EL152257.1,INSD:EH936952.1,INSD:DR247146.1,
FT                   INSD:EH920985.1,INSD:DR247305.1,INSD:EL316509.1,
FT                   INSD:DR247166.1,INSD:DR247207.1,INSD:N37205.1,
FT                   INSD:DR247061.1,INSD:ES125378.1,INSD:ES051454.1,
FT                   INSD:DR247066.1,INSD:ES098749.1,INSD:EL302427.1,
FT                   INSD:EH815248.1,INSD:DR247221.1,INSD:ES144100.1,
FT                   INSD:EL074095.1,INSD:BP661427.1,INSD:DR247109.1,
FT                   INSD:EH956252.1,INSD:EL270425.1,INSD:EL335557.1,
FT                   INSD:EH968985.1,INSD:ES013047.1,INSD:EG506160.1,
FT                   INSD:EL979838.1,INSD:R84071.1,INSD:AV789717.1,
FT                   INSD:BP601295.1,INSD:EL980445.1,INSD:DR247151.1,
FT                   INSD:EL295575.1,INSD:EH958408.1,INSD:DR247307.1,
FT                   INSD:EL069438.1,INSD:ES012100.1,INSD:ES186483.1,
FT                   INSD:DR247278.1,INSD:EL160527.1,INSD:DR247137.1,
FT                   INSD:DR247154.1,INSD:ES110468.1,INSD:EH857688.1,
FT                   INSD:AI993618.1,INSD:ES014653.1,INSD:ES039759.1,
FT                   INSD:BP650820.1,INSD:EL009863.1,INSD:AV800590.1,
FT                   INSD:EL119803.1,INSD:EL228551.1,INSD:EL323361.1,
FT                   INSD:BP643011.1,INSD:DR247266.1,INSD:EL152142.1,
FT                   INSD:EH837632.1,INSD:ES150704.1,INSD:EL091750.1,
FT                   INSD:EH980667.1,INSD:DR247083.1,INSD:DR247276.1,
FT                   INSD:ES089396.1,INSD:EL997610.1,INSD:DR247104.1,
FT                   INSD:EL981741.1,INSD:EL221806.1,INSD:ES138665.1,
FT                   INSD:EH955939.1,INSD:DR247243.1,INSD:DR247267.1,
FT                   INSD:BP788757.1,INSD:DR247264.1,INSD:EH845828.1,
FT                   INSD:AV804359.1,INSD:DR354975.1,INSD:AV519133.1,
FT                   INSD:EL203912.1,INSD:EH802797.1,INSD:EL238313.1,
FT                   INSD:DR247080.1,INSD:EL320507.1,INSD:DR247262.1,
FT                   INSD:ES089750.1,INSD:BP855206.1,INSD:DR354979.1,
FT                   INSD:EG492680.1,INSD:DR247076.1,INSD:DR247174.1,
FT                   INSD:EL212507.1,INSD:EL210743.1,INSD:EH883430.1,
FT                   INSD:DR247270.1,INSD:ES182705.1,INSD:EL221598.1,
FT                   INSD:EL986830.1,INSD:DR247081.1,INSD:EL332244.1,
FT                   INSD:ES016126.1,INSD:DR247234.1,INSD:EL062496.1,
FT                   INSD:DR247120.1,INSD:EL037201.1,INSD:DR247306.1,
FT                   INSD:EL976247.1,INSD:DR358814.1,INSD:EL104218.1,
FT                   INSD:DR247099.1,INSD:DR247129.1,INSD:DR247208.1,
FT                   INSD:ES061646.1,INSD:EH855470.1,INSD:DR247078.1,
FT                   INSD:AV552809.1,INSD:EL302245.1,INSD:EL337294.1,
FT                   INSD:EH981680.1,INSD:T75794.1,INSD:EL281188.1,
FT                   INSD:DR247176.1,INSD:EL157283.1,INSD:CF774367.1,
FT                   INSD:EH847850.1,INSD:EL073297.1,INSD:DR247279.1,
FT                   INSD:DR247256.1,INSD:BP814073.1,INSD:EH929944.1,
FT                   INSD:DR247064.1,INSD:BP646428.1,INSD:EL123815.1,
FT                   INSD:BP632407.1,INSD:ES205957.1,INSD:AV810231.1,
FT                   INSD:ES201488.1,INSD:BP828672.2,INSD:DR247090.1,
FT                   INSD:AV541679.1,INSD:EH852996.1,INSD:AJ609311.1,
FT                   INSD:BP660735.1,INSD:ES046039.1,INSD:EH967129.1,
FT                   INSD:EL250123.1,INSD:EL100343.1,INSD:EH904326.1,
FT                   INSD:EL207957.1,INSD:DR247162.1,INSD:ES067524.1,
FT                   INSD:EH848350.1,INSD:DR247245.1,INSD:ES030708.1,
FT                   INSD:DR247191.1,INSD:EL069625.1,INSD:EL989362.1,
FT                   INSD:DR247211.1,INSD:EH928686.1,INSD:DR354976.1,
FT                   INSD:ES062900.1,INSD:BP614643.1,INSD:EL290774.1,
FT                   INSD:DR247055.1,INSD:EL140076.1,INSD:DR247171.1,
FT                   INSD:BP650632.1,INSD:EL306002.1,INSD:DR247273.1,
FT                   INSD:EH951449.1,INSD:ES162715.1,INSD:EL010067.1,
FT                   INSD:DR247157.1,INSD:DR247190.1,INSD:ES047952.1,
FT                   INSD:EH811940.1,INSD:EH976017.1,INSD:AV818238.1,
FT                   INSD:DR247145.1,INSD:EL309240.1,INSD:DR247057.1,
FT                   INSD:EL041000.1,INSD:AV550479.1,INSD:DR247072.1,
FT                   INSD:ES077938.1,INSD:EL115268.1,INSD:BP819623.1,
FT                   INSD:DR247126.1,INSD:DR247150.1,INSD:DR247240.1,
FT                   INSD:BP638356.1,INSD:DR247237.1,INSD:EL253026.1,
FT                   INSD:DR247302.1,INSD:DR247141.1,INSD:EH963084.1,
FT                   INSD:BE528754.1,INSD:DR247265.1,INSD:ES059735.1,
FT                   INSD:BP584368.1,INSD:ES202671.1,INSD:EL249012.1,
FT                   INSD:EL178826.1,INSD:DR247108.1,INSD:ES211851.1,
FT                   INSD:EH804445.1,INSD:ES017521.1,INSD:DR247122.1,
FT                   INSD:DR247156.1,INSD:EL034920.1,INSD:DR247215.1,
FT                   INSD:BP788530.1,INSD:EL009648.1,INSD:EL099733.1,
FT                   INSD:DR247260.1,INSD:EL101413.1,INSD:EL254723.1,
FT                   INSD:DR247232.1,INSD:BP562488.2,INSD:EH834868.1,
FT                   INSD:EL023876.1,INSD:EH919462.1,INSD:EH898373.1,
FT                   INSD:EL313951.1,INSD:ES134107.1,INSD:DR247263.1,
FT                   INSD:DR247259.1,INSD:EL211145.1,INSD:EL223281.1,
FT                   INSD:DR247128.1,INSD:BP588056.1,INSD:EG456157.1,
FT                   INSD:DR247127.1,INSD:EL032798.1,INSD:EH826964.1,
FT                   INSD:DR247113.1,INSD:EL139697.1,INSD:EH934896.1,
FT                   INSD:EH956072.1,INSD:ES148031.1,INSD:BP853121.1,
FT                   INSD:EL191306.1,INSD:DR247093.1,INSD:T43789.1,
FT                   INSD:DR247286.1,INSD:EL223413.1,INSD:EL141946.1,
FT                   INSD:DR247071.1,INSD:EH819539.1,INSD:DR247272.1,
FT                   INSD:EL294795.1,INSD:DR358817.1,INSD:DR247147.1,
FT                   INSD:ES177731.1,INSD:DR247183.1,INSD:DR247170.1,
FT                   INSD:EL273429.1,INSD:ES126308.1,INSD:AV560623.1,
FT                   INSD:ES186121.1,INSD:ES084660.1,INSD:EL314028.1,
FT                   INSD:EL339130.1,INSD:DR247275.1,INSD:EL080020.1,
FT                   INSD:DR247114.1,INSD:EL101304.1,INSD:EH993055.1,
FT                   INSD:DR247304.1,INSD:DR247199.1,INSD:DR247251.1,
FT                   INSD:DR247216.1,INSD:BP627730.1,INSD:CK119580.1,
FT                   INSD:ES090315.1,INSD:DR247244.1,INSD:ES131646.1,
FT                   INSD:EL307807.1,INSD:EL207571.1,INSD:DR247105.1,
FT                   INSD:DR358824.1,INSD:EL230730.1,INSD:DR247096.1,
FT                   INSD:BP575426.1,INSD:ES151068.1,INSD:EL006122.1,
FT                   INSD:ES127688.1,INSD:DR247252.1,INSD:EL320727.1,
FT                   INSD:DR247210.1,INSD:ES188615.1,INSD:DR354981.1,
FT                   INSD:EH976696.1,INSD:DR247233.1,INSD:DR358821.1,
FT                   INSD:DR247069.1,INSD:EH906828.1,INSD:DR247089.1,
FT                   INSD:N96552.1,INSD:EL215195.1,INSD:DR247196.1,
FT                   INSD:DR247095.1,INSD:EL045212.1,INSD:ES133317.1,
FT                   INSD:ES163389.1,INSD:DR247087.1,INSD:AV789014.1,
FT                   INSD:EL215492.1,INSD:ES163304.1,INSD:EL229370.1,
FT                   INSD:EH855865.1,INSD:DR247194.1,INSD:DR247140.1,
FT                   INSD:DR354977.1,INSD:DR247168.1,INSD:EL106892.1,
FT                   INSD:EL106770.1,INSD:DR247074.1,INSD:EL277498.1,
FT                   INSD:DR247226.1,INSD:DR247088.1,INSD:EL146883.1,
FT                   INSD:AV806035.1,INSD:DR247068.1,INSD:ES105560.1,
FT                   INSD:DR247065.1,INSD:EL129553.1,INSD:ES201599.1,
FT                   INSD:EL330130.1,INSD:DR247136.1,INSD:EH804203.1,
FT                   INSD:EL090918.1,INSD:EL229599.1,INSD:DR247121.1,
FT                   INSD:AV556163.1,INSD:DR247284.1,INSD:BP657061.1,
FT                   INSD:DR247242.1,INSD:BP862717.1,INSD:EH875978.1,
FT                   INSD:EL005042.1,INSD:DR247163.1,INSD:DR247169.1,
FT                   INSD:DR247097.1,INSD:EH808926.1,INSD:DR358818.1,
FT                   INSD:ES094907.1,INSD:EL335888.1,INSD:EH890517.1,
FT                   INSD:AV559687.1,INSD:DR247192.1,INSD:EL254223.1,
FT                   INSD:ES176795.1,INSD:EH857664.1,INSD:DR247291.1,
FT                   INSD:DR247086.1,INSD:DR247224.1,INSD:EH889522.1,
FT                   INSD:EL073014.1,INSD:DR247212.1,INSD:ES215122.1,
FT                   INSD:ES198467.1,INSD:AV820606.1,INSD:EL238991.1,
FT                   INSD:CF773493.1,INSD:EL283457.1,INSD:EL059381.1,
FT                   INSD:BP830016.1,INSD:DR247287.1,INSD:DR247261.1,
FT                   INSD:DR247148.1,INSD:DR247308.1,INSD:EL196403.1,
FT                   INSD:EL043392.1,INSD:EL026787.1,INSD:AI099997.1,
FT                   INSD:EL226194.1,INSD:DR247303.1,INSD:EH880700.1,
FT                   INSD:DR247297.1,INSD:ES025947.1,INSD:EG506780.1,
FT                   INSD:DR358819.1,INSD:DR247220.1,INSD:DR247180.1,
FT                   INSD:BP629738.1,INSD:DR247225.1,INSD:EL288137.1,
FT                   INSD:EL152121.1,INSD:ES104892.1,INSD:EH857860.1,
FT                   INSD:EG506157.1,INSD:EL078021.1,INSD:DR247236.1,
FT                   INSD:EL327787.1,INSD:ES115949.1,INSD:ES179899.1,
FT                   INSD:EL280448.1,INSD:BP586036.1,INSD:EH795466.1,
FT                   INSD:EL324581.1,INSD:EL326382.1,INSD:EH941926.1,
FT                   INSD:DR247173.1,INSD:DR354980.1,INSD:EL188246.1,
FT                   INSD:EL076688.1,INSD:DR247295.1,INSD:DR247091.1,
FT                   INSD:DR247231.1,INSD:ES105348.1,INSD:BP827850.1,
FT                   INSD:BP654481.1,INSD:BP845290.1,INSD:DR358810.1,
FT                   INSD:EL207077.1,INSD:DR247197.1,INSD:EL296033.1,
FT                   INSD:EL256742.1,INSD:DR358815.1,INSD:EL211198.1,
FT                   INSD:ES020354.1,INSD:EH993906.1,INSD:EG481336.1,
FT                   INSD:DR358823.1,INSD:BP781035.1,INSD:DR247280.1,
FT                   INSD:EH802445.1,INSD:DR247238.1,INSD:DR247067.1,
FT                   INSD:EH930082.1,INSD:DR247172.1,INSD:AV526595.1,
FT                   INSD:EH969324.1,INSD:DR247079.1,INSD:EL286783.1,
FT                   INSD:EH987853.1,INSD:EH919103.1,INSD:DR247288.1,
FT                   INSD:EH975317.1,INSD:ES122321.1,INSD:EL120615.1,
FT                   INSD:EL996101.1,INSD:AV823836.1,INSD:EL236918.1,
FT                   INSD:DR247218.1,INSD:DR247112.1,INSD:DR247175.1,
FT                   INSD:EG492679.1,INSD:DR247206.1,INSD:ES045621.1,
FT                   INSD:AV550197.1,INSD:EH810928.1,INSD:EL275688.1,
FT                   INSD:EL038284.1,INSD:ES121416.1,INSD:ES092555.1,
FT                   INSD:BP853235.1,INSD:DR247158.1,INSD:DR247070.1,
FT                   INSD:EL198416.1,INSD:DR247193.1,INSD:EL131256.1,
FT                   INSD:DR247160.1,INSD:DR247134.1,INSD:DR247155.1,
FT                   INSD:DR247200.1,INSD:EL117636.1,INSD:EL970249.1,
FT                   INSD:EL002561.1,INSD:DR247186.1,INSD:EH974733.1,
FT                   INSD:EH982669.1,INSD:DR247203.1,INSD:EL194417.1,
FT                   INSD:ES116202.1,INSD:DR247213.1,INSD:DR247063.1,
FT                   INSD:EH978783.1,INSD:DR247254.1,INSD:EL273877.1,
FT                   INSD:T41850.1,INSD:EL089267.1,INSD:DR354978.1,
FT                   INSD:EG481332.1,INSD:DR247125.1,INSD:DR247177.1,
FT                   INSD:AV564838.1,INSD:ES138620.1,INSD:EH959971.1,
FT                   INSD:EG439449.1,INSD:EL093572.1,INSD:EL110173.1,
FT                   INSD:EL061438.1,INSD:EL243186.1,INSD:EL214344.1,
FT                   INSD:EL108560.1,INSD:EH853413.1,INSD:DR247182.1,
FT                   INSD:DR247269.1,INSD:DR247124.1,INSD:ES151083.1,
FT                   INSD:EH908130.1,INSD:T43049.1,INSD:DR247189.1,
FT                   INSD:BP562606.1,INSD:DR358822.1,INSD:DR247060.1,
FT                   INSD:EL068097.1,INSD:EL036233.1,INSD:DR247092.1,
FT                   INSD:DR247209.1,INSD:DR358812.1,INSD:EL202238.1,
FT                   INSD:EH903973.1,INSD:DR247077.1,INSD:EL293444.1,
FT                   INSD:DR358825.1,INSD:CB185607.1,INSD:DR247056.1,
FT                   INSD:EL318672.1,INSD:DR247290.1,INSD:ES054425.1,
FT                   INSD:DR247247.1,INSD:DR247106.1,INSD:EH797739.1,
FT                   INSD:DR358820.1,INSD:ES033411.1,INSD:EL126423.1,
FT                   INSD:EL240791.1,INSD:EH859726.1,INSD:EL185957.1,
FT                   INSD:EH917601.1,INSD:AV557226.1,INSD:ES012488.1,
FT                   INSD:BP567064.1,INSD:ES080142.1,INSD:DR247205.1,
FT                   INSD:EL210092.1,INSD:EL041909.1,INSD:BP622949.1,
FT                   INSD:EL296474.1,INSD:DR247085.1,INSD:DR247293.1,
FT                   INSD:ES102440.1,INSD:DR247248.1,INSD:EH947602.1,
FT                   INSD:BP864526.1,INSD:ES205884.1,INSD:ES214898.1,
FT                   INSD:EH808943.1,INSD:EL191027.1,INSD:DR247222.1,
FT                   INSD:EL277103.1,INSD:H36862.1,INSD:EL088768.1,
FT                   INSD:EL287680.1,INSD:EL239840.1,INSD:DR247135.1,
FT                   INSD:DR247098.1,INSD:EL028114.1,INSD:EL207862.1,
FT                   INSD:EL334993.1,INSD:AV530330.1,INSD:DR247246.1,
FT                   INSD:DR247123.1,INSD:EL165351.1,INSD:DR247296.1,
FT                   INSD:DR247116.1,INSD:ES039642.1,INSD:BP821466.1,
FT                   INSD:ES113638.1,INSD:EL083742.1,INSD:DR247202.1,
FT                   INSD:DR247058.1,INSD:ES158880.1,INSD:EL300908.1,
FT                   INSD:DR247103.1,INSD:EL274413.1,INSD:EH888137.1,
FT                   INSD:EG500319.1,INSD:EH837490.1,INSD:DR247282.1,
FT                   INSD:AV810215.1,INSD:BP828729.1,INSD:AV442107.1,
FT                   INSD:DR247228.1,INSD:AA721872.1,INSD:DR358811.1,
FT                   INSD:EL228719.1,INSD:EL329863.1,INSD:EL001909.1,
FT                   INSD:AV563055.1,INSD:BP561031.2,INSD:BP659181.1,
FT                   INSD:EL219395.1,INSD:EL155385.1,INSD:BP825904.1,
FT                   INSD:BP823642.1,INSD:ES053280.1,INSD:EL014651.1,
FT                   INSD:EL238314.1,INSD:EL236672.1,INSD:EH873291.1,
FT                   INSD:DR247131.1,INSD:EL230264.1,INSD:DR247230.1,
FT                   INSD:DR247257.1,INSD:DR247062.1,INSD:EL079929.1,
FT                   INSD:DR247115.1,INSD:AV550722.1,INSD:DR247285.1,
FT                   INSD:EL982148.1,INSD:BP637325.1,INSD:ES129323.1,
FT                   INSD:EH867088.1,INSD:DR247294.1,INSD:DR247075.1,
FT                   INSD:EL284939.1,INSD:AV551779.1,INSD:DR247133.1,
FT                   INSD:DR247165.1,INSD:EL988883.1,INSD:EH797212.1,
FT                   INSD:DR247179.1,INSD:DR358816.1,INSD:EH948813.1,
FT                   INSD:DR247100.1,INSD:ES181240.1,INSD:DR247167.1,
FT                   INSD:EL319161.1,INSD:EL997000.1,INSD:EL029898.1,
FT                   INSD:DR247178.1,INSD:DR247187.1,INSD:EL173309.1,
FT                   INSD:ES104273.1,INSD:EL023437.1,INSD:EG439445.1,
FT                   INSD:EL976525.1,INSD:ES196076.1,INSD:DR247253.1,
FT                   INSD:EL289765.1,INSD:DR247094.1,INSD:AV812529.1,
FT                   INSD:ES046060.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX827573.1"
FT                   /protein_id="AEE81878.1"
FT                   /translation="MEGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGE
FT                   LSSWSFYRAGIAEFIATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVY
FT                   CTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLG
FT                   GGANTVAHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPVWTPLLVPVC"
FT   gene            193528..198582
FT                   /gene="TRM15"
FT                   /gene_synonym="A_IG005I10.23"
FT                   /gene_synonym="A_IG005I10_23"
FT                   /gene_synonym="F5I10.23"
FT                   /gene_synonym="F5I10_23"
FT                   /gene_synonym="TON1 Recruiting Motif 15"
FT                   /locus_tag="AT4G00440"
FT   mRNA            join(193528..194667,195119..195311,195401..195471,
FT                   195562..196915,196991..197121,197230..197416,
FT                   197503..198579)
FT                   /gene="TRM15"
FT                   /gene_synonym="A_IG005I10.23"
FT                   /gene_synonym="A_IG005I10_23"
FT                   /gene_synonym="F5I10.23"
FT                   /gene_synonym="F5I10_23"
FT                   /gene_synonym="TON1 Recruiting Motif 15"
FT                   /locus_tag="AT4G00440"
FT                   /product="GPI-anchored adhesin-like protein, putative
FT                   (DUF3741)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL228223.1,INSD:EG478706.1,INSD:BP562509.2,
FT                   INSD:EL330380.1,INSD:EL160118.1,INSD:EH925825.1,
FT                   INSD:BP619278.1,INSD:EH855420.1,INSD:BP784538.1,
FT                   INSD:BP562069.2,INSD:BP822742.1,INSD:BP837095.1"
FT   mRNA            join(193528..194667,195119..195311,195401..195471,
FT                   195562..196915,196991..197121,197230..197416,
FT                   197503..198112,198212..198579)
FT                   /gene="TRM15"
FT                   /gene_synonym="A_IG005I10.23"
FT                   /gene_synonym="A_IG005I10_23"
FT                   /gene_synonym="F5I10.23"
FT                   /gene_synonym="F5I10_23"
FT                   /gene_synonym="TON1 Recruiting Motif 15"
FT                   /locus_tag="AT4G00440"
FT                   /product="GPI-anchored adhesin-like protein, putative
FT                   (DUF3741)"
FT   mRNA            join(193605..193681,193795..194667,195119..195311,
FT                   195401..195471,195562..196915,196991..197121,
FT                   197230..197416,197503..198112,198212..198582)
FT                   /gene="TRM15"
FT                   /gene_synonym="A_IG005I10.23"
FT                   /gene_synonym="A_IG005I10_23"
FT                   /gene_synonym="F5I10.23"
FT                   /gene_synonym="F5I10_23"
FT                   /gene_synonym="TON1 Recruiting Motif 15"
FT                   /locus_tag="AT4G00440"
FT                   /product="GPI-anchored adhesin-like protein, putative
FT                   (DUF3741)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL228223.1,INSD:EG478706.1,INSD:BP562509.2,
FT                   INSD:EL330380.1,INSD:EL160118.1,INSD:EH925825.1,
FT                   INSD:BP619278.1,INSD:EH855420.1,INSD:AV524050.1,
FT                   INSD:BP562069.2,INSD:BP822742.1,INSD:BP837095.1"
FT   mRNA            join(193879..194667,195119..195311,195401..195471,
FT                   195562..196915,196991..197121,197230..197416,
FT                   197503..198112,198207..198579)
FT                   /gene="TRM15"
FT                   /gene_synonym="A_IG005I10.23"
FT                   /gene_synonym="A_IG005I10_23"
FT                   /gene_synonym="F5I10.23"
FT                   /gene_synonym="F5I10_23"
FT                   /gene_synonym="TON1 Recruiting Motif 15"
FT                   /locus_tag="AT4G00440"
FT                   /product="GPI-anchored adhesin-like protein, putative
FT                   (DUF3741)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP562509.2,INSD:EL160118.1,INSD:BP619278.1,
FT                   INSD:BP611381.1,INSD:BP611532.1,INSD:EL228223.1,
FT                   INSD:ES166764.1,INSD:BP794837.1,INSD:EG478706.1,
FT                   INSD:EL330380.1,INSD:BP652138.1,INSD:EH925825.1,
FT                   INSD:EH855420.1,INSD:EH930755.1,INSD:BP562069.2,
FT                   INSD:BP822742.1,INSD:BP837095.1,INSD:BP602257.1,
FT                   INSD:AV806303.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK227177.1,INSD:BT008655.1,INSD:AK221998.1"
FT   mRNA            join(194985..195028,195119..195311,195401..195471,
FT                   195562..196915,196991..197121,197230..197416,
FT                   197503..198579)
FT                   /gene="TRM15"
FT                   /gene_synonym="A_IG005I10.23"
FT                   /gene_synonym="A_IG005I10_23"
FT                   /gene_synonym="F5I10.23"
FT                   /gene_synonym="F5I10_23"
FT                   /gene_synonym="TON1 Recruiting Motif 15"
FT                   /locus_tag="AT4G00440"
FT                   /product="GPI-anchored adhesin-like protein, putative
FT                   (DUF3741)"
FT   CDS_pept        join(195176..195311,195401..195471,195562..196915,
FT                   196991..197121,197230..197416,197503..198112,
FT                   198207..198225)
FT                   /codon_start=1
FT                   /gene="TRM15"
FT                   /gene_synonym="A_IG005I10.23"
FT                   /gene_synonym="A_IG005I10_23"
FT                   /gene_synonym="F5I10.23"
FT                   /gene_synonym="F5I10_23"
FT                   /gene_synonym="TON1 Recruiting Motif 15"
FT                   /locus_tag="AT4G00440"
FT                   /product="GPI-anchored adhesin-like protein, putative
FT                   (DUF3741)"
FT                   /note="FUNCTIONS IN: molecular_function unknown; INVOLVED
FT                   IN: biological_process unknown; LOCATED IN: mitochondrion;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Protein of
FT                   unknown function DUF3741 (InterPro:IPR022212); BEST
FT                   Arabidopsis thaliana protein match is: Phosphatidylinositol
FT                   N-acetyglucosaminlytransferase subunit P-related
FT                   (TAIR:AT2G45900.1); Has 1283 Blast hits to 1059 proteins in
FT                   155 species: Archae - 0; Bacteria - 77; Metazoa - 265;
FT                   Fungi - 74; Plants - 239; Viruses - 0; Other Eukaryotes -
FT                   628 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00440"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00440.2"
FT                   /db_xref="GOA:A8MQI6"
FT                   /db_xref="InterPro:IPR022212"
FT                   /db_xref="InterPro:IPR025486"
FT                   /db_xref="UniProtKB/TrEMBL:A8MQI6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL228223.1,INSD:EG478706.1,INSD:BP562509.2,
FT                   INSD:EL330380.1,INSD:EL160118.1,INSD:EH925825.1,
FT                   INSD:BP619278.1,INSD:EH855420.1,INSD:AV524050.1,
FT                   INSD:BP562069.2,INSD:BP822742.1,INSD:BP837095.1"
FT                   /protein_id="AEE81881.1"
FT                   /translation="MAKKTQRRAAARQEREQLGCMWGFMNMFSFRHGPLAHKLLLDQKH
FT                   ASGNPKNNELNKSKFREKDAQETHVGEERNITITIIKPSVKKLIAEELSIDKEIKKQRE
FT                   NAEAGQLSDSELEGRRRKNQRRKNKTRKKSCDNFSHMNLVDSEEPLVQRRNRRSARSVD
FT                   IDNMIEEFYSEIHRRSTSHAKNDEDYKEKLRELVKFLISQKLLHGNRPRGNSEILTSKD
FT                   LMEVFQILGSDEELFLKLLQDPEILVPREKGAESLSLVESEQSSLADKKWSSFFRRKDE
FT                   PQEECEASDRIFILKPRSASFSSPDIGNSRGSSPDSHLMGNKLQNERNSSHYFLSEIKR
FT                   KLKHAIKKEQPAGGFGEGFPKTKDHFFLERMAKPSTSQKKSHSEDDKKQRVSNIYTEAK
FT                   KHLSEMLNNGDLDSKSTSRQVQRSLGRILSFPEYLSPLNSPGRRWEKSSTAHKKSASAD
FT                   FINLVNIKKETHASQPEENTDIQVCNLSKEPDDSIQPIASEPNEKSVDIEDETANEDNM
FT                   FSAGSADDVMIPNELDEVPEEASSTLIGDLSKVEAQDEQRDSINSKQTSLEESQPPLSS
FT                   SVASPSHCLAQTEECKSAITDFPEWSSPISVLEPLFVEDDISPAKMRSQSGEAEVQPWC
FT                   IHFDEKDPAPTYRENSVTSDKELVFKYVKAVLDAVDSDIEELYLKAQFSDQLLEPALIS
FT                   NIPFCPNQLCPDHELLFDCINEALMELCCCPPWASFVTPRTRVFSTVKSIIHEVQEAVY
FT                   WHLLPLPLPHALDQIVRKDMARAGNWLDIRCDIDCIGFETSELILNELLEELILNNTEH
FT                   SLVSPELKTDGSILILESTEPCR"
FT   CDS_pept        join(195176..195311,195401..195471,195562..196915,
FT                   196991..197121,197230..197416,197503..198112,
FT                   198212..198221)
FT                   /codon_start=1
FT                   /gene="TRM15"
FT                   /gene_synonym="A_IG005I10.23"
FT                   /gene_synonym="A_IG005I10_23"
FT                   /gene_synonym="F5I10.23"
FT                   /gene_synonym="F5I10_23"
FT                   /gene_synonym="TON1 Recruiting Motif 15"
FT                   /locus_tag="AT4G00440"
FT                   /product="GPI-anchored adhesin-like protein, putative
FT                   (DUF3741)"
FT                   /db_xref="InterPro:IPR022212"
FT                   /db_xref="InterPro:IPR025486"
FT                   /db_xref="UniProtKB/TrEMBL:A8MQN3"
FT                   /protein_id="ANM66186.1"
FT                   /translation="MAKKTQRRAAARQEREQLGCMWGFMNMFSFRHGPLAHKLLLDQKH
FT                   ASGNPKNNELNKSKFREKDAQETHVGEERNITITIIKPSVKKLIAEELSIDKEIKKQRE
FT                   NAEAGQLSDSELEGRRRKNQRRKNKTRKKSCDNFSHMNLVDSEEPLVQRRNRRSARSVD
FT                   IDNMIEEFYSEIHRRSTSHAKNDEDYKEKLRELVKFLISQKLLHGNRPRGNSEILTSKD
FT                   LMEVFQILGSDEELFLKLLQDPEILVPREKGAESLSLVESEQSSLADKKWSSFFRRKDE
FT                   PQEECEASDRIFILKPRSASFSSPDIGNSRGSSPDSHLMGNKLQNERNSSHYFLSEIKR
FT                   KLKHAIKKEQPAGGFGEGFPKTKDHFFLERMAKPSTSQKKSHSEDDKKQRVSNIYTEAK
FT                   KHLSEMLNNGDLDSKSTSRQVQRSLGRILSFPEYLSPLNSPGRRWEKSSTAHKKSASAD
FT                   FINLVNIKKETHASQPEENTDIQVCNLSKEPDDSIQPIASEPNEKSVDIEDETANEDNM
FT                   FSAGSADDVMIPNELDEVPEEASSTLIGDLSKVEAQDEQRDSINSKQTSLEESQPPLSS
FT                   SVASPSHCLAQTEECKSAITDFPEWSSPISVLEPLFVEDDISPAKMRSQSGEAEVQPWC
FT                   IHFDEKDPAPTYRENSVTSDKELVFKYVKAVLDAVDSDIEELYLKAQFSDQLLEPALIS
FT                   NIPFCPNQLCPDHELLFDCINEALMELCCCPPWASFVTPRTRVFSTVKSIIHEVQEAVY
FT                   WHLLPLPLPHALDQIVRKDMARAGNWLDIRCDIDCIGFETSELILNELLEELILNNTEH
FT                   SLVSPELKTDGSILILERTM"
FT   CDS_pept        join(195176..195311,195401..195471,195562..196915,
FT                   196991..197121,197230..197416,197503..198112,
FT                   198212..198221)
FT                   /codon_start=1
FT                   /gene="TRM15"
FT                   /gene_synonym="A_IG005I10.23"
FT                   /gene_synonym="A_IG005I10_23"
FT                   /gene_synonym="F5I10.23"
FT                   /gene_synonym="F5I10_23"
FT                   /gene_synonym="TON1 Recruiting Motif 15"
FT                   /locus_tag="AT4G00440"
FT                   /product="GPI-anchored adhesin-like protein, putative
FT                   (DUF3741)"
FT                   /note="FUNCTIONS IN: molecular_function unknown; INVOLVED
FT                   IN: biological_process unknown; LOCATED IN: mitochondrion;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Protein of
FT                   unknown function DUF3741 (InterPro:IPR022212); BEST
FT                   Arabidopsis thaliana protein match is: Phosphatidylinositol
FT                   N-acetyglucosaminlytransferase subunit P-related
FT                   (TAIR:AT2G45900.1); Has 1283 Blast hits to 1059 proteins in
FT                   155 species: Archae - 0; Bacteria - 77; Metazoa - 265;
FT                   Fungi - 74; Plants - 239; Viruses - 0; Other Eukaryotes -
FT                   628 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00440"
FT                   /db_xref="InterPro:IPR022212"
FT                   /db_xref="InterPro:IPR025486"
FT                   /db_xref="UniProtKB/TrEMBL:A8MQN3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL228223.1,INSD:EG478706.1,INSD:BP562509.2,
FT                   INSD:EL330380.1,INSD:EL160118.1,INSD:EH925825.1,
FT                   INSD:BP619278.1,INSD:EH855420.1,INSD:BP784538.1,
FT                   INSD:BP562069.2,INSD:BP822742.1,INSD:BP837095.1"
FT                   /protein_id="AEE81882.1"
FT                   /translation="MAKKTQRRAAARQEREQLGCMWGFMNMFSFRHGPLAHKLLLDQKH
FT                   ASGNPKNNELNKSKFREKDAQETHVGEERNITITIIKPSVKKLIAEELSIDKEIKKQRE
FT                   NAEAGQLSDSELEGRRRKNQRRKNKTRKKSCDNFSHMNLVDSEEPLVQRRNRRSARSVD
FT                   IDNMIEEFYSEIHRRSTSHAKNDEDYKEKLRELVKFLISQKLLHGNRPRGNSEILTSKD
FT                   LMEVFQILGSDEELFLKLLQDPEILVPREKGAESLSLVESEQSSLADKKWSSFFRRKDE
FT                   PQEECEASDRIFILKPRSASFSSPDIGNSRGSSPDSHLMGNKLQNERNSSHYFLSEIKR
FT                   KLKHAIKKEQPAGGFGEGFPKTKDHFFLERMAKPSTSQKKSHSEDDKKQRVSNIYTEAK
FT                   KHLSEMLNNGDLDSKSTSRQVQRSLGRILSFPEYLSPLNSPGRRWEKSSTAHKKSASAD
FT                   FINLVNIKKETHASQPEENTDIQVCNLSKEPDDSIQPIASEPNEKSVDIEDETANEDNM
FT                   FSAGSADDVMIPNELDEVPEEASSTLIGDLSKVEAQDEQRDSINSKQTSLEESQPPLSS
FT                   SVASPSHCLAQTEECKSAITDFPEWSSPISVLEPLFVEDDISPAKMRSQSGEAEVQPWC
FT                   IHFDEKDPAPTYRENSVTSDKELVFKYVKAVLDAVDSDIEELYLKAQFSDQLLEPALIS
FT                   NIPFCPNQLCPDHELLFDCINEALMELCCCPPWASFVTPRTRVFSTVKSIIHEVQEAVY
FT                   WHLLPLPLPHALDQIVRKDMARAGNWLDIRCDIDCIGFETSELILNELLEELILNNTEH
FT                   SLVSPELKTDGSILILERTM"
FT   CDS_pept        join(195176..195311,195401..195471,195562..196915,
FT                   196991..197121,197230..197416,197503..198119)
FT                   /codon_start=1
FT                   /gene="TRM15"
FT                   /gene_synonym="A_IG005I10.23"
FT                   /gene_synonym="A_IG005I10_23"
FT                   /gene_synonym="F5I10.23"
FT                   /gene_synonym="F5I10_23"
FT                   /gene_synonym="TON1 Recruiting Motif 15"
FT                   /locus_tag="AT4G00440"
FT                   /product="GPI-anchored adhesin-like protein, putative
FT                   (DUF3741)"
FT                   /db_xref="InterPro:IPR022212"
FT                   /db_xref="InterPro:IPR025486"
FT                   /db_xref="UniProtKB/TrEMBL:Q7Y207"
FT                   /protein_id="ANM66185.1"
FT                   /translation="MAKKTQRRAAARQEREQLGCMWGFMNMFSFRHGPLAHKLLLDQKH
FT                   ASGNPKNNELNKSKFREKDAQETHVGEERNITITIIKPSVKKLIAEELSIDKEIKKQRE
FT                   NAEAGQLSDSELEGRRRKNQRRKNKTRKKSCDNFSHMNLVDSEEPLVQRRNRRSARSVD
FT                   IDNMIEEFYSEIHRRSTSHAKNDEDYKEKLRELVKFLISQKLLHGNRPRGNSEILTSKD
FT                   LMEVFQILGSDEELFLKLLQDPEILVPREKGAESLSLVESEQSSLADKKWSSFFRRKDE
FT                   PQEECEASDRIFILKPRSASFSSPDIGNSRGSSPDSHLMGNKLQNERNSSHYFLSEIKR
FT                   KLKHAIKKEQPAGGFGEGFPKTKDHFFLERMAKPSTSQKKSHSEDDKKQRVSNIYTEAK
FT                   KHLSEMLNNGDLDSKSTSRQVQRSLGRILSFPEYLSPLNSPGRRWEKSSTAHKKSASAD
FT                   FINLVNIKKETHASQPEENTDIQVCNLSKEPDDSIQPIASEPNEKSVDIEDETANEDNM
FT                   FSAGSADDVMIPNELDEVPEEASSTLIGDLSKVEAQDEQRDSINSKQTSLEESQPPLSS
FT                   SVASPSHCLAQTEECKSAITDFPEWSSPISVLEPLFVEDDISPAKMRSQSGEAEVQPWC
FT                   IHFDEKDPAPTYRENSVTSDKELVFKYVKAVLDAVDSDIEELYLKAQFSDQLLEPALIS
FT                   NIPFCPNQLCPDHELLFDCINEALMELCCCPPWASFVTPRTRVFSTVKSIIHEVQEAVY
FT                   WHLLPLPLPHALDQIVRKDMARAGNWLDIRCDIDCIGFETSELILNELLEELILNNTEH
FT                   SLVSPELKTDGSILILERS"
FT   CDS_pept        join(195176..195311,195401..195471,195562..196915,
FT                   196991..197121,197230..197416,197503..198119)
FT                   /codon_start=1
FT                   /gene="TRM15"
FT                   /gene_synonym="A_IG005I10.23"
FT                   /gene_synonym="A_IG005I10_23"
FT                   /gene_synonym="F5I10.23"
FT                   /gene_synonym="F5I10_23"
FT                   /gene_synonym="TON1 Recruiting Motif 15"
FT                   /locus_tag="AT4G00440"
FT                   /product="GPI-anchored adhesin-like protein, putative
FT                   (DUF3741)"
FT                   /note="FUNCTIONS IN: molecular_function unknown; INVOLVED
FT                   IN: biological_process unknown; LOCATED IN: mitochondrion;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Protein of
FT                   unknown function DUF3741 (InterPro:IPR022212); BEST
FT                   Arabidopsis thaliana protein match is: Phosphatidylinositol
FT                   N-acetyglucosaminlytransferase subunit P-related
FT                   (TAIR:AT2G45900.1); Has 1239 Blast hits to 1045 proteins in
FT                   162 species: Archae - 0; Bacteria - 74; Metazoa - 262;
FT                   Fungi - 79; Plants - 239; Viruses - 0; Other Eukaryotes -
FT                   585 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00440"
FT                   /db_xref="InterPro:IPR022212"
FT                   /db_xref="InterPro:IPR025486"
FT                   /db_xref="UniProtKB/TrEMBL:Q7Y207"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP562509.2,INSD:EL160118.1,INSD:BP619278.1,
FT                   INSD:BP611381.1,INSD:BP611532.1,INSD:EL228223.1,
FT                   INSD:ES166764.1,INSD:BP794837.1,INSD:EG478706.1,
FT                   INSD:EL330380.1,INSD:BP652138.1,INSD:EH925825.1,
FT                   INSD:EH855420.1,INSD:EH930755.1,INSD:BP562069.2,
FT                   INSD:BP822742.1,INSD:BP837095.1,INSD:BP602257.1,
FT                   INSD:AV806303.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK227177.1,INSD:BT008655.1,INSD:AK221998.1"
FT                   /protein_id="AEE81880.1"
FT                   /translation="MAKKTQRRAAARQEREQLGCMWGFMNMFSFRHGPLAHKLLLDQKH
FT                   ASGNPKNNELNKSKFREKDAQETHVGEERNITITIIKPSVKKLIAEELSIDKEIKKQRE
FT                   NAEAGQLSDSELEGRRRKNQRRKNKTRKKSCDNFSHMNLVDSEEPLVQRRNRRSARSVD
FT                   IDNMIEEFYSEIHRRSTSHAKNDEDYKEKLRELVKFLISQKLLHGNRPRGNSEILTSKD
FT                   LMEVFQILGSDEELFLKLLQDPEILVPREKGAESLSLVESEQSSLADKKWSSFFRRKDE
FT                   PQEECEASDRIFILKPRSASFSSPDIGNSRGSSPDSHLMGNKLQNERNSSHYFLSEIKR
FT                   KLKHAIKKEQPAGGFGEGFPKTKDHFFLERMAKPSTSQKKSHSEDDKKQRVSNIYTEAK
FT                   KHLSEMLNNGDLDSKSTSRQVQRSLGRILSFPEYLSPLNSPGRRWEKSSTAHKKSASAD
FT                   FINLVNIKKETHASQPEENTDIQVCNLSKEPDDSIQPIASEPNEKSVDIEDETANEDNM
FT                   FSAGSADDVMIPNELDEVPEEASSTLIGDLSKVEAQDEQRDSINSKQTSLEESQPPLSS
FT                   SVASPSHCLAQTEECKSAITDFPEWSSPISVLEPLFVEDDISPAKMRSQSGEAEVQPWC
FT                   IHFDEKDPAPTYRENSVTSDKELVFKYVKAVLDAVDSDIEELYLKAQFSDQLLEPALIS
FT                   NIPFCPNQLCPDHELLFDCINEALMELCCCPPWASFVTPRTRVFSTVKSIIHEVQEAVY
FT                   WHLLPLPLPHALDQIVRKDMARAGNWLDIRCDIDCIGFETSELILNELLEELILNNTEH
FT                   SLVSPELKTDGSILILERS"
FT   gene            complement(199428..200953)
FT                   /locus_tag="AT4G03615"
FT   misc_RNA        complement(join(199428..199690,200930..200953))
FT                   /locus_tag="AT4G03615"
FT                   /note="AT4G03615.1"
FT   gene            200874..211309
FT                   /gene="CCT"
FT                   /gene_synonym="A_IG005I10.24"
FT                   /gene_synonym="A_IG005I10_24"
FT                   /gene_synonym="CENTER CITY"
FT                   /gene_synonym="CRP"
FT                   /gene_synonym="CRYPTIC PRECOCIOUS"
FT                   /gene_synonym="F5I10.24"
FT                   /gene_synonym="F5I10_24"
FT                   /gene_synonym="GCT"
FT                   /gene_synonym="GRAND CENTRAL"
FT                   /gene_synonym="MED12"
FT                   /gene_synonym="mediator 12"
FT                   /locus_tag="AT4G00450"
FT                   /note="Encodes the Arabidopsis homolog of the
FT                   transcriptional regulator MED12, is dynamically expressed
FT                   during embryogenesis and regulates both developmental
FT                   timing and the radial pattern formation. Involved in
FT                   flowering time. The mutant enhances the expression of the
FT                   flowering time (FT) gene. A knockout mutant of this gene
FT                   showed late-flowering phenotype."
FT   mRNA            join(200874..201542,202241..202549,202633..202692,
FT                   202907..203012,203378..203446,203551..203604,
FT                   203724..203828,203968..204114,204198..204542,
FT                   204625..206942,207040..209649,209796..210108,
FT                   210211..211030)
FT                   /gene="CCT"
FT                   /gene_synonym="A_IG005I10.24"
FT                   /gene_synonym="A_IG005I10_24"
FT                   /gene_synonym="CENTER CITY"
FT                   /gene_synonym="CRP"
FT                   /gene_synonym="CRYPTIC PRECOCIOUS"
FT                   /gene_synonym="F5I10.24"
FT                   /gene_synonym="F5I10_24"
FT                   /gene_synonym="GCT"
FT                   /gene_synonym="GRAND CENTRAL"
FT                   /gene_synonym="MED12"
FT                   /gene_synonym="mediator 12"
FT                   /locus_tag="AT4G00450"
FT                   /product="RNA polymerase II transcription mediator"
FT   mRNA            join(200874..201542,202241..202292,202396..202549,
FT                   202633..202692,202907..203012,203378..203446,
FT                   203551..203604,203724..203828,203968..204114,
FT                   204198..204542,204625..206942,207040..209649,
FT                   209796..210108,210211..211030)
FT                   /gene="CCT"
FT                   /gene_synonym="A_IG005I10.24"
FT                   /gene_synonym="A_IG005I10_24"
FT                   /gene_synonym="CENTER CITY"
FT                   /gene_synonym="CRP"
FT                   /gene_synonym="CRYPTIC PRECOCIOUS"
FT                   /gene_synonym="F5I10.24"
FT                   /gene_synonym="F5I10_24"
FT                   /gene_synonym="GCT"
FT                   /gene_synonym="GRAND CENTRAL"
FT                   /gene_synonym="MED12"
FT                   /gene_synonym="mediator 12"
FT                   /locus_tag="AT4G00450"
FT                   /product="RNA polymerase II transcription mediator"
FT   mRNA            join(202250..202549,202633..202692,202907..203012,
FT                   203378..203446,203551..203604,203724..203828,
FT                   203968..204114,204198..204542,204625..206942,
FT                   207040..209649,209796..210108,210211..211309)
FT                   /gene="CCT"
FT                   /gene_synonym="A_IG005I10.24"
FT                   /gene_synonym="A_IG005I10_24"
FT                   /gene_synonym="CENTER CITY"
FT                   /gene_synonym="CRP"
FT                   /gene_synonym="CRYPTIC PRECOCIOUS"
FT                   /gene_synonym="F5I10.24"
FT                   /gene_synonym="F5I10_24"
FT                   /gene_synonym="GCT"
FT                   /gene_synonym="GRAND CENTRAL"
FT                   /gene_synonym="MED12"
FT                   /gene_synonym="mediator 12"
FT                   /locus_tag="AT4G00450"
FT                   /product="RNA polymerase II transcription mediator"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV545836.1,INSD:AI999580.1,INSD:AV543848.1,
FT                   INSD:ES164604.1,INSD:AU237597.1,INSD:CD529092.1,
FT                   INSD:EL033770.1,INSD:DR374005.1,INSD:ES010733.1,
FT                   INSD:BP607528.1,INSD:AV528896.1,INSD:BE530143.1,
FT                   INSD:AU228675.1,INSD:EL310640.1,INSD:EL127034.1,
FT                   INSD:EL988036.1,INSD:AV543265.1,INSD:ES076930.1,
FT                   INSD:AV529730.1,INSD:EH812007.1,INSD:EH864498.1,
FT                   INSD:ES006804.1,INSD:EH904757.1,INSD:CO048765.1,
FT                   INSD:DR259399.1,INSD:AV523257.1,INSD:ES137132.1,
FT                   INSD:AV554827.1,INSD:DR259398.1,INSD:EH891090.1,
FT                   INSD:BX838391.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK229105.1"
FT   CDS_pept        join(202425..202549,202633..202692,202907..203012,
FT                   203378..203446,203551..203604,203724..203828,
FT                   203968..204114,204198..204542,204625..206942,
FT                   207040..209649,209796..210108,210211..210666)
FT                   /codon_start=1
FT                   /gene="CCT"
FT                   /gene_synonym="A_IG005I10.24"
FT                   /gene_synonym="A_IG005I10_24"
FT                   /gene_synonym="CENTER CITY"
FT                   /gene_synonym="CRP"
FT                   /gene_synonym="CRYPTIC PRECOCIOUS"
FT                   /gene_synonym="F5I10.24"
FT                   /gene_synonym="F5I10_24"
FT                   /gene_synonym="GCT"
FT                   /gene_synonym="GRAND CENTRAL"
FT                   /gene_synonym="MED12"
FT                   /gene_synonym="mediator 12"
FT                   /locus_tag="AT4G00450"
FT                   /product="RNA polymerase II transcription mediator"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00450"
FT                   /db_xref="GOA:H3K2Y6"
FT                   /db_xref="InterPro:IPR019035"
FT                   /db_xref="UniProtKB/Swiss-Prot:H3K2Y6"
FT                   /protein_id="ANM67285.1"
FT                   /translation="MQRYHAANCTSAVNNSAIGGASARDSGRADSSSIGNYSLNSRRPP
FT                   PLTPYKLKCEKDGLNSRLGPPDFHPPTSNSPEENLTKEYVQFGYKETVDGLKESEEIIL
FT                   SQVHTFSKPVVHKCKEAVRKCLRAINESRALKRKAGQVYGVPLSGSLLCKPGFPEQRSC
FT                   GEETKKRWIESLSQQHKRLRSLADNIPGYRRKTLFEVLIRNNVPLLRATWFIKVTYLNQ
FT                   VRPSPAAISSGTPDKTQASRCEQWTKDVIEYLQYLLDELLSRNSSFPAQQTRDRSPQML
FT                   YTGSMQKNSPASTSLYGEETSLHFKWWYMVRLLQWHHAEGLLFPNLIVDWVLKLLQEKE
FT                   IFEILQLLLPIVYGVLESIVLSQTYVQSLVAIAVRFIQEPAPGGSDLVDNSRRAYTLSA
FT                   LIEMVRYLVLAAPDTFVASDFFPLPPSVAACGPNDVSYTSKAYENLEKLRSNSAEISAQ
FT                   FQGRGVLSRFEFLSFDYTISTIQRSADDLAKIASAGYPQHNVAKAVQALDKALSDGDIR
FT                   AAYSYLFEDLCNGAVDEAWITDVSPCLRSSLRWIGAISTSFVCSVFFLIEWATCDFRDF
FT                   RAGVPKDIKFSGRKDCSQVYLVIQLLKQKILGGEFTARKGKNCRNNFLGVSKPSGSMDA
FT                   FESPGPLHDIIVCWIDQHEVHKGGAKRLQLLVFELIRSGIFNPIAYVRQLIVSGMIDVI
FT                   QPAVDPERRMRHHRILKQLPGCFVHETLEEAQLFGGDKLSEAVRTYSNERRLLLRELLV
FT                   EKGKYWNNLVLSDQKSKKISTSLSSVIFPRACNAKSNSKGPRKHTKSSVDIRELKERIS
FT                   ALLQFPGMSCGVETPVRDEFQNSVKRSSGSVYSKMDQPEATPGCEDCRRAKRPKMNDEK
FT                   SSCYQGNSPIASDEEDNWWIKKGSKTVESSLKVDPQIEITKQVPRGRQKMARKTQSLAQ
FT                   LQAARIEGSQGASTSHVCDNKVSCPHHGPGVEGENQKVVDVFRTSTPVDMVSVGNSLKQ
FT                   LQFVDKRSIAVWLTTAVRQLVEEPQKSSVRVGQFNRGAPVEEKNTIRWKLGADELYSIL
FT                   FLLDISLDLVSAVKFLLWLLPKANSTPSFAVQGGRNLVTVPRNVENNMCEIGEAILVSS
FT                   LRRYENILLSADLVPEAMTALMNRAASLMSSNGKISGSAALVYTRYILKRYGSLPSVVE
FT                   WHNNFKATSEKKLLSELDHTRSGNGEYGNPLGVPAGVDNPDDYLRKKISIGGARPSRVG
FT                   LSMRDVLQRHVEEATHYLKKLIGTGTMKASLAEKNDDGYQVAQQIVVGLMDCIRQTGGA
FT                   AQEGDPSLVSSAVSAIINSVGLSVARITDFSLGNIYQNHPSGVDSSNIARYILRIHITC
FT                   LCLLKEALGERQSRVFEIALATESSTALTGVFAPVKGSRGQHQLSPESYDSNANNSTID
FT                   MSNGTGKMALSRATKITAAVSALVIGSITHGVITLERIVGLLRLKDYLDFVQFVRRTKS
FT                   SSNGSARSMGASKVESPIEVYVHWFRLLVGNCKTVSEGLVLELVGESSVVAISRMQRML
FT                   PLKLVFPPAYSIIAFVLWRPFVSNSNSNSSVHEDTHRLYQSLTMAFHDVIKHLPFRDVC
FT                   FRDTQGLYELIVADSTDAEFASVFESHGLDMHLKSVAFAPLRARLFLNSLIDCKVPSSG
FT                   YSHEGVSEAKNRHQGNGTKLVDKLVSVLDCLQPAKFHWQWVELRLLLNEQALAEKLENH
FT                   DMPLTDAIRSSCPTSEKPDASENEKNFIQILLTRLLVRPDAVPLFSEVVHLFGRSVEDS
FT                   MLKQAEWFLAGQDVLFGRKTIRQKLIIVGESKGLPTKPQFWKPWGWCNSSSSDHITANK
FT                   AGKKRKFEITSIEEGEVIEEGSGSRKVLLPRVLDENSPSVGYGITTERAFVQLVLPCID
FT                   QSSDESRSTFVNELVRQFSNIEQQLSSVTNRSTTSNKQMGTASSGSEISSNKGSTRKGL
FT                   RGGSPSLARRSSANTTDTSPPPSPAALRASMSLRLQFLLRLLPVICGEPSFKNTRHALA
FT                   STIVRLLGSRVVYEDYAVCSPRSELSKAETESTIDPSSMADLSSEVLFDRLLFVLHGLL
FT                   SNHQPKWLKPRPSSNESSKDFTLFDRDAAESLQNELSRMQLPDTIRWRIQAAMPILLPS
FT                   LRCSLSCQPHSVPPTALTLVQPSGSTAAAGTNQRNSPAISKSGTAAAQGKLKPTMLAPH
FT                   QQQEADNTDVVDPWTLLEDGTSSGLSSSNASNSSDMANLRATCWLKGAVRVRRTDLTYV
FT                   GSVDDDS"
FT   CDS_pept        join(202425..202549,202633..202692,202907..203012,
FT                   203378..203446,203551..203604,203724..203828,
FT                   203968..204114,204198..204542,204625..206942,
FT                   207040..209649,209796..210108,210211..210666)
FT                   /codon_start=1
FT                   /gene="CCT"
FT                   /gene_synonym="A_IG005I10.24"
FT                   /gene_synonym="A_IG005I10_24"
FT                   /gene_synonym="CENTER CITY"
FT                   /gene_synonym="CRP"
FT                   /gene_synonym="CRYPTIC PRECOCIOUS"
FT                   /gene_synonym="F5I10.24"
FT                   /gene_synonym="F5I10_24"
FT                   /gene_synonym="GCT"
FT                   /gene_synonym="GRAND CENTRAL"
FT                   /gene_synonym="MED12"
FT                   /gene_synonym="mediator 12"
FT                   /locus_tag="AT4G00450"
FT                   /product="RNA polymerase II transcription mediator"
FT                   /db_xref="GOA:H3K2Y6"
FT                   /db_xref="InterPro:IPR019035"
FT                   /db_xref="UniProtKB/Swiss-Prot:H3K2Y6"
FT                   /protein_id="ANM67286.1"
FT                   /translation="MQRYHAANCTSAVNNSAIGGASARDSGRADSSSIGNYSLNSRRPP
FT                   PLTPYKLKCEKDGLNSRLGPPDFHPPTSNSPEENLTKEYVQFGYKETVDGLKESEEIIL
FT                   SQVHTFSKPVVHKCKEAVRKCLRAINESRALKRKAGQVYGVPLSGSLLCKPGFPEQRSC
FT                   GEETKKRWIESLSQQHKRLRSLADNIPGYRRKTLFEVLIRNNVPLLRATWFIKVTYLNQ
FT                   VRPSPAAISSGTPDKTQASRCEQWTKDVIEYLQYLLDELLSRNSSFPAQQTRDRSPQML
FT                   YTGSMQKNSPASTSLYGEETSLHFKWWYMVRLLQWHHAEGLLFPNLIVDWVLKLLQEKE
FT                   IFEILQLLLPIVYGVLESIVLSQTYVQSLVAIAVRFIQEPAPGGSDLVDNSRRAYTLSA
FT                   LIEMVRYLVLAAPDTFVASDFFPLPPSVAACGPNDVSYTSKAYENLEKLRSNSAEISAQ
FT                   FQGRGVLSRFEFLSFDYTISTIQRSADDLAKIASAGYPQHNVAKAVQALDKALSDGDIR
FT                   AAYSYLFEDLCNGAVDEAWITDVSPCLRSSLRWIGAISTSFVCSVFFLIEWATCDFRDF
FT                   RAGVPKDIKFSGRKDCSQVYLVIQLLKQKILGGEFTARKGKNCRNNFLGVSKPSGSMDA
FT                   FESPGPLHDIIVCWIDQHEVHKGGAKRLQLLVFELIRSGIFNPIAYVRQLIVSGMIDVI
FT                   QPAVDPERRMRHHRILKQLPGCFVHETLEEAQLFGGDKLSEAVRTYSNERRLLLRELLV
FT                   EKGKYWNNLVLSDQKSKKISTSLSSVIFPRACNAKSNSKGPRKHTKSSVDIRELKERIS
FT                   ALLQFPGMSCGVETPVRDEFQNSVKRSSGSVYSKMDQPEATPGCEDCRRAKRPKMNDEK
FT                   SSCYQGNSPIASDEEDNWWIKKGSKTVESSLKVDPQIEITKQVPRGRQKMARKTQSLAQ
FT                   LQAARIEGSQGASTSHVCDNKVSCPHHGPGVEGENQKVVDVFRTSTPVDMVSVGNSLKQ
FT                   LQFVDKRSIAVWLTTAVRQLVEEPQKSSVRVGQFNRGAPVEEKNTIRWKLGADELYSIL
FT                   FLLDISLDLVSAVKFLLWLLPKANSTPSFAVQGGRNLVTVPRNVENNMCEIGEAILVSS
FT                   LRRYENILLSADLVPEAMTALMNRAASLMSSNGKISGSAALVYTRYILKRYGSLPSVVE
FT                   WHNNFKATSEKKLLSELDHTRSGNGEYGNPLGVPAGVDNPDDYLRKKISIGGARPSRVG
FT                   LSMRDVLQRHVEEATHYLKKLIGTGTMKASLAEKNDDGYQVAQQIVVGLMDCIRQTGGA
FT                   AQEGDPSLVSSAVSAIINSVGLSVARITDFSLGNIYQNHPSGVDSSNIARYILRIHITC
FT                   LCLLKEALGERQSRVFEIALATESSTALTGVFAPVKGSRGQHQLSPESYDSNANNSTID
FT                   MSNGTGKMALSRATKITAAVSALVIGSITHGVITLERIVGLLRLKDYLDFVQFVRRTKS
FT                   SSNGSARSMGASKVESPIEVYVHWFRLLVGNCKTVSEGLVLELVGESSVVAISRMQRML
FT                   PLKLVFPPAYSIIAFVLWRPFVSNSNSNSSVHEDTHRLYQSLTMAFHDVIKHLPFRDVC
FT                   FRDTQGLYELIVADSTDAEFASVFESHGLDMHLKSVAFAPLRARLFLNSLIDCKVPSSG
FT                   YSHEGVSEAKNRHQGNGTKLVDKLVSVLDCLQPAKFHWQWVELRLLLNEQALAEKLENH
FT                   DMPLTDAIRSSCPTSEKPDASENEKNFIQILLTRLLVRPDAVPLFSEVVHLFGRSVEDS
FT                   MLKQAEWFLAGQDVLFGRKTIRQKLIIVGESKGLPTKPQFWKPWGWCNSSSSDHITANK
FT                   AGKKRKFEITSIEEGEVIEEGSGSRKVLLPRVLDENSPSVGYGITTERAFVQLVLPCID
FT                   QSSDESRSTFVNELVRQFSNIEQQLSSVTNRSTTSNKQMGTASSGSEISSNKGSTRKGL
FT                   RGGSPSLARRSSANTTDTSPPPSPAALRASMSLRLQFLLRLLPVICGEPSFKNTRHALA
FT                   STIVRLLGSRVVYEDYAVCSPRSELSKAETESTIDPSSMADLSSEVLFDRLLFVLHGLL
FT                   SNHQPKWLKPRPSSNESSKDFTLFDRDAAESLQNELSRMQLPDTIRWRIQAAMPILLPS
FT                   LRCSLSCQPHSVPPTALTLVQPSGSTAAAGTNQRNSPAISKSGTAAAQGKLKPTMLAPH
FT                   QQQEADNTDVVDPWTLLEDGTSSGLSSSNASNSSDMANLRATCWLKGAVRVRRTDLTYV
FT                   GSVDDDS"
FT   CDS_pept        join(202425..202549,202633..202692,202907..203012,
FT                   203378..203446,203551..203604,203724..203828,
FT                   203968..204114,204198..204542,204625..206942,
FT                   207040..209649,209796..210108,210211..210666)
FT                   /codon_start=1
FT                   /gene="CCT"
FT                   /gene_synonym="A_IG005I10.24"
FT                   /gene_synonym="A_IG005I10_24"
FT                   /gene_synonym="CENTER CITY"
FT                   /gene_synonym="CRP"
FT                   /gene_synonym="CRYPTIC PRECOCIOUS"
FT                   /gene_synonym="F5I10.24"
FT                   /gene_synonym="F5I10_24"
FT                   /gene_synonym="GCT"
FT                   /gene_synonym="GRAND CENTRAL"
FT                   /gene_synonym="MED12"
FT                   /gene_synonym="mediator 12"
FT                   /locus_tag="AT4G00450"
FT                   /product="RNA polymerase II transcription mediator"
FT                   /note="CENTER CITY (CCT); FUNCTIONS IN: RNA polymerase II
FT                   transcription mediator activity; INVOLVED IN:
FT                   photoperiodism, flowering, regulation of development,
FT                   heterochronic, regulation of radial pattern formation;
FT                   LOCATED IN: mediator complex, chloroplast; EXPRESSED IN: 22
FT                   plant structures; EXPRESSED DURING: 14 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Mediator complex, subunit Med12
FT                   (InterPro:IPR019035); Has 216 Blast hits to 184 proteins in
FT                   75 species: Archae - 0; Bacteria - 0; Metazoa - 42; Fungi -
FT                   65; Plants - 86; Viruses - 0; Other Eukaryotes - 23
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:H3K2Y6"
FT                   /db_xref="InterPro:IPR019035"
FT                   /db_xref="UniProtKB/Swiss-Prot:H3K2Y6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV545836.1,INSD:AI999580.1,INSD:AV543848.1,
FT                   INSD:ES164604.1,INSD:AU237597.1,INSD:CD529092.1,
FT                   INSD:EL033770.1,INSD:DR374005.1,INSD:ES010733.1,
FT                   INSD:BP607528.1,INSD:AV528896.1,INSD:BE530143.1,
FT                   INSD:AU228675.1,INSD:EL310640.1,INSD:EL127034.1,
FT                   INSD:EL988036.1,INSD:AV543265.1,INSD:ES076930.1,
FT                   INSD:AV529730.1,INSD:EH812007.1,INSD:EH864498.1,
FT                   INSD:ES006804.1,INSD:EH904757.1,INSD:CO048765.1,
FT                   INSD:DR259399.1,INSD:AV523257.1,INSD:ES137132.1,
FT                   INSD:AV554827.1,INSD:DR259398.1,INSD:EH891090.1,
FT                   INSD:BX838391.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK229105.1"
FT                   /protein_id="AEE81883.2"
FT                   /translation="MQRYHAANCTSAVNNSAIGGASARDSGRADSSSIGNYSLNSRRPP
FT                   PLTPYKLKCEKDGLNSRLGPPDFHPPTSNSPEENLTKEYVQFGYKETVDGLKESEEIIL
FT                   SQVHTFSKPVVHKCKEAVRKCLRAINESRALKRKAGQVYGVPLSGSLLCKPGFPEQRSC
FT                   GEETKKRWIESLSQQHKRLRSLADNIPGYRRKTLFEVLIRNNVPLLRATWFIKVTYLNQ
FT                   VRPSPAAISSGTPDKTQASRCEQWTKDVIEYLQYLLDELLSRNSSFPAQQTRDRSPQML
FT                   YTGSMQKNSPASTSLYGEETSLHFKWWYMVRLLQWHHAEGLLFPNLIVDWVLKLLQEKE
FT                   IFEILQLLLPIVYGVLESIVLSQTYVQSLVAIAVRFIQEPAPGGSDLVDNSRRAYTLSA
FT                   LIEMVRYLVLAAPDTFVASDFFPLPPSVAACGPNDVSYTSKAYENLEKLRSNSAEISAQ
FT                   FQGRGVLSRFEFLSFDYTISTIQRSADDLAKIASAGYPQHNVAKAVQALDKALSDGDIR
FT                   AAYSYLFEDLCNGAVDEAWITDVSPCLRSSLRWIGAISTSFVCSVFFLIEWATCDFRDF
FT                   RAGVPKDIKFSGRKDCSQVYLVIQLLKQKILGGEFTARKGKNCRNNFLGVSKPSGSMDA
FT                   FESPGPLHDIIVCWIDQHEVHKGGAKRLQLLVFELIRSGIFNPIAYVRQLIVSGMIDVI
FT                   QPAVDPERRMRHHRILKQLPGCFVHETLEEAQLFGGDKLSEAVRTYSNERRLLLRELLV
FT                   EKGKYWNNLVLSDQKSKKISTSLSSVIFPRACNAKSNSKGPRKHTKSSVDIRELKERIS
FT                   ALLQFPGMSCGVETPVRDEFQNSVKRSSGSVYSKMDQPEATPGCEDCRRAKRPKMNDEK
FT                   SSCYQGNSPIASDEEDNWWIKKGSKTVESSLKVDPQIEITKQVPRGRQKMARKTQSLAQ
FT                   LQAARIEGSQGASTSHVCDNKVSCPHHGPGVEGENQKVVDVFRTSTPVDMVSVGNSLKQ
FT                   LQFVDKRSIAVWLTTAVRQLVEEPQKSSVRVGQFNRGAPVEEKNTIRWKLGADELYSIL
FT                   FLLDISLDLVSAVKFLLWLLPKANSTPSFAVQGGRNLVTVPRNVENNMCEIGEAILVSS
FT                   LRRYENILLSADLVPEAMTALMNRAASLMSSNGKISGSAALVYTRYILKRYGSLPSVVE
FT                   WHNNFKATSEKKLLSELDHTRSGNGEYGNPLGVPAGVDNPDDYLRKKISIGGARPSRVG
FT                   LSMRDVLQRHVEEATHYLKKLIGTGTMKASLAEKNDDGYQVAQQIVVGLMDCIRQTGGA
FT                   AQEGDPSLVSSAVSAIINSVGLSVARITDFSLGNIYQNHPSGVDSSNIARYILRIHITC
FT                   LCLLKEALGERQSRVFEIALATESSTALTGVFAPVKGSRGQHQLSPESYDSNANNSTID
FT                   MSNGTGKMALSRATKITAAVSALVIGSITHGVITLERIVGLLRLKDYLDFVQFVRRTKS
FT                   SSNGSARSMGASKVESPIEVYVHWFRLLVGNCKTVSEGLVLELVGESSVVAISRMQRML
FT                   PLKLVFPPAYSIIAFVLWRPFVSNSNSNSSVHEDTHRLYQSLTMAFHDVIKHLPFRDVC
FT                   FRDTQGLYELIVADSTDAEFASVFESHGLDMHLKSVAFAPLRARLFLNSLIDCKVPSSG
FT                   YSHEGVSEAKNRHQGNGTKLVDKLVSVLDCLQPAKFHWQWVELRLLLNEQALAEKLENH
FT                   DMPLTDAIRSSCPTSEKPDASENEKNFIQILLTRLLVRPDAVPLFSEVVHLFGRSVEDS
FT                   MLKQAEWFLAGQDVLFGRKTIRQKLIIVGESKGLPTKPQFWKPWGWCNSSSSDHITANK
FT                   AGKKRKFEITSIEEGEVIEEGSGSRKVLLPRVLDENSPSVGYGITTERAFVQLVLPCID
FT                   QSSDESRSTFVNELVRQFSNIEQQLSSVTNRSTTSNKQMGTASSGSEISSNKGSTRKGL
FT                   RGGSPSLARRSSANTTDTSPPPSPAALRASMSLRLQFLLRLLPVICGEPSFKNTRHALA
FT                   STIVRLLGSRVVYEDYAVCSPRSELSKAETESTIDPSSMADLSSEVLFDRLLFVLHGLL
FT                   SNHQPKWLKPRPSSNESSKDFTLFDRDAAESLQNELSRMQLPDTIRWRIQAAMPILLPS
FT                   LRCSLSCQPHSVPPTALTLVQPSGSTAAAGTNQRNSPAISKSGTAAAQGKLKPTMLAPH
FT                   QQQEADNTDVVDPWTLLEDGTSSGLSSSNASNSSDMANLRATCWLKGAVRVRRTDLTYV
FT                   GSVDDDS"
FT   gene            complement(211000..213697)
FT                   /gene="ROPGEF3"
FT                   /gene_synonym="ATROPGEF3"
FT                   /gene_synonym="A_IG005I10.1"
FT                   /gene_synonym="A_IG005I10_1"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 3"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 3"
FT                   /locus_tag="AT4G00460"
FT                   /note="Encodes a member of KPP-like gene family, homolog of
FT                   KPP (kinase partner protein) gene in tomato. Also a member
FT                   of the RopGEF (guanine nucleotide exchange factor) family,
FT                   containing the novel PRONE domain (plant-specific Rop
FT                   nucleotide exchanger), which is exclusively active towards
FT                   members of the Rop subfamily."
FT   mRNA            complement(join(211000..211265,211353..211697,
FT                   211788..212087,212183..212257,212340..212494,
FT                   212583..212699,212785..213153,213494..213697))
FT                   /gene="ROPGEF3"
FT                   /gene_synonym="ATROPGEF3"
FT                   /gene_synonym="A_IG005I10.1"
FT                   /gene_synonym="A_IG005I10_1"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 3"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 3"
FT                   /locus_tag="AT4G00460"
FT                   /product="RHO guanyl-nucleotide exchange factor 3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX840323.1,INSD:CO048496.1,INSD:CO048486.1,
FT                   INSD:CO048499.1,INSD:BX836259.1,INSD:CO048507.1,
FT                   INSD:CO048502.1,INSD:CO048492.1,INSD:CO048506.1,
FT                   INSD:CO048487.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX842312.1"
FT   mRNA            complement(join(211081..211265,211353..212087,
FT                   212183..212257,212340..212494,212583..212699,
FT                   212785..213153,213494..213697))
FT                   /gene="ROPGEF3"
FT                   /gene_synonym="ATROPGEF3"
FT                   /gene_synonym="A_IG005I10.1"
FT                   /gene_synonym="A_IG005I10_1"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 3"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 3"
FT                   /locus_tag="AT4G00460"
FT                   /product="RHO guanyl-nucleotide exchange factor 3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX840323.1,INSD:CO048496.1,INSD:CO048486.1,
FT                   INSD:CO048499.1,INSD:CO048507.1,INSD:CO048502.1,
FT                   INSD:CO048492.1,INSD:CO048506.1,INSD:CO048487.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT030385.1"
FT   mRNA            complement(join(211117..211265,211353..211697,
FT                   211788..212087,212183..212257,212340..212494,
FT                   212583..212699,212785..213285))
FT                   /gene="ROPGEF3"
FT                   /gene_synonym="ATROPGEF3"
FT                   /gene_synonym="A_IG005I10.1"
FT                   /gene_synonym="A_IG005I10_1"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 3"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 3"
FT                   /locus_tag="AT4G00460"
FT                   /product="RHO guanyl-nucleotide exchange factor 3"
FT   mRNA            complement(join(211117..211265,211353..211697,
FT                   211788..212087,212183..212257,212340..212699,
FT                   212785..213265))
FT                   /gene="ROPGEF3"
FT                   /gene_synonym="ATROPGEF3"
FT                   /gene_synonym="A_IG005I10.1"
FT                   /gene_synonym="A_IG005I10_1"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 3"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 3"
FT                   /locus_tag="AT4G00460"
FT                   /product="RHO guanyl-nucleotide exchange factor 3"
FT   CDS_pept        complement(join(211146..211265,211353..211697,
FT                   211788..212087,212183..212257,212340..212494,
FT                   212583..212699,212785..213094))
FT                   /codon_start=1
FT                   /gene="ROPGEF3"
FT                   /gene_synonym="ATROPGEF3"
FT                   /gene_synonym="A_IG005I10.1"
FT                   /gene_synonym="A_IG005I10_1"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 3"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 3"
FT                   /locus_tag="AT4G00460"
FT                   /product="RHO guanyl-nucleotide exchange factor 3"
FT                   /db_xref="GOA:A4IJ27"
FT                   /db_xref="InterPro:IPR005512"
FT                   /db_xref="InterPro:IPR038937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJ27"
FT                   /protein_id="ANM66275.1"
FT                   /translation="MENLSNPDENDDHQSPRSIDQNDQSAVETPVYSTMSIDSFVYPRT
FT                   CSETTSGFSDQIDETNSFCSEASPCNWPVLTESKSSKCLSGLEMQSNECLVVQEISEPE
FT                   LETMKERFAKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLRLEPLETEKRALW
FT                   KREMNCLLSVCDYIVEFIPRCQNLSNGATVEVMESRPRADIYINLPALRKLDSMLMEAL
FT                   DSFQNTEFWYAEEGSLSMKSARSSTGSFRKVIVQRKEEKWWLPVPLVPSEGLSDKARKQ
FT                   LKNKRESTNQIHKAAMAINSSILSEMEIPDSYMTTLPKCGKSSVGDSIYRYMSGSGRFF
FT                   PEQLLDCLNISSEHEAVQLADRVEASMYTWRRKSCLSNSKNSWNMVKDLMSTTERTDKN
FT                   YVMAERAETLLFCLKQRYPELSQTSLDICKIQYNKDVGKAVLESYSRVLEGLAFNIVAW
FT                   IDDVLYVDKTMRGSE"
FT   CDS_pept        complement(join(211146..211265,211353..211697,
FT                   211788..212087,212183..212257,212340..212494,
FT                   212583..212699,212785..213094))
FT                   /codon_start=1
FT                   /gene="ROPGEF3"
FT                   /gene_synonym="ATROPGEF3"
FT                   /gene_synonym="A_IG005I10.1"
FT                   /gene_synonym="A_IG005I10_1"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 3"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 3"
FT                   /locus_tag="AT4G00460"
FT                   /product="RHO guanyl-nucleotide exchange factor 3"
FT                   /note="RHO guanyl-nucleotide exchange factor 3 (ROPGEF3);
FT                   CONTAINS InterPro DOMAIN/s: Rop nucleotide exchanger, PRONE
FT                   (InterPro:IPR005512); BEST Arabidopsis thaliana protein
FT                   match is: RHO guanyl-nucleotide exchange factor 2
FT                   (TAIR:AT1G01700.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="GOA:A4IJ27"
FT                   /db_xref="InterPro:IPR005512"
FT                   /db_xref="InterPro:IPR038937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJ27"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX840323.1,INSD:CO048496.1,INSD:CO048486.1,
FT                   INSD:CO048499.1,INSD:CO048507.1,INSD:CO048502.1,
FT                   INSD:CO048492.1,INSD:CO048506.1,INSD:CO048487.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT030385.1"
FT                   /protein_id="AEE81885.1"
FT                   /translation="MENLSNPDENDDHQSPRSIDQNDQSAVETPVYSTMSIDSFVYPRT
FT                   CSETTSGFSDQIDETNSFCSEASPCNWPVLTESKSSKCLSGLEMQSNECLVVQEISEPE
FT                   LETMKERFAKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLRLEPLETEKRALW
FT                   KREMNCLLSVCDYIVEFIPRCQNLSNGATVEVMESRPRADIYINLPALRKLDSMLMEAL
FT                   DSFQNTEFWYAEEGSLSMKSARSSTGSFRKVIVQRKEEKWWLPVPLVPSEGLSDKARKQ
FT                   LKNKRESTNQIHKAAMAINSSILSEMEIPDSYMTTLPKCGKSSVGDSIYRYMSGSGRFF
FT                   PEQLLDCLNISSEHEAVQLADRVEASMYTWRRKSCLSNSKNSWNMVKDLMSTTERTDKN
FT                   YVMAERAETLLFCLKQRYPELSQTSLDICKIQYNKDVGKAVLESYSRVLEGLAFNIVAW
FT                   IDDVLYVDKTMRGSE"
FT   CDS_pept        complement(join(211146..211265,211353..211697,
FT                   211788..212087,212183..212257,212340..212522))
FT                   /codon_start=1
FT                   /gene="ROPGEF3"
FT                   /gene_synonym="ATROPGEF3"
FT                   /gene_synonym="A_IG005I10.1"
FT                   /gene_synonym="A_IG005I10_1"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 3"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 3"
FT                   /locus_tag="AT4G00460"
FT                   /product="RHO guanyl-nucleotide exchange factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00460"
FT                   /db_xref="GOA:A0A1P8B3X4"
FT                   /db_xref="InterPro:IPR005512"
FT                   /db_xref="InterPro:IPR038937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B3X4"
FT                   /protein_id="ANM66276.1"
FT                   /translation="MILHLIMFAATVFGQNLRLEPLETEKRALWKREMNCLLSVCDYIV
FT                   EFIPRCQNLSNGATVEVMESRPRADIYINLPALRKLDSMLMEALDSFQNTEFWYAEEGS
FT                   LSMKSARSSTGSFRKVIVQRKEEKWWLPVPLVPSEGLSDKARKQLKNKRESTNQIHKAA
FT                   MAINSSILSEMEIPDSYMTTLPKCGKSSVGDSIYRYMSGSGRFFPEQLLDCLNISSEHE
FT                   AVQLADRVEASMYTWRRKSCLSNSKNSWNMVKDLMSTTERTDKNYVMAERAETLLFCLK
FT                   QRYPELSQTSLDICKIQYNKDVGKAVLESYSRVLEGLAFNIVAWIDDVLYVDKTMRGSE
FT                   "
FT   CDS_pept        complement(join(211731..212087,212183..212257,
FT                   212340..212494,212583..212699,212785..213094))
FT                   /codon_start=1
FT                   /gene="ROPGEF3"
FT                   /gene_synonym="ATROPGEF3"
FT                   /gene_synonym="A_IG005I10.1"
FT                   /gene_synonym="A_IG005I10_1"
FT                   /gene_synonym="KINASE PARTNER PROTEIN-LIKE"
FT                   /gene_synonym="KPP-LIKE"
FT                   /gene_synonym="RHO guanyl-nucleotide exchange factor 3"
FT                   /gene_synonym="ROP (rho of plants) guanine nucleotide
FT                   exchange factor 3"
FT                   /locus_tag="AT4G00460"
FT                   /product="RHO guanyl-nucleotide exchange factor 3"
FT                   /note="RHO guanyl-nucleotide exchange factor 3 (ROPGEF3);
FT                   CONTAINS InterPro DOMAIN/s: Rop nucleotide exchanger, PRONE
FT                   (InterPro:IPR005512); BEST Arabidopsis thaliana protein
FT                   match is: RHO guanyl-nucleotide exchange factor 2
FT                   (TAIR:AT1G01700.1); Has 292 Blast hits to 291 proteins in
FT                   14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 292; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00460"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00460.1"
FT                   /db_xref="GOA:B3H471"
FT                   /db_xref="InterPro:IPR005512"
FT                   /db_xref="InterPro:IPR038937"
FT                   /db_xref="UniProtKB/TrEMBL:B3H471"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX840323.1,INSD:CO048496.1,INSD:CO048486.1,
FT                   INSD:CO048499.1,INSD:BX836259.1,INSD:CO048507.1,
FT                   INSD:CO048502.1,INSD:CO048492.1,INSD:CO048506.1,
FT                   INSD:CO048487.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX842312.1"
FT                   /protein_id="AEE81884.1"
FT                   /translation="MENLSNPDENDDHQSPRSIDQNDQSAVETPVYSTMSIDSFVYPRT
FT                   CSETTSGFSDQIDETNSFCSEASPCNWPVLTESKSSKCLSGLEMQSNECLVVQEISEPE
FT                   LETMKERFAKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLRLEPLETEKRALW
FT                   KREMNCLLSVCDYIVEFIPRCQNLSNGATVEVMESRPRADIYINLPALRKLDSMLMEAL
FT                   DSFQNTEFWYAEEGSLSMKSARSSTGSFRKVIVQRKEEKWWLPVPLVPSEGLSDKARKQ
FT                   LKNKRESTNQIHKAAMAINSSILSEMEIPDSYMTTLPKVFFFVTFIHSYLLGILKF"
FT   gene            complement(214768..216076)
FT                   /locus_tag="AT4G00467"
FT   mRNA            complement(join(214768..214942,215054..215225,
FT                   215402..215537,215634..215772,215862..215927,
FT                   216010..216076))
FT                   /locus_tag="AT4G00467"
FT                   /product="Calcium-dependent lipid-binding (CaLB domain)
FT                   family protein"
FT   mRNA            complement(join(214846..214942,215122..215225,
FT                   215402..215537,215634..215772,215862..215927,
FT                   216010..216076))
FT                   /locus_tag="AT4G00467"
FT                   /product="Calcium-dependent lipid-binding (CaLB domain)
FT                   family protein"
FT   CDS_pept        complement(join(214846..214942,215122..215225,
FT                   215402..215537,215634..215772,215862..215927,
FT                   216010..216076))
FT                   /codon_start=1
FT                   /locus_tag="AT4G00467"
FT                   /product="Calcium-dependent lipid-binding (CaLB domain)
FT                   family protein"
FT                   /note="Calcium-dependent lipid-binding (CaLB domain) family
FT                   protein; FUNCTIONS IN: molecular_function unknown; INVOLVED
FT                   IN: biological_process unknown; LOCATED IN:
FT                   cellular_component unknown; CONTAINS InterPro DOMAIN/s: C2
FT                   membrane targeting protein (InterPro:IPR018029), C2
FT                   calcium/lipid-binding domain, CaLB (InterPro:IPR008973), C2
FT                   calcium-dependent membrane targeting (InterPro:IPR000008);
FT                   BEST Arabidopsis thaliana protein match is:
FT                   Calcium-dependent lipid-binding (CaLB domain) family
FT                   protein (TAIR:AT1G63220.1); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00467"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00467.1"
FT                   /db_xref="GOA:B3H4G1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:B3H4G1"
FT                   /protein_id="AEE81886.1"
FT                   /translation="MKRGILEVFLIDAHGITHTNFIGTPVYYVLLQCGTKEYRSKMSKG
FT                   DNDNALWNQKFVFDFPMSQWKKLTYIKLRILDKELFNDGGFVGETIIHLGGIITEGRDR
FT                   GYIEIKPAPYNVVLEDDTFKGELKVGLRFIATDKLQRKAWELKMEAKNSEELMISPIQN
FT                   LMKLPLLRFIAAWARRQCLINAKLLYCFVDYKKCLTPYS"
FT   CDS_pept        complement(join(215067..215225,215402..215537,
FT                   215634..215772,215862..215927,216010..216076))
FT                   /codon_start=1
FT                   /locus_tag="AT4G00467"
FT                   /product="Calcium-dependent lipid-binding (CaLB domain)
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00467"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B3W1"
FT                   /protein_id="ANM66277.1"
FT                   /translation="MKRGILEVFLIDAHGITHTNFIGTPVYYVLLQCGTKEYRSKMSKG
FT                   DNDNALWNQKFVFDFPMSQWKKLTYIKLRILDKELFNDGGFVGETIIHLGGIITEGRDR
FT                   GYIEIKPAPYNVVLEDDTFKGELKVGLRFIATDKLQRKAWELKMEAKNSEELMISPIQN
FT                   LMKLPLLRFLLYCFRKTKQYQLKEN"
FT   gene            complement(216812..219926)
FT                   /gene="ATMYC1"
FT                   /gene_synonym="F6N23.22"
FT                   /gene_synonym="F6N23_22"
FT                   /gene_synonym="myc1"
FT                   /locus_tag="AT4G00480"
FT                   /note="MYC-related protein with a basic helix-loop-helix
FT                   motif at the C-terminus and a region similar to the maize
FT                   B/R family at the N-terminus"
FT   mRNA            complement(join(216812..217041,217120..217180,
FT                   217265..217675,217754..218242,218344..218400,
FT                   218545..218559,218685..218781,219122..219409,
FT                   219536..219781))
FT                   /gene="ATMYC1"
FT                   /gene_synonym="F6N23.22"
FT                   /gene_synonym="F6N23_22"
FT                   /gene_synonym="myc1"
FT                   /locus_tag="AT4G00480"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT   mRNA            complement(join(216848..217180,217265..217675,
FT                   217754..218242,218344..218400,218545..218559,
FT                   218685..218781,219122..219409,219536..219926))
FT                   /gene="ATMYC1"
FT                   /gene_synonym="F6N23.22"
FT                   /gene_synonym="F6N23_22"
FT                   /gene_synonym="myc1"
FT                   /locus_tag="AT4G00480"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR749631.1,INSD:AV521644.1,INSD:EL195083.1,
FT                   INSD:EL255637.1"
FT   CDS_pept        complement(join(216866..217041,217120..217180,
FT                   217265..217675,217754..218242,218344..218400,
FT                   218545..218559,218685..218781,219122..219409,
FT                   219536..219684))
FT                   /codon_start=1
FT                   /gene="ATMYC1"
FT                   /gene_synonym="F6N23.22"
FT                   /gene_synonym="F6N23_22"
FT                   /gene_synonym="myc1"
FT                   /locus_tag="AT4G00480"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /note="ATMYC1; FUNCTIONS IN: DNA binding, sequence-specific
FT                   DNA binding transcription factor activity; INVOLVED IN:
FT                   regulation of transcription; LOCATED IN: nucleus; EXPRESSED
FT                   IN: 21 plant structures; EXPRESSED DURING: 12 growth
FT                   stages; CONTAINS InterPro DOMAIN/s: Helix-loop-helix
FT                   DNA-binding domain (InterPro:IPR001092), Helix-loop-helix
FT                   DNA-binding (InterPro:IPR011598); BEST Arabidopsis thaliana
FT                   protein match is: basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein (TAIR:AT1G63650.3); Has 1481 Blast hits
FT                   to 1090 proteins in 120 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 3; Fungi - 0; Plants - 1462; Viruses - 0; Other
FT                   Eukaryotes - 16 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00480"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00480.2"
FT                   /db_xref="GOA:F4JHC4"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR025610"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHC4"
FT                   /protein_id="AEE81888.1"
FT                   /translation="MSLTMADGVEAAAGRSKRQNSLLRKQLALAVRSVQWSYAIFWSSS
FT                   LTQPGVLEWGEGCYNGDMKKRKKSYESHYKYGLQKSKELRKLYLSMLEGDSGTTVSTTH
FT                   DNLNDDDDNCHSTSMMLSPDDLSDEEWYYLVSMSYVFSPSQCLPGRASATGETIWLCNA
FT                   QYAENKLFSRSLLARSASIQTVVCFPYLGGVIELGVTELISEDHNLLRNIKSCLMEISA
FT                   HQDNDDEKKMEIKISEEKHQLPLGISDEDLHYKRTISTVLNYSADRSGKNDKNIRHRQP
FT                   NIVTSEPGSSFLRWKQCEQQVSGFVQKKKSQNVLRKILHDVPLMHTKRMFPSQNSGLNQ
FT                   DDPSDRRKENEKFSVLRTMVPTVNEVDKESILNNTIKYLQELEARVEELESCMGSVNFV
FT                   ERQRKTTENLNDSVLIEETSGNYDDSTKIDDNSGETEQVTVFRDKTHLRVKLKETEVVI
FT                   EVRCSYRDYIVADIMETLSNLHMDAFSVRSHTLNKFLTLNLKAKFRGAAVASVGMIKRE
FT                   LRRVIDFREPICDVPLSLHQVFRVFVCKVCQSLVGIFDNVVSSSSTKPRSILIHNSWAI
FT                   CIFH"
FT   CDS_pept        complement(join(217106..217180,217265..217675,
FT                   217754..218242,218344..218400,218545..218559,
FT                   218685..218781,219122..219409,219536..219684))
FT                   /codon_start=1
FT                   /gene="ATMYC1"
FT                   /gene_synonym="F6N23.22"
FT                   /gene_synonym="F6N23_22"
FT                   /gene_synonym="myc1"
FT                   /locus_tag="AT4G00480"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /note="ATMYC1; FUNCTIONS IN: DNA binding, sequence-specific
FT                   DNA binding transcription factor activity; INVOLVED IN:
FT                   regulation of transcription; LOCATED IN: nucleus; EXPRESSED
FT                   IN: 21 plant structures; EXPRESSED DURING: 12 growth
FT                   stages; CONTAINS InterPro DOMAIN/s: Helix-loop-helix
FT                   DNA-binding domain (InterPro:IPR001092), Helix-loop-helix
FT                   DNA-binding (InterPro:IPR011598); BEST Arabidopsis thaliana
FT                   protein match is: basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein (TAIR:AT1G63650.3); Has 1473 Blast hits
FT                   to 1082 proteins in 120 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 3; Fungi - 0; Plants - 1458; Viruses - 0; Other
FT                   Eukaryotes - 12 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8W2F1"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR025610"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8W2F1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR749631.1,INSD:AV521644.1,INSD:EL195083.1,
FT                   INSD:EL255637.1"
FT                   /protein_id="AEE81887.1"
FT                   /translation="MSLTMADGVEAAAGRSKRQNSLLRKQLALAVRSVQWSYAIFWSSS
FT                   LTQPGVLEWGEGCYNGDMKKRKKSYESHYKYGLQKSKELRKLYLSMLEGDSGTTVSTTH
FT                   DNLNDDDDNCHSTSMMLSPDDLSDEEWYYLVSMSYVFSPSQCLPGRASATGETIWLCNA
FT                   QYAENKLFSRSLLARSASIQTVVCFPYLGGVIELGVTELISEDHNLLRNIKSCLMEISA
FT                   HQDNDDEKKMEIKISEEKHQLPLGISDEDLHYKRTISTVLNYSADRSGKNDKNIRHRQP
FT                   NIVTSEPGSSFLRWKQCEQQVSGFVQKKKSQNVLRKILHDVPLMHTKRMFPSQNSGLNQ
FT                   DDPSDRRKENEKFSVLRTMVPTVNEVDKESILNNTIKYLQELEARVEELESCMGSVNFV
FT                   ERQRKTTENLNDSVLIEETSGNYDDSTKIDDNSGETEQVTVFRDKTHLRVKLKETEVVI
FT                   EVRCSYRDYIVADIMETLSNLHMDAFSVRSHTLNKFLTLNLKAKFRGAAVASVGMIKRE
FT                   LRRVIGDLF"
FT   mRNA            complement(join(217234..217675,217754..218242,
FT                   218344..218400,218545..218559,218685..218781,
FT                   219122..219409,219536..219817))
FT                   /gene="ATMYC1"
FT                   /gene_synonym="F6N23.22"
FT                   /gene_synonym="F6N23_22"
FT                   /gene_synonym="myc1"
FT                   /locus_tag="AT4G00480"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT   CDS_pept        complement(join(217256..217675,217754..218242,
FT                   218344..218400,218545..218559,218685..218781,
FT                   219122..219409,219536..219684))
FT                   /codon_start=1
FT                   /gene="ATMYC1"
FT                   /gene_synonym="F6N23.22"
FT                   /gene_synonym="F6N23_22"
FT                   /gene_synonym="myc1"
FT                   /locus_tag="AT4G00480"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00480"
FT                   /db_xref="GOA:A0A1P8B8H4"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR025610"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B8H4"
FT                   /protein_id="ANM67896.1"
FT                   /translation="MSLTMADGVEAAAGRSKRQNSLLRKQLALAVRSVQWSYAIFWSSS
FT                   LTQPGVLEWGEGCYNGDMKKRKKSYESHYKYGLQKSKELRKLYLSMLEGDSGTTVSTTH
FT                   DNLNDDDDNCHSTSMMLSPDDLSDEEWYYLVSMSYVFSPSQCLPGRASATGETIWLCNA
FT                   QYAENKLFSRSLLARSASIQTVVCFPYLGGVIELGVTELISEDHNLLRNIKSCLMEISA
FT                   HQDNDDEKKMEIKISEEKHQLPLGISDEDLHYKRTISTVLNYSADRSGKNDKNIRHRQP
FT                   NIVTSEPGSSFLRWKQCEQQVSGFVQKKKSQNVLRKILHDVPLMHTKRMFPSQNSGLNQ
FT                   DDPSDRRKENEKFSVLRTMVPTVNEVDKESILNNTIKYLQELEARVEELESCMGSVNFV
FT                   ERQRKTTENLNDSVLIEETSGNYDDSTKIDDNSGETEQVTVFRDKTHLRVKLKETEVVI
FT                   EVRCSYRDYIVADIMETLSNLHMDAFSVRSHTLNKFLTLNLKAKVN"
FT   gene            222289..225131
FT                   /gene="BAM2"
FT                   /gene_synonym="beta-amylase 2"
FT                   /gene_synonym="BETA-AMYLASE 9"
FT                   /gene_synonym="BMY9"
FT                   /gene_synonym="F6N23.1"
FT                   /gene_synonym="F6N23_1"
FT                   /locus_tag="AT4G00490"
FT                   /note="Encodes a chloroplast beta-amylase. The enzyme
FT                   activity is very weak compared to BAM1 and BAM3. Mutant of
FT                   BAM2 has no visible phenotype."
FT   mRNA            join(222289..222649,222722..222799,222880..223083,
FT                   223185..223379,223528..223692,223820..224080,
FT                   224185..224403,224502..224721,224804..225131)
FT                   /gene="BAM2"
FT                   /gene_synonym="beta-amylase 2"
FT                   /gene_synonym="BETA-AMYLASE 9"
FT                   /gene_synonym="BMY9"
FT                   /gene_synonym="F6N23.1"
FT                   /gene_synonym="F6N23_1"
FT                   /locus_tag="AT4G00490"
FT                   /product="beta-amylase 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI995593.1,INSD:ES015614.1,INSD:ES015221.1,
FT                   INSD:BP843069.1,INSD:AV814967.1,INSD:ES087625.1,
FT                   INSD:ES019590.1,INSD:ES088151.1,INSD:ES030788.1,
FT                   INSD:EL033210.1,INSD:AI997573.1,INSD:AV786933.1,
FT                   INSD:EL006422.1,INSD:AV807175.1,INSD:EG494455.1,
FT                   INSD:BP784835.1,INSD:AV804534.1,INSD:EG494456.1,
FT                   INSD:EH853020.1,INSD:EL119492.1,INSD:AV786302.1,
FT                   INSD:EH966071.1,INSD:ES193935.1,INSD:BP591730.1,
FT                   INSD:AV815983.1,INSD:EL154389.1,INSD:BP593576.1,
FT                   INSD:BP792268.1,INSD:AV795840.1,INSD:ES140979.1,
FT                   INSD:AV814954.1,INSD:EH847401.1,INSD:ES072665.1"
FT   CDS_pept        join(222422..222649,222722..222799,222880..223083,
FT                   223185..223379,223528..223692,223820..224080,
FT                   224185..224403,224502..224721,224804..224862)
FT                   /codon_start=1
FT                   /gene="BAM2"
FT                   /gene_synonym="beta-amylase 2"
FT                   /gene_synonym="BETA-AMYLASE 9"
FT                   /gene_synonym="BMY9"
FT                   /gene_synonym="F6N23.1"
FT                   /gene_synonym="F6N23_1"
FT                   /locus_tag="AT4G00490"
FT                   /product="beta-amylase 2"
FT                   /note="beta-amylase 2 (BAM2); FUNCTIONS IN: beta-amylase
FT                   activity; INVOLVED IN: carbohydrate metabolic process,
FT                   polysaccharide catabolic process; LOCATED IN: chloroplast;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Glycoside
FT                   hydrolase, family 14, conserved site (InterPro:IPR018238),
FT                   Glycoside hydrolase, family 14 (InterPro:IPR001554),
FT                   Glycoside hydrolase, catalytic core (InterPro:IPR017853),
FT                   Glycoside hydrolase, family 14B, plant
FT                   (InterPro:IPR001371), Glycoside hydrolase, subgroup,
FT                   catalytic core (InterPro:IPR013781); BEST Arabidopsis
FT                   thaliana protein match is: beta-amylase 7
FT                   (TAIR:AT2G45880.1); Has 836 Blast hits to 835 proteins in
FT                   165 species: Archae - 0; Bacteria - 84; Metazoa - 0; Fungi
FT                   - 0; Plants - 686; Viruses - 0; Other Eukaryotes - 66
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00490"
FT                   /db_xref="GOA:O65258"
FT                   /db_xref="InterPro:IPR001371"
FT                   /db_xref="InterPro:IPR001554"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018238"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65258"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI995593.1,INSD:ES015614.1,INSD:ES015221.1,
FT                   INSD:BP843069.1,INSD:AV814967.1,INSD:ES087625.1,
FT                   INSD:ES019590.1,INSD:ES088151.1,INSD:ES030788.1,
FT                   INSD:EL033210.1,INSD:AI997573.1,INSD:AV786933.1,
FT                   INSD:EL006422.1,INSD:AV807175.1,INSD:EG494455.1,
FT                   INSD:BP784835.1,INSD:AV804534.1,INSD:EG494456.1,
FT                   INSD:EH853020.1,INSD:EL119492.1,INSD:AV786302.1,
FT                   INSD:EH966071.1,INSD:ES193935.1,INSD:BP591730.1,
FT                   INSD:AV815983.1,INSD:EL154389.1,INSD:BP593576.1,
FT                   INSD:BP792268.1,INSD:AV795840.1,INSD:ES140979.1,
FT                   INSD:AV814954.1,INSD:EH847401.1,INSD:ES072665.1"
FT                   /protein_id="AEE81889.1"
FT                   /translation="MAIRLNHSVIPVSVKLGAPTRVSARSSLPFSVGDWRGVSTFSGAR
FT                   PLVLAKVKLRAESTEEDRVPIDDDDDSTDQLVDEEIVHFEERDFAGTACVPVYVMLPLG
FT                   VIDMNSEVVEPEELLDQLRTLKSVNVDGVMVDCWWGIVESHTPQVYNWSGYKKLFQMIR
FT                   ELGLKIQVVMSFHECGGNVGDDVHIQIPEWVREIGQSNPDIYFTDSAGRRNTECLTWGI
FT                   DKQRVLRGRTALEVYFDYMRSFRVEFDEFFEEKIIPEIEVGLGPCGELRYPSYPAQFGW
FT                   KYPGIGEFQCYDKYLMNSLKEAAEVRGHSFWGRGPDNTETYNSTPHGTGFFRDGGDYDS
FT                   YYGRFFLNWYSRVLIDHGDRVLAMANLAFEGTCIAAKLSGIHWWYKTASHAAELTAGFY
FT                   NSSNRDGYGPIAAMFKKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDA
FT                   SIPVASENALPCYDREGYNKILENAKPLTDPDGRHLSCFTYLRLNPTLMESQNFKEFER
FT                   FLKRMHGEAVPDLGLAPGTQETNPE"
FT   gene            complement(225028..227396)
FT                   /gene_synonym="F6N23.21"
FT                   /gene_synonym="F6N23_21"
FT                   /locus_tag="AT4G00500"
FT   mRNA            complement(join(225028..225567,225667..225802,
FT                   225899..226027,226130..226188,226274..227172,
FT                   227351..227396))
FT                   /gene_synonym="F6N23.21"
FT                   /gene_synonym="F6N23_21"
FT                   /locus_tag="AT4G00500"
FT                   /product="alpha/beta-Hydrolases superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI995593.1,INSD:AV814967.1,INSD:EH965116.1,
FT                   INSD:ES088151.1,INSD:AV786933.1,INSD:AV807175.1,
FT                   INSD:BP784835.1,INSD:AV804534.1,INSD:AV826622.1,
FT                   INSD:AV786302.1,INSD:ES066775.1,INSD:EL204962.1,
FT                   INSD:EL156296.1,INSD:EL224664.1,INSD:BP591730.1,
FT                   INSD:AV815983.1,INSD:BP593576.1,INSD:BP845923.1,
FT                   INSD:BP792268.1,INSD:AV795840.1,INSD:AV814954.1,
FT                   INSD:ES140979.1,INSD:BP844920.1,INSD:EL051780.1,
FT                   INSD:AA713241.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT000137.1,INSD:AY062737.1"
FT   mRNA            complement(join(225028..225567,225667..225802,
FT                   225899..226027,226130..226188,226274..227374))
FT                   /gene_synonym="F6N23.21"
FT                   /gene_synonym="F6N23_21"
FT                   /locus_tag="AT4G00500"
FT                   /product="alpha/beta-Hydrolases superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI995593.1,INSD:AV814967.1,INSD:EH965116.1,
FT                   INSD:ES088151.1,INSD:AV786933.1,INSD:AV807175.1,
FT                   INSD:BP784835.1,INSD:AV804534.1,INSD:AV786302.1,
FT                   INSD:ES066775.1,INSD:EL204962.1,INSD:EL156296.1,
FT                   INSD:EL224664.1,INSD:BP591730.1,INSD:AV815983.1,
FT                   INSD:BP593576.1,INSD:BP792268.1,INSD:AV795840.1,
FT                   INSD:AV814954.1,INSD:ES140979.1,INSD:EL051780.1,
FT                   INSD:BX841245.1,INSD:BP844920.1,INSD:AA713241.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT000137.1"
FT   CDS_pept        complement(join(225214..225567,225667..225802,
FT                   225899..226027,226130..226188,226274..226978))
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.21"
FT                   /gene_synonym="F6N23_21"
FT                   /locus_tag="AT4G00500"
FT                   /product="alpha/beta-Hydrolases superfamily protein"
FT                   /note="alpha/beta-Hydrolases superfamily protein; FUNCTIONS
FT                   IN: triglyceride lipase activity, calmodulin binding;
FT                   INVOLVED IN: lipid catabolic process, lipid metabolic
FT                   process; LOCATED IN: endomembrane system; EXPRESSED IN: 21
FT                   plant structures; EXPRESSED DURING: 9 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Lipase, class 3
FT                   (InterPro:IPR002921), Mono-/di-acylglycerol lipase,
FT                   N-terminal (InterPro:IPR005592); BEST Arabidopsis thaliana
FT                   protein match is: alpha/beta-Hydrolases superfamily protein
FT                   (TAIR:AT3G49050.1); Has 561 Blast hits to 561 proteins in
FT                   134 species: Archae - 0; Bacteria - 2; Metazoa - 171; Fungi
FT                   - 76; Plants - 213; Viruses - 0; Other Eukaryotes - 99
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8W495"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR005592"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8W495"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI995593.1,INSD:AV814967.1,INSD:EH965116.1,
FT                   INSD:ES088151.1,INSD:AV786933.1,INSD:AV807175.1,
FT                   INSD:BP784835.1,INSD:AV804534.1,INSD:AV826622.1,
FT                   INSD:AV786302.1,INSD:ES066775.1,INSD:EL204962.1,
FT                   INSD:EL156296.1,INSD:EL224664.1,INSD:BP591730.1,
FT                   INSD:AV815983.1,INSD:BP593576.1,INSD:BP845923.1,
FT                   INSD:BP792268.1,INSD:AV795840.1,INSD:AV814954.1,
FT                   INSD:ES140979.1,INSD:BP844920.1,INSD:EL051780.1,
FT                   INSD:AA713241.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT000137.1,INSD:AY062737.1"
FT                   /protein_id="AEE81890.1"
FT                   /translation="MSILCCVPVLECVYCLGCTHWLWKKCLYSAGHESENWGLATSDEF
FT                   EPIPRICRLILAVYEENLHDPMWAPPDGYGIDPNHVILKKDYDQTEGRVTPYMIYLDHE
FT                   NGDVVLAIRGLNLAKECDYAVLLDNKLGQTKFDGGYVHNGLLKAAMWVFEEEHVVLREL
FT                   LEANPSYSLTFVGHSLGAGVVSLLVLFVIQNRVRLGNIERKRIRCFAIAPPRCMSLHLA
FT                   VTYADVINSVVLQDDFLPRTTTALENVFKSIICLPCLLCLTCLKDTFTFEERKLKDARR
FT                   LYAPGRLYHIVVRKPLRLGRYPPVVRTAVPVDGRFEQIVLSCNATADHAIIWIERESQR
FT                   ALDLMVEEDQVMQIPVEQKIVRQKSIVEDHDEEYRAAIMKAASLNIPMSPSPSYGTFHD
FT                   TEEGESSAGSGMEGSPSGWSFKGMRRKWDQFIDCHFPVNDNSEHMIFKNQESQALLCGQ
FT                   ET"
FT   CDS_pept        complement(join(225214..225567,225667..225802,
FT                   225899..226027,226130..226188,226274..226978))
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.21"
FT                   /gene_synonym="F6N23_21"
FT                   /locus_tag="AT4G00500"
FT                   /product="alpha/beta-Hydrolases superfamily protein"
FT                   /note="alpha/beta-Hydrolases superfamily protein; FUNCTIONS
FT                   IN: triglyceride lipase activity, calmodulin binding;
FT                   INVOLVED IN: lipid catabolic process, lipid metabolic
FT                   process; LOCATED IN: endomembrane system; EXPRESSED IN: 21
FT                   plant structures; EXPRESSED DURING: 9 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Lipase, class 3
FT                   (InterPro:IPR002921), Mono-/di-acylglycerol lipase,
FT                   N-terminal (InterPro:IPR005592); BEST Arabidopsis thaliana
FT                   protein match is: alpha/beta-Hydrolases superfamily protein
FT                   (TAIR:AT3G49050.1); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8W495"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR005592"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8W495"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI995593.1,INSD:AV814967.1,INSD:EH965116.1,
FT                   INSD:ES088151.1,INSD:AV786933.1,INSD:AV807175.1,
FT                   INSD:BP784835.1,INSD:AV804534.1,INSD:AV786302.1,
FT                   INSD:ES066775.1,INSD:EL204962.1,INSD:EL156296.1,
FT                   INSD:EL224664.1,INSD:BP591730.1,INSD:AV815983.1,
FT                   INSD:BP593576.1,INSD:BP792268.1,INSD:AV795840.1,
FT                   INSD:AV814954.1,INSD:ES140979.1,INSD:EL051780.1,
FT                   INSD:BX841245.1,INSD:BP844920.1,INSD:AA713241.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT000137.1"
FT                   /protein_id="AEE81891.1"
FT                   /translation="MSILCCVPVLECVYCLGCTHWLWKKCLYSAGHESENWGLATSDEF
FT                   EPIPRICRLILAVYEENLHDPMWAPPDGYGIDPNHVILKKDYDQTEGRVTPYMIYLDHE
FT                   NGDVVLAIRGLNLAKECDYAVLLDNKLGQTKFDGGYVHNGLLKAAMWVFEEEHVVLREL
FT                   LEANPSYSLTFVGHSLGAGVVSLLVLFVIQNRVRLGNIERKRIRCFAIAPPRCMSLHLA
FT                   VTYADVINSVVLQDDFLPRTTTALENVFKSIICLPCLLCLTCLKDTFTFEERKLKDARR
FT                   LYAPGRLYHIVVRKPLRLGRYPPVVRTAVPVDGRFEQIVLSCNATADHAIIWIERESQR
FT                   ALDLMVEEDQVMQIPVEQKIVRQKSIVEDHDEEYRAAIMKAASLNIPMSPSPSYGTFHD
FT                   TEEGESSAGSGMEGSPSGWSFKGMRRKWDQFIDCHFPVNDNSEHMIFKNQESQALLCGQ
FT                   ET"
FT   gene            227650..231751
FT                   /locus_tag="AT4G00520"
FT   mRNA            join(227650..227741,227859..227951,228039..228207,
FT                   228320..228395,228494..228540,228653..228769,
FT                   228986..229063,229211..229298,229449..229561,
FT                   229700..229762,229838..229893,229972..230076,
FT                   230173..230232,230503..230604,230805..230853,
FT                   231243..231311,231417..231751)
FT                   /locus_tag="AT4G00520"
FT                   /product="Acyl-CoA thioesterase family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU226966.1,INSD:DR375387.1,INSD:AA651333.1,
FT                   INSD:BP810182.1,INSD:EL028067.1,INSD:EL321265.1,
FT                   INSD:CB253621.1,INSD:AU236147.1,INSD:EL284799.1,
FT                   INSD:DR215146.1,INSD:H37158.1,INSD:H36947.1,
FT                   INSD:CB253566.1"
FT   mRNA            join(227650..227741,227859..227951,228140..228207,
FT                   228320..228395,228494..228540,228653..228769,
FT                   228986..229063,229211..229298,229449..229561,
FT                   229700..229762,229838..229893,229972..230076,
FT                   230173..230232,230503..230604,230805..230853,
FT                   231243..231311,231417..231751)
FT                   /locus_tag="AT4G00520"
FT                   /product="Acyl-CoA thioesterase family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU226966.1,INSD:BP570131.1,INSD:AA651333.1,
FT                   INSD:BP810182.1,INSD:EL028067.1,INSD:EL321265.1,
FT                   INSD:CB253621.1,INSD:AU236147.1,INSD:EL284799.1,
FT                   INSD:H37158.1,INSD:DR215146.1,INSD:H36947.1,
FT                   INSD:CB253566.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY874170.1,INSD:AK228258.1,INSD:BX842334.1"
FT   CDS_pept        join(227681..227741,227859..227951,228140..228207,
FT                   228320..228395,228494..228540,228653..228769,
FT                   228986..229063,229211..229298,229449..229561,
FT                   229700..229762,229838..229893,229972..230076,
FT                   230173..230232,230503..230604,230805..230853,
FT                   231243..231311,231417..231494)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00520"
FT                   /product="Acyl-CoA thioesterase family protein"
FT                   /note="Acyl-CoA thioesterase family protein; FUNCTIONS IN:
FT                   acyl-CoA thioesterase activity; INVOLVED IN: acyl-CoA
FT                   metabolic process; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Cyclic nucleotide-binding (InterPro:IPR000595),
FT                   Cyclic nucleotide-binding-like (InterPro:IPR018490),
FT                   Acyl-CoA thioesterase (InterPro:IPR003703), RmlC-like jelly
FT                   roll fold (InterPro:IPR014710); BEST Arabidopsis thaliana
FT                   protein match is: Acyl-CoA thioesterase family protein
FT                   (TAIR:AT1G01710.1); Has 3429 Blast hits to 3402 proteins in
FT                   976 species: Archae - 0; Bacteria - 1910; Metazoa - 393;
FT                   Fungi - 300; Plants - 65; Viruses - 0; Other Eukaryotes -
FT                   761 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00520"
FT                   /db_xref="GOA:F4JHC9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHC9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU226966.1,INSD:BP570131.1,INSD:AA651333.1,
FT                   INSD:BP810182.1,INSD:EL028067.1,INSD:EL321265.1,
FT                   INSD:CB253621.1,INSD:AU236147.1,INSD:EL284799.1,
FT                   INSD:H37158.1,INSD:DR215146.1,INSD:H36947.1,
FT                   INSD:CB253566.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY874170.1,INSD:AK228258.1,INSD:BX842334.1"
FT                   /protein_id="AEE81892.2"
FT                   /translation="MIEFAGQRFDSLYTVMNTESVVEFLGNVTLLQRLPSSSLKRISEV
FT                   VVFKGYDRGDYVVRENQNVDGVYFLLQGQAQVLRSAGEENYQEFPLKRYDFFGHGIFGD
FT                   VYSADVVAVTELTCLLLMSDHRALLEIKSVSDSDKERCLVEDILYLEPLDLNVYRGFTP
FT                   PNAPTYGKVYGGQLVGQALAAASKTVETMKIVHNFHCYFLLVGDINIPIIYDVNRLRDG
FT                   NNFATRSVDARQKGKTIFTLFASFQKKQQGFIHQESTMPHTPAPETLLPREEMLERLVT
FT                   EPLLPRDYRNQVATEISVPFPIDIRFCEPNRSTKQNKSPPRLKYWFRAKGKLSDDDQAL
FT                   HRCVVAFASDLIFATISLNPHRREGMSVAALSLDHSMWFHRPVRADDWLLFVIVSPTAT
FT                   ESRGFATGKMFNRKGELVVSLTQEAVLREAVTIKPSFGAKL"
FT   mRNA            join(227694..227741,227859..228207,228320..228395,
FT                   228494..228540,228653..228769,228986..229063,
FT                   229211..229298,229449..229561,229700..229762,
FT                   229838..229893,229972..230076,230173..230232,
FT                   230503..230604,230805..230853,231243..231311,
FT                   231417..231724)
FT                   /locus_tag="AT4G00520"
FT                   /product="Acyl-CoA thioesterase family protein"
FT   CDS_pept        join(228127..228207,228320..228395,228494..228540,
FT                   228653..228769,228986..229063,229211..229298,
FT                   229449..229561,229700..229762,229838..229893,
FT                   229972..230076,230173..230232,230503..230604,
FT                   230805..230853,231243..231311,231417..231494)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00520"
FT                   /product="Acyl-CoA thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00520"
FT                   /db_xref="GOA:B3H5Z2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:B3H5Z2"
FT                   /protein_id="ANM66432.1"
FT                   /translation="MCFTDRGDYVVRENQNVDGVYFLLQGQAQVLRSAGEENYQEFPLK
FT                   RYDFFGHGIFGDVYSADVVAVTELTCLLLMSDHRALLEIKSVSDSDKERCLVEDILYLE
FT                   PLDLNVYRGFTPPNAPTYGKVYGGQLVGQALAAASKTVETMKIVHNFHCYFLLVGDINI
FT                   PIIYDVNRLRDGNNFATRSVDARQKGKTIFTLFASFQKKQQGFIHQESTMPHTPAPETL
FT                   LPREEMLERLVTEPLLPRDYRNQVATEISVPFPIDIRFCEPNRSTKQNKSPPRLKYWFR
FT                   AKGKLSDDDQALHRCVVAFASDLIFATISLNPHRREGMSVAALSLDHSMWFHRPVRADD
FT                   WLLFVIVSPTATESRGFATGKMFNRKGELVVSLTQEAVLREAVTIKPSFGAKL"
FT   CDS_pept        join(228127..228207,228320..228395,228494..228540,
FT                   228653..228769,228986..229063,229211..229298,
FT                   229449..229561,229700..229762,229838..229893,
FT                   229972..230076,230173..230232,230503..230604,
FT                   230805..230853,231243..231311,231417..231494)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00520"
FT                   /product="Acyl-CoA thioesterase family protein"
FT                   /note="Acyl-CoA thioesterase family protein; FUNCTIONS IN:
FT                   acyl-CoA thioesterase activity; INVOLVED IN: acyl-CoA
FT                   metabolic process; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Cyclic nucleotide-binding (InterPro:IPR000595),
FT                   Cyclic nucleotide-binding-like (InterPro:IPR018490),
FT                   Acyl-CoA thioesterase (InterPro:IPR003703), RmlC-like jelly
FT                   roll fold (InterPro:IPR014710); BEST Arabidopsis thaliana
FT                   protein match is: Acyl-CoA thioesterase family protein
FT                   (TAIR:AT1G01710.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00520.3"
FT                   /db_xref="GOA:B3H5Z2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:B3H5Z2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU226966.1,INSD:DR375387.1,INSD:AA651333.1,
FT                   INSD:BP810182.1,INSD:EL028067.1,INSD:EL321265.1,
FT                   INSD:CB253621.1,INSD:AU236147.1,INSD:EL284799.1,
FT                   INSD:DR215146.1,INSD:H37158.1,INSD:H36947.1,
FT                   INSD:CB253566.1"
FT                   /protein_id="AEE81893.2"
FT                   /translation="MCFTDRGDYVVRENQNVDGVYFLLQGQAQVLRSAGEENYQEFPLK
FT                   RYDFFGHGIFGDVYSADVVAVTELTCLLLMSDHRALLEIKSVSDSDKERCLVEDILYLE
FT                   PLDLNVYRGFTPPNAPTYGKVYGGQLVGQALAAASKTVETMKIVHNFHCYFLLVGDINI
FT                   PIIYDVNRLRDGNNFATRSVDARQKGKTIFTLFASFQKKQQGFIHQESTMPHTPAPETL
FT                   LPREEMLERLVTEPLLPRDYRNQVATEISVPFPIDIRFCEPNRSTKQNKSPPRLKYWFR
FT                   AKGKLSDDDQALHRCVVAFASDLIFATISLNPHRREGMSVAALSLDHSMWFHRPVRADD
FT                   WLLFVIVSPTATESRGFATGKMFNRKGELVVSLTQEAVLREAVTIKPSFGAKL"
FT   gene            complement(231732..231950)
FT                   /locus_tag="AT4G03655"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT4G00525"
FT   ncRNA           complement(231732..231950)
FT                   /locus_tag="AT4G03655"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            231780..232939
FT                   /locus_tag="AT4G00525"
FT   mRNA            join(231780..232087,232573..232939)
FT                   /locus_tag="AT4G00525"
FT                   /product="hypothetical protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CF773155.1,INSD:EG420604.1,INSD:DR260102.1,
FT                   INSD:DR260092.1,INSD:EL052751.1,INSD:DR260098.1,
FT                   INSD:DR260099.1,INSD:DR260095.1,INSD:AV535418.1,
FT                   INSD:DR260093.1,INSD:ES058484.1,INSD:EG420601.1,
FT                   INSD:ES161017.1,INSD:DR260096.1,INSD:DR260094.1,
FT                   INSD:EG420484.1,INSD:DR260104.1,INSD:DR260097.1,
FT                   INSD:DR374795.1,INSD:DR371507.1,INSD:EG420602.1,
FT                   INSD:ES015729.1,INSD:EH958349.1,INSD:EG420603.1,
FT                   INSD:DR260100.1"
FT   CDS_pept        join(231862..232087,232573..232769)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00525"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00525"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00525.1"
FT                   /db_xref="GOA:Q6AWV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AWV5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CF773155.1,INSD:EG420604.1,INSD:DR260102.1,
FT                   INSD:DR260092.1,INSD:EL052751.1,INSD:DR260098.1,
FT                   INSD:DR260099.1,INSD:DR260095.1,INSD:AV535418.1,
FT                   INSD:DR260093.1,INSD:ES058484.1,INSD:EG420601.1,
FT                   INSD:ES161017.1,INSD:DR260096.1,INSD:DR260094.1,
FT                   INSD:EG420484.1,INSD:DR260104.1,INSD:DR260097.1,
FT                   INSD:DR374795.1,INSD:DR371507.1,INSD:EG420602.1,
FT                   INSD:ES015729.1,INSD:EH958349.1,INSD:EG420603.1,
FT                   INSD:DR260100.1"
FT                   /protein_id="AEE81894.1"
FT                   /translation="MESMASDPELDMDEGDLEKLESDVKQMAKKISEYRQTLPDHLRNT
FT                   LDSALSSHIPVFPNIDSGSDPLPSSCLTIAEAQVPGVLEEQDSEEKWIQLKERMSRNAA
FT                   NIPKVVKRMRECIESIDKLDSLEVTIHPAFKRQRIN"
FT   gene            complement(232928..233652)
FT                   /gene_synonym="F6N23.20"
FT                   /gene_synonym="F6N23_20"
FT                   /locus_tag="AT4G00530"
FT   mRNA            complement(join(232928..233131,233479..233652))
FT                   /gene_synonym="F6N23.20"
FT                   /gene_synonym="F6N23_20"
FT                   /locus_tag="AT4G00530"
FT                   /product="UvrABC system protein A"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH842521.1,INSD:EH988306.1,INSD:EG420601.1,
FT                   INSD:EG420483.1"
FT   CDS_pept        complement(join(233030..233131,233479..233592))
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.20"
FT                   /gene_synonym="F6N23_20"
FT                   /locus_tag="AT4G00530"
FT                   /product="UvrABC system protein A"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: mitochondrion; EXPRESSED IN: 19 plant structures;
FT                   EXPRESSED DURING: 9 growth stages; BEST Arabidopsis
FT                   thaliana protein match is: unknown protein
FT                   (TAIR:AT1G01725.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00530"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00530.1"
FT                   /db_xref="GOA:Q6DYB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DYB5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH842521.1,INSD:EH988306.1,INSD:EG420601.1,
FT                   INSD:EG420483.1"
FT                   /protein_id="AEE81895.1"
FT                   /translation="MNPQTDKVVRRTTMVATAVASYFLLTGDYGPEPNVLDPIKRKILA
FT                   AQDSVKQFIFGPKGEPSGKEPSDTAK"
FT   gene            complement(234597..237582)
FT                   /gene="MYB3R2"
FT                   /gene_synonym="ATMYB3R2"
FT                   /gene_synonym="C-MYB-LIKE TRANSCRIPTION FACTOR 3R-2"
FT                   /gene_synonym="F6N23.19"
FT                   /gene_synonym="F6N23_19"
FT                   /gene_synonym="myb domain protein 3r2"
FT                   /gene_synonym="MYB DOMAIN PROTEIN 3R2"
FT                   /gene_synonym="MYB3R-2"
FT                   /gene_synonym="PC-MYB2"
FT                   /locus_tag="AT4G00540"
FT                   /note="Encodes a putative c-myb-like transcription factor.
FT                   Member of a class of domain proteins containing structural
FT                   features of the vertebrate c-Myb proto-oncoprotein,
FT                   including the presence of three Myb motifs (R1,R2,R3)."
FT   mRNA            complement(join(234597..234708,235407..235725,
FT                   235807..236126,236196..236324,236427..236539,
FT                   236626..236735,236826..236883,236959..237013,
FT                   237259..237582))
FT                   /gene="MYB3R2"
FT                   /gene_synonym="ATMYB3R2"
FT                   /gene_synonym="C-MYB-LIKE TRANSCRIPTION FACTOR 3R-2"
FT                   /gene_synonym="F6N23.19"
FT                   /gene_synonym="F6N23_19"
FT                   /gene_synonym="myb domain protein 3r2"
FT                   /gene_synonym="MYB DOMAIN PROTEIN 3R2"
FT                   /gene_synonym="MYB3R-2"
FT                   /gene_synonym="PC-MYB2"
FT                   /locus_tag="AT4G00540"
FT                   /product="myb domain protein 3r2"
FT                   /inference="similar to RNA sequence, EST:INSD:EL975499.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF218054.2,INSD:AF151647.1"
FT   CDS_pept        complement(join(234597..234708,235407..235725,
FT                   235807..236126,236196..236324,236427..236539,
FT                   236626..236735,236826..236883,236959..237013,
FT                   237259..237356))
FT                   /codon_start=1
FT                   /gene="MYB3R2"
FT                   /gene_synonym="ATMYB3R2"
FT                   /gene_synonym="C-MYB-LIKE TRANSCRIPTION FACTOR 3R-2"
FT                   /gene_synonym="F6N23.19"
FT                   /gene_synonym="F6N23_19"
FT                   /gene_synonym="myb domain protein 3r2"
FT                   /gene_synonym="MYB DOMAIN PROTEIN 3R2"
FT                   /gene_synonym="MYB3R-2"
FT                   /gene_synonym="PC-MYB2"
FT                   /locus_tag="AT4G00540"
FT                   /product="myb domain protein 3r2"
FT                   /note="myb domain protein 3r2 (MYB3R2); CONTAINS InterPro
FT                   DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005),
FT                   Homeodomain-like (InterPro:IPR009057), Myb, DNA-binding
FT                   (InterPro:IPR014778), HTH transcriptional regulator,
FT                   Myb-type, DNA-binding (InterPro:IPR017930),
FT                   Homeodomain-related (InterPro:IPR012287), Myb transcription
FT                   factor (InterPro:IPR015495); BEST Arabidopsis thaliana
FT                   protein match is: Homeodomain-like protein
FT                   (TAIR:AT4G32730.2); Has 13272 Blast hits to 8134 proteins
FT                   in 555 species: Archae - 0; Bacteria - 0; Metazoa - 1137;
FT                   Fungi - 983; Plants - 8207; Viruses - 4; Other Eukaryotes -
FT                   2941 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00540"
FT                   /db_xref="GOA:Q9SPN3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SPN3"
FT                   /inference="similar to RNA sequence, EST:INSD:EL975499.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF218054.2,INSD:AF151647.1"
FT                   /protein_id="AEE81896.1"
FT                   /translation="MTESIDLNRSESESDNNTDDVTPIFAIDDSSKGRVSGPTRRSTKG
FT                   GWTAEEDQILTNVVKKYQGRNWKRIAECLPGSEENRRNDVQCQHRWLKVLDPSLQKGAW
FT                   KKEEDELLSELVKDYMENDRPPWSKISKELPGRIGKQCRERWHNHLNPTIIKSPWTREE
FT                   ELILVQAQRGNGNKWAEIAKLLPGRTENNIKNHWNCSVKKRLEQFPSNLFSGVVYGSKP
FT                   SSGFEYNFFNQRNTMVESCITSQIKEAAKSPQRDFLDLTLGLNWRSISSSTSSLRGEES
FT                   VSSSVDSVCARLNACLETPQNSNNDTVCVKEVREMKERLRMAARTFDTPSIISKTSSPA
FT                   SGLKRLRQKYDTPFPTDARSHMSSEEDHSVSASPSSKYRFVKRNTCSGSKPLERRLDFD
FT                   FLLWDEHGRRNGIVNFSVRILPQKSDLKSGLVRPFWLR"
FT   mRNA            complement(join(235214..235731,235807..236126,
FT                   236196..236324,236427..236539,236626..236735,
FT                   236826..236883,236959..237019,237259..237582))
FT                   /gene="MYB3R2"
FT                   /gene_synonym="ATMYB3R2"
FT                   /gene_synonym="C-MYB-LIKE TRANSCRIPTION FACTOR 3R-2"
FT                   /gene_synonym="F6N23.19"
FT                   /gene_synonym="F6N23_19"
FT                   /gene_synonym="myb domain protein 3r2"
FT                   /gene_synonym="MYB DOMAIN PROTEIN 3R2"
FT                   /gene_synonym="MYB3R-2"
FT                   /gene_synonym="PC-MYB2"
FT                   /locus_tag="AT4G00540"
FT                   /product="myb domain protein 3r2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR749597.1,INSD:DR749591.1,INSD:EL975499.1,
FT                   INSD:BE521244.1,INSD:BE521245.1"
FT   CDS_pept        complement(join(235403..235731,235807..236126,
FT                   236196..236324,236427..236539,236626..236735,
FT                   236826..236883,236959..237019,237259..237356))
FT                   /codon_start=1
FT                   /gene="MYB3R2"
FT                   /gene_synonym="ATMYB3R2"
FT                   /gene_synonym="C-MYB-LIKE TRANSCRIPTION FACTOR 3R-2"
FT                   /gene_synonym="F6N23.19"
FT                   /gene_synonym="F6N23_19"
FT                   /gene_synonym="myb domain protein 3r2"
FT                   /gene_synonym="MYB DOMAIN PROTEIN 3R2"
FT                   /gene_synonym="MYB3R-2"
FT                   /gene_synonym="PC-MYB2"
FT                   /locus_tag="AT4G00540"
FT                   /product="myb domain protein 3r2"
FT                   /note="myb domain protein 3r2 (MYB3R2); CONTAINS InterPro
FT                   DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005),
FT                   Homeodomain-like (InterPro:IPR009057), Myb, DNA-binding
FT                   (InterPro:IPR014778), HTH transcriptional regulator,
FT                   Myb-type, DNA-binding (InterPro:IPR017930),
FT                   Homeodomain-related (InterPro:IPR012287), Myb transcription
FT                   factor (InterPro:IPR015495); BEST Arabidopsis thaliana
FT                   protein match is: Homeodomain-like protein
FT                   (TAIR:AT4G32730.2); Has 14074 Blast hits to 8120 proteins
FT                   in 551 species: Archae - 0; Bacteria - 0; Metazoa - 1200;
FT                   Fungi - 968; Plants - 8858; Viruses - 6; Other Eukaryotes -
FT                   3042 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00540"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00540.2"
FT                   /db_xref="GOA:F4JHD4"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHD4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR749597.1,INSD:DR749591.1,INSD:EL975499.1,
FT                   INSD:BE521244.1,INSD:BE521245.1"
FT                   /protein_id="AEE81897.1"
FT                   /translation="MTESIDLNRSESESDNNTDDVTPIFAIDDSSKGYRRVSGPTRRST
FT                   KGGWTAEEDQILTNVVKKYQGRNWKRIAECLPGSEENRRNDVQCQHRWLKVLDPSLQKG
FT                   AWKKEEDELLSELVKDYMENDRPPWSKISKELPGRIGKQCRERWHNHLNPTIIKSPWTR
FT                   EEELILVQAQRGNGNKWAEIAKLLPGRTENNIKNHWNCSVKKRLEQFPSNLFSGVVYGS
FT                   KPSSGFEYNFFNQRNTMVESCITSQIKEAAKSPQRDFLDLTLGLNWRSISSSTSSLRGE
FT                   ESVSSSVDSVCARLNVSACLETPQNSNNDTVCVKEVREMKERLRMAARTFDTPSIISKT
FT                   SSPASGLKRLRQKYDTPFPTDARSHMSSEEDHSVSASPSSKYRFVKRNTCSGSKPLERR
FT                   LDFDFL"
FT   gene            complement(237901..240579)
FT                   /gene="DGD2"
FT                   /gene_synonym="digalactosyl diacylglycerol deficient 2"
FT                   /gene_synonym="DIGALACTOSYLDIACYLGLYCEROL SYNTHASE"
FT                   /gene_synonym="F6N23.24"
FT                   /gene_synonym="F6N23_24"
FT                   /locus_tag="AT4G00550"
FT                   /note="encodes a UDP-galactose-dependent
FT                   digalactosyldiacylglycerol(DGDG) synthase. Located in
FT                   chloroplast outer membrane."
FT   mRNA            complement(join(237901..238670,238765..239114,
FT                   239295..239561,239732..240211))
FT                   /gene="DGD2"
FT                   /gene_synonym="digalactosyl diacylglycerol deficient 2"
FT                   /gene_synonym="DIGALACTOSYLDIACYLGLYCEROL SYNTHASE"
FT                   /gene_synonym="F6N23.24"
FT                   /gene_synonym="F6N23_24"
FT                   /locus_tag="AT4G00550"
FT                   /product="digalactosyl diacylglycerol deficient 2"
FT   mRNA            complement(join(237955..238670,238765..239114,
FT                   239295..239561,239732..240038,240238..240579))
FT                   /gene="DGD2"
FT                   /gene_synonym="digalactosyl diacylglycerol deficient 2"
FT                   /gene_synonym="DIGALACTOSYLDIACYLGLYCEROL SYNTHASE"
FT                   /gene_synonym="F6N23.24"
FT                   /gene_synonym="F6N23_24"
FT                   /locus_tag="AT4G00550"
FT                   /product="digalactosyl diacylglycerol deficient 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR359168.1,INSD:EL004277.1,INSD:EH902330.1,
FT                   INSD:BP846398.1,INSD:BP567826.1,INSD:EL326230.1,
FT                   INSD:EH883835.1,INSD:AI998922.1,INSD:BX836600.1,
FT                   INSD:EH874986.1,INSD:AU226924.1,INSD:EH912614.1,
FT                   INSD:EL211392.1,INSD:W43142.1,INSD:BP584232.1,
FT                   INSD:AV555577.1,INSD:BP815751.1,INSD:BP577584.1,
FT                   INSD:EG466381.1,INSD:EL203534.1,INSD:ES185165.1,
FT                   INSD:EL268226.1,INSD:EG466393.1,INSD:EL253756.1,
FT                   INSD:AA651217.1,INSD:EG466382.1,INSD:DR383376.1,
FT                   INSD:BP562787.3,INSD:BX840945.1,INSD:CB254271.1,
FT                   INSD:ES106607.1,INSD:EL084769.1,INSD:AV440158.1,
FT                   INSD:EL200337.1,INSD:BP863504.1,INSD:H36657.1,
FT                   INSD:EG466392.1,INSD:ES076772.1,INSD:EL980268.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT010144.1,INSD:BX828499.1,INSD:AK220856.1,
FT                   INSD:BX827334.1"
FT   CDS_pept        complement(join(238154..238670,238765..239114,
FT                   239295..239561,239732..240019))
FT                   /codon_start=1
FT                   /gene="DGD2"
FT                   /gene_synonym="digalactosyl diacylglycerol deficient 2"
FT                   /gene_synonym="DIGALACTOSYLDIACYLGLYCEROL SYNTHASE"
FT                   /gene_synonym="F6N23.24"
FT                   /gene_synonym="F6N23_24"
FT                   /locus_tag="AT4G00550"
FT                   /product="digalactosyl diacylglycerol deficient 2"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00550"
FT                   /db_xref="GOA:Q8W1S1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="PDB:2L7C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8W1S1"
FT                   /protein_id="ANM67739.1"
FT                   /translation="MTNQQEQHIAIFTTASIPWLTGTAVNPLFRAAYLANDGERRVTLV
FT                   IPWLTLKHQKLVYPNSITFSSPSEQEAYVRQWLEERVSFRLAFEIRFYPGKFAIDKRSI
FT                   LPVGDISDAIPDEEADIAVLEEPEHLTWFHHGQKWKTKFNYVIGIVHTNYLEYVKREKQ
FT                   GRVKAFFLKYLNSWVVGIYCHKVIRLSAATQEYPKSIVCNVHGVNPKFLEIGLRKLEQQ
FT                   KLQEQPFTKGAYYIGKMVWSKGYKELLKLLEKHQKELAELEVDLYGDGEDSEEIKEAAR
FT                   KLDLTVNVYPGRDHADSLFHNYKVFLNPSTTDVVCTTTAEALAMGKIVVCANHISNKFF
FT                   KQFPNCRTYDDGQGFVRATLKALGEQPSQLTEQQRHELSWEAATQRFIKVSDLNRLSRA
FT                   DSNLSKRSVFASSSISVGKNLEDMSAYIHFLASGFEASRTAFGAIPGSLQPDEELCRDL
FT                   GLSLNTPSPNTRKQD"
FT   CDS_pept        complement(join(238154..238670,238765..239114,
FT                   239295..239561,239732..240019))
FT                   /codon_start=1
FT                   /gene="DGD2"
FT                   /gene_synonym="digalactosyl diacylglycerol deficient 2"
FT                   /gene_synonym="DIGALACTOSYLDIACYLGLYCEROL SYNTHASE"
FT                   /gene_synonym="F6N23.24"
FT                   /gene_synonym="F6N23_24"
FT                   /locus_tag="AT4G00550"
FT                   /product="digalactosyl diacylglycerol deficient 2"
FT                   /note="digalactosyl diacylglycerol deficient 2 (DGD2);
FT                   CONTAINS InterPro DOMAIN/s: Glycosyl transferase, group 1
FT                   (InterPro:IPR001296); BEST Arabidopsis thaliana protein
FT                   match is: UDP-Glycosyltransferase superfamily protein
FT                   (TAIR:AT3G11670.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8W1S1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="PDB:2L7C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8W1S1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR359168.1,INSD:EL004277.1,INSD:EH902330.1,
FT                   INSD:BP846398.1,INSD:BP567826.1,INSD:EL326230.1,
FT                   INSD:EH883835.1,INSD:AI998922.1,INSD:BX836600.1,
FT                   INSD:EH874986.1,INSD:AU226924.1,INSD:EH912614.1,
FT                   INSD:EL211392.1,INSD:W43142.1,INSD:BP584232.1,
FT                   INSD:AV555577.1,INSD:BP815751.1,INSD:BP577584.1,
FT                   INSD:EG466381.1,INSD:EL203534.1,INSD:ES185165.1,
FT                   INSD:EL268226.1,INSD:EG466393.1,INSD:EL253756.1,
FT                   INSD:AA651217.1,INSD:EG466382.1,INSD:DR383376.1,
FT                   INSD:BP562787.3,INSD:BX840945.1,INSD:CB254271.1,
FT                   INSD:ES106607.1,INSD:EL084769.1,INSD:AV440158.1,
FT                   INSD:EL200337.1,INSD:BP863504.1,INSD:H36657.1,
FT                   INSD:EG466392.1,INSD:ES076772.1,INSD:EL980268.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT010144.1,INSD:BX828499.1,INSD:AK220856.1,
FT                   INSD:BX827334.1"
FT                   /protein_id="AEE81898.1"
FT                   /translation="MTNQQEQHIAIFTTASIPWLTGTAVNPLFRAAYLANDGERRVTLV
FT                   IPWLTLKHQKLVYPNSITFSSPSEQEAYVRQWLEERVSFRLAFEIRFYPGKFAIDKRSI
FT                   LPVGDISDAIPDEEADIAVLEEPEHLTWFHHGQKWKTKFNYVIGIVHTNYLEYVKREKQ
FT                   GRVKAFFLKYLNSWVVGIYCHKVIRLSAATQEYPKSIVCNVHGVNPKFLEIGLRKLEQQ
FT                   KLQEQPFTKGAYYIGKMVWSKGYKELLKLLEKHQKELAELEVDLYGDGEDSEEIKEAAR
FT                   KLDLTVNVYPGRDHADSLFHNYKVFLNPSTTDVVCTTTAEALAMGKIVVCANHISNKFF
FT                   KQFPNCRTYDDGQGFVRATLKALGEQPSQLTEQQRHELSWEAATQRFIKVSDLNRLSRA
FT                   DSNLSKRSVFASSSISVGKNLEDMSAYIHFLASGFEASRTAFGAIPGSLQPDEELCRDL
FT                   GLSLNTPSPNTRKQD"
FT   gene            complement(240634..242497)
FT                   /gene_synonym="F6N23.17"
FT                   /gene_synonym="F6N23_17"
FT                   /locus_tag="AT4G00560"
FT   mRNA            complement(join(240634..240941,241025..241155,
FT                   241459..241646,241743..241902,242031..242497))
FT                   /gene_synonym="F6N23.17"
FT                   /gene_synonym="F6N23_17"
FT                   /locus_tag="AT4G00560"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG498822.1,INSD:EG498828.1,INSD:EG498810.1,
FT                   INSD:EG498804.1,INSD:ES171491.1,INSD:EL038220.1,
FT                   INSD:EL204942.1,INSD:BP845455.1,INSD:EH995168.1,
FT                   INSD:EG498826.1,INSD:EG498805.1,INSD:EL277500.1,
FT                   INSD:EL239115.1,INSD:ES133215.1,INSD:EL172759.1,
FT                   INSD:EG498824.1,INSD:EL292046.1,INSD:EH882048.1,
FT                   INSD:EH868802.1,INSD:AU227067.1,INSD:EG498823.1,
FT                   INSD:EL299248.1,INSD:EG498816.1,INSD:EG481092.1,
FT                   INSD:BP608222.1,INSD:EG498832.1,INSD:EG498827.1,
FT                   INSD:EL046513.1,INSD:EL037632.1,INSD:EG498833.1,
FT                   INSD:EL160116.1,INSD:EG498811.1,INSD:EG498802.1,
FT                   INSD:ES013069.1,INSD:BP801028.1,INSD:EG498819.1,
FT                   INSD:EH906775.1,INSD:EH942705.1,INSD:EL185694.1,
FT                   INSD:EL211469.1,INSD:ES165104.1,INSD:EG498803.1,
FT                   INSD:EL308725.1,INSD:EH967862.1,INSD:EL172043.1,
FT                   INSD:EG498821.1,INSD:EG498825.1,INSD:EH954092.1,
FT                   INSD:F14131.1,INSD:EL289427.1,INSD:EL052750.1,
FT                   INSD:ES189554.1,INSD:ES160718.1,INSD:EL036994.1,
FT                   INSD:DR297019.1,INSD:EL090258.1,INSD:EL996610.1,
FT                   INSD:BP797177.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827503.1,INSD:BX827018.1"
FT   mRNA            complement(join(240634..240941,241025..241155,
FT                   241247..241370,241459..241646,241743..241902,
FT                   242031..242497))
FT                   /gene_synonym="F6N23.17"
FT                   /gene_synonym="F6N23_17"
FT                   /locus_tag="AT4G00560"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT   mRNA            complement(join(240660..240953,241025..241155,
FT                   241247..241370,241459..241646,241743..241902,
FT                   242031..242351))
FT                   /gene_synonym="F6N23.17"
FT                   /gene_synonym="F6N23_17"
FT                   /locus_tag="AT4G00560"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG498822.1,INSD:EG498828.1,INSD:EG498810.1,
FT                   INSD:EG498804.1,INSD:EL188626.1,INSD:ES171491.1,
FT                   INSD:EL038220.1,INSD:EL204942.1,INSD:BP845455.1,
FT                   INSD:EH995168.1,INSD:BP616700.1,INSD:EL179013.1,
FT                   INSD:AU236229.1,INSD:EG498826.1,INSD:EG498805.1,
FT                   INSD:EL277500.1,INSD:EL239115.1,INSD:ES133215.1,
FT                   INSD:BP790095.1,INSD:EL172759.1,INSD:EG498824.1,
FT                   INSD:EL292046.1,INSD:EH882048.1,INSD:EH868802.1,
FT                   INSD:AU227067.1,INSD:EG498823.1,INSD:EL299248.1,
FT                   INSD:EG498816.1,INSD:EG481092.1,INSD:BP608222.1,
FT                   INSD:EG498832.1,INSD:ES104285.1,INSD:EG498827.1,
FT                   INSD:EL046513.1,INSD:EL037632.1,INSD:EG498833.1,
FT                   INSD:EL160116.1,INSD:EG498811.1,INSD:BP794512.1,
FT                   INSD:EG498802.1,INSD:ES013069.1,INSD:AI997669.1,
FT                   INSD:DR382036.1,INSD:BP801028.1,INSD:EG498819.1,
FT                   INSD:EH906775.1,INSD:EH942705.1,INSD:EL185694.1,
FT                   INSD:EL211469.1,INSD:ES165104.1,INSD:BP603099.1,
FT                   INSD:EG498803.1,INSD:EL308725.1,INSD:EH967862.1,
FT                   INSD:EL172043.1,INSD:EG498821.1,INSD:EH954092.1,
FT                   INSD:EG498825.1,INSD:F14131.1,INSD:BP584535.1,
FT                   INSD:EL289427.1,INSD:EL052750.1,INSD:ES189554.1,
FT                   INSD:ES160718.1,INSD:EL036994.1,INSD:BP583031.1,
FT                   INSD:DR297019.1,INSD:EL090258.1,INSD:EL996610.1,
FT                   INSD:BP797177.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK228352.1"
FT   mRNA            complement(join(240676..240941,241025..241370,
FT                   241459..241646,241743..241902,242031..242379))
FT                   /gene_synonym="F6N23.17"
FT                   /gene_synonym="F6N23_17"
FT                   /locus_tag="AT4G00560"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG498822.1,INSD:EG498828.1,INSD:EG498810.1,
FT                   INSD:CB262622.1,INSD:EG498804.1,INSD:EL188626.1,
FT                   INSD:ES171491.1,INSD:EL038220.1,INSD:EL204942.1,
FT                   INSD:BP845455.1,INSD:EH995168.1,INSD:AU236229.1,
FT                   INSD:EG498826.1,INSD:EG498805.1,INSD:EL277500.1,
FT                   INSD:EL239115.1,INSD:ES133215.1,INSD:EL172759.1,
FT                   INSD:EG498824.1,INSD:EL292046.1,INSD:EH882048.1,
FT                   INSD:EH868802.1,INSD:AU227067.1,INSD:EG498823.1,
FT                   INSD:EL299248.1,INSD:BP583849.1,INSD:EG498816.1,
FT                   INSD:EG481092.1,INSD:BP608222.1,INSD:EG498832.1,
FT                   INSD:BP573925.1,INSD:EG498827.1,INSD:ES104285.1,
FT                   INSD:EL046513.1,INSD:EL037632.1,INSD:EG498833.1,
FT                   INSD:BP670345.1,INSD:EL160116.1,INSD:EG498811.1,
FT                   INSD:EG498802.1,INSD:ES013069.1,INSD:BP801028.1,
FT                   INSD:EG498819.1,INSD:EH906775.1,INSD:EH942705.1,
FT                   INSD:EL185694.1,INSD:EL211469.1,INSD:ES165104.1,
FT                   INSD:EG498803.1,INSD:EL308725.1,INSD:EH967862.1,
FT                   INSD:EL172043.1,INSD:EG498821.1,INSD:EH954092.1,
FT                   INSD:EG498825.1,INSD:F14131.1,INSD:EL991233.1,
FT                   INSD:F14059.1,INSD:EL984485.1,INSD:EL289427.1,
FT                   INSD:EL052750.1,INSD:ES189554.1,INSD:ES160718.1,
FT                   INSD:EL036994.1,INSD:DR297019.1,INSD:EL090258.1,
FT                   INSD:EL996610.1,INSD:BP797177.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT030049.1"
FT   CDS_pept        complement(join(240798..240941,241025..241155,
FT                   241247..241370,241459..241646,241743..241902,
FT                   242031..242267))
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.17"
FT                   /gene_synonym="F6N23_17"
FT                   /locus_tag="AT4G00560"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /note="NAD(P)-binding Rossmann-fold superfamily protein;
FT                   FUNCTIONS IN: dTDP-4-dehydrorhamnose reductase activity,
FT                   binding, catalytic activity; INVOLVED IN: dTDP-rhamnose
FT                   biosynthetic process, extracellular polysaccharide
FT                   biosynthetic process, metabolic process; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 17 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: NAD(P)-binding domain (InterPro:IPR016040),
FT                   dTDP-4-dehydrorhamnose reductase (InterPro:IPR005913); Has
FT                   7761 Blast hits to 7761 proteins in 1842 species: Archae -
FT                   350; Bacteria - 5037; Metazoa - 116; Fungi - 124; Plants -
FT                   45; Viruses - 0; Other Eukaryotes - 2089 (source: NCBI
FT                   BLink)."
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHD6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG498822.1,INSD:EG498828.1,INSD:EG498810.1,
FT                   INSD:EG498804.1,INSD:EL188626.1,INSD:ES171491.1,
FT                   INSD:EL038220.1,INSD:EL204942.1,INSD:BP845455.1,
FT                   INSD:EH995168.1,INSD:BP616700.1,INSD:EL179013.1,
FT                   INSD:AU236229.1,INSD:EG498826.1,INSD:EG498805.1,
FT                   INSD:EL277500.1,INSD:EL239115.1,INSD:ES133215.1,
FT                   INSD:BP790095.1,INSD:EL172759.1,INSD:EG498824.1,
FT                   INSD:EL292046.1,INSD:EH882048.1,INSD:EH868802.1,
FT                   INSD:AU227067.1,INSD:EG498823.1,INSD:EL299248.1,
FT                   INSD:EG498816.1,INSD:EG481092.1,INSD:BP608222.1,
FT                   INSD:EG498832.1,INSD:ES104285.1,INSD:EG498827.1,
FT                   INSD:EL046513.1,INSD:EL037632.1,INSD:EG498833.1,
FT                   INSD:EL160116.1,INSD:EG498811.1,INSD:BP794512.1,
FT                   INSD:EG498802.1,INSD:ES013069.1,INSD:AI997669.1,
FT                   INSD:DR382036.1,INSD:BP801028.1,INSD:EG498819.1,
FT                   INSD:EH906775.1,INSD:EH942705.1,INSD:EL185694.1,
FT                   INSD:EL211469.1,INSD:ES165104.1,INSD:BP603099.1,
FT                   INSD:EG498803.1,INSD:EL308725.1,INSD:EH967862.1,
FT                   INSD:EL172043.1,INSD:EG498821.1,INSD:EH954092.1,
FT                   INSD:EG498825.1,INSD:F14131.1,INSD:BP584535.1,
FT                   INSD:EL289427.1,INSD:EL052750.1,INSD:ES189554.1,
FT                   INSD:ES160718.1,INSD:EL036994.1,INSD:BP583031.1,
FT                   INSD:DR297019.1,INSD:EL090258.1,INSD:EL996610.1,
FT                   INSD:BP797177.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK228352.1"
FT                   /protein_id="AEE81899.1"
FT                   /translation="MEKKTKVLIVGGTGYLGQHLLQAFAGNYGGECELYDVAFTHHSSP
FT                   LPARLLDAFPHSPAFPVDLKSGLGLNSISQDFRQPDVVVNCAALSVPRACEQDPDSAMS
FT                   INVPTSLVNWLSSFETNKTLLIHLSTDQVYQGVKSFYKEEDETVAVNVYGKSKVAAELL
FT                   IKDKCQSFAILRSSIIFGPQTVSPLPKTLPIQWIDSSLKKGDTVDFFHDEFRCPIYVKD
FT                   LVNITFKLIDRWVSDDKQMRLVLNAGGPERLSRVQMAQMVAEVRGYDLSLIKHVSASSI
FT                   DRGVVSPADISMDITKLIHTLELSPTSFKEGVRLTLDSESHSHMLP"
FT   CDS_pept        complement(join(240798..240953,241025..241155,
FT                   241247..241370,241459..241646,241743..241902,
FT                   242031..242267))
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.17"
FT                   /gene_synonym="F6N23_17"
FT                   /locus_tag="AT4G00560"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /note="NAD(P)-binding Rossmann-fold superfamily protein;
FT                   FUNCTIONS IN: dTDP-4-dehydrorhamnose reductase activity,
FT                   binding, catalytic activity; INVOLVED IN: extracellular
FT                   polysaccharide biosynthetic process, metabolic process;
FT                   LOCATED IN: endomembrane system; EXPRESSED IN: 17 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: NAD(P)-binding domain
FT                   (InterPro:IPR016040), dTDP-4-dehydrorhamnose reductase
FT                   (InterPro:IPR005913)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00560"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00560.4"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHD7"
FT                   /protein_id="AEE81902.1"
FT                   /translation="MEKKTKVLIVGGTGYLGQHLLQAFAGNYGGECELYDVAFTHHSSP
FT                   LPARLLDAFPHSPAFPVDLKSGLGLNSISQDFRQPDVVVNCAALSVPRACEQDPDSAMS
FT                   INVPTSLVNWLSSFETNKTLLIHLSTDQVYQGVKSFYKEEDETVAVNVYGKSKVAAELL
FT                   IKDKCQSFAILRSSIIFGPQTVSPLPKTLPIQWIDSSLKKGDTVDFFHDEFRCPIYVKD
FT                   LVNITFKLIDRWVSDDKQMRLVLNAGGPERLSRVQMAQMVAEVRGYDLSLIKHVSASSL
FT                   FCQIDRGVVSPADISMDITKLIHTLELSPTSFKEGVRLTLDSESHSHMLP"
FT   CDS_pept        complement(join(241135..241155,241459..241646,
FT                   241743..241902,242031..242267))
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.17"
FT                   /gene_synonym="F6N23_17"
FT                   /locus_tag="AT4G00560"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /note="NAD(P)-binding Rossmann-fold superfamily protein;
FT                   FUNCTIONS IN: dTDP-4-dehydrorhamnose reductase activity,
FT                   binding, catalytic activity; INVOLVED IN: extracellular
FT                   polysaccharide biosynthetic process, metabolic process;
FT                   LOCATED IN: endomembrane system; EXPRESSED IN: 17 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: NAD(P)-binding domain
FT                   (InterPro:IPR016040), dTDP-4-dehydrorhamnose reductase
FT                   (InterPro:IPR005913); Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00560"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00560.2"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHD8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG498822.1,INSD:EG498828.1,INSD:EG498810.1,
FT                   INSD:EG498804.1,INSD:ES171491.1,INSD:EL038220.1,
FT                   INSD:EL204942.1,INSD:BP845455.1,INSD:EH995168.1,
FT                   INSD:EG498826.1,INSD:EG498805.1,INSD:EL277500.1,
FT                   INSD:EL239115.1,INSD:ES133215.1,INSD:EL172759.1,
FT                   INSD:EG498824.1,INSD:EL292046.1,INSD:EH882048.1,
FT                   INSD:EH868802.1,INSD:AU227067.1,INSD:EG498823.1,
FT                   INSD:EL299248.1,INSD:EG498816.1,INSD:EG481092.1,
FT                   INSD:BP608222.1,INSD:EG498832.1,INSD:EG498827.1,
FT                   INSD:EL046513.1,INSD:EL037632.1,INSD:EG498833.1,
FT                   INSD:EL160116.1,INSD:EG498811.1,INSD:EG498802.1,
FT                   INSD:ES013069.1,INSD:BP801028.1,INSD:EG498819.1,
FT                   INSD:EH906775.1,INSD:EH942705.1,INSD:EL185694.1,
FT                   INSD:EL211469.1,INSD:ES165104.1,INSD:EG498803.1,
FT                   INSD:EL308725.1,INSD:EH967862.1,INSD:EL172043.1,
FT                   INSD:EG498821.1,INSD:EG498825.1,INSD:EH954092.1,
FT                   INSD:F14131.1,INSD:EL289427.1,INSD:EL052750.1,
FT                   INSD:ES189554.1,INSD:ES160718.1,INSD:EL036994.1,
FT                   INSD:DR297019.1,INSD:EL090258.1,INSD:EL996610.1,
FT                   INSD:BP797177.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827503.1,INSD:BX827018.1"
FT                   /protein_id="AEE81901.1"
FT                   /translation="MEKKTKVLIVGGTGYLGQHLLQAFAGNYGGECELYDVAFTHHSSP
FT                   LPARLLDAFPHSPAFPVDLKSGLGLNSISQDFRQPDVVVNCAALSVPRACEQDPDSAMS
FT                   INVPTSLVNWLSSFETNKTLLIHLSTDQVYQGVKSFYKEEDETVAVNVYGKSKVAAELL
FT                   IKDKCQSFAILRSSIIFGPQTVSPLPKTLPIQMINRCG"
FT   CDS_pept        complement(join(241194..241370,241459..241646,
FT                   241743..241902,242031..242267))
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.17"
FT                   /gene_synonym="F6N23_17"
FT                   /locus_tag="AT4G00560"
FT                   /product="NAD(P)-binding Rossmann-fold superfamily protein"
FT                   /note="NAD(P)-binding Rossmann-fold superfamily protein;
FT                   FUNCTIONS IN: dTDP-4-dehydrorhamnose reductase activity,
FT                   binding, catalytic activity; INVOLVED IN: extracellular
FT                   polysaccharide biosynthetic process, metabolic process;
FT                   LOCATED IN: endomembrane system; EXPRESSED IN: 17 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: NAD(P)-binding domain
FT                   (InterPro:IPR016040), dTDP-4-dehydrorhamnose reductase
FT                   (InterPro:IPR005913); Has 35333 Blast hits to 34131
FT                   proteins in 2444 species: Archae - 798; Bacteria - 22429;
FT                   Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0;
FT                   Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00560"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVQ8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG498822.1,INSD:EG498828.1,INSD:EG498810.1,
FT                   INSD:CB262622.1,INSD:EG498804.1,INSD:EL188626.1,
FT                   INSD:ES171491.1,INSD:EL038220.1,INSD:EL204942.1,
FT                   INSD:BP845455.1,INSD:EH995168.1,INSD:AU236229.1,
FT                   INSD:EG498826.1,INSD:EG498805.1,INSD:EL277500.1,
FT                   INSD:EL239115.1,INSD:ES133215.1,INSD:EL172759.1,
FT                   INSD:EG498824.1,INSD:EL292046.1,INSD:EH882048.1,
FT                   INSD:EH868802.1,INSD:AU227067.1,INSD:EG498823.1,
FT                   INSD:EL299248.1,INSD:BP583849.1,INSD:EG498816.1,
FT                   INSD:EG481092.1,INSD:BP608222.1,INSD:EG498832.1,
FT                   INSD:BP573925.1,INSD:EG498827.1,INSD:ES104285.1,
FT                   INSD:EL046513.1,INSD:EL037632.1,INSD:EG498833.1,
FT                   INSD:BP670345.1,INSD:EL160116.1,INSD:EG498811.1,
FT                   INSD:EG498802.1,INSD:ES013069.1,INSD:BP801028.1,
FT                   INSD:EG498819.1,INSD:EH906775.1,INSD:EH942705.1,
FT                   INSD:EL185694.1,INSD:EL211469.1,INSD:ES165104.1,
FT                   INSD:EG498803.1,INSD:EL308725.1,INSD:EH967862.1,
FT                   INSD:EL172043.1,INSD:EG498821.1,INSD:EH954092.1,
FT                   INSD:EG498825.1,INSD:F14131.1,INSD:EL991233.1,
FT                   INSD:F14059.1,INSD:EL984485.1,INSD:EL289427.1,
FT                   INSD:EL052750.1,INSD:ES189554.1,INSD:ES160718.1,
FT                   INSD:EL036994.1,INSD:DR297019.1,INSD:EL090258.1,
FT                   INSD:EL996610.1,INSD:BP797177.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT030049.1"
FT                   /protein_id="AEE81900.1"
FT                   /translation="MEKKTKVLIVGGTGYLGQHLLQAFAGNYGGECELYDVAFTHHSSP
FT                   LPARLLDAFPHSPAFPVDLKSGLGLNSISQDFRQPDVVVNCAALSVPRACEQDPDSAMS
FT                   INVPTSLVNWLSSFETNKTLLIHLSTDQVYQGVKSFYKEEDETVAVNVYGKSKVAAELL
FT                   IKDKCQSFAILRSSIIFGPQTVSPLPKTLPIQWIDSSLKKGDTVDFFHDEFRCPIYVKD
FT                   LVNITFKLIDRWVSGRFFFTEFHSLALHHCT"
FT   gene            complement(242461..246804)
FT                   /gene="NAD-ME2"
FT                   /gene_synonym="F6N23.16"
FT                   /gene_synonym="F6N23_16"
FT                   /gene_synonym="NAD-dependent malic enzyme 2"
FT                   /locus_tag="AT4G00570"
FT                   /note="Encodes an NAD-dependent malic enzyme (NAD-ME) that
FT                   does not act on oxaloacetate, indicating that it belongs to
FT                   EC 1.1.1.39. It is a member of the beta family of NAD-MEs
FT                   in plants. It appears to function as a homodimer or as a
FT                   heterodimer with the alpha-type NAD-ME2 (At2g13560).
FT                   NAD-ME2 transcript and protein levels are higher during the
FT                   night than during the day."
FT   mRNA            complement(join(242461..242888,242986..243100,
FT                   243197..243259,243346..243417,243543..243597,
FT                   243684..243770,243850..243922,244013..244078,
FT                   244257..244355,244674..244776,244877..244983,
FT                   245087..245170,245249..245352,245434..245494,
FT                   245596..245892,245967..246085,246168..246264,
FT                   246373..246557,246680..246804))
FT                   /gene="NAD-ME2"
FT                   /gene_synonym="F6N23.16"
FT                   /gene_synonym="F6N23_16"
FT                   /gene_synonym="NAD-dependent malic enzyme 2"
FT                   /locus_tag="AT4G00570"
FT                   /product="NAD-dependent malic enzyme 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP805195.1,INSD:EL341279.1,INSD:AV823890.1,
FT                   INSD:EH938037.1,INSD:AV825639.1,INSD:EL991920.1,
FT                   INSD:BP646124.1,INSD:ES199477.1,INSD:BP804279.1,
FT                   INSD:AV531265.1,INSD:EL048370.1,INSD:ES140041.1,
FT                   INSD:AV798340.1,INSD:BP607416.1,INSD:BP840951.1,
FT                   INSD:AV814024.1,INSD:EL119107.1,INSD:EL192211.1,
FT                   INSD:EL291418.1,INSD:AV791815.1,INSD:BX841114.1,
FT                   INSD:BP840932.1,INSD:EH945989.1,INSD:EH840476.1,
FT                   INSD:BP822780.1,INSD:EL234009.1,INSD:ES211010.1,
FT                   INSD:BP598564.1,INSD:EG448510.1,INSD:BP808746.1,
FT                   INSD:BP612687.1,INSD:EH942415.1,INSD:ES007877.1,
FT                   INSD:BP793279.1,INSD:BP645997.1,INSD:AV827912.1,
FT                   INSD:EH847190.1,INSD:BP600777.1,INSD:ES163575.1,
FT                   INSD:EH953928.1,INSD:AV817549.1,INSD:BP562417.2,
FT                   INSD:EH936029.1,INSD:AV784969.1,INSD:ES006850.1,
FT                   INSD:AA651154.1,INSD:EL176948.1,INSD:BP573307.1,
FT                   INSD:BP801609.1,INSD:EH942993.1,INSD:AV796242.1,
FT                   INSD:BP820676.1,INSD:BP832913.1,INSD:ES114866.1,
FT                   INSD:AV826779.1,INSD:EG448508.1,INSD:EH823742.1,
FT                   INSD:BP592582.1,INSD:CB259738.1,INSD:H36031.1,
FT                   INSD:BP588852.1,INSD:EL327452.1,INSD:AV799883.1,
FT                   INSD:EL252953.1,INSD:BP656878.1,INSD:AV811045.1,
FT                   INSD:EH956525.1,INSD:EL248180.1,INSD:ES056148.1,
FT                   INSD:BP828824.1,INSD:BP594801.1,INSD:EG505985.1,
FT                   INSD:ES144056.1,INSD:BP655506.1,INSD:EH982021.1,
FT                   INSD:ES071456.1,INSD:AV794120.1,INSD:BP812644.1,
FT                   INSD:BP660749.1,INSD:EH944191.1,INSD:BP650317.1,
FT                   INSD:BP637824.1,INSD:BX839092.1,INSD:AV816406.1,
FT                   INSD:ES122495.1,INSD:CF773642.1,INSD:ES017989.1,
FT                   INSD:EH816179.1,INSD:BP575157.1,INSD:BP829599.1,
FT                   INSD:BP822115.2"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY128396.1,INSD:BX828688.1,INSD:BT008375.1,
FT                   INSD:BT002046.1,INSD:BT000075.1"
FT   CDS_pept        complement(join(242817..242888,242986..243100,
FT                   243197..243259,243346..243417,243543..243597,
FT                   243684..243770,243850..243922,244013..244078,
FT                   244257..244355,244674..244776,244877..244983,
FT                   245087..245170,245249..245352,245434..245494,
FT                   245596..245892,245967..246085,246168..246264,
FT                   246373..246522))
FT                   /codon_start=1
FT                   /gene="NAD-ME2"
FT                   /gene_synonym="F6N23.16"
FT                   /gene_synonym="F6N23_16"
FT                   /gene_synonym="NAD-dependent malic enzyme 2"
FT                   /locus_tag="AT4G00570"
FT                   /product="NAD-dependent malic enzyme 2"
FT                   /note="NAD-dependent malic enzyme 2 (NAD-ME2); FUNCTIONS
FT                   IN: in 7 functions; INVOLVED IN: malate metabolic process;
FT                   LOCATED IN: mitochondrion, chloroplast; EXPRESSED IN: 25
FT                   plant structures; EXPRESSED DURING: 15 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Malic enzyme, NAD-binding
FT                   (InterPro:IPR012302), Malic oxidoreductase
FT                   (InterPro:IPR001891), Malic enzyme, conserved site
FT                   (InterPro:IPR015884), Malic enzyme, N-terminal
FT                   (InterPro:IPR012301), NAD(P)-binding domain
FT                   (InterPro:IPR016040); BEST Arabidopsis thaliana protein
FT                   match is: NAD-dependent malic enzyme 1 (TAIR:AT2G13560.1);
FT                   Has 9343 Blast hits to 9326 proteins in 2439 species:
FT                   Archae - 143; Bacteria - 6323; Metazoa - 607; Fungi - 223;
FT                   Plants - 463; Viruses - 0; Other Eukaryotes - 1584 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:Q8L7K9"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L7K9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP805195.1,INSD:EL341279.1,INSD:AV823890.1,
FT                   INSD:EH938037.1,INSD:AV825639.1,INSD:EL991920.1,
FT                   INSD:BP646124.1,INSD:ES199477.1,INSD:BP804279.1,
FT                   INSD:AV531265.1,INSD:EL048370.1,INSD:ES140041.1,
FT                   INSD:AV798340.1,INSD:BP607416.1,INSD:BP840951.1,
FT                   INSD:AV814024.1,INSD:EL119107.1,INSD:EL192211.1,
FT                   INSD:EL291418.1,INSD:AV791815.1,INSD:BX841114.1,
FT                   INSD:BP840932.1,INSD:EH945989.1,INSD:EH840476.1,
FT                   INSD:BP822780.1,INSD:EL234009.1,INSD:ES211010.1,
FT                   INSD:BP598564.1,INSD:EG448510.1,INSD:BP808746.1,
FT                   INSD:BP612687.1,INSD:EH942415.1,INSD:ES007877.1,
FT                   INSD:BP793279.1,INSD:BP645997.1,INSD:AV827912.1,
FT                   INSD:EH847190.1,INSD:BP600777.1,INSD:ES163575.1,
FT                   INSD:EH953928.1,INSD:AV817549.1,INSD:BP562417.2,
FT                   INSD:EH936029.1,INSD:AV784969.1,INSD:ES006850.1,
FT                   INSD:AA651154.1,INSD:EL176948.1,INSD:BP573307.1,
FT                   INSD:BP801609.1,INSD:EH942993.1,INSD:AV796242.1,
FT                   INSD:BP820676.1,INSD:BP832913.1,INSD:ES114866.1,
FT                   INSD:AV826779.1,INSD:EG448508.1,INSD:EH823742.1,
FT                   INSD:BP592582.1,INSD:CB259738.1,INSD:H36031.1,
FT                   INSD:BP588852.1,INSD:EL327452.1,INSD:AV799883.1,
FT                   INSD:EL252953.1,INSD:BP656878.1,INSD:AV811045.1,
FT                   INSD:EH956525.1,INSD:EL248180.1,INSD:ES056148.1,
FT                   INSD:BP828824.1,INSD:BP594801.1,INSD:EG505985.1,
FT                   INSD:ES144056.1,INSD:BP655506.1,INSD:EH982021.1,
FT                   INSD:ES071456.1,INSD:AV794120.1,INSD:BP812644.1,
FT                   INSD:BP660749.1,INSD:EH944191.1,INSD:BP650317.1,
FT                   INSD:BP637824.1,INSD:BX839092.1,INSD:AV816406.1,
FT                   INSD:ES122495.1,INSD:CF773642.1,INSD:ES017989.1,
FT                   INSD:EH816179.1,INSD:BP575157.1,INSD:BP829599.1,
FT                   INSD:BP822115.2"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY128396.1,INSD:BX828688.1,INSD:BT008375.1,
FT                   INSD:BT002046.1,INSD:BT000075.1"
FT                   /protein_id="AEE81903.1"
FT                   /translation="MMWKNIAGLSKAAAAARTHGSRRCFSTAIPGPCIVHKRGADILHD
FT                   PWFNKDTGFPLTERDRLGIRGLLPPRVMTCVQQCDRFIESFRSLENNTKGEPENVVALA
FT                   KWRMLNRLHDRNETLYYRVLIDNIKDFAPIIYTPTVGLVCQNYSGLYRRPRGMYFSAKD
FT                   KGEMMSMIYNWPAPQVDMIVITDGSRILGLGDLGVQGIGIPIGKLDMYVAAAGINPQRV
FT                   LPIMLDVGTNNEKLLQNDLYLGVRQPRLEGEEYLEIIDEFMEAAFTRWPKAVVQFEDFQ
FT                   AKWAFGTLERYRKKFCMFNDDVQGTAGVALAGLLGTVRAQGRPISDFVNQKIVVVGAGS
FT                   AGLGVTKMAVQAVARMAGISESEATKNFYLIDKDGLVTTERTKLDPGAVLFAKNPAEIR
FT                   EGASIVEVVKKVRPHVLLGLSGVGGIFNEEVLKAMRESDSCKPAIFAMSNPTLNAECTA
FT                   ADAFKHAGGNIVFASGSPFENVELENGKVGHVNQANNMYLFPGIGLGTLLSGARIVTDG
FT                   MLQAASECLASYMTDEEVQKGILYPSINNIRHITAEVGAAVLRAAVTDDIAEGHGDVGP
FT                   KDLSHMSKEDTVNYITRNMWFPVYSPLVHEK"
FT   gene            complement(247703..247943)
FT                   /locus_tag="AT4G03665"
FT   ncRNA           complement(247703..247943)
FT                   /locus_tag="AT4G03665"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            247927..250406
FT                   /gene_synonym="F6N23.4"
FT                   /gene_synonym="F6N23_4"
FT                   /locus_tag="AT4G00580"
FT   mRNA            join(247927..248228,248749..248812,248917..248984,
FT                   249074..249305,249404..249541,249629..249697,
FT                   249813..249908,250008..250406)
FT                   /gene_synonym="F6N23.4"
FT                   /gene_synonym="F6N23_4"
FT                   /locus_tag="AT4G00580"
FT                   /product="COP1-interacting protein-like protein"
FT   CDS_pept        join(248214..248228,248749..248812,248917..248984,
FT                   249074..249305,249404..249541,249629..249697,
FT                   249813..249908,250008..250258)
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.4"
FT                   /gene_synonym="F6N23_4"
FT                   /locus_tag="AT4G00580"
FT                   /product="COP1-interacting protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00580"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B3U7"
FT                   /protein_id="ANM66246.1"
FT                   /translation="MILHQTSIDTRLGLLLDSHDSVSSFKDKFCKEHELCFPSVGNITV
FT                   SALKVNVSGNDYHLSDSMILKKALQGLSNEDFFLSVDLVRVQEKSELQIGEAVEKKTRK
FT                   RKSKSANNSRKKLSIETPTEAKGLESGEGTVTRLEENQNICDVDQEEPVDGHTIDVEAK
FT                   IDLSGTIEQDDVQKEVANADLNMIDQDKDLENDNLLAELNQTSDDAEKEGIIGLVNATS
FT                   EAIENETEMSVKEKDGDEEAKSEKPKKKNRAKKVKTPTKEDGLVASSSRNAEEDGVSRD
FT                   PQENVAKVVKKPNKRSKKEQSSNIVEEDA"
FT   mRNA            join(248713..248812,248917..248984,249074..249305,
FT                   249404..249541,249629..249697,249813..249908,
FT                   250008..250258)
FT                   /gene_synonym="F6N23.4"
FT                   /gene_synonym="F6N23_4"
FT                   /locus_tag="AT4G00580"
FT                   /product="COP1-interacting protein-like protein"
FT   CDS_pept        join(248713..248812,248917..248984,249074..249305,
FT                   249404..249541,249629..249697,249813..249908,
FT                   250008..250258)
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.4"
FT                   /gene_synonym="F6N23_4"
FT                   /locus_tag="AT4G00580"
FT                   /product="COP1-interacting protein-like protein"
FT                   /note="COP1-interacting protein-related; BEST Arabidopsis
FT                   thaliana protein match is: COP1-interacting protein-related
FT                   (TAIR:AT2G01800.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:O65267"
FT                   /db_xref="UniProtKB/TrEMBL:O65267"
FT                   /protein_id="AEE81904.1"
FT                   /translation="MADSGSQCVFVKTSIDTRLGLLLDSHDSVSSFKDKFCKEHELCFP
FT                   SVGNITVSALKVNVSGNDYHLSDSMILKKALQGLSNEDFFLSVDLVRVQEKSELQIGEA
FT                   VEKKTRKRKSKSANNSRKKLSIETPTEAKGLESGEGTVTRLEENQNICDVDQEEPVDGH
FT                   TIDVEAKIDLSGTIEQDDVQKEVANADLNMIDQDKDLENDNLLAELNQTSDDAEKEGII
FT                   GLVNATSEAIENETEMSVKEKDGDEEAKSEKPKKKNRAKKVKTPTKEDGLVASSSRNAE
FT                   EDGVSRDPQENVAKVVKKPNKRSKKEQSSNIVEEDA"
FT   gene            complement(250840..252598)
FT                   /locus_tag="AT4G00585"
FT   mRNA            complement(join(250840..251246,252108..252332,
FT                   252492..252598))
FT                   /locus_tag="AT4G00585"
FT                   /product="transmembrane protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP611437.1,INSD:EL309984.1,INSD:EG502704.1,
FT                   INSD:ES156858.1,INSD:BP849329.1,INSD:EL048206.1,
FT                   INSD:EG502715.1,INSD:ES170872.1,INSD:DR187736.1,
FT                   INSD:EH990514.1,INSD:BP857544.1,INSD:EL177921.1,
FT                   INSD:BP817053.1,INSD:EL012041.1,INSD:DR315083.1,
FT                   INSD:ES175892.1,INSD:EL219396.1,INSD:BP652728.1,
FT                   INSD:DR315080.1,INSD:DR187738.1,INSD:BP633948.1,
FT                   INSD:EG502712.1,INSD:BP868489.1,INSD:DR187743.1,
FT                   INSD:DR187745.1,INSD:BP579689.1,INSD:DR315082.1,
FT                   INSD:AV789361.1,INSD:AM111251.1,INSD:DR187742.1,
FT                   INSD:DR315078.1,INSD:DR372878.1,INSD:DR187741.1,
FT                   INSD:AV825019.1,INSD:DR315075.1,INSD:EL173453.1,
FT                   INSD:EL339607.1,INSD:ES088676.1,INSD:ES204179.1,
FT                   INSD:DR315084.1,INSD:BP805237.1,INSD:DR187746.1,
FT                   INSD:DR315076.1,INSD:BP826460.1,INSD:AV534063.1,
FT                   INSD:DR315074.1,INSD:EL260435.1,INSD:EL316496.1,
FT                   INSD:BP657876.1,INSD:BP624262.1,INSD:BP814278.1,
FT                   INSD:EL224524.1,INSD:AM111231.1,INSD:EG502711.1,
FT                   INSD:BP856750.1,INSD:EL060382.1,INSD:DR187747.1,
FT                   INSD:DR315073.1,INSD:BP862429.1,INSD:EL006286.1,
FT                   INSD:BP579056.1,INSD:EL207266.1,INSD:DR187739.1,
FT                   INSD:ES061555.1,INSD:AM111237.1,INSD:EL085265.1,
FT                   INSD:DR187750.1,INSD:ES105372.1,INSD:ES094805.1,
FT                   INSD:BP666443.1,INSD:BX840500.1,INSD:EL189817.1,
FT                   INSD:EL200315.1,INSD:BP586279.1,INSD:BP563092.1,
FT                   INSD:EG502703.1,INSD:BP828465.1,INSD:DR315077.1,
FT                   INSD:T04225.1,INSD:DR372904.1,INSD:BP573603.1,
FT                   INSD:DR187748.1,INSD:EH977973.1,INSD:AV535076.1,
FT                   INSD:EG502716.1,INSD:DR315081.1,INSD:DR315079.1,
FT                   INSD:EH943940.1,INSD:BP856822.1,INSD:EG427629.1,
FT                   INSD:ES096613.1,INSD:ES096787.1,INSD:DR187749.1,
FT                   INSD:DR187751.1,INSD:DR187744.1,INSD:DR187740.1,
FT                   INSD:BP585002.1,INSD:BP868294.1,INSD:BP802182.1,
FT                   INSD:AV533148.1,INSD:AM111246.1,INSD:BP822396.1,
FT                   INSD:EH877112.1,INSD:BP630743.1,INSD:DR187737.1,
FT                   INSD:BP632519.1,INSD:ES120212.1,INSD:DR315072.1,
FT                   INSD:EH978628.1,INSD:AU230895.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK118700.1,INSD:AY063842.1,INSD:AY091239.1,
FT                   INSD:AY085811.1"
FT   CDS_pept        complement(join(251157..251246,252108..252284))
FT                   /codon_start=1
FT                   /locus_tag="AT4G00585"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; Has 47 Blast hits to 47 proteins in
FT                   22 species: Archae - 0; Bacteria - 0; Metazoa - 3; Fungi -
FT                   7; Plants - 33; Viruses - 0; Other Eukaryotes - 4 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00585"
FT                   /db_xref="GOA:Q8VZT9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VZT9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP611437.1,INSD:EL309984.1,INSD:EG502704.1,
FT                   INSD:ES156858.1,INSD:BP849329.1,INSD:EL048206.1,
FT                   INSD:EG502715.1,INSD:ES170872.1,INSD:DR187736.1,
FT                   INSD:EH990514.1,INSD:BP857544.1,INSD:EL177921.1,
FT                   INSD:BP817053.1,INSD:EL012041.1,INSD:DR315083.1,
FT                   INSD:ES175892.1,INSD:EL219396.1,INSD:BP652728.1,
FT                   INSD:DR315080.1,INSD:DR187738.1,INSD:BP633948.1,
FT                   INSD:EG502712.1,INSD:BP868489.1,INSD:DR187743.1,
FT                   INSD:DR187745.1,INSD:BP579689.1,INSD:DR315082.1,
FT                   INSD:AV789361.1,INSD:AM111251.1,INSD:DR187742.1,
FT                   INSD:DR315078.1,INSD:DR372878.1,INSD:DR187741.1,
FT                   INSD:AV825019.1,INSD:DR315075.1,INSD:EL173453.1,
FT                   INSD:EL339607.1,INSD:ES088676.1,INSD:ES204179.1,
FT                   INSD:DR315084.1,INSD:BP805237.1,INSD:DR187746.1,
FT                   INSD:DR315076.1,INSD:BP826460.1,INSD:AV534063.1,
FT                   INSD:DR315074.1,INSD:EL260435.1,INSD:EL316496.1,
FT                   INSD:BP657876.1,INSD:BP624262.1,INSD:BP814278.1,
FT                   INSD:EL224524.1,INSD:AM111231.1,INSD:EG502711.1,
FT                   INSD:BP856750.1,INSD:EL060382.1,INSD:DR187747.1,
FT                   INSD:DR315073.1,INSD:BP862429.1,INSD:EL006286.1,
FT                   INSD:BP579056.1,INSD:EL207266.1,INSD:DR187739.1,
FT                   INSD:ES061555.1,INSD:AM111237.1,INSD:EL085265.1,
FT                   INSD:DR187750.1,INSD:ES105372.1,INSD:ES094805.1,
FT                   INSD:BP666443.1,INSD:BX840500.1,INSD:EL189817.1,
FT                   INSD:EL200315.1,INSD:BP586279.1,INSD:BP563092.1,
FT                   INSD:EG502703.1,INSD:BP828465.1,INSD:DR315077.1,
FT                   INSD:T04225.1,INSD:DR372904.1,INSD:BP573603.1,
FT                   INSD:DR187748.1,INSD:EH977973.1,INSD:AV535076.1,
FT                   INSD:EG502716.1,INSD:DR315081.1,INSD:DR315079.1,
FT                   INSD:EH943940.1,INSD:BP856822.1,INSD:EG427629.1,
FT                   INSD:ES096613.1,INSD:ES096787.1,INSD:DR187749.1,
FT                   INSD:DR187751.1,INSD:DR187744.1,INSD:DR187740.1,
FT                   INSD:BP585002.1,INSD:BP868294.1,INSD:BP802182.1,
FT                   INSD:AV533148.1,INSD:AM111246.1,INSD:BP822396.1,
FT                   INSD:EH877112.1,INSD:BP630743.1,INSD:DR187737.1,
FT                   INSD:BP632519.1,INSD:ES120212.1,INSD:DR315072.1,
FT                   INSD:EH978628.1,INSD:AU230895.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK118700.1,INSD:AY063842.1,INSD:AY091239.1,
FT                   INSD:AY085811.1"
FT                   /protein_id="AEE81905.1"
FT                   /translation="MGGGDHGHGAEGGDFRAKVWSMTGGPNCRPKHWRRNTAIAMFGVF
FT                   LVCIPIAKLSAKLEQRPHMPVRPIPSQIWCKNFGTKDDYEKEH"
FT   gene            252766..255054
FT                   /gene_synonym="F6N23.5"
FT                   /gene_synonym="F6N23_5"
FT                   /locus_tag="AT4G00590"
FT   mRNA            join(252766..252981,253071..253121,253224..253344,
FT                   253426..253465,253611..253692,253780..254031,
FT                   254111..254274,254369..254498,254588..254692,
FT                   254791..255054)
FT                   /gene_synonym="F6N23.5"
FT                   /gene_synonym="F6N23_5"
FT                   /locus_tag="AT4G00590"
FT                   /product="N-terminal nucleophile aminohydrolases (Ntn
FT                   hydrolases) superfamily protein"
FT   mRNA            join(252811..252981,253071..253121,253224..253344,
FT                   253431..253515,253611..253692,253780..254031,
FT                   254111..254274,254369..254498,254588..254692,
FT                   254791..255042)
FT                   /gene_synonym="F6N23.5"
FT                   /gene_synonym="F6N23_5"
FT                   /locus_tag="AT4G00590"
FT                   /product="N-terminal nucleophile aminohydrolases (Ntn
FT                   hydrolases) superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV541842.1,INSD:BP851303.1,INSD:BX838792.1,
FT                   INSD:ES157271.1,INSD:EL971494.1,INSD:AV804021.1,
FT                   INSD:DR351318.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX827980.1"
FT   CDS_pept        join(252835..252981,253071..253121,253224..253344,
FT                   253426..253465,253611..253692,253780..254031,
FT                   254111..254274,254369..254498,254588..254692,
FT                   254791..254880)
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.5"
FT                   /gene_synonym="F6N23_5"
FT                   /locus_tag="AT4G00590"
FT                   /product="N-terminal nucleophile aminohydrolases (Ntn
FT                   hydrolases) superfamily protein"
FT                   /note="N-terminal nucleophile aminohydrolases (Ntn
FT                   hydrolases) superfamily protein; FUNCTIONS IN: hydrolase
FT                   activity; EXPRESSED IN: 19 plant structures; EXPRESSED
FT                   DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Peptidase T2, asparaginase 2 (InterPro:IPR000246); BEST
FT                   Arabidopsis thaliana protein match is: N-terminal
FT                   nucleophile aminohydrolases (Ntn hydrolases) superfamily
FT                   protein (TAIR:AT3G16150.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00590"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00590.2"
FT                   /db_xref="GOA:F4JHE3"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR037464"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHE3"
FT                   /protein_id="AEE81907.1"
FT                   /translation="MMAGDGADQSRRFFVAVHVGAGYHAAANEKALRSVMRRACLAAST
FT                   ILRQDSGECIDAVSAAIQVLEDDPSTNAGRGSNLTEDGHVECDASLMDGDSGMFGGVGA
FT                   VPDQVSEMLSKLLLCWLLVGEGARRWGKSKSVLIPGTVTEADQWLVTERARNQWRRFKA
FT                   MLSEVGAKSILSAEEHPRGTENNETCEENVSSCAAADEDKIMDTVGVICVDNEGHIACG
FT                   SSSGGIAMKISGRVGLAATYGSGCWASSKGPFGAPFLVGCCVSGAGEYLMRGFAARECC
FT                   TSLALSQAGPASAAMKVLRSVMHQESSKIGTADKTAGILVVQADASVVVPGSKPELNAV
FT                   EIAAAYSSLSFGVGYYGNSIEKPKISILRTRRQMSEAGVDHFEARIDLRPTCC"
FT   CDS_pept        join(252835..252981,253071..253121,253224..253344,
FT                   253431..253515,253611..253692,253780..254031,
FT                   254111..254274,254369..254498,254588..254692,
FT                   254791..254880)
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.5"
FT                   /gene_synonym="F6N23_5"
FT                   /locus_tag="AT4G00590"
FT                   /product="N-terminal nucleophile aminohydrolases (Ntn
FT                   hydrolases) superfamily protein"
FT                   /note="N-terminal nucleophile aminohydrolases (Ntn
FT                   hydrolases) superfamily protein; FUNCTIONS IN: hydrolase
FT                   activity; EXPRESSED IN: 19 plant structures; EXPRESSED
FT                   DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Peptidase T2, asparaginase 2 (InterPro:IPR000246); BEST
FT                   Arabidopsis thaliana protein match is: N-terminal
FT                   nucleophile aminohydrolases (Ntn hydrolases) superfamily
FT                   protein (TAIR:AT3G16150.1); Has 3104 Blast hits to 3030
FT                   proteins in 885 species: Archae - 117; Bacteria - 1482;
FT                   Metazoa - 502; Fungi - 255; Plants - 169; Viruses - 0;
FT                   Other Eukaryotes - 579 (source: NCBI BLink)."
FT                   /db_xref="GOA:O65268"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR037464"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65268"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV541842.1,INSD:BP851303.1,INSD:BX838792.1,
FT                   INSD:ES157271.1,INSD:EL971494.1,INSD:AV804021.1,
FT                   INSD:DR351318.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX827980.1"
FT                   /protein_id="AEE81906.1"
FT                   /translation="MMAGDGADQSRRFFVAVHVGAGYHAAANEKALRSVMRRACLAAST
FT                   ILRQDSGECIDAVSAAIQVLEDDPSTNAGRGSNLTEDGHVECDASLMDGDSGMFGGVGA
FT                   VPGVRNAIKIAALLVKEQITGSTLLGRIPPMLLVGEGARRWGKSKSVLIPGTVTEADQW
FT                   LVTERARNQWRRFKAMLSEVGAKSILSAEEHPRGTENNETCEENVSSCAAADEDKIMDT
FT                   VGVICVDNEGHIACGSSSGGIAMKISGRVGLAATYGSGCWASSKGPFGAPFLVGCCVSG
FT                   AGEYLMRGFAARECCTSLALSQAGPASAAMKVLRSVMHQESSKIGTADKTAGILVVQAD
FT                   ASVVVPGSKPELNAVEIAAAYSSLSFGVGYYGNSIEKPKISILRTRRQMSEAGVDHFEA
FT                   RIDLRPTCC"
FT   gene            complement(255320..256610)
FT                   /gene_synonym="F6N23.28"
FT                   /gene_synonym="F6N23_28"
FT                   /locus_tag="AT4G00600"
FT   mRNA            complement(join(255320..255490,255571..255738,
FT                   255820..256056,256145..256242,256352..256610))
FT                   /gene_synonym="F6N23.28"
FT                   /gene_synonym="F6N23_28"
FT                   /locus_tag="AT4G00600"
FT                   /product="Amino acid dehydrogenase family protein"
FT   CDS_pept        complement(join(255320..255490,255571..255738,
FT                   255820..256056,256145..256242,256352..256610))
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.28"
FT                   /gene_synonym="F6N23_28"
FT                   /locus_tag="AT4G00600"
FT                   /product="Amino acid dehydrogenase family protein"
FT                   /note="Amino acid dehydrogenase family protein; FUNCTIONS
FT                   IN: binding, catalytic activity; INVOLVED IN: folic acid
FT                   and derivative biosynthetic process, metabolic process;
FT                   LOCATED IN: chloroplast; CONTAINS InterPro DOMAIN/s:
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   NAD(P)-binding domain (InterPro:IPR020631),
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase
FT                   (InterPro:IPR000672), NAD(P)-binding domain
FT                   (InterPro:IPR016040), Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, catalytic domain
FT                   (InterPro:IPR020630); BEST Arabidopsis thaliana protein
FT                   match is: Amino acid dehydrogenase family protein
FT                   (TAIR:AT4G00620.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:O65269"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65269"
FT                   /protein_id="AEE81908.1"
FT                   /translation="MFTDCSSSTTSRLIHLYNRNGVFLPRPSVSQFSLRTTASTWRCTL
FT                   SIRSSSSPSAIVIDGKAEAKKIRDDIKIEVSRMKESIGVVPAEDSSEEEVLKYVSGFND
FT                   DPSVHGVLVQLPLPSHMDEQNILNAVSIEKDVDGFHPLNIGRLAMRGREPLFVPCTPKG
FT                   CIELLHRYNIEFKGKRAVVIGRSNIVGMPAALLLQKEDATVSIIHSRTMNPEELTRQAD
FT                   ILISAVGKPNMVRGSWIKPGAVLIDVGIKPVEDPSAAGGERLVGDICYVEASKIASAIT
FT                   PVPGDVGPMTIAMLLSNTLTSAKRIHNFQ"
FT   gene            complement(256957..257943)
FT                   /gene_synonym="F6N23.29"
FT                   /gene_synonym="F6N23_29"
FT                   /locus_tag="AT4G00610"
FT   mRNA            complement(256957..257943)
FT                   /gene_synonym="F6N23.29"
FT                   /gene_synonym="F6N23_29"
FT                   /locus_tag="AT4G00610"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT   CDS_pept        complement(256957..257943)
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.29"
FT                   /gene_synonym="F6N23_29"
FT                   /locus_tag="AT4G00610"
FT                   /product="DNA-binding storekeeper protein-related
FT                   transcriptional regulator"
FT                   /note="DNA-binding storekeeper protein-related
FT                   transcriptional regulator; FUNCTIONS IN: transcription
FT                   regulator activity; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: chloroplast; CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF573
FT                   (InterPro:IPR007592); BEST Arabidopsis thaliana protein
FT                   match is: DNA-binding storekeeper protein-related
FT                   transcriptional regulator (TAIR:AT1G44810.1); Has 1807
FT                   Blast hits to 1807 proteins in 277 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00610"
FT                   /db_xref="GOA:O65270"
FT                   /db_xref="InterPro:IPR007592"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65270"
FT                   /protein_id="AEE81909.1"
FT                   /translation="MVSVQNLKTDQLLNFLFKNPTKFLSRFSPMAKNKTLVTPSTVKKS
FT                   SDVASTSKKLSGVASPAKKPSGVTSPVKKPLEAVASTSSEEEEEDEPSSDSESGSESES
FT                   DTEAEPMTLAAAAPSSSNEKRQSEGKPEEERAKTETETGKKPLLFQRLWTDEDEIVFLQ
FT                   GMIKFAKDTGKNVSEDMNGFFEKLKDSISFEVKTDQFVNKIRSMKRKYIENKKTTTEHD
FT                   KKCYELAEIIWVSDGDATALVKPKKKKLKVDEESDWFERSFVDGAFKELGPGVDEETWK
FT                   KNWSLVPVKKRKRIEEKVKSMQADELKTTWQKIDVVHEMRSLMAKYV"
FT   gene            complement(258987..261289)
FT                   /gene="EMB3127"
FT                   /gene_synonym="EMBRYO DEFECTIVE 3127"
FT                   /gene_synonym="F6N23.26"
FT                   /gene_synonym="F6N23_26"
FT                   /locus_tag="AT4G00620"
FT   mRNA            complement(join(258987..259435,259546..259713,
FT                   259816..260052,260130..260455,260608..261289))
FT                   /gene="EMB3127"
FT                   /gene_synonym="EMBRYO DEFECTIVE 3127"
FT                   /gene_synonym="F6N23.26"
FT                   /gene_synonym="F6N23_26"
FT                   /locus_tag="AT4G00620"
FT                   /product="Amino acid dehydrogenase family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR356834.1,INSD:ES183745.1,INSD:DR356836.1,
FT                   INSD:ES202824.1,INSD:AV537874.1,INSD:BE528922.1,
FT                   INSD:EH861372.1,INSD:EH858858.1,INSD:BP786862.1,
FT                   INSD:EL004012.1,INSD:AV784836.1,INSD:BP782169.1,
FT                   INSD:AI993049.1,INSD:T42307.1,INSD:DR356837.1,
FT                   INSD:AV785729.1,INSD:BP586155.1,INSD:DR382835.1,
FT                   INSD:AV549941.1,INSD:BP788292.1,INSD:EL075766.1,
FT                   INSD:AA395032.1,INSD:AI993117.1,INSD:AV539954.1,
FT                   INSD:DR356835.1,INSD:DR356838.1,INSD:EL987549.1,
FT                   INSD:EL976372.1,INSD:ES210510.1,INSD:DR356833.1,
FT                   INSD:AV823784.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY059944.1,INSD:BX827884.1,INSD:BX826901.1,
FT                   INSD:BX827979.1,INSD:BT000066.1,INSD:BX828420.1"
FT   CDS_pept        complement(join(259265..259435,259546..259713,
FT                   259816..260052,260130..260455,260608..260788))
FT                   /codon_start=1
FT                   /gene="EMB3127"
FT                   /gene_synonym="F6N23.26"
FT                   /gene_synonym="F6N23_26"
FT                   /gene_synonym="EMBRYO DEFECTIVE 3127"
FT                   /locus_tag="AT4G00620"
FT                   /product="Amino acid dehydrogenase family protein"
FT                   /note="Amino acid dehydrogenase family protein; FUNCTIONS
FT                   IN: binding, catalytic activity; INVOLVED IN: folic acid
FT                   and derivative biosynthetic process, metabolic process;
FT                   LOCATED IN: chloroplast; CONTAINS InterPro DOMAIN/s:
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   NAD(P)-binding domain (InterPro:IPR020631),
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase
FT                   (InterPro:IPR000672), NAD(P)-binding domain
FT                   (InterPro:IPR016040), Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, conserved site
FT                   (InterPro:IPR020867), Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, catalytic domain
FT                   (InterPro:IPR020630); BEST Arabidopsis thaliana protein
FT                   match is: Amino acid dehydrogenase family protein
FT                   (TAIR:AT4G00600.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00620"
FT                   /db_xref="GOA:O65271"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65271"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR356834.1,INSD:ES183745.1,INSD:DR356836.1,
FT                   INSD:ES202824.1,INSD:AV537874.1,INSD:BE528922.1,
FT                   INSD:EH861372.1,INSD:EH858858.1,INSD:BP786862.1,
FT                   INSD:EL004012.1,INSD:AV784836.1,INSD:BP782169.1,
FT                   INSD:AI993049.1,INSD:T42307.1,INSD:DR356837.1,
FT                   INSD:AV785729.1,INSD:BP586155.1,INSD:DR382835.1,
FT                   INSD:AV549941.1,INSD:BP788292.1,INSD:EL075766.1,
FT                   INSD:AA395032.1,INSD:AI993117.1,INSD:AV539954.1,
FT                   INSD:DR356835.1,INSD:DR356838.1,INSD:EL987549.1,
FT                   INSD:EL976372.1,INSD:ES210510.1,INSD:DR356833.1,
FT                   INSD:AV823784.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY059944.1,INSD:BX827884.1,INSD:BX826901.1,
FT                   INSD:BX827979.1,INSD:BT000066.1,INSD:BX828420.1"
FT                   /protein_id="AEE81910.1"
FT                   /translation="MASMMFTDCSSTTTSRLIHLNRSSGTFLLRQCVGQLRLQTTASGR
FT                   GCCIRSSSSPISSISADTKSEGGAIVIDGKAVAKKIRDEITIEVSRMKESIGVIPGLAV
FT                   ILVGDRKDSATYVRNKKKACDSVGIKSFEVRLAEDSSEEEVLKSVSGFNDDPSVHGILV
FT                   QLPLPSHMDEQNILNAVSIEKDVDGFHPLNIGRLAMRGREPLFVPCTPKGCIELLHRYN
FT                   IEIKGKRAVVIGRSNIVGMPAALLLQREDATVSIIHSRTKNPEEITREADIIISAVGQP
FT                   NMVRGSWIKPGAVLIDVGINPVEDPSAARGYRLVGDICYEEASKVASAITPVPGGVGPM
FT                   TIAMLLSNTLTSAKRIHNFQ"
FT   gene            complement(261246..268097)
FT                   /gene="KEA2"
FT                   /gene_synonym="ATKEA2"
FT                   /gene_synonym="F6N23.15"
FT                   /gene_synonym="F6N23_15"
FT                   /gene_synonym="K+ efflux antiporter 2"
FT                   /locus_tag="AT4G00630"
FT                   /note="Encodes a K(+)/H(+) antiporter that modulates
FT                   monovalent cation and pH homeostasis in plant chloroplasts
FT                   or plastids."
FT   mRNA            complement(join(261246..261780,261854..261928,
FT                   262012..262068,262162..262338,262425..262491,
FT                   262582..262640,262776..262829,262992..263141,
FT                   263425..263634,263857..263985,264082..264186,
FT                   264396..264485,264710..264775,264861..264929,
FT                   265124..265243,265350..265409,265508..265644,
FT                   265827..265917,266012..266183,266279..268097))
FT                   /gene="KEA2"
FT                   /gene_synonym="ATKEA2"
FT                   /gene_synonym="F6N23.15"
FT                   /gene_synonym="F6N23_15"
FT                   /gene_synonym="K+ efflux antiporter 2"
FT                   /locus_tag="AT4G00630"
FT                   /product="K+ efflux antiporter 2"
FT   mRNA            complement(join(261449..261780,261854..261928,
FT                   262012..262068,262162..262338,262425..262491,
FT                   262582..262640,262776..262829,262992..263141,
FT                   263425..263634,263857..263985,264082..264219,
FT                   264396..264485,264710..264775,264861..264929,
FT                   265124..265243,265350..265409,265508..265644,
FT                   265827..265917,266012..266183,266279..268031))
FT                   /gene="KEA2"
FT                   /gene_synonym="ATKEA2"
FT                   /gene_synonym="F6N23.15"
FT                   /gene_synonym="F6N23_15"
FT                   /gene_synonym="K+ efflux antiporter 2"
FT                   /locus_tag="AT4G00630"
FT                   /product="K+ efflux antiporter 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH984508.1,INSD:EG458352.1,INSD:EG420525.1,
FT                   INSD:EG497176.1,INSD:EG420514.1,INSD:DR363932.1,
FT                   INSD:T42193.1,INSD:EG458275.1,INSD:EG497167.1,
FT                   INSD:EL987802.1,INSD:ES009828.1,INSD:EG420501.1,
FT                   INSD:EG420497.1,INSD:EG497182.1,INSD:EG497181.1,
FT                   INSD:EG420522.1,INSD:EL997925.1,INSD:EG420523.1,
FT                   INSD:EG458408.1,INSD:EG497179.1,INSD:EG458441.1,
FT                   INSD:EG458452.1,INSD:EG497168.1,INSD:EG420511.1,
FT                   INSD:EG420507.1,INSD:EG430891.1,INSD:EG458419.1,
FT                   INSD:EH983905.1,INSD:EG458308.1,INSD:EG458219.1,
FT                   INSD:EG458252.1,INSD:EG458264.1,INSD:EG420503.1,
FT                   INSD:EG458341.1,INSD:EG420505.1,INSD:EG458197.1,
FT                   INSD:EG497177.1,INSD:EG458386.1,INSD:DR363931.1,
FT                   INSD:EG420519.1,INSD:AA585882.1,INSD:EG497178.1,
FT                   INSD:EG420510.1,INSD:ES029374.1,INSD:EG458375.1,
FT                   INSD:EG497175.1,INSD:EG420521.1,INSD:EG458330.1,
FT                   INSD:EG497164.1,INSD:EG420494.1,INSD:EG420513.1,
FT                   INSD:EL063463.1,INSD:EG420500.1,INSD:EG420515.1,
FT                   INSD:EG458363.1,INSD:EG420516.1,INSD:EG458230.1,
FT                   INSD:EL188044.1,INSD:EG458474.1,INSD:EG497180.1,
FT                   INSD:EG430889.1,INSD:EG497173.1,INSD:DR363933.1,
FT                   INSD:EG458241.1,INSD:EH820981.1,INSD:EG420512.1,
FT                   INSD:CO048766.1,INSD:EG458430.1,INSD:EG420495.1,
FT                   INSD:EG458397.1,INSD:EG497172.1,INSD:ES175243.1,
FT                   INSD:EG458463.1,INSD:EG430892.1"
FT   CDS_pept        complement(join(261655..261780,261854..261928,
FT                   262012..262068,262162..262338,262425..262491,
FT                   262582..262640,262776..262829,262992..263141,
FT                   263425..263634,263857..263985,264082..264186,
FT                   264396..264485,264710..264775,264861..264929,
FT                   265124..265243,265350..265409,265508..265644,
FT                   265827..265917,266012..266183,266279..267789))
FT                   /codon_start=1
FT                   /gene="KEA2"
FT                   /gene_synonym="ATKEA2"
FT                   /gene_synonym="F6N23.15"
FT                   /gene_synonym="F6N23_15"
FT                   /gene_synonym="K+ efflux antiporter 2"
FT                   /locus_tag="AT4G00630"
FT                   /product="K+ efflux antiporter 2"
FT                   /note="K+ efflux antiporter 2 (KEA2); FUNCTIONS IN:
FT                   potassium:hydrogen antiporter activity, potassium ion
FT                   transmembrane transporter activity; INVOLVED IN: potassium
FT                   ion transport, cation transport, metabolic process,
FT                   transmembrane transport; LOCATED IN: chloroplast, membrane,
FT                   chloroplast envelope; EXPRESSED IN: 24 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Cation/H+ exchanger (InterPro:IPR006153), K+/H+
FT                   exchanger (InterPro:IPR004771), NAD(P)-binding domain
FT                   (InterPro:IPR016040), Regulator of K+ conductance,
FT                   N-terminal (InterPro:IPR003148); BEST Arabidopsis thaliana
FT                   protein match is: K+ efflux antiporter 1
FT                   (TAIR:AT1G01790.1); Has 34304 Blast hits to 27699 proteins
FT                   in 2887 species: Archae - 928; Bacteria - 15112; Metazoa -
FT                   9897; Fungi - 1524; Plants - 1371; Viruses - 95; Other
FT                   Eukaryotes - 5377 (source: NCBI BLink)."
FT                   /db_xref="GOA:O65272"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65272"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH984508.1,INSD:EG458352.1,INSD:EG420525.1,
FT                   INSD:EG497176.1,INSD:EG420514.1,INSD:DR363932.1,
FT                   INSD:T42193.1,INSD:EG458275.1,INSD:EG497167.1,
FT                   INSD:EL987802.1,INSD:ES009828.1,INSD:EG420501.1,
FT                   INSD:EG420497.1,INSD:EG497182.1,INSD:EG497181.1,
FT                   INSD:EG420522.1,INSD:EL997925.1,INSD:EG420523.1,
FT                   INSD:EG458408.1,INSD:EG497179.1,INSD:EG458441.1,
FT                   INSD:EG458452.1,INSD:EG497168.1,INSD:EG420511.1,
FT                   INSD:EG420507.1,INSD:EG430891.1,INSD:EG458419.1,
FT                   INSD:EH983905.1,INSD:EG458308.1,INSD:EG458219.1,
FT                   INSD:EG458252.1,INSD:EG458264.1,INSD:EG420503.1,
FT                   INSD:EG458341.1,INSD:EG420505.1,INSD:EG458197.1,
FT                   INSD:EG497177.1,INSD:EG458386.1,INSD:DR363931.1,
FT                   INSD:EG420519.1,INSD:AA585882.1,INSD:EG497178.1,
FT                   INSD:EG420510.1,INSD:ES029374.1,INSD:EG458375.1,
FT                   INSD:EG497175.1,INSD:EG420521.1,INSD:EG458330.1,
FT                   INSD:EG497164.1,INSD:EG420494.1,INSD:EG420513.1,
FT                   INSD:EL063463.1,INSD:EG420500.1,INSD:EG420515.1,
FT                   INSD:EG458363.1,INSD:EG420516.1,INSD:EG458230.1,
FT                   INSD:EL188044.1,INSD:EG458474.1,INSD:EG497180.1,
FT                   INSD:EG430889.1,INSD:EG497173.1,INSD:DR363933.1,
FT                   INSD:EG458241.1,INSD:EH820981.1,INSD:EG420512.1,
FT                   INSD:CO048766.1,INSD:EG458430.1,INSD:EG420495.1,
FT                   INSD:EG458397.1,INSD:EG497172.1,INSD:ES175243.1,
FT                   INSD:EG458463.1,INSD:EG430892.1"
FT                   /protein_id="AEE81911.1"
FT                   /translation="MDFASSVQRQSMFHGGADFASYCLPNRMISAKLCPKGLGGTRFWD
FT                   PMIDSKVRSAIRSKRNVSYRSSLTLNADFNGRFYGHLLPAKPQNVPLGFRLLCQSSDSV
FT                   GDLVGNDRNLEFAEGSDDREVTFSKEEKDTREQDSAPSLEELRDLLNKATKELEVASLN
FT                   STMFEEKAQRISEVAIALKDEAASAWNDVNQTLNVVQEAVDEESVAKEAVQKATMALSL
FT                   AEARLQVALESLEAEGYNTSEESEVRDGVKDKEEALLSAKADIKECQENLASCEEQLRR
FT                   LQVKKDELQKEVDRLNEAAERAQISALKAEEDVANIMVLAEQAVAFELEATQRVNDAEI
FT                   ALQRAEKTLFGSQTQETTQGKVLDGKNTIVGEDEVLSEIVDVSHQAERDLVVVGVSSDV
FT                   GTQSYESDNENGKPTADFAKEAEGEAEKSKNVVLTKKQEVQKDLPRESSSHNGTKTSLK
FT                   KSSRFFPASFFSSNGDGTATVFESLVESAKQQWPKLILGFTLLGAGVAIYSNGVGRNNQ
FT                   LPQQPNIVSTSAEDVSSSTKPLIRQMQKLPKRIKKLLEMFPQQEVNEEEASLLDVLWLL
FT                   LASVIFVPLFQKIPGGSPVLGYLAAGILIGPYGLSIIRNVHGTKAIAEFGVVFLLFNIG
FT                   LELSVERLSSMKKYVFGLGSAQVLVTAAVIGLITHYVAGQAGPAAIVIGNGLALSSTAV
FT                   VLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISPNSSKGGIGFQAIAEALG
FT                   LAAIKAAVAITGIIAGGRLLLRPIYKQIAENRNAEIFSANTLLVILGTSLLTARAGLSM
FT                   ALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLANFPLIMGTL
FT                   GLLLVGKTILVVIIGKLFGISIISAVRVGLLLAPGGEFAFVAFGEAVNQGIMTPQLSSL
FT                   LFLVVGISMALTPWLAAGGQLIASRFELQDVRSLLPVESETDDLQGHIIICGFGRIGQI
FT                   IAQLLSERLIPFVALDVSSDRVAIGRSLDLPVYFGDAGSREVLHKIGADRACAAAIALD
FT                   TPGANYRCVWALSKYFPNVKTFVRAHDVDHGLNLEKAGATAVVPETLEPSLQLAAAVLA
FT                   QAKLPTSEIATTINEFRSRHLSELAELCEASGSSLGYGFSRSTSKPKPPSPSETSDDNQ
FT                   IIEGTLAI"
FT   CDS_pept        complement(join(261655..261780,261854..261928,
FT                   262012..262068,262162..262338,262425..262491,
FT                   262582..262640,262776..262829,262992..263141,
FT                   263425..263634,263857..263985,264082..264219,
FT                   264396..264485,264710..264775,264861..264929,
FT                   265124..265243,265350..265409,265508..265644,
FT                   265827..265917,266012..266183,266279..267789))
FT                   /codon_start=1
FT                   /gene="KEA2"
FT                   /gene_synonym="ATKEA2"
FT                   /gene_synonym="F6N23.15"
FT                   /gene_synonym="F6N23_15"
FT                   /gene_synonym="K+ efflux antiporter 2"
FT                   /locus_tag="AT4G00630"
FT                   /product="K+ efflux antiporter 2"
FT                   /note="K+ efflux antiporter 2 (KEA2); FUNCTIONS IN:
FT                   potassium:hydrogen antiporter activity, potassium ion
FT                   transmembrane transporter activity; INVOLVED IN: potassium
FT                   ion transport, cation transport, metabolic process,
FT                   transmembrane transport; EXPRESSED IN: 24 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: K+/H+ exchanger (InterPro:IPR004771), Cation/H+
FT                   exchanger (InterPro:IPR006153), NAD(P)-binding domain
FT                   (InterPro:IPR016040), Regulator of K+ conductance,
FT                   N-terminal (InterPro:IPR003148); BEST Arabidopsis thaliana
FT                   protein match is: K+ efflux antiporter 1
FT                   (TAIR:AT1G01790.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00630"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00630.2"
FT                   /db_xref="GOA:F4JHE9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHE9"
FT                   /protein_id="AEE81912.1"
FT                   /translation="MDFASSVQRQSMFHGGADFASYCLPNRMISAKLCPKGLGGTRFWD
FT                   PMIDSKVRSAIRSKRNVSYRSSLTLNADFNGRFYGHLLPAKPQNVPLGFRLLCQSSDSV
FT                   GDLVGNDRNLEFAEGSDDREVTFSKEEKDTREQDSAPSLEELRDLLNKATKELEVASLN
FT                   STMFEEKAQRISEVAIALKDEAASAWNDVNQTLNVVQEAVDEESVAKEAVQKATMALSL
FT                   AEARLQVALESLEAEGYNTSEESEVRDGVKDKEEALLSAKADIKECQENLASCEEQLRR
FT                   LQVKKDELQKEVDRLNEAAERAQISALKAEEDVANIMVLAEQAVAFELEATQRVNDAEI
FT                   ALQRAEKTLFGSQTQETTQGKVLDGKNTIVGEDEVLSEIVDVSHQAERDLVVVGVSSDV
FT                   GTQSYESDNENGKPTADFAKEAEGEAEKSKNVVLTKKQEVQKDLPRESSSHNGTKTSLK
FT                   KSSRFFPASFFSSNGDGTATVFESLVESAKQQWPKLILGFTLLGAGVAIYSNGVGRNNQ
FT                   LPQQPNIVSTSAEDVSSSTKPLIRQMQKLPKRIKKLLEMFPQQEVNEEEASLLDVLWLL
FT                   LASVIFVPLFQKIPGGSPVLGYLAAGILIGPYGLSIIRNVHGTKAIAEFGVVFLLFNIG
FT                   LELSVERLSSMKKYVFGLGSAQVLVTAAVIGLITHYVAGQAGPAAIVIGNGLALSSTAV
FT                   VLQVLQERGESTSRHGRATFSVLLFQDLAVVVLLILIPLISPNSSKGGIGFQAIAEALG
FT                   LAAIKAAVAITGIIAGGRLFYNALIFWYTQLLRPIYKQIAENRNAEIFSANTLLVILGT
FT                   SLLTARAGLSMALGAFLAGLLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLL
FT                   LANFPLIMGTLGLLLVGKTILVVIIGKLFGISIISAVRVGLLLAPGGEFAFVAFGEAVN
FT                   QGIMTPQLSSLLFLVVGISMALTPWLAAGGQLIASRFELQDVRSLLPVESETDDLQGHI
FT                   IICGFGRIGQIIAQLLSERLIPFVALDVSSDRVAIGRSLDLPVYFGDAGSREVLHKIGA
FT                   DRACAAAIALDTPGANYRCVWALSKYFPNVKTFVRAHDVDHGLNLEKAGATAVVPETLE
FT                   PSLQLAAAVLAQAKLPTSEIATTINEFRSRHLSELAELCEASGSSLGYGFSRSTSKPKP
FT                   PSPSETSDDNQIIEGTLAI"
FT   gene            268901..271503
FT                   /gene="FRI"
FT                   /gene_synonym="F6N23.25"
FT                   /gene_synonym="F6N23_25"
FT                   /gene_synonym="FLA"
FT                   /gene_synonym="FLOWERING LOCUS A"
FT                   /gene_synonym="FRIGIDA"
FT                   /gene_synonym="REDUCED STEM BRANCHING 7"
FT                   /gene_synonym="RSB7"
FT                   /locus_tag="AT4G00650"
FT                   /note="Encodes a major determinant of natural variation in
FT                   Arabidopsis flowering time. Dominant alleles of FRI confer
FT                   a vernalization requirement causing plants to overwinter
FT                   vegetatively. Many early flowering accessions carry
FT                   loss-of-function fri alleles .Twenty distinct haplotypes
FT                   that contain non-functional FRI alleles have been
FT                   identified and the distribution analyzed in over 190
FT                   accessions. The common lab strains- Col and Ler each carry
FT                   loss of function mutations in FRI."
FT   mRNA            join(268901..269964,270358..270530,270620..271503)
FT                   /gene="FRI"
FT                   /gene_synonym="F6N23.25"
FT                   /gene_synonym="F6N23_25"
FT                   /gene_synonym="FLA"
FT                   /gene_synonym="FLOWERING LOCUS A"
FT                   /gene_synonym="FRIGIDA"
FT                   /gene_synonym="REDUCED STEM BRANCHING 7"
FT                   /gene_synonym="RSB7"
FT                   /locus_tag="AT4G00650"
FT                   /product="FRIGIDA-like protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV541057.1,INSD:BP797557.1"
FT   CDS_pept        join(269026..269964,270358..270363)
FT                   /codon_start=1
FT                   /gene="FRI"
FT                   /gene_synonym="F6N23.25"
FT                   /gene_synonym="F6N23_25"
FT                   /gene_synonym="FLA"
FT                   /gene_synonym="FLOWERING LOCUS A"
FT                   /gene_synonym="FRIGIDA"
FT                   /gene_synonym="REDUCED STEM BRANCHING 7"
FT                   /gene_synonym="RSB7"
FT                   /locus_tag="AT4G00650"
FT                   /product="FRIGIDA-like protein"
FT                   /note="FRIGIDA (FRI); CONTAINS InterPro DOMAIN/s:
FT                   Frigida-like (InterPro:IPR012474); BEST Arabidopsis
FT                   thaliana protein match is: FRIGIDA-like protein
FT                   (TAIR:AT5G48385.1); Has 841 Blast hits to 841 proteins in
FT                   38 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 841; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00650"
FT                   /db_xref="GOA:Q67Z93"
FT                   /db_xref="InterPro:IPR012474"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q67Z93"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV541057.1,INSD:BP797557.1"
FT                   /protein_id="AEE81913.1"
FT                   /translation="MSNYPPTVAAQPTTTANPLLQRHQSEQRRRELPKIVETESTSMDI
FT                   TIGQSKQPQFLKSIDELAAFSVAVETFKRQFDDLQKHIESIENAIDSKLESNGVVLAAR
FT                   NNNFHQPMLSPPRNNVSVETTVTVSQPSQEIVPETSNKPEGERICELMCSKGLRKYIYA
FT                   NISDQAKLMEEIPSALKLAKEPAKFVLDCIGKFYLQGRRAFTKESPMSSARQVSLLILE
FT                   SFLLMPDRGKGKVKIESWIKDEAETAAVAWRKRLMTEGGLAAAEKMDARGLLLLVACFG
FT                   VPSNFRSTDLLDLIRMSGSNEIAGALKRSQFQV"
FT   gene            complement(270998..271192)
FT                   /locus_tag="AT4G03675"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT4G00650"
FT   ncRNA           complement(270998..271192)
FT                   /locus_tag="AT4G03675"
FT                   /product="other RNA"
FT                   /ncRNA_class="antisense_RNA"
FT   gene            complement(271487..271879)
FT                   /locus_tag="AT4G00651"
FT   mRNA            complement(join(271487..271724,271830..271879))
FT                   /locus_tag="AT4G00651"
FT                   /product="Fe superoxide dismutase"
FT                   /inference="similar to RNA sequence, EST:INSD:AV541057.1"
FT   CDS_pept        complement(join(271487..271724,271830..271879))
FT                   /codon_start=1
FT                   /locus_tag="AT4G00651"
FT                   /product="Fe superoxide dismutase"
FT                   /note="FUNCTIONS IN: molecular_function unknown; INVOLVED
FT                   IN: biological_process unknown; LOCATED IN: endomembrane
FT                   system; BEST Arabidopsis thaliana protein match is: Fe
FT                   superoxide dismutase 2 (TAIR:AT5G51100.1); Has 34 Blast
FT                   hits to 34 proteins in 11 species: Archae - 0; Bacteria -
FT                   0; Metazoa - 0; Fungi - 0; Plants - 34; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00651"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00651.1"
FT                   /db_xref="GOA:F4JHF1"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHF1"
FT                   /inference="similar to RNA sequence, EST:INSD:AV541057.1"
FT                   /protein_id="AEE81914.1"
FT                   /translation="MESMLLFMFKIQFKACNSSWIFGEFIFLKKDKKADINTFMEKLVS
FT                   WETVSTRLESAIARAVQREQEGTETEDEENPDDQEPEVYLDSDIDVSEVD"
FT   gene            271533..271722
FT                   /locus_tag="AT4G03685"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT4G00651"
FT   ncRNA           271533..271722
FT                   /locus_tag="AT4G03685"
FT                   /product="other RNA"
FT                   /ncRNA_class="antisense_RNA"
FT   gene            274252..278737
FT                   /gene="RH8"
FT                   /gene_synonym="ATRH8"
FT                   /gene_synonym="F6N23.6"
FT                   /gene_synonym="F6N23_6"
FT                   /gene_synonym="RNAhelicase-like 8"
FT                   /locus_tag="AT4G00660"
FT   mRNA            join(274252..274945,275109..275169,275406..275640,
FT                   275956..276194,276330..276581,276655..276835,
FT                   277033..277121,277209..277282,277360..277444,
FT                   277839..278737)
FT                   /gene="RH8"
FT                   /gene_synonym="ATRH8"
FT                   /gene_synonym="F6N23.6"
FT                   /gene_synonym="F6N23_6"
FT                   /gene_synonym="RNAhelicase-like 8"
FT                   /locus_tag="AT4G00660"
FT                   /product="RNAhelicase-like 8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES185414.1,INSD:DR366734.1,INSD:EH889823.1,
FT                   INSD:ES157691.1,INSD:EG471865.1,INSD:AU237035.1,
FT                   INSD:BP806461.1,INSD:Z26776.1,INSD:BX837461.1,
FT                   INSD:EL981571.1,INSD:CO871577.1,INSD:ES022000.1,
FT                   INSD:EH952369.1,INSD:AI994768.1,INSD:AV526724.1,
FT                   INSD:AV539246.1,INSD:AV560948.1,INSD:BP561423.2,
FT                   INSD:Z35343.1,INSD:Z35344.1,INSD:AV794176.1,
FT                   INSD:ES143185.1,INSD:DR366737.1,INSD:AV547679.1,
FT                   INSD:BP585376.1,INSD:DR366735.1,INSD:EL223624.1,
FT                   INSD:BP841394.1,INSD:ES009562.1,INSD:AV818432.1,
FT                   INSD:AU228049.1,INSD:AV791054.1,INSD:BP613560.1,
FT                   INSD:BX834527.1,INSD:EH832443.1,INSD:BP789495.1,
FT                   INSD:DR366741.1,INSD:DR366739.1,INSD:EG491362.1,
FT                   INSD:AV551652.1,INSD:EH973158.1,INSD:EG471887.1,
FT                   INSD:BP589494.1,INSD:BE524360.1,INSD:EH937892.1,
FT                   INSD:Z26476.1,INSD:AV527200.1,INSD:DR366740.1,
FT                   INSD:EL052114.1,INSD:DR366736.1,INSD:DR366738.1,
FT                   INSD:ES102863.1,INSD:ES191555.1,INSD:N38221.1,
FT                   INSD:AV560289.1,INSD:EG491351.1,INSD:EH796618.1,
FT                   INSD:BP832938.1,INSD:BP593728.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY080837.1,INSD:AY113985.1,INSD:AJ010460.1,
FT                   INSD:BX828369.1"
FT   mRNA            join(274257..274945,275109..275169,275406..275640,
FT                   275956..276194,276330..276581,276655..276835,
FT                   277033..277121,277209..277282,277360..277487,
FT                   277839..278737)
FT                   /gene="RH8"
FT                   /gene_synonym="ATRH8"
FT                   /gene_synonym="F6N23.6"
FT                   /gene_synonym="F6N23_6"
FT                   /gene_synonym="RNAhelicase-like 8"
FT                   /locus_tag="AT4G00660"
FT                   /product="RNAhelicase-like 8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU228049.1,INSD:ES185414.1,INSD:DR366734.1,
FT                   INSD:EH889823.1,INSD:ES157691.1,INSD:EH832443.1,
FT                   INSD:DR366741.1,INSD:EG471865.1,INSD:AU237035.1,
FT                   INSD:DR366739.1,INSD:EG491362.1,INSD:AV551652.1,
FT                   INSD:EH973158.1,INSD:BP806461.1,INSD:Z26776.1,
FT                   INSD:EG471887.1,INSD:BX837461.1,INSD:EL981571.1,
FT                   INSD:CO871577.1,INSD:EH952369.1,INSD:AI994768.1,
FT                   INSD:AV526724.1,INSD:BE524360.1,INSD:EH937892.1,
FT                   INSD:AV527200.1,INSD:BP561423.2,INSD:DR366740.1,
FT                   INSD:Z35343.1,INSD:DR366736.1,INSD:DR366738.1,
FT                   INSD:ES102863.1,INSD:AV794176.1,INSD:ES191555.1,
FT                   INSD:ES143185.1,INSD:DR366737.1,INSD:N38221.1,
FT                   INSD:AV547679.1,INSD:DR366735.1,INSD:EL223624.1,
FT                   INSD:EG491351.1,INSD:BP841394.1,INSD:EH796618.1,
FT                   INSD:BP832938.1,INSD:AV816352.1"
FT   CDS_pept        join(274638..274945,275109..275169,275406..275640,
FT                   275956..276194,276330..276581,276655..276835,
FT                   277033..277121,277209..277282,277360..277438)
FT                   /codon_start=1
FT                   /gene="RH8"
FT                   /gene_synonym="ATRH8"
FT                   /gene_synonym="F6N23.6"
FT                   /gene_synonym="F6N23_6"
FT                   /gene_synonym="RNAhelicase-like 8"
FT                   /locus_tag="AT4G00660"
FT                   /product="RNAhelicase-like 8"
FT                   /note="RNAhelicase-like 8 (RH8); FUNCTIONS IN: helicase
FT                   activity, nucleic acid binding, ATP-dependent helicase
FT                   activity, ATP binding; INVOLVED IN: viral reproduction,
FT                   virus-host interaction; EXPRESSED IN: 24 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: RNA helicase, DEAD-box type, Q motif
FT                   (InterPro:IPR014014), DNA/RNA helicase, DEAD/DEAH box type,
FT                   N-terminal (InterPro:IPR011545), RNA helicase,
FT                   ATP-dependent, DEAD-box, conserved site
FT                   (InterPro:IPR000629), DEAD-like helicase, N-terminal
FT                   (InterPro:IPR014001), DNA/RNA helicase, C-terminal
FT                   (InterPro:IPR001650), Helicase, superfamily 1/2,
FT                   ATP-binding domain (InterPro:IPR014021); BEST Arabidopsis
FT                   thaliana protein match is: DEA(D/H)-box RNA helicase family
FT                   protein (TAIR:AT2G45810.1); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8RXK6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RXK6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU228049.1,INSD:ES185414.1,INSD:DR366734.1,
FT                   INSD:EH889823.1,INSD:ES157691.1,INSD:EH832443.1,
FT                   INSD:DR366741.1,INSD:EG471865.1,INSD:AU237035.1,
FT                   INSD:DR366739.1,INSD:EG491362.1,INSD:AV551652.1,
FT                   INSD:EH973158.1,INSD:BP806461.1,INSD:Z26776.1,
FT                   INSD:EG471887.1,INSD:BX837461.1,INSD:EL981571.1,
FT                   INSD:CO871577.1,INSD:EH952369.1,INSD:AI994768.1,
FT                   INSD:AV526724.1,INSD:BE524360.1,INSD:EH937892.1,
FT                   INSD:AV527200.1,INSD:BP561423.2,INSD:DR366740.1,
FT                   INSD:Z35343.1,INSD:DR366736.1,INSD:DR366738.1,
FT                   INSD:ES102863.1,INSD:AV794176.1,INSD:ES191555.1,
FT                   INSD:ES143185.1,INSD:DR366737.1,INSD:N38221.1,
FT                   INSD:AV547679.1,INSD:DR366735.1,INSD:EL223624.1,
FT                   INSD:EG491351.1,INSD:BP841394.1,INSD:EH796618.1,
FT                   INSD:BP832938.1,INSD:AV816352.1"
FT                   /protein_id="AEE81915.1"
FT                   /translation="MNNRGRYPPGIGAGRGAFNPNPNYQSRSGYQQHPPPQYVQRGNYA
FT                   QNHQQQFQQAPSQPHQYQQQQQQQQQWLRRGQIPGGNSNGDAVVEVEKTVQSEVIDPNS
FT                   EDWKARLKLPAPDTRYRTEDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIP
FT                   IALTGRDILARAKNGTGKTAAFCIPVLEKIDQDNNVIQAVIIVPTRELALQTSQVCKEL
FT                   GKHLKIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLTKKGVCVLKDCSVLVMDE
FT                   ADKLLSQEFQPSVEHLISFLPESRQILMFSATFPVTVKDFKDRFLTNPYVINLMDELTL
FT                   KGITQFYAFVEERQKIHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIH
FT                   AKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRVGR
FT                   SGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ"
FT   CDS_pept        join(274638..274945,275109..275169,275406..275640,
FT                   275956..276194,276330..276581,276655..276835,
FT                   277033..277121,277209..277282,277360..277438)
FT                   /codon_start=1
FT                   /gene="RH8"
FT                   /gene_synonym="ATRH8"
FT                   /gene_synonym="F6N23.6"
FT                   /gene_synonym="F6N23_6"
FT                   /gene_synonym="RNAhelicase-like 8"
FT                   /locus_tag="AT4G00660"
FT                   /product="RNAhelicase-like 8"
FT                   /note="RNAhelicase-like 8 (RH8); FUNCTIONS IN: helicase
FT                   activity, nucleic acid binding, ATP binding, ATP-dependent
FT                   helicase activity; INVOLVED IN: viral reproduction,
FT                   virus-host interaction; EXPRESSED IN: 24 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: RNA helicase, DEAD-box type, Q motif
FT                   (InterPro:IPR014014), DNA/RNA helicase, DEAD/DEAH box type,
FT                   N-terminal (InterPro:IPR011545), RNA helicase,
FT                   ATP-dependent, DEAD-box, conserved site
FT                   (InterPro:IPR000629), DEAD-like helicase, N-terminal
FT                   (InterPro:IPR014001), DNA/RNA helicase, C-terminal
FT                   (InterPro:IPR001650), Helicase, superfamily 1/2,
FT                   ATP-binding domain (InterPro:IPR014021); BEST Arabidopsis
FT                   thaliana protein match is: DEA(D/H)-box RNA helicase family
FT                   protein (TAIR:AT2G45810.1); Has 44948 Blast hits to 43709
FT                   proteins in 3097 species: Archae - 707; Bacteria - 21922;
FT                   Metazoa - 6580; Fungi - 4983; Plants - 2686; Viruses - 56;
FT                   Other Eukaryotes - 8014 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8RXK6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RXK6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES185414.1,INSD:DR366734.1,INSD:EH889823.1,
FT                   INSD:ES157691.1,INSD:EG471865.1,INSD:AU237035.1,
FT                   INSD:BP806461.1,INSD:Z26776.1,INSD:BX837461.1,
FT                   INSD:EL981571.1,INSD:CO871577.1,INSD:ES022000.1,
FT                   INSD:EH952369.1,INSD:AI994768.1,INSD:AV526724.1,
FT                   INSD:AV539246.1,INSD:AV560948.1,INSD:BP561423.2,
FT                   INSD:Z35343.1,INSD:Z35344.1,INSD:AV794176.1,
FT                   INSD:ES143185.1,INSD:DR366737.1,INSD:AV547679.1,
FT                   INSD:BP585376.1,INSD:DR366735.1,INSD:EL223624.1,
FT                   INSD:BP841394.1,INSD:ES009562.1,INSD:AV818432.1,
FT                   INSD:AU228049.1,INSD:AV791054.1,INSD:BP613560.1,
FT                   INSD:BX834527.1,INSD:EH832443.1,INSD:BP789495.1,
FT                   INSD:DR366741.1,INSD:DR366739.1,INSD:EG491362.1,
FT                   INSD:AV551652.1,INSD:EH973158.1,INSD:EG471887.1,
FT                   INSD:BP589494.1,INSD:BE524360.1,INSD:EH937892.1,
FT                   INSD:Z26476.1,INSD:AV527200.1,INSD:DR366740.1,
FT                   INSD:EL052114.1,INSD:DR366736.1,INSD:DR366738.1,
FT                   INSD:ES102863.1,INSD:ES191555.1,INSD:N38221.1,
FT                   INSD:AV560289.1,INSD:EG491351.1,INSD:EH796618.1,
FT                   INSD:BP832938.1,INSD:BP593728.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY080837.1,INSD:AY113985.1,INSD:AJ010460.1,
FT                   INSD:BX828369.1"
FT                   /protein_id="AEE81916.1"
FT                   /translation="MNNRGRYPPGIGAGRGAFNPNPNYQSRSGYQQHPPPQYVQRGNYA
FT                   QNHQQQFQQAPSQPHQYQQQQQQQQQWLRRGQIPGGNSNGDAVVEVEKTVQSEVIDPNS
FT                   EDWKARLKLPAPDTRYRTEDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIP
FT                   IALTGRDILARAKNGTGKTAAFCIPVLEKIDQDNNVIQAVIIVPTRELALQTSQVCKEL
FT                   GKHLKIQVMVTTGGTSLKDDIMRLYQPVHLLVGTPGRILDLTKKGVCVLKDCSVLVMDE
FT                   ADKLLSQEFQPSVEHLISFLPESRQILMFSATFPVTVKDFKDRFLTNPYVINLMDELTL
FT                   KGITQFYAFVEERQKIHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIH
FT                   AKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRVGR
FT                   SGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ"
FT   gene            complement(277466..277679)
FT                   /locus_tag="AT4G03705"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT4G00660"
FT   ncRNA           complement(277466..277679)
FT                   /locus_tag="AT4G03705"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(278316..279197)
FT                   /gene_synonym="F6N23.13"
FT                   /gene_synonym="F6N23_13"
FT                   /locus_tag="AT4G00670"
FT   mRNA            complement(join(278316..278631,278846..278927,
FT                   278995..279058,279143..279197))
FT                   /gene_synonym="F6N23.13"
FT                   /gene_synonym="F6N23_13"
FT                   /locus_tag="AT4G00670"
FT                   /product="Remorin family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG510745.1,INSD:EG500078.1,INSD:EG510746.1,
FT                   INSD:AV794176.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT014759.1,INSD:BT015948.1,INSD:BX828624.1"
FT   CDS_pept        complement(join(278434..278631,278846..278927,
FT                   278995..279058,279143..279170))
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.13"
FT                   /gene_synonym="F6N23_13"
FT                   /locus_tag="AT4G00670"
FT                   /product="Remorin family protein"
FT                   /note="Remorin family protein; CONTAINS InterPro DOMAIN/s:
FT                   Remorin, C-terminal (InterPro:IPR005516); BEST Arabidopsis
FT                   thaliana protein match is: Remorin family protein
FT                   (TAIR:AT3G61260.1); Has 353 Blast hits to 353 proteins in
FT                   28 species: Archae - 0; Bacteria - 2; Metazoa - 1; Fungi -
FT                   8; Plants - 326; Viruses - 0; Other Eukaryotes - 16
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00670.1"
FT                   /db_xref="InterPro:IPR005516"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IDB4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG510745.1,INSD:EG500078.1,INSD:EG510746.1,
FT                   INSD:AV794176.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT014759.1,INSD:BT015948.1,INSD:BX828624.1"
FT                   /protein_id="AEE81917.1"
FT                   /translation="MEPNIPIQRGDEQSKVIKAWKELKITKVNNKTQKKLLDISGWEKK
FT                   KTTKIESELARIQRKMDSKKMEKSEKLRNEKAAVHAKAQKKKADVQTRRAQEILDAEEA
FT                   AARFQAAGKIPKKSSLSCF"
FT   gene            complement(279596..281072)
FT                   /gene="ADF8"
FT                   /gene_synonym="actin depolymerizing factor 8"
FT                   /gene_synonym="F6N23.12"
FT                   /gene_synonym="F6N23_12"
FT                   /locus_tag="AT4G00680"
FT   mRNA            complement(join(279596..279933,280011..280276,
FT                   280606..281072))
FT                   /gene="ADF8"
FT                   /gene_synonym="actin depolymerizing factor 8"
FT                   /gene_synonym="F6N23.12"
FT                   /gene_synonym="F6N23_12"
FT                   /locus_tag="AT4G00680"
FT                   /product="actin depolymerizing factor 8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH862816.1,INSD:BP581298.1,INSD:DR332392.1,
FT                   INSD:DR374053.1,INSD:EH992365.1,INSD:BP576012.1,
FT                   INSD:AV545352.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK220571.1,INSD:AY086598.1"
FT   mRNA            complement(join(279596..279933,280011..281072))
FT                   /gene="ADF8"
FT                   /gene_synonym="actin depolymerizing factor 8"
FT                   /gene_synonym="F6N23.12"
FT                   /gene_synonym="F6N23_12"
FT                   /locus_tag="AT4G00680"
FT                   /product="actin depolymerizing factor 8"
FT   CDS_pept        complement(join(279780..279933,280011..280276,
FT                   280606..280608))
FT                   /codon_start=1
FT                   /gene="ADF8"
FT                   /gene_synonym="actin depolymerizing factor 8"
FT                   /gene_synonym="F6N23.12"
FT                   /gene_synonym="F6N23_12"
FT                   /locus_tag="AT4G00680"
FT                   /product="actin depolymerizing factor 8"
FT                   /note="actin depolymerizing factor 8 (ADF8); FUNCTIONS IN:
FT                   actin binding; INVOLVED IN: biological_process unknown;
FT                   LOCATED IN: intracellular; EXPRESSED IN: root, flower;
FT                   EXPRESSED DURING: petal differentiation and expansion
FT                   stage; CONTAINS InterPro DOMAIN/s: Actin-binding,
FT                   cofilin/tropomyosin type (InterPro:IPR002108); BEST
FT                   Arabidopsis thaliana protein match is: actin depolymerizing
FT                   factor 11 (TAIR:AT1G01750.1); Has 1612 Blast hits to 1604
FT                   proteins in 270 species: Archae - 0; Bacteria - 5; Metazoa
FT                   - 759; Fungi - 157; Plants - 515; Viruses - 0; Other
FT                   Eukaryotes - 176 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q570Y6"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q570Y6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH862816.1,INSD:BP581298.1,INSD:DR332392.1,
FT                   INSD:DR374053.1,INSD:EH992365.1,INSD:BP576012.1,
FT                   INSD:AV545352.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK220571.1,INSD:AY086598.1"
FT                   /protein_id="AEE81918.1"
FT                   /translation="MANSASGMHVNDECKIKFLELKAKRTYRFIVFKIDEKAQQVQIEK
FT                   LGNPEETYDDFTSSIPDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYA
FT                   SSKDRFKREMEGIQVELQATDPSEMSLDIIKGRLNL"
FT   CDS_pept        complement(join(279780..279933,280011..280309))
FT                   /codon_start=1
FT                   /gene="ADF8"
FT                   /gene_synonym="actin depolymerizing factor 8"
FT                   /gene_synonym="F6N23.12"
FT                   /gene_synonym="F6N23_12"
FT                   /locus_tag="AT4G00680"
FT                   /product="actin depolymerizing factor 8"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00680"
FT                   /db_xref="GOA:A0A1P8B506"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B506"
FT                   /protein_id="ANM66672.1"
FT                   /translation="MTTCVCVCVVQANSASGMHVNDECKIKFLELKAKRTYRFIVFKID
FT                   EKAQQVQIEKLGNPEETYDDFTSSIPDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDT
FT                   SRVRSKMLYASSKDRFKREMEGIQVELQATDPSEMSLDIIKGRLNL"
FT   gene            281132..283612
FT                   /gene="ULP1B"
FT                   /gene_synonym="F6N23.7"
FT                   /gene_synonym="F6N23_7"
FT                   /gene_synonym="UB-like protease 1B"
FT                   /locus_tag="AT4G00690"
FT   mRNA            join(281132..281615,281722..281798,281885..281978,
FT                   282058..282156,282240..282329,282397..282519,
FT                   282594..282697,282765..282837,283067..283612)
FT                   /gene="ULP1B"
FT                   /gene_synonym="F6N23.7"
FT                   /gene_synonym="F6N23_7"
FT                   /gene_synonym="UB-like protease 1B"
FT                   /locus_tag="AT4G00690"
FT                   /product="UB-like protease 1B"
FT                   /inference="similar to RNA sequence, EST:INSD:CO048767.1"
FT   CDS_pept        join(281313..281615,281722..281798,281885..281978,
FT                   282058..282156,282240..282329,282397..282519,
FT                   282594..282697,282765..282837,283067..283129)
FT                   /codon_start=1
FT                   /gene="ULP1B"
FT                   /gene_synonym="F6N23.7"
FT                   /gene_synonym="F6N23_7"
FT                   /gene_synonym="UB-like protease 1B"
FT                   /locus_tag="AT4G00690"
FT                   /product="UB-like protease 1B"
FT                   /note="UB-like protease 1B (ULP1B); FUNCTIONS IN:
FT                   cysteine-type peptidase activity; INVOLVED IN: proteolysis;
FT                   LOCATED IN: chloroplast; EXPRESSED IN: sperm cell; CONTAINS
FT                   InterPro DOMAIN/s: Peptidase C48, SUMO/Sentrin/Ubl1
FT                   (InterPro:IPR003653); BEST Arabidopsis thaliana protein
FT                   match is: Cysteine proteinases superfamily protein
FT                   (TAIR:AT4G15880.1); Has 1373 Blast hits to 1372 proteins in
FT                   211 species: Archae - 0; Bacteria - 0; Metazoa - 603; Fungi
FT                   - 267; Plants - 349; Viruses - 5; Other Eukaryotes - 149
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:O65278"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65278"
FT                   /inference="similar to RNA sequence, EST:INSD:CO048767.1"
FT                   /protein_id="AEE81919.2"
FT                   /translation="MALVPKIRNRTISDKPVSSSCTRTSSFRQRLLASCKRFLRFKLLV
FT                   RASSVSLKKKAARCSQSQQVVKHNDDRIEEHSSSNRGFKDGNNFLVSSTETKKLVAFCG
FT                   EPFQPLNEEEVALVNSALSKRNRKKILVSHKNSNIDISGETLQCLRPNQWLNDDVTNLY
FT                   LELLKERQTRDPQKYFKCHFFNTFFYVKLVSGSGYNYKAVSRWTTKRKLGYDLIDCDII
FT                   FVPIHIDIHWTLGVINNRERKFVYLDSLFTGVGHTILNAMAKYLVDEVKQKSQKNIDVS
FT                   SWGMEYVEERPQQQNGYDCGMFMLKYIDFYSRGLSLQFSQKDMPYFRLRTAKEILRLRA
FT                   D"
FT   gene            complement(283406..283709)
FT                   /locus_tag="AT4G03715"
FT   ncRNA           complement(283406..283709)
FT                   /locus_tag="AT4G03715"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            283592..285975
FT                   /locus_tag="AT4G00695"
FT   mRNA            join(283592..284000,284126..284209,284281..284386,
FT                   284493..284658,285785..285975)
FT                   /locus_tag="AT4G00695"
FT                   /product="Spc97/Spc98 family of spindle pole body (SBP)
FT                   component"
FT   mRNA            join(283592..283832,283943..284000,284126..284209,
FT                   284281..284386,284493..284658,285785..285975)
FT                   /locus_tag="AT4G00695"
FT                   /product="Spc97/Spc98 family of spindle pole body (SBP)
FT                   component"
FT   mRNA            join(283760..283832,283943..284000,284126..284209,
FT                   284281..284386,284493..284682,284777..284971)
FT                   /locus_tag="AT4G00695"
FT                   /product="Spc97/Spc98 family of spindle pole body (SBP)
FT                   component"
FT   mRNA            join(283918..284000,284126..284209,284281..284386,
FT                   284493..284682,284777..285142)
FT                   /locus_tag="AT4G00695"
FT                   /product="Spc97/Spc98 family of spindle pole body (SBP)
FT                   component"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CO048592.1,INSD:EG454310.1,INSD:EG454304.1,
FT                   INSD:CO048587.1,INSD:EG462153.1,INSD:EG462141.1,
FT                   INSD:CO048596.1,INSD:EG462154.1,INSD:EG462109.1,
FT                   INSD:EG454312.1,INSD:EG454313.1,INSD:EG454314.1,
FT                   INSD:EG460365.1,INSD:CO048586.1,INSD:EG460350.1,
FT                   INSD:EG462150.1,INSD:EG454315.1,INSD:EG462142.1,
FT                   INSD:EG454317.1,INSD:EG454305.1,INSD:EG460348.1,
FT                   INSD:EG460366.1,INSD:EG454316.1,INSD:CO048584.1,
FT                   INSD:CO048594.1,INSD:EG460347.1,INSD:EG462111.1,
FT                   INSD:EG460349.1,INSD:EG454309.1,INSD:EG454311.1,
FT                   INSD:EG460352.1,INSD:EG462148.1,INSD:CO048591.1,
FT                   INSD:EG460377.1,INSD:CO048595.1,INSD:EG454322.1,
FT                   INSD:EG462121.1,INSD:CO048590.1,INSD:EG454321.1,
FT                   INSD:EG460376.1,INSD:EG462149.1"
FT   mRNA            join(284031..284209,284281..284386,284493..284682,
FT                   284777..285142)
FT                   /locus_tag="AT4G00695"
FT                   /product="Spc97/Spc98 family of spindle pole body (SBP)
FT                   component"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CO048592.1,INSD:EG454310.1,INSD:EG460389.1,
FT                   INSD:EG454304.1,INSD:CO048587.1,INSD:EG462153.1,
FT                   INSD:EG462141.1,INSD:CO048596.1,INSD:EG462154.1,
FT                   INSD:EG462109.1,INSD:EG454312.1,INSD:EG454313.1,
FT                   INSD:EG454314.1,INSD:CO048586.1,INSD:EG462150.1,
FT                   INSD:EG454315.1,INSD:EG462142.1,INSD:EG454317.1,
FT                   INSD:EG460383.1,INSD:EG454305.1,INSD:EG454316.1,
FT                   INSD:CO048584.1,INSD:CO048594.1,INSD:EG462111.1,
FT                   INSD:EG454309.1,INSD:EG454311.1,INSD:EG462148.1,
FT                   INSD:CO048591.1,INSD:CO048595.1,INSD:EG454322.1,
FT                   INSD:EG462121.1,INSD:CO048590.1,INSD:EG454321.1,
FT                   INSD:EG462149.1"
FT   CDS_pept        join(284129..284209,284281..284386,284493..284658,
FT                   285785..285893)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00695"
FT                   /product="Spc97/Spc98 family of spindle pole body (SBP)
FT                   component"
FT                   /db_xref="GOA:F4JHF7"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHF7"
FT                   /protein_id="ANM67845.1"
FT                   /translation="MEELSQILKNNRTDDLTWFCSLSESELDLLISLKKLVIRRAKVSG
FT                   LEDLVADKFDLKMLRSLGLVLMEYVRKRVEDDTSLAPSVVQELSLLDSCNLLKTHVDDT
FT                   VDIEEILTDICNKNWATKGTRVKIRRRFSKQPGNFHGNRGMTNIVSTVE"
FT   CDS_pept        join(284129..284209,284281..284386,284493..284658,
FT                   285785..285893)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00695"
FT                   /product="Spc97/Spc98 family of spindle pole body (SBP)
FT                   component"
FT                   /note="FUNCTIONS IN: molecular_function unknown; BEST
FT                   Arabidopsis thaliana protein match is: Spc97 / Spc98 family
FT                   of spindle pole body (SBP) component (TAIR:AT1G80245.3)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00695"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00695.3"
FT                   /db_xref="GOA:F4JHF7"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHF7"
FT                   /protein_id="AEE81922.1"
FT                   /translation="MEELSQILKNNRTDDLTWFCSLSESELDLLISLKKLVIRRAKVSG
FT                   LEDLVADKFDLKMLRSLGLVLMEYVRKRVEDDTSLAPSVVQELSLLDSCNLLKTHVDDT
FT                   VDIEEILTDICNKNWATKGTRVKIRRRFSKQPGNFHGNRGMTNIVSTVE"
FT   CDS_pept        join(284129..284209,284281..284386,284493..284682,
FT                   284777..284786)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00695"
FT                   /product="Spc97/Spc98 family of spindle pole body (SBP)
FT                   component"
FT                   /db_xref="UniProtKB/TrEMBL:Q58FV2"
FT                   /protein_id="ANM67844.1"
FT                   /translation="MEELSQILKNNRTDDLTWFCSLSESELDLLISLKKLVIRRAKVSG
FT                   LEDLVADKFDLKMLRSLGLVLMEYVRKRVEDDTSLAPSVVQELSLLDSCNLLKTHVDDT
FT                   VDIEEILTDICNKKSKKKTRKRSR"
FT   CDS_pept        join(284129..284209,284281..284386,284493..284682,
FT                   284777..284786)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00695"
FT                   /product="Spc97/Spc98 family of spindle pole body (SBP)
FT                   component"
FT                   /note="FUNCTIONS IN: molecular_function unknown; INVOLVED
FT                   IN: microtubule cytoskeleton organization; LOCATED IN:
FT                   spindle pole, microtubule organizing center; EXPRESSED IN:
FT                   cotyledon; CONTAINS InterPro DOMAIN/s: Spc97/Spc98
FT                   (InterPro:IPR007259); BEST Arabidopsis thaliana protein
FT                   match is: Spc97 / Spc98 family of spindle pole body (SBP)
FT                   component (TAIR:AT1G80245.3); Has 27 Blast hits to 27
FT                   proteins in 8 species: Archae - 0; Bacteria - 0; Metazoa -
FT                   0; Fungi - 0; Plants - 27; Viruses - 0; Other Eukaryotes -
FT                   0 (source: NCBI BLink)."
FT                   /db_xref="UniProtKB/TrEMBL:Q58FV2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CO048592.1,INSD:EG454310.1,INSD:EG454304.1,
FT                   INSD:CO048587.1,INSD:EG462153.1,INSD:EG462141.1,
FT                   INSD:CO048596.1,INSD:EG462154.1,INSD:EG462109.1,
FT                   INSD:EG454312.1,INSD:EG454313.1,INSD:EG454314.1,
FT                   INSD:EG460365.1,INSD:CO048586.1,INSD:EG460350.1,
FT                   INSD:EG462150.1,INSD:EG454315.1,INSD:EG462142.1,
FT                   INSD:EG454317.1,INSD:EG454305.1,INSD:EG460348.1,
FT                   INSD:EG460366.1,INSD:EG454316.1,INSD:CO048584.1,
FT                   INSD:CO048594.1,INSD:EG460347.1,INSD:EG462111.1,
FT                   INSD:EG460349.1,INSD:EG454309.1,INSD:EG454311.1,
FT                   INSD:EG460352.1,INSD:EG462148.1,INSD:CO048591.1,
FT                   INSD:EG460377.1,INSD:CO048595.1,INSD:EG454322.1,
FT                   INSD:EG462121.1,INSD:CO048590.1,INSD:EG454321.1,
FT                   INSD:EG460376.1,INSD:EG462149.1"
FT                   /protein_id="AEE81920.1"
FT                   /translation="MEELSQILKNNRTDDLTWFCSLSESELDLLISLKKLVIRRAKVSG
FT                   LEDLVADKFDLKMLRSLGLVLMEYVRKRVEDDTSLAPSVVQELSLLDSCNLLKTHVDDT
FT                   VDIEEILTDICNKKSKKKTRKRSR"
FT   CDS_pept        join(284129..284209,284281..284386,284493..284682,
FT                   284777..284786)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00695"
FT                   /product="Spc97/Spc98 family of spindle pole body (SBP)
FT                   component"
FT                   /note="FUNCTIONS IN: molecular_function unknown; INVOLVED
FT                   IN: microtubule cytoskeleton organization; LOCATED IN:
FT                   spindle pole, microtubule organizing center; EXPRESSED IN:
FT                   cotyledon; CONTAINS InterPro DOMAIN/s: Spc97/Spc98
FT                   (InterPro:IPR007259); BEST Arabidopsis thaliana protein
FT                   match is: Spc97 / Spc98 family of spindle pole body (SBP)
FT                   component (TAIR:AT1G80245.3); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00695.1"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00695.2"
FT                   /db_xref="UniProtKB/TrEMBL:Q58FV2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CO048592.1,INSD:EG454310.1,INSD:EG460389.1,
FT                   INSD:EG454304.1,INSD:CO048587.1,INSD:EG462153.1,
FT                   INSD:EG462141.1,INSD:CO048596.1,INSD:EG462154.1,
FT                   INSD:EG462109.1,INSD:EG454312.1,INSD:EG454313.1,
FT                   INSD:EG454314.1,INSD:CO048586.1,INSD:EG462150.1,
FT                   INSD:EG454315.1,INSD:EG462142.1,INSD:EG454317.1,
FT                   INSD:EG460383.1,INSD:EG454305.1,INSD:EG454316.1,
FT                   INSD:CO048584.1,INSD:CO048594.1,INSD:EG462111.1,
FT                   INSD:EG454309.1,INSD:EG454311.1,INSD:EG462148.1,
FT                   INSD:CO048591.1,INSD:CO048595.1,INSD:EG454322.1,
FT                   INSD:EG462121.1,INSD:CO048590.1,INSD:EG454321.1,
FT                   INSD:EG462149.1"
FT                   /protein_id="AEE81921.1"
FT                   /translation="MEELSQILKNNRTDDLTWFCSLSESELDLLISLKKLVIRRAKVSG
FT                   LEDLVADKFDLKMLRSLGLVLMEYVRKRVEDDTSLAPSVVQELSLLDSCNLLKTHVDDT
FT                   VDIEEILTDICNKKSKKKTRKRSR"
FT   gene            285876..289575
FT                   /gene_synonym="F6N23.8"
FT                   /gene_synonym="F6N23_8"
FT                   /locus_tag="AT4G00700"
FT   mRNA            join(285876..288988,289078..289575)
FT                   /gene_synonym="F6N23.8"
FT                   /gene_synonym="F6N23_8"
FT                   /locus_tag="AT4G00700"
FT                   /product="C2 calcium/lipid-binding plant
FT                   phosphoribosyltransferase family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV548365.1,INSD:BP621070.1,INSD:AV529707.1,
FT                   INSD:AV548402.1,INSD:AV523937.1,INSD:BP605888.1,
FT                   INSD:CD534835.1,INSD:EL310515.1,INSD:AV816530.1,
FT                   INSD:AV546028.1,INSD:EL285129.1,INSD:CB074852.1,
FT                   INSD:AV831559.1,INSD:AV547673.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY080664.1"
FT   mRNA            join(285876..286062,286200..288988,289078..289575)
FT                   /gene_synonym="F6N23.8"
FT                   /gene_synonym="F6N23_8"
FT                   /locus_tag="AT4G00700"
FT                   /product="C2 calcium/lipid-binding plant
FT                   phosphoribosyltransferase family protein"
FT   CDS_pept        join(286260..288988,289078..289369)
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.8"
FT                   /gene_synonym="F6N23_8"
FT                   /locus_tag="AT4G00700"
FT                   /product="C2 calcium/lipid-binding plant
FT                   phosphoribosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00700"
FT                   /db_xref="GOA:Q8RXU9"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RXU9"
FT                   /protein_id="ANM66307.1"
FT                   /translation="MSNIKLGVEVISAQGLLQRDKHNSCSPFVELKFDNQIFRATTKHN
FT                   DPNPVWHECFYFVVSDPSVLSTRTLEAHVYSYQNEFDAKPFLGKVRVNGTSFVPRSEAA
FT                   PFNYPLEKRSVFSRARGELCLRVFITDDPSVTPSVPTPVPESPQAYSPSPRKEHVKSLI
FT                   TADASMATDERRELKPKTRTFHNSAPLVKQQPMMNYGIHEMRAAPMPPRVVQVNGPGPS
FT                   LHQLPPDFSVKETSPLLGGGRIVGGRVVRGTERPTSGTYDLVEEMKFLYVRVVKARDLP
FT                   NKDLTGSLDPYVVVKIGNFKGVTTHFNKNTDPEWNQVFAFAKDNLQSNFLEVMVKDKDI
FT                   LLDDFVGIVKFDLREVQSRVPPDSPLAPQWYRLENKRGEKKNYEIMLAVWSGTQADEAF
FT                   GDATFSDSLVDSDSSNIISANLRSKVYHSPRLWYLRVQILEAQDVIIVSDKSRVPEVFV
FT                   RVKVGNQMLRTKFPQRSNNPKWGDEFTFVVAEPFEDNLVLSVEDHTAPNRDEPVGKAVI
FT                   LMNDIEKRIDDKPFHDRWVHLEDSISDAMDVDKAKKVKFATRLRYKAVLDGGYHVFDES
FT                   MYNSSDLRPSSRKLWKPAIGVLELGILNANVFHSMKTREGKGTSDTYVVAKYGHKWVRS
FT                   RTVINSMNPKYNEQYTWEVFDPATVLTICVFDNAHFAAGDGGNKRDQPIGKVRIRLSTL
FT                   QTGRVYTHAYPLLVLQPTGLKKRGELHLAVRFTCTSVSSMLMKYTKPLLPKMHYILPLS
FT                   TNQQEALKMQAINIIIVRLGRSEPPLRREVVDYLTDWKSQLFSMRRSKANFNRFTTVFS
FT                   GALSVWKWMEQVCTWKTPVTTALVHVLYTMLVTFPEMILPTVFLYMAVIGMWNYRFKPR
FT                   FPPHMDAKLSYADNVNSDELDEEFDTFPTVRAPDIVKMRYDRLRSVAGKVQSVAGDIAA
FT                   QGERVQALLSWRDPRATAIFVTFCFIIAMALYITPFKLVALLSGYYFMRHPKLRHRIPS
FT                   APVNFFRRLPAMTDSML"
FT   CDS_pept        join(286260..288988,289078..289369)
FT                   /codon_start=1
FT                   /gene_synonym="F6N23.8"
FT                   /gene_synonym="F6N23_8"
FT                   /locus_tag="AT4G00700"
FT                   /product="C2 calcium/lipid-binding plant
FT                   phosphoribosyltransferase family protein"
FT                   /note="C2 calcium/lipid-binding plant
FT                   phosphoribosyltransferase family protein; CONTAINS InterPro
FT                   DOMAIN/s: C2 membrane targeting protein
FT                   (InterPro:IPR018029), C2 calcium/lipid-binding domain, CaLB
FT                   (InterPro:IPR008973), Phosphoribosyltransferase C-terminal
FT                   (InterPro:IPR013583), C2 calcium-dependent membrane
FT                   targeting (InterPro:IPR000008); BEST Arabidopsis thaliana
FT                   protein match is: C2 calcium/lipid-binding plant
FT                   phosphoribosyltransferase family protein
FT                   (TAIR:AT4G11610.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00700.1"
FT                   /db_xref="GOA:Q8RXU9"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RXU9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV548365.1,INSD:BP621070.1,INSD:AV529707.1,
FT                   INSD:AV548402.1,INSD:AV523937.1,INSD:BP605888.1,
FT                   INSD:CD534835.1,INSD:EL310515.1,INSD:AV816530.1,
FT                   INSD:AV546028.1,INSD:EL285129.1,INSD:CB074852.1,
FT                   INSD:AV831559.1,INSD:AV547673.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY080664.1"
FT                   /protein_id="AEE81923.1"
FT                   /translation="MSNIKLGVEVISAQGLLQRDKHNSCSPFVELKFDNQIFRATTKHN
FT                   DPNPVWHECFYFVVSDPSVLSTRTLEAHVYSYQNEFDAKPFLGKVRVNGTSFVPRSEAA
FT                   PFNYPLEKRSVFSRARGELCLRVFITDDPSVTPSVPTPVPESPQAYSPSPRKEHVKSLI
FT                   TADASMATDERRELKPKTRTFHNSAPLVKQQPMMNYGIHEMRAAPMPPRVVQVNGPGPS
FT                   LHQLPPDFSVKETSPLLGGGRIVGGRVVRGTERPTSGTYDLVEEMKFLYVRVVKARDLP
FT                   NKDLTGSLDPYVVVKIGNFKGVTTHFNKNTDPEWNQVFAFAKDNLQSNFLEVMVKDKDI
FT                   LLDDFVGIVKFDLREVQSRVPPDSPLAPQWYRLENKRGEKKNYEIMLAVWSGTQADEAF
FT                   GDATFSDSLVDSDSSNIISANLRSKVYHSPRLWYLRVQILEAQDVIIVSDKSRVPEVFV
FT                   RVKVGNQMLRTKFPQRSNNPKWGDEFTFVVAEPFEDNLVLSVEDHTAPNRDEPVGKAVI
FT                   LMNDIEKRIDDKPFHDRWVHLEDSISDAMDVDKAKKVKFATRLRYKAVLDGGYHVFDES
FT                   MYNSSDLRPSSRKLWKPAIGVLELGILNANVFHSMKTREGKGTSDTYVVAKYGHKWVRS
FT                   RTVINSMNPKYNEQYTWEVFDPATVLTICVFDNAHFAAGDGGNKRDQPIGKVRIRLSTL
FT                   QTGRVYTHAYPLLVLQPTGLKKRGELHLAVRFTCTSVSSMLMKYTKPLLPKMHYILPLS
FT                   TNQQEALKMQAINIIIVRLGRSEPPLRREVVDYLTDWKSQLFSMRRSKANFNRFTTVFS
FT                   GALSVWKWMEQVCTWKTPVTTALVHVLYTMLVTFPEMILPTVFLYMAVIGMWNYRFKPR
FT                   FPPHMDAKLSYADNVNSDELDEEFDTFPTVRAPDIVKMRYDRLRSVAGKVQSVAGDIAA
FT                   QGERVQALLSWRDPRATAIFVTFCFIIAMALYITPFKLVALLSGYYFMRHPKLRHRIPS
FT                   APVNFFRRLPAMTDSML"
FT   gene            289779..293492
FT                   /gene="BSK3"
FT                   /gene_synonym="BR-signaling kinase 3"
FT                   /gene_synonym="brassinosteroid-signaling kinase 3"
FT                   /gene_synonym="F6N23.9"
FT                   /gene_synonym="F6N23_9"
FT                   /locus_tag="AT4G00710"
FT                   /note="Encodes BR-signaling kinase 3 (BSK3), one of the
FT                   three homologous BR-signaling kinases (BSK1, AT4G35230;
FT                   BSK2, AT5G46570; BSK3, AT4G00710). Mediates signal
FT                   transduction from receptor kinase BRI1 by functioning as
FT                   the substrate of BRI1. Plasma membrane localized."
FT   mRNA            join(289779..290603,290695..290885,290966..291186,
FT                   291270..291405,291504..291637,291743..291848,
FT                   291926..292011,292108..292296,292387..292539,
FT                   292651..292764,292845..293492)
FT                   /gene="BSK3"
FT                   /gene_synonym="BR-signaling kinase 3"
FT                   /gene_synonym="brassinosteroid-signaling kinase 3"
FT                   /gene_synonym="F6N23.9"
FT                   /gene_synonym="F6N23_9"
FT                   /locus_tag="AT4G00710"
FT                   /product="BR-signaling kinase 3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP786723.1,INSD:CK121146.1,INSD:DR244032.1,
FT                   INSD:EL332195.1,INSD:EL271639.1,INSD:EL156886.1,
FT                   INSD:AV807488.1,INSD:EL047816.1,INSD:ES008889.1,
FT                   INSD:EH877540.1,INSD:DR244036.1,INSD:EH900333.1,
FT                   INSD:EL255348.1,INSD:EG482027.1,INSD:CK121145.1,
FT                   INSD:BP574842.1,INSD:BP658749.1,INSD:BP790722.1,
FT                   INSD:EL158509.1,INSD:BP608149.1,INSD:BP778502.1,
FT                   INSD:BP787976.1,INSD:BX839907.1,INSD:BP621183.1,
FT                   INSD:AV534857.1,INSD:EL147547.1,INSD:EL050879.1,
FT                   INSD:EL333373.1,INSD:AV816576.1,INSD:EH970592.1,
FT                   INSD:DR244033.1,INSD:BP791076.1,INSD:ES073015.1,
FT                   INSD:BP600536.1,INSD:ES142563.1,INSD:ES096108.1,
FT                   INSD:BP600111.1,INSD:EH887962.1,INSD:EH940263.1,
FT                   INSD:EL039277.1,INSD:BP617646.1,INSD:BP671012.1,
FT                   INSD:BP633131.1,INSD:BP779323.1,INSD:EL164280.1,
FT                   INSD:EH876641.1,INSD:BP599697.1,INSD:BP600350.1,
FT                   INSD:EH938519.1,INSD:AV792155.1,INSD:BP639535.1,
FT                   INSD:DR374397.1,INSD:EL134619.1,INSD:BX835889.1,
FT                   INSD:DR244035.1,INSD:EG472048.1,INSD:EH907806.1,
FT                   INSD:DR244034.1,INSD:BP838470.1,INSD:AV825731.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062495.1,INSD:BX827000.1,INSD:AY093275.1"
FT   mRNA            join(289882..290885,290966..291186,291270..291405,
FT                   291504..291637,291743..291848,291926..292011,
FT                   292108..292296,292387..292539,292651..292764,
FT                   292845..293475)
FT                   /gene="BSK3"
FT                   /gene_synonym="BR-signaling kinase 3"
FT                   /gene_synonym="brassinosteroid-signaling kinase 3"
FT                   /gene_synonym="F6N23.9"
FT                   /gene_synonym="F6N23_9"
FT                   /locus_tag="AT4G00710"
FT                   /product="BR-signaling kinase 3"
FT   CDS_pept        join(290807..290885,290966..291186,291270..291405,
FT                   291504..291637,291743..291848,291926..292011,
FT                   292108..292296,292387..292539,292651..292764,
FT                   292845..293096)
FT                   /codon_start=1
FT                   /gene="BSK3"
FT                   /gene_synonym="BR-signaling kinase 3"
FT                   /gene_synonym="brassinosteroid-signaling kinase 3"
FT                   /gene_synonym="F6N23.9"
FT                   /gene_synonym="F6N23_9"
FT                   /locus_tag="AT4G00710"
FT                   /product="BR-signaling kinase 3"
FT                   /db_xref="GOA:Q8W4L3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8W4L3"
FT                   /protein_id="ANM67341.1"
FT                   /translation="MGGQCSSLSCCRNTSHKTAVLEAPDVDNGESSEITDVPNFREYTL
FT                   EQLKAATSGFAVEYIVSEHGEKAPNVVYKGKLENQKKIAVKRFTRMAWPDSRQFLEEAR
FT                   SVGQLRSERMANLLGCCCEGDERLLVAEFMPNETLAKHLFHWETQPMKWTMRLRVVLYL
FT                   AQALEYCTSKGRTLYHDLNAYRVLFDEECNPRLSTFGLMKNSRDGKSYSTNLAFTPPEY
FT                   LRTGRITPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQTLTDSCLDGQFSDSDG
FT                   TELVRLASRCLQYEARERPNTKSLVTALTPLQKETEVLSHVLMGLPHSGSVSPLSPLGE
FT                   ACSRRDLTAMLEILEKLGYKDDEGVTNELSFHMWTDQMQESLNSKKKGDVAFRQKDFRE
FT                   AIECYTQFIDGGMISPTVCARRSLCYLMSDMPKEALDDAIQAQVISPVWHVASYLQSAS
FT                   LGILGMEKESQIALKEGSNLEAKMNGVPRVK"
FT   CDS_pept        join(290807..290885,290966..291186,291270..291405,
FT                   291504..291637,291743..291848,291926..292011,
FT                   292108..292296,292387..292539,292651..292764,
FT                   292845..293096)
FT                   /codon_start=1
FT                   /gene="BSK3"
FT                   /gene_synonym="BR-signaling kinase 3"
FT                   /gene_synonym="F6N23.9"
FT                   /gene_synonym="F6N23_9"
FT                   /gene_synonym="brassinosteroid-signaling kinase 3"
FT                   /locus_tag="AT4G00710"
FT                   /product="BR-signaling kinase 3"
FT                   /note="BR-signaling kinase 3 (BSK3); FUNCTIONS IN: binding,
FT                   protein kinase activity, kinase activity, ATP binding;
FT                   INVOLVED IN: brassinosteroid mediated signaling pathway,
FT                   N-terminal protein myristoylation; LOCATED IN: plasma
FT                   membrane, membrane; EXPRESSED IN: 22 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Tetratricopeptide-like helical
FT                   (InterPro:IPR011990), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Serine-threonine/tyrosine-protein
FT                   kinase (InterPro:IPR001245), Protein kinase-like domain
FT                   (InterPro:IPR011009); BEST Arabidopsis thaliana protein
FT                   match is: Protein kinase protein with tetratricopeptide
FT                   repeat domain (TAIR:AT1G01740.2); Has 30201 Blast hits to
FT                   17322 proteins in 780 species: Archae - 12; Bacteria -
FT                   1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses
FT                   - 0; Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00710"
FT                   /db_xref="GOA:Q8W4L3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8W4L3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP786723.1,INSD:CK121146.1,INSD:DR244032.1,
FT                   INSD:EL332195.1,INSD:EL271639.1,INSD:EL156886.1,
FT                   INSD:AV807488.1,INSD:EL047816.1,INSD:ES008889.1,
FT                   INSD:EH877540.1,INSD:DR244036.1,INSD:EH900333.1,
FT                   INSD:EL255348.1,INSD:EG482027.1,INSD:CK121145.1,
FT                   INSD:BP574842.1,INSD:BP658749.1,INSD:BP790722.1,
FT                   INSD:EL158509.1,INSD:BP608149.1,INSD:BP778502.1,
FT                   INSD:BP787976.1,INSD:BX839907.1,INSD:BP621183.1,
FT                   INSD:AV534857.1,INSD:EL147547.1,INSD:EL050879.1,
FT                   INSD:EL333373.1,INSD:AV816576.1,INSD:EH970592.1,
FT                   INSD:DR244033.1,INSD:BP791076.1,INSD:ES073015.1,
FT                   INSD:BP600536.1,INSD:ES142563.1,INSD:ES096108.1,
FT                   INSD:BP600111.1,INSD:EH887962.1,INSD:EH940263.1,
FT                   INSD:EL039277.1,INSD:BP617646.1,INSD:BP671012.1,
FT                   INSD:BP633131.1,INSD:BP779323.1,INSD:EL164280.1,
FT                   INSD:EH876641.1,INSD:BP599697.1,INSD:BP600350.1,
FT                   INSD:EH938519.1,INSD:AV792155.1,INSD:BP639535.1,
FT                   INSD:DR374397.1,INSD:EL134619.1,INSD:BX835889.1,
FT                   INSD:DR244035.1,INSD:EG472048.1,INSD:EH907806.1,
FT                   INSD:DR244034.1,INSD:BP838470.1,INSD:AV825731.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062495.1,INSD:BX827000.1,INSD:AY093275.1"
FT                   /protein_id="AEE81924.1"
FT                   /translation="MGGQCSSLSCCRNTSHKTAVLEAPDVDNGESSEITDVPNFREYTL
FT                   EQLKAATSGFAVEYIVSEHGEKAPNVVYKGKLENQKKIAVKRFTRMAWPDSRQFLEEAR
FT                   SVGQLRSERMANLLGCCCEGDERLLVAEFMPNETLAKHLFHWETQPMKWTMRLRVVLYL
FT                   AQALEYCTSKGRTLYHDLNAYRVLFDEECNPRLSTFGLMKNSRDGKSYSTNLAFTPPEY
FT                   LRTGRITPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNLQTLTDSCLDGQFSDSDG
FT                   TELVRLASRCLQYEARERPNTKSLVTALTPLQKETEVLSHVLMGLPHSGSVSPLSPLGE
FT                   ACSRRDLTAMLEILEKLGYKDDEGVTNELSFHMWTDQMQESLNSKKKGDVAFRQKDFRE
FT                   AIECYTQFIDGGMISPTVCARRSLCYLMSDMPKEALDDAIQAQVISPVWHVASYLQSAS
FT                   LGILGMEKESQIALKEGSNLEAKMNGVPRVK"
FT   gene            complement(293588..297479)
FT                   /gene="SK32"
FT                   /gene_synonym="ASKTHETA"
FT                   /gene_synonym="ATSK32"
FT                   /gene_synonym="F6N23.11"
FT                   /gene_synonym="F6N23_11"
FT                   /gene_synonym="shaggy-like protein kinase 32"
FT                   /gene_synonym="SHAGGY-LIKE PROTEIN KINASE THETA"
FT                   /locus_tag="AT4G00720"
FT                   /note="Encodes ASKtheta, a group III Arabidopsis
FT                   GSK3/shaggy-like kinase. Functions in the brassinosteroid
FT                   signalling pathway."
FT   mRNA            complement(join(293588..294192,294390..294492,
FT                   294598..294681,294761..294856,294937..294987,
FT                   295112..295252,295333..295389,295476..295550,
FT                   295679..295951,296040..296099,296244..296336,
FT                   296416..296661,296940..297479))
FT                   /gene="SK32"
FT                   /gene_synonym="ASKTHETA"
FT                   /gene_synonym="ATSK32"
FT                   /gene_synonym="F6N23.11"
FT                   /gene_synonym="F6N23_11"
FT                   /gene_synonym="shaggy-like protein kinase 32"
FT                   /gene_synonym="SHAGGY-LIKE PROTEIN KINASE THETA"
FT                   /locus_tag="AT4G00720"
FT                   /product="shaggy-like protein kinase 32"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL184907.1,INSD:AV797230.1,INSD:EH920725.1,
FT                   INSD:EL158880.1,INSD:EL059109.1,INSD:EL297818.1,
FT                   INSD:BP802420.1,INSD:EH978276.1,INSD:BP599584.1,
FT                   INSD:EL297934.1,INSD:EL194264.1,INSD:BP613845.1,
FT                   INSD:EL320695.1,INSD:EL305809.1,INSD:ES026995.1,
FT                   INSD:AV546767.1,INSD:EL991433.1,INSD:DR363277.1,
FT                   INSD:EL054317.1,INSD:EH948273.1,INSD:EL205403.1,
FT                   INSD:EL026594.1,INSD:EL083047.1,INSD:EH992190.1,
FT                   INSD:EL332879.1,INSD:EL219557.1,INSD:EL303218.1,
FT                   INSD:AV811866.1,INSD:EL237046.1,INSD:BP567128.1,
FT                   INSD:EH952721.1,INSD:BP567428.1,INSD:EL166491.1,
FT                   INSD:R29763.1,INSD:DR383749.1,INSD:EH873377.1,
FT                   INSD:BP843123.1,INSD:EG486923.1,INSD:EH917932.1,
FT                   INSD:BP848247.1,INSD:EL149391.1,INSD:EL099232.1,
FT                   INSD:EL983955.1,INSD:EL195005.1,INSD:BP810537.1,
FT                   INSD:AV533683.1,INSD:EL175267.1,INSD:EH941450.1,
FT                   INSD:ES035177.1,INSD:BP864899.1,INSD:AV549322.1,
FT                   INSD:EL174467.1,INSD:BP607054.1,INSD:EL311540.1,
FT                   INSD:EH827076.1,INSD:BP667117.1,INSD:EL178135.1,
FT                   INSD:EL031964.1,INSD:EH831512.1,INSD:EH993584.1,
FT                   INSD:EL968959.1,INSD:EL260502.1,INSD:BP799361.1,
FT                   INSD:BP570871.1,INSD:EH974440.1,INSD:EH823355.1,
FT                   INSD:EL227582.1,INSD:EL309779.1,INSD:BP856903.1,
FT                   INSD:EH888045.1,INSD:EL099865.1,INSD:BE524397.1,
FT                   INSD:EH822099.1,INSD:AV781937.1,INSD:BP862655.1,
FT                   INSD:BP624372.1,INSD:EH877283.1,INSD:BP611823.1,
FT                   INSD:BP619586.1,INSD:EL340572.1,INSD:AV440169.1,
FT                   INSD:BP859962.1,INSD:AV795913.1,INSD:BP563750.1,
FT                   INSD:EH818758.1,INSD:EL105775.1,INSD:EL075735.1,
FT                   INSD:EL284313.1,INSD:EH867501.1,INSD:EH992418.1,
FT                   INSD:BP807347.1,INSD:EL173061.1,INSD:BP566732.1,
FT                   INSD:EH826842.1,INSD:BP599791.1,INSD:EL236690.1,
FT                   INSD:ES205296.1,INSD:EL115164.1,INSD:EL287897.1,
FT                   INSD:EL029207.1,INSD:EL262900.1,INSD:ES106534.1,
FT                   INSD:EH799510.1,INSD:ES057703.1,INSD:EH955458.1,
FT                   INSD:ES115823.1,INSD:EL256458.1,INSD:EH867018.1,
FT                   INSD:EL267678.1,INSD:EL140074.1,INSD:EH851632.1,
FT                   INSD:EH820601.1,INSD:EH796891.1,INSD:EH937520.1,
FT                   INSD:BP648787.1,INSD:EL039384.1,INSD:EH966102.1,
FT                   INSD:BP628004.1,INSD:EL047315.1,INSD:AV439795.1,
FT                   INSD:BP565877.1,INSD:ES211638.1,INSD:EL340765.1,
FT                   INSD:BP862527.1,INSD:EH809832.1,INSD:EH890177.1,
FT                   INSD:EH859309.1,INSD:ES213014.1,INSD:EL258988.1,
FT                   INSD:BP865722.1,INSD:EL136583.1,INSD:EH824338.1,
FT                   INSD:DR363278.1,INSD:EL181278.1,INSD:EL279676.1,
FT                   INSD:BX840310.1,INSD:EH835983.1,INSD:ES214648.1,
FT                   INSD:EL190613.1,INSD:BP599041.1,INSD:EH991736.1,
FT                   INSD:N96886.1,INSD:EL275223.1,INSD:EH985980.1,
FT                   INSD:BP580170.1,INSD:EL139921.1,INSD:EL286175.1,
FT                   INSD:BP564073.1,INSD:EL299900.1,INSD:EL296348.1,
FT                   INSD:BP570659.1,INSD:EL136640.1,INSD:EH943689.1,
FT                   INSD:EH832003.1,INSD:EH882532.1,INSD:ES068755.1,
FT                   INSD:BP809496.1,INSD:BP611103.1,INSD:AV527416.1,
FT                   INSD:EL133021.1,INSD:EL007329.1,INSD:BP804506.1,
FT                   INSD:EL028571.1,INSD:EH830674.1,INSD:EL330275.1,
FT                   INSD:EL251365.1,INSD:EL159979.1,INSD:EL166214.1,
FT                   INSD:AV794010.1,INSD:EH854473.1,INSD:AV807955.1,
FT                   INSD:EG486925.1,INSD:EH985878.1,INSD:BP799698.1,
FT                   INSD:BP796950.1,INSD:ES040079.1,INSD:BP659308.1,
FT                   INSD:EL980304.1,INSD:AV821475.1,INSD:EL095081.1,
FT                   INSD:EH904282.1,INSD:EH804834.1,INSD:EL321404.1,
FT                   INSD:EL010603.1,INSD:AI993343.1,INSD:EL063165.1,
FT                   INSD:CB261060.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK226199.1,INSD:Y07822.1,INSD:AY124881.1,
FT                   INSD:BX826501.1,INSD:BX827493.1,INSD:AY062099.1"
FT   CDS_pept        complement(join(294116..294192,294390..294492,
FT                   294598..294681,294761..294856,294937..294987,
FT                   295112..295252,295333..295389,295476..295550,
FT                   295679..295951,296040..296099,296244..296336,
FT                   296416..296661,296940..297002))
FT                   /codon_start=1
FT                   /gene="SK32"
FT                   /gene_synonym="ASKTHETA"
FT                   /gene_synonym="ATSK32"
FT                   /gene_synonym="F6N23.11"
FT                   /gene_synonym="F6N23_11"
FT                   /gene_synonym="shaggy-like protein kinase 32"
FT                   /gene_synonym="SHAGGY-LIKE PROTEIN KINASE THETA"
FT                   /locus_tag="AT4G00720"
FT                   /product="shaggy-like protein kinase 32"
FT                   /note="shaggy-like protein kinase 32 (SK32); FUNCTIONS IN:
FT                   kinase activity; INVOLVED IN: response to brassinosteroid
FT                   stimulus; LOCATED IN: cytosol, nucleus; EXPRESSED IN: 26
FT                   plant structures; EXPRESSED DURING: 15 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Protein kinase, ATP binding
FT                   site (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), Serine/threonine-protein
FT                   kinase-like domain (InterPro:IPR017442), Protein
FT                   kinase-like domain (InterPro:IPR011009),
FT                   Serine/threonine-protein kinase, active site
FT                   (InterPro:IPR008271), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Tyrosine-protein kinase, catalytic
FT                   domain (InterPro:IPR020635); BEST Arabidopsis thaliana
FT                   protein match is: shaggy-like kinase 13 (TAIR:AT5G14640.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q96287"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR039192"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96287"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL184907.1,INSD:AV797230.1,INSD:EH920725.1,
FT                   INSD:EL158880.1,INSD:EL059109.1,INSD:EL297818.1,
FT                   INSD:BP802420.1,INSD:EH978276.1,INSD:BP599584.1,
FT                   INSD:EL297934.1,INSD:EL194264.1,INSD:BP613845.1,
FT                   INSD:EL320695.1,INSD:EL305809.1,INSD:ES026995.1,
FT                   INSD:AV546767.1,INSD:EL991433.1,INSD:DR363277.1,
FT                   INSD:EL054317.1,INSD:EH948273.1,INSD:EL205403.1,
FT                   INSD:EL026594.1,INSD:EL083047.1,INSD:EH992190.1,
FT                   INSD:EL332879.1,INSD:EL219557.1,INSD:EL303218.1,
FT                   INSD:AV811866.1,INSD:EL237046.1,INSD:BP567128.1,
FT                   INSD:EH952721.1,INSD:BP567428.1,INSD:EL166491.1,
FT                   INSD:R29763.1,INSD:DR383749.1,INSD:EH873377.1,
FT                   INSD:BP843123.1,INSD:EG486923.1,INSD:EH917932.1,
FT                   INSD:BP848247.1,INSD:EL149391.1,INSD:EL099232.1,
FT                   INSD:EL983955.1,INSD:EL195005.1,INSD:BP810537.1,
FT                   INSD:AV533683.1,INSD:EL175267.1,INSD:EH941450.1,
FT                   INSD:ES035177.1,INSD:BP864899.1,INSD:AV549322.1,
FT                   INSD:EL174467.1,INSD:BP607054.1,INSD:EL311540.1,
FT                   INSD:EH827076.1,INSD:BP667117.1,INSD:EL178135.1,
FT                   INSD:EL031964.1,INSD:EH831512.1,INSD:EH993584.1,
FT                   INSD:EL968959.1,INSD:EL260502.1,INSD:BP799361.1,
FT                   INSD:BP570871.1,INSD:EH974440.1,INSD:EH823355.1,
FT                   INSD:EL227582.1,INSD:EL309779.1,INSD:BP856903.1,
FT                   INSD:EH888045.1,INSD:EL099865.1,INSD:BE524397.1,
FT                   INSD:EH822099.1,INSD:AV781937.1,INSD:BP862655.1,
FT                   INSD:BP624372.1,INSD:EH877283.1,INSD:BP611823.1,
FT                   INSD:BP619586.1,INSD:EL340572.1,INSD:AV440169.1,
FT                   INSD:BP859962.1,INSD:AV795913.1,INSD:BP563750.1,
FT                   INSD:EH818758.1,INSD:EL105775.1,INSD:EL075735.1,
FT                   INSD:EL284313.1,INSD:EH867501.1,INSD:EH992418.1,
FT                   INSD:BP807347.1,INSD:EL173061.1,INSD:BP566732.1,
FT                   INSD:EH826842.1,INSD:BP599791.1,INSD:EL236690.1,
FT                   INSD:ES205296.1,INSD:EL115164.1,INSD:EL287897.1,
FT                   INSD:EL029207.1,INSD:EL262900.1,INSD:ES106534.1,
FT                   INSD:EH799510.1,INSD:ES057703.1,INSD:EH955458.1,
FT                   INSD:ES115823.1,INSD:EL256458.1,INSD:EH867018.1,
FT                   INSD:EL267678.1,INSD:EL140074.1,INSD:EH851632.1,
FT                   INSD:EH820601.1,INSD:EH796891.1,INSD:EH937520.1,
FT                   INSD:BP648787.1,INSD:EL039384.1,INSD:EH966102.1,
FT                   INSD:BP628004.1,INSD:EL047315.1,INSD:AV439795.1,
FT                   INSD:BP565877.1,INSD:ES211638.1,INSD:EL340765.1,
FT                   INSD:BP862527.1,INSD:EH809832.1,INSD:EH890177.1,
FT                   INSD:EH859309.1,INSD:ES213014.1,INSD:EL258988.1,
FT                   INSD:BP865722.1,INSD:EL136583.1,INSD:EH824338.1,
FT                   INSD:DR363278.1,INSD:EL181278.1,INSD:EL279676.1,
FT                   INSD:BX840310.1,INSD:EH835983.1,INSD:ES214648.1,
FT                   INSD:EL190613.1,INSD:BP599041.1,INSD:EH991736.1,
FT                   INSD:N96886.1,INSD:EL275223.1,INSD:EH985980.1,
FT                   INSD:BP580170.1,INSD:EL139921.1,INSD:EL286175.1,
FT                   INSD:BP564073.1,INSD:EL299900.1,INSD:EL296348.1,
FT                   INSD:BP570659.1,INSD:EL136640.1,INSD:EH943689.1,
FT                   INSD:EH832003.1,INSD:EH882532.1,INSD:ES068755.1,
FT                   INSD:BP809496.1,INSD:BP611103.1,INSD:AV527416.1,
FT                   INSD:EL133021.1,INSD:EL007329.1,INSD:BP804506.1,
FT                   INSD:EL028571.1,INSD:EH830674.1,INSD:EL330275.1,
FT                   INSD:EL251365.1,INSD:EL159979.1,INSD:EL166214.1,
FT                   INSD:AV794010.1,INSD:EH854473.1,INSD:AV807955.1,
FT                   INSD:EG486925.1,INSD:EH985878.1,INSD:BP799698.1,
FT                   INSD:BP796950.1,INSD:ES040079.1,INSD:BP659308.1,
FT                   INSD:EL980304.1,INSD:AV821475.1,INSD:EL095081.1,
FT                   INSD:EH904282.1,INSD:EH804834.1,INSD:EL321404.1,
FT                   INSD:EL010603.1,INSD:AI993343.1,INSD:EL063165.1,
FT                   INSD:CB261060.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK226199.1,INSD:Y07822.1,INSD:AY124881.1,
FT                   INSD:BX826501.1,INSD:BX827493.1,INSD:AY062099.1"
FT                   /protein_id="AEE81925.1"
FT                   /translation="MNVMRRLKSIASGRTSISSDPGGDYALKRAKLDQENDNLCVDPMQ
FT                   VDQNSSCFEMKADVLSQESVAGTSNVPAVSEKPVDDQLPDVMIEMKIRDERNANREDKD
FT                   METTVVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQ
FT                   VAIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEYVPETVYR
FT                   ASKHYTKMNQHMPIIFVQLYTYQICRALNYLHRVVGVCHRDIKPQNLLVNPQTHQLKIC
FT                   DFGSAKMLVPGEPNISYICSRYYRAPELIFGATEYTNAIDMWSGGCVMAELLLGQPLFP
FT                   GESGIDQLVEIIKILGTPTREEIRCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLV
FT                   SRLLQYSPNLRCTALEACAHPFFDDLRDPNVSLPNGRALPPLFNFTAQELAGASTELRQ
FT                   RLIPAHCQGTGSSS"
FT   gene            complement(299261..304612)
FT                   /gene="ANL2"
FT                   /gene_synonym="AHDP"
FT                   /gene_synonym="ANTHOCYANINLESS 2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HOMEODOMAIN PROTEIN"
FT                   /gene_synonym="F6N23.10"
FT                   /gene_synonym="F6N23_10"
FT                   /gene_synonym="HOMEODOMAIN PROTEIN AHDP"
FT                   /locus_tag="AT4G00730"
FT                   /note="Encodes a homeodomain protein of the HD-GLABRA2
FT                   group. Involved in the accumulation of anthocyanin and in
FT                   root development"
FT   mRNA            complement(join(299261..300112,300656..301017,
FT                   301109..301283,302204..302410,302497..302598,
FT                   302681..303301,303376..303493,303581..303825,
FT                   303897..304612))
FT                   /gene="ANL2"
FT                   /gene_synonym="AHDP"
FT                   /gene_synonym="ANTHOCYANINLESS 2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HOMEODOMAIN PROTEIN"
FT                   /gene_synonym="F6N23.10"
FT                   /gene_synonym="F6N23_10"
FT                   /gene_synonym="HOMEODOMAIN PROTEIN AHDP"
FT                   /locus_tag="AT4G00730"
FT                   /product="Homeobox-leucine zipper family protein /
FT                   lipid-binding START domain-containing protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX840043.1,INSD:AV529787.1,INSD:DR750150.1,
FT                   INSD:ES008211.1,INSD:AV528196.1,INSD:EL250611.1,
FT                   INSD:AV530238.1,INSD:ES205952.1,INSD:AV529561.1,
FT                   INSD:AV524110.1,INSD:EL124671.1,INSD:ES207702.1,
FT                   INSD:DR750262.1,INSD:BX836014.1,INSD:AA713192.1,
FT                   INSD:EH907361.1,INSD:BP589899.1,INSD:BP604413.1,
FT                   INSD:BP610041.1,INSD:BX839561.1,INSD:BP783747.1,
FT                   INSD:N65736.1,INSD:AV828962.1,INSD:BP593849.1,
FT                   INSD:BX835796.1,INSD:ES027196.1,INSD:AI993655.1,
FT                   INSD:EH982504.1,INSD:BP807384.1,INSD:EH941397.1,
FT                   INSD:ES184424.1,INSD:AV830469.1,INSD:BX835968.1,
FT                   INSD:AV529945.1,INSD:ES072829.1,INSD:BX835671.1,
FT                   INSD:DR750263.1,INSD:DR751644.1,INSD:DR751645.1,
FT                   INSD:ES026539.1,INSD:AV547837.1,INSD:ES039198.1,
FT                   INSD:BP617022.1,INSD:BP806573.1,INSD:AV523808.1,
FT                   INSD:EL326710.1,INSD:AV528450.1,INSD:BP590847.1,
FT                   INSD:CO048588.1,INSD:AA394617.1,INSD:W43752.1,
FT                   INSD:BP598693.1,INSD:AV530121.1,INSD:BX839803.1,
FT                   INSD:ES032353.1,INSD:AV528698.1,INSD:EL113432.1,
FT                   INSD:AV441565.1,INSD:AV810808.1,INSD:CO048593.1,
FT                   INSD:BP585092.1,INSD:EH948940.1,INSD:AV522692.1,
FT                   INSD:DR750149.1,INSD:EL078483.1,INSD:CO048597.1,
FT                   INSD:EH935392.1,INSD:BX839994.1,INSD:ES006654.1,
FT                   INSD:AV529435.1,INSD:EH930509.1,INSD:EL111782.1,
FT                   INSD:AV524335.1,INSD:EG447686.1,INSD:EL139430.1,
FT                   INSD:EH888767.1,INSD:EG447697.1,INSD:BP779277.1,
FT                   INSD:AV547515.1,INSD:BX840266.1,INSD:BP614509.1,
FT                   INSD:CO048585.1,INSD:EL102956.1,INSD:AV803599.1,
FT                   INSD:EL305963.1,INSD:BP603957.1,INSD:ES157266.1,
FT                   INSD:EL131801.1,INSD:EH799387.1,INSD:ES216135.1,
FT                   INSD:BP600897.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827413.1,INSD:AY062100.1,INSD:U85254.1,
FT                   INSD:AK226968.1"
FT   mRNA            complement(join(299359..300112,300656..301283,
FT                   302204..302410,302497..302598,302681..303301,
FT                   303376..303493,303581..303825,303897..304508))
FT                   /gene="ANL2"
FT                   /gene_synonym="AHDP"
FT                   /gene_synonym="ANTHOCYANINLESS 2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HOMEODOMAIN PROTEIN"
FT                   /gene_synonym="F6N23.10"
FT                   /gene_synonym="F6N23_10"
FT                   /gene_synonym="HOMEODOMAIN PROTEIN AHDP"
FT                   /locus_tag="AT4G00730"
FT                   /product="Homeobox-leucine zipper family protein /
FT                   lipid-binding START domain-containing protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX840043.1,INSD:AV529787.1,INSD:ES008211.1,
FT                   INSD:AV528196.1,INSD:EL250611.1,INSD:AV530238.1,
FT                   INSD:ES205952.1,INSD:AV529561.1,INSD:AV524110.1,
FT                   INSD:EL124671.1,INSD:ES207702.1,INSD:DR750262.1,
FT                   INSD:BX836014.1,INSD:AA713192.1,INSD:EH907361.1,
FT                   INSD:BP589899.1,INSD:BP604413.1,INSD:BP610041.1,
FT                   INSD:BX839561.1,INSD:BP783747.1,INSD:N65736.1,
FT                   INSD:AV828962.1,INSD:BP593849.1,INSD:BX835796.1,
FT                   INSD:ES027196.1,INSD:AI993655.1,INSD:EH982504.1,
FT                   INSD:BP807384.1,INSD:EH941397.1,INSD:AV830469.1,
FT                   INSD:BX835968.1,INSD:AV529945.1,INSD:BX835671.1,
FT                   INSD:DR751644.1,INSD:ES026539.1,INSD:AV547837.1,
FT                   INSD:ES039198.1,INSD:BP617022.1,INSD:BP806573.1,
FT                   INSD:AV523808.1,INSD:EL326710.1,INSD:AV528450.1,
FT                   INSD:BP590847.1,INSD:AA394617.1,INSD:CO048588.1,
FT                   INSD:W43752.1,INSD:BP598693.1,INSD:AV530121.1,
FT                   INSD:BX839803.1,INSD:ES032353.1,INSD:AV528698.1,
FT                   INSD:EL113432.1,INSD:AV441565.1,INSD:AV810808.1,
FT                   INSD:CO048593.1,INSD:BP585092.1,INSD:EH948940.1,
FT                   INSD:AV522692.1,INSD:DR750149.1,INSD:EL078483.1,
FT                   INSD:CO048597.1,INSD:EH935392.1,INSD:BX839994.1,
FT                   INSD:ES006654.1,INSD:AV529435.1,INSD:EH930509.1,
FT                   INSD:EL111782.1,INSD:AV524335.1,INSD:EG447686.1,
FT                   INSD:EL139430.1,INSD:EH888767.1,INSD:EG447697.1,
FT                   INSD:BP779277.1,INSD:AV547515.1,INSD:BX840266.1,
FT                   INSD:BP614509.1,INSD:EL102956.1,INSD:CO048585.1,
FT                   INSD:AV803599.1,INSD:EL305963.1,INSD:BP603957.1,
FT                   INSD:T76436.1,INSD:EL131801.1,INSD:EH799387.1,
FT                   INSD:ES216135.1,INSD:BP600897.1"
FT   CDS_pept        complement(join(299741..300112,300656..301017,
FT                   301109..301283,302204..302410,302497..302598,
FT                   302681..303301,303376..303493,303581..303825,
FT                   303897..304103))
FT                   /codon_start=1
FT                   /gene="ANL2"
FT                   /gene_synonym="AHDP"
FT                   /gene_synonym="ANTHOCYANINLESS 2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HOMEODOMAIN PROTEIN"
FT                   /gene_synonym="F6N23.10"
FT                   /gene_synonym="F6N23_10"
FT                   /gene_synonym="HOMEODOMAIN PROTEIN AHDP"
FT                   /locus_tag="AT4G00730"
FT                   /product="Homeobox-leucine zipper family protein /
FT                   lipid-binding START domain-containing protein"
FT                   /note="ANTHOCYANINLESS 2 (ANL2); FUNCTIONS IN:
FT                   transcription regulator activity, sequence-specific DNA
FT                   binding transcription factor activity; INVOLVED IN: root
FT                   development, anthocyanin accumulation in tissues in
FT                   response to UV light; LOCATED IN: nucleus; EXPRESSED IN: 22
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356),
FT                   Homeobox, conserved site (InterPro:IPR017970),
FT                   Homeodomain-like (InterPro:IPR009057), Lipid-binding START
FT                   (InterPro:IPR002913), Homeodomain-related
FT                   (InterPro:IPR012287); BEST Arabidopsis thaliana protein
FT                   match is: homeodomain GLABROUS 1 (TAIR:AT3G61150.1); Has
FT                   12660 Blast hits to 12608 proteins in 595 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 9962; Fungi - 223; Plants -
FT                   2228; Viruses - 1; Other Eukaryotes - 246 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q0WV12"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR042160"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WV12"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX840043.1,INSD:AV529787.1,INSD:DR750150.1,
FT                   INSD:ES008211.1,INSD:AV528196.1,INSD:EL250611.1,
FT                   INSD:AV530238.1,INSD:ES205952.1,INSD:AV529561.1,
FT                   INSD:AV524110.1,INSD:EL124671.1,INSD:ES207702.1,
FT                   INSD:DR750262.1,INSD:BX836014.1,INSD:AA713192.1,
FT                   INSD:EH907361.1,INSD:BP589899.1,INSD:BP604413.1,
FT                   INSD:BP610041.1,INSD:BX839561.1,INSD:BP783747.1,
FT                   INSD:N65736.1,INSD:AV828962.1,INSD:BP593849.1,
FT                   INSD:BX835796.1,INSD:ES027196.1,INSD:AI993655.1,
FT                   INSD:EH982504.1,INSD:BP807384.1,INSD:EH941397.1,
FT                   INSD:ES184424.1,INSD:AV830469.1,INSD:BX835968.1,
FT                   INSD:AV529945.1,INSD:ES072829.1,INSD:BX835671.1,
FT                   INSD:DR750263.1,INSD:DR751644.1,INSD:DR751645.1,
FT                   INSD:ES026539.1,INSD:AV547837.1,INSD:ES039198.1,
FT                   INSD:BP617022.1,INSD:BP806573.1,INSD:AV523808.1,
FT                   INSD:EL326710.1,INSD:AV528450.1,INSD:BP590847.1,
FT                   INSD:CO048588.1,INSD:AA394617.1,INSD:W43752.1,
FT                   INSD:BP598693.1,INSD:AV530121.1,INSD:BX839803.1,
FT                   INSD:ES032353.1,INSD:AV528698.1,INSD:EL113432.1,
FT                   INSD:AV441565.1,INSD:AV810808.1,INSD:CO048593.1,
FT                   INSD:BP585092.1,INSD:EH948940.1,INSD:AV522692.1,
FT                   INSD:DR750149.1,INSD:EL078483.1,INSD:CO048597.1,
FT                   INSD:EH935392.1,INSD:BX839994.1,INSD:ES006654.1,
FT                   INSD:AV529435.1,INSD:EH930509.1,INSD:EL111782.1,
FT                   INSD:AV524335.1,INSD:EG447686.1,INSD:EL139430.1,
FT                   INSD:EH888767.1,INSD:EG447697.1,INSD:BP779277.1,
FT                   INSD:AV547515.1,INSD:BX840266.1,INSD:BP614509.1,
FT                   INSD:CO048585.1,INSD:EL102956.1,INSD:AV803599.1,
FT                   INSD:EL305963.1,INSD:BP603957.1,INSD:ES157266.1,
FT                   INSD:EL131801.1,INSD:EH799387.1,INSD:ES216135.1,
FT                   INSD:BP600897.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX827413.1,INSD:AY062100.1,INSD:U85254.1,
FT                   INSD:AK226968.1"
FT                   /protein_id="AEE81926.1"
FT                   /translation="MNFGSLFDNTPGGGSTGARLLSGLSYGNHTAATNVLPGGAMAQAA
FT                   AAASLFSPPLTKSVYASSGLSLALEQPERGTNRGEASMRNNNNVGGGGDTFDGSVNRRS
FT                   REEEHESRSGSDNVEGISGEDQDAADKPPRKKRYHRHTPQQIQELESMFKECPHPDEKQ
FT                   RLELSKRLCLETRQVKFWFQNRRTQMKTQLERHENALLRQENDKLRAENMSIREAMRNP
FT                   ICTNCGGPAMLGDVSLEEHHLRIENARLKDELDRVCNLTGKFLGHHHNHHYNSSLELAV
FT                   GTNNNGGHFAFPPDFGGGGGCLPPQQQQSTVINGIDQKSVLLELALTAMDELVKLAQSE
FT                   EPLWVKSLDGERDELNQDEYMRTFSSTKPTGLATEASRTSGMVIINSLALVETLMDSNR
FT                   WTEMFPCNVARATTTDVISGGMAGTINGALQLMNAELQVLSPLVPVRNVNFLRFCKQHA
FT                   EGVWAVVDVSIDPVRENSGGAPVIRRLPSGCVVQDVSNGYSKVTWVEHAEYDENQIHQL
FT                   YRPLLRSGLGFGSQRWLATLQRQCECLAILISSSVTSHDNTSITPGGRKSMLKLAQRMT
FT                   FNFCSGISAPSVHNWSKLTVGNVDPDVRVMTRKSVDDPGEPPGIVLSAATSVWLPAAPQ
FT                   RLYDFLRNERMRCEWDILSNGGPMQEMAHITKGQDQGVSLLRSNAMNANQSSMLILQET
FT                   CIDASGALVVYAPVDIPAMHVVMNGGDSSYVALLPSGFAVLPDGGIDGGGSGDGDQRPV
FT                   GGGSLLTVAFQILVNNLPTAKLTVESVETVNNLISCTVQKIRAALQCES"
FT   CDS_pept        complement(join(301071..301283,302204..302410,
FT                   302497..302598,302681..303301,303376..303493,
FT                   303581..303825,303897..304103))
FT                   /codon_start=1
FT                   /gene="ANL2"
FT                   /gene_synonym="AHDP"
FT                   /gene_synonym="ANTHOCYANINLESS 2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA HOMEODOMAIN PROTEIN"
FT                   /gene_synonym="F6N23.10"
FT                   /gene_synonym="F6N23_10"
FT                   /gene_synonym="HOMEODOMAIN PROTEIN AHDP"
FT                   /locus_tag="AT4G00730"
FT                   /product="Homeobox-leucine zipper family protein /
FT                   lipid-binding START domain-containing protein"
FT                   /note="ANTHOCYANINLESS 2 (ANL2); FUNCTIONS IN:
FT                   transcription regulator activity, sequence-specific DNA
FT                   binding transcription factor activity; INVOLVED IN: root
FT                   development, anthocyanin accumulation in tissues in
FT                   response to UV light; LOCATED IN: nucleus; EXPRESSED IN: 22
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Homeobox, conserved site
FT                   (InterPro:IPR017970), Homeobox (InterPro:IPR001356),
FT                   Homeodomain-like (InterPro:IPR009057), Lipid-binding START
FT                   (InterPro:IPR002913), Homeodomain-related
FT                   (InterPro:IPR012287); BEST Arabidopsis thaliana protein
FT                   match is: homeodomain GLABROUS 1 (TAIR:AT3G61150.1); Has
FT                   30201 Blast hits to 17322 proteins in 780 species: Archae -
FT                   12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants
FT                   - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00730"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00730.2"
FT                   /db_xref="GOA:B3H591"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR042160"
FT                   /db_xref="UniProtKB/TrEMBL:B3H591"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BX840043.1,INSD:AV529787.1,INSD:ES008211.1,
FT                   INSD:AV528196.1,INSD:EL250611.1,INSD:AV530238.1,
FT                   INSD:ES205952.1,INSD:AV529561.1,INSD:AV524110.1,
FT                   INSD:EL124671.1,INSD:ES207702.1,INSD:DR750262.1,
FT                   INSD:BX836014.1,INSD:AA713192.1,INSD:EH907361.1,
FT                   INSD:BP589899.1,INSD:BP604413.1,INSD:BP610041.1,
FT                   INSD:BX839561.1,INSD:BP783747.1,INSD:N65736.1,
FT                   INSD:AV828962.1,INSD:BP593849.1,INSD:BX835796.1,
FT                   INSD:ES027196.1,INSD:AI993655.1,INSD:EH982504.1,
FT                   INSD:BP807384.1,INSD:EH941397.1,INSD:AV830469.1,
FT                   INSD:BX835968.1,INSD:AV529945.1,INSD:BX835671.1,
FT                   INSD:DR751644.1,INSD:ES026539.1,INSD:AV547837.1,
FT                   INSD:ES039198.1,INSD:BP617022.1,INSD:BP806573.1,
FT                   INSD:AV523808.1,INSD:EL326710.1,INSD:AV528450.1,
FT                   INSD:BP590847.1,INSD:AA394617.1,INSD:CO048588.1,
FT                   INSD:W43752.1,INSD:BP598693.1,INSD:AV530121.1,
FT                   INSD:BX839803.1,INSD:ES032353.1,INSD:AV528698.1,
FT                   INSD:EL113432.1,INSD:AV441565.1,INSD:AV810808.1,
FT                   INSD:CO048593.1,INSD:BP585092.1,INSD:EH948940.1,
FT                   INSD:AV522692.1,INSD:DR750149.1,INSD:EL078483.1,
FT                   INSD:CO048597.1,INSD:EH935392.1,INSD:BX839994.1,
FT                   INSD:ES006654.1,INSD:AV529435.1,INSD:EH930509.1,
FT                   INSD:EL111782.1,INSD:AV524335.1,INSD:EG447686.1,
FT                   INSD:EL139430.1,INSD:EH888767.1,INSD:EG447697.1,
FT                   INSD:BP779277.1,INSD:AV547515.1,INSD:BX840266.1,
FT                   INSD:BP614509.1,INSD:EL102956.1,INSD:CO048585.1,
FT                   INSD:AV803599.1,INSD:EL305963.1,INSD:BP603957.1,
FT                   INSD:T76436.1,INSD:EL131801.1,INSD:EH799387.1,
FT                   INSD:ES216135.1,INSD:BP600897.1"
FT                   /protein_id="AEE81927.1"
FT                   /translation="MNFGSLFDNTPGGGSTGARLLSGLSYGNHTAATNVLPGGAMAQAA
FT                   AAASLFSPPLTKSVYASSGLSLALEQPERGTNRGEASMRNNNNVGGGGDTFDGSVNRRS
FT                   REEEHESRSGSDNVEGISGEDQDAADKPPRKKRYHRHTPQQIQELESMFKECPHPDEKQ
FT                   RLELSKRLCLETRQVKFWFQNRRTQMKTQLERHENALLRQENDKLRAENMSIREAMRNP
FT                   ICTNCGGPAMLGDVSLEEHHLRIENARLKDELDRVCNLTGKFLGHHHNHHYNSSLELAV
FT                   GTNNNGGHFAFPPDFGGGGGCLPPQQQQSTVINGIDQKSVLLELALTAMDELVKLAQSE
FT                   EPLWVKSLDGERDELNQDEYMRTFSSTKPTGLATEASRTSGMVIINSLALVETLMDSNR
FT                   WTEMFPCNVARATTTDVISGGMAGTINGALQLMNAELQVLSPLVPVRNVNFLRFCKQHA
FT                   EGVWAVVDVSIDPVRENSGGAPVIRRLPSGCVVQDVSNGYSKVTWVEHAEYDENQIHQL
FT                   YRPLLRSGLGFGSQRWLATLQRQCECLAILISSSVTSHDNTCPFLTHLSLCLT"
FT   gene            complement(306869..310517)
FT                   /gene="QUA3"
FT                   /gene_synonym="F15P23.2"
FT                   /gene_synonym="F15P23_2"
FT                   /gene_synonym="QUASIMODO 3"
FT                   /locus_tag="AT4G00740"
FT                   /note="Encodes a Golgi-localized type II membrane pectin
FT                   methyltransferase regulating cell wall biosynthesis in
FT                   suspension cells."
FT   mRNA            complement(join(306869..308037,308128..308223,
FT                   308375..308749,308859..309120,309214..309424,
FT                   309501..309704,309867..310484))
FT                   /gene="QUA3"
FT                   /gene_synonym="F15P23.2"
FT                   /gene_synonym="F15P23_2"
FT                   /gene_synonym="QUASIMODO 3"
FT                   /locus_tag="AT4G00740"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP840125.1,INSD:BP861995.1,INSD:AV562736.1,
FT                   INSD:EL276898.1,INSD:ES013192.1,INSD:EL021973.1,
FT                   INSD:AV440886.1,INSD:ES045077.1,INSD:EH824828.1,
FT                   INSD:EH888454.1,INSD:ES209435.1,INSD:EH821689.1,
FT                   INSD:EL206445.1,INSD:ES061812.1,INSD:ES024771.1,
FT                   INSD:BE528671.1,INSD:EH817902.1,INSD:EL988361.1,
FT                   INSD:EH965652.1,INSD:BX841269.1,INSD:EL143461.1,
FT                   INSD:EG525379.1,INSD:BP782955.1,INSD:EG525380.1,
FT                   INSD:EL042320.1,INSD:BX839583.1,INSD:BP579639.1,
FT                   INSD:AV441008.1,INSD:BP620372.1,INSD:ES164630.1,
FT                   INSD:BX836051.1,INSD:ES095004.1,INSD:AV826786.1,
FT                   INSD:EL333393.1,INSD:EL260175.1,INSD:EL295290.1,
FT                   INSD:EL993139.1,INSD:ES086319.1,INSD:AV825593.1,
FT                   INSD:EL062442.1,INSD:EH974876.1,INSD:EH805587.1,
FT                   INSD:EL316041.1,INSD:EH984186.1,INSD:ES200120.1,
FT                   INSD:AV791677.1,INSD:EH956680.1,INSD:BP564955.1,
FT                   INSD:BX836792.1,INSD:EL218000.1,INSD:BP567101.1,
FT                   INSD:ES215831.1,INSD:AV796254.1,INSD:ES164122.1,
FT                   INSD:EH887055.1,INSD:BP650511.1,INSD:BP782109.1,
FT                   INSD:ES195972.1,INSD:EH963679.1,INSD:BP790085.1,
FT                   INSD:EL053635.1,INSD:ES061881.1,INSD:EL004697.1,
FT                   INSD:AV442737.1,INSD:EL251638.1,INSD:AV442650.1,
FT                   INSD:BP618989.1,INSD:EL977632.1,INSD:EH879163.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY059835.1,INSD:BT000151.1,INSD:BX827248.1,
FT                   INSD:AY059913.1,INSD:BT008377.1"
FT   mRNA            complement(join(306948..307358,307769..308037,
FT                   308128..308223,308375..308749,308859..309120,
FT                   309214..309424,309501..309704,309867..310517))
FT                   /gene="QUA3"
FT                   /gene_synonym="F15P23.2"
FT                   /gene_synonym="F15P23_2"
FT                   /gene_synonym="QUASIMODO 3"
FT                   /locus_tag="AT4G00740"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT   CDS_pept        complement(join(307815..308037,308128..308223,
FT                   308375..308749,308859..309120,309214..309424,
FT                   309501..309704,309867..310298))
FT                   /codon_start=1
FT                   /gene="QUA3"
FT                   /gene_synonym="F15P23.2"
FT                   /gene_synonym="F15P23_2"
FT                   /gene_synonym="QUASIMODO 3"
FT                   /locus_tag="AT4G00740"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /db_xref="GOA:Q93W95"
FT                   /db_xref="InterPro:IPR004159"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93W95"
FT                   /protein_id="ANM66439.1"
FT                   /translation="MGHVNLPASKRGNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDS
FT                   MAASGRQTLLLSTASDPRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLS
FT                   REMNFYRERHCPLPEETPLCLIPPPSGYKIPVPWPESLHKIWHANMPYNKIADRKGHQG
FT                   WMKREGEYFTFPGGGTMFPGGAGQYIEKLAQYIPLNGGTLRTALDMGCGVASFGGTLLS
FT                   QGILALSFAPRDSHKSQIQFALERGVPAFVAMLGTRRLPFPAYSFDLMHCSRCLIPFTA
FT                   YNATYFIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIW
FT                   KKPVGDSCLPSQNEFGLELCDESVPPSDAWYFKLKRCVTRPSSVKGEHALGTISKWPER
FT                   LTKVPSRAIVMKNGLDVFEADARRWARRVAYYRDSLNLKLKSPTVRNVMDMNAFFGGFA
FT                   ATLASDPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESL
FT                   IKRQDSSKSRCSLVDLMVEMDRILRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHEKE
FT                   PESHGREKILIATKSLWKLPSNSH"
FT   CDS_pept        complement(join(307815..308037,308128..308223,
FT                   308375..308749,308859..309120,309214..309424,
FT                   309501..309704,309867..310298))
FT                   /codon_start=1
FT                   /gene="QUA3"
FT                   /gene_synonym="F15P23.2"
FT                   /gene_synonym="F15P23_2"
FT                   /gene_synonym="QUASIMODO 3"
FT                   /locus_tag="AT4G00740"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; CONTAINS InterPro DOMAIN/s: Protein of
FT                   unknown function DUF248, methyltransferase putative
FT                   (InterPro:IPR004159); BEST Arabidopsis thaliana protein
FT                   match is: S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein (TAIR:AT4G10440.1);
FT                   Has 1057 Blast hits to 1046 proteins in 101 species: Archae
FT                   - 2; Bacteria - 148; Metazoa - 0; Fungi - 0; Plants - 904;
FT                   Viruses - 0; Other Eukaryotes - 3 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q93W95"
FT                   /db_xref="InterPro:IPR004159"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93W95"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP840125.1,INSD:BP861995.1,INSD:AV562736.1,
FT                   INSD:EL276898.1,INSD:ES013192.1,INSD:EL021973.1,
FT                   INSD:AV440886.1,INSD:ES045077.1,INSD:EH824828.1,
FT                   INSD:EH888454.1,INSD:ES209435.1,INSD:EH821689.1,
FT                   INSD:EL206445.1,INSD:ES061812.1,INSD:ES024771.1,
FT                   INSD:BE528671.1,INSD:EH817902.1,INSD:EL988361.1,
FT                   INSD:EH965652.1,INSD:BX841269.1,INSD:EL143461.1,
FT                   INSD:EG525379.1,INSD:BP782955.1,INSD:EG525380.1,
FT                   INSD:EL042320.1,INSD:BX839583.1,INSD:BP579639.1,
FT                   INSD:AV441008.1,INSD:BP620372.1,INSD:ES164630.1,
FT                   INSD:BX836051.1,INSD:ES095004.1,INSD:AV826786.1,
FT                   INSD:EL333393.1,INSD:EL260175.1,INSD:EL295290.1,
FT                   INSD:EL993139.1,INSD:ES086319.1,INSD:AV825593.1,
FT                   INSD:EL062442.1,INSD:EH974876.1,INSD:EH805587.1,
FT                   INSD:EL316041.1,INSD:EH984186.1,INSD:ES200120.1,
FT                   INSD:AV791677.1,INSD:EH956680.1,INSD:BP564955.1,
FT                   INSD:BX836792.1,INSD:EL218000.1,INSD:BP567101.1,
FT                   INSD:ES215831.1,INSD:AV796254.1,INSD:ES164122.1,
FT                   INSD:EH887055.1,INSD:BP650511.1,INSD:BP782109.1,
FT                   INSD:ES195972.1,INSD:EH963679.1,INSD:BP790085.1,
FT                   INSD:EL053635.1,INSD:ES061881.1,INSD:EL004697.1,
FT                   INSD:AV442737.1,INSD:EL251638.1,INSD:AV442650.1,
FT                   INSD:BP618989.1,INSD:EL977632.1,INSD:EH879163.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY059835.1,INSD:BT000151.1,INSD:BX827248.1,
FT                   INSD:AY059913.1,INSD:BT008377.1"
FT                   /protein_id="AEE81928.1"
FT                   /translation="MGHVNLPASKRGNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDS
FT                   MAASGRQTLLLSTASDPRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLS
FT                   REMNFYRERHCPLPEETPLCLIPPPSGYKIPVPWPESLHKIWHANMPYNKIADRKGHQG
FT                   WMKREGEYFTFPGGGTMFPGGAGQYIEKLAQYIPLNGGTLRTALDMGCGVASFGGTLLS
FT                   QGILALSFAPRDSHKSQIQFALERGVPAFVAMLGTRRLPFPAYSFDLMHCSRCLIPFTA
FT                   YNATYFIEVDRLLRPGGYLVISGPPVQWPKQDKEWADLQAVARALCYELIAVDGNTVIW
FT                   KKPVGDSCLPSQNEFGLELCDESVPPSDAWYFKLKRCVTRPSSVKGEHALGTISKWPER
FT                   LTKVPSRAIVMKNGLDVFEADARRWARRVAYYRDSLNLKLKSPTVRNVMDMNAFFGGFA
FT                   ATLASDPVWVMNVIPARKPLTLDVIYDRGLIGVYHDWCEPFSTYPRTYDFIHVSGIESL
FT                   IKRQDSSKSRCSLVDLMVEMDRILRPEGKVVIRDSPEVLDKVARMAHAVRWSSSIHEKE
FT                   PESHGREKILIATKSLWKLPSNSH"
FT   gene            314239..317675
FT                   /gene_synonym="F15P23.1"
FT                   /gene_synonym="F15P23_1"
FT                   /locus_tag="AT4G00750"
FT   mRNA            join(314239..315085,316016..316226,316318..316615,
FT                   316711..317109,317195..317675)
FT                   /gene_synonym="F15P23.1"
FT                   /gene_synonym="F15P23_1"
FT                   /locus_tag="AT4G00750"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR356006.1,INSD:AV442058.1,INSD:BP584280.1,
FT                   INSD:ES151122.1,INSD:EL230332.1,INSD:AV826926.1,
FT                   INSD:ES017302.1,INSD:CB185810.2,INSD:BP782567.1,
FT                   INSD:EL979299.1,INSD:AU226205.1,INSD:BX835502.1,
FT                   INSD:BE528900.1,INSD:BP787384.1,INSD:EH823620.1,
FT                   INSD:AV525275.1,INSD:BP644522.1,INSD:EG480316.1,
FT                   INSD:ES094556.1,INSD:BP789455.1,INSD:BP795547.1,
FT                   INSD:DR357273.1,INSD:AA651399.1,INSD:EL164644.1,
FT                   INSD:ES040002.1,INSD:ES165098.1,INSD:EL003644.1,
FT                   INSD:DR369116.1,INSD:AV796789.1,INSD:EH884015.1,
FT                   INSD:EG480317.1,INSD:EL111561.1,INSD:AV439510.1,
FT                   INSD:ES103097.1,INSD:ES179166.1,INSD:AV801523.1,
FT                   INSD:EL114701.1,INSD:ES144690.1,INSD:CB262139.1,
FT                   INSD:EL114559.1,INSD:EL214455.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX828866.1,INSD:BT000539.1,INSD:AY058882.1"
FT   CDS_pept        join(314405..315085,316016..316226,316318..316615,
FT                   316711..317109,317195..317507)
FT                   /codon_start=1
FT                   /gene_synonym="F15P23.1"
FT                   /gene_synonym="F15P23_1"
FT                   /locus_tag="AT4G00750"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; CONTAINS InterPro DOMAIN/s: Protein of
FT                   unknown function DUF248, methyltransferase putative
FT                   (InterPro:IPR004159); BEST Arabidopsis thaliana protein
FT                   match is: S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein (TAIR:AT2G45750.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9ZPH9"
FT                   /db_xref="InterPro:IPR004159"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZPH9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR356006.1,INSD:AV442058.1,INSD:BP584280.1,
FT                   INSD:ES151122.1,INSD:EL230332.1,INSD:AV826926.1,
FT                   INSD:ES017302.1,INSD:CB185810.2,INSD:BP782567.1,
FT                   INSD:EL979299.1,INSD:AU226205.1,INSD:BX835502.1,
FT                   INSD:BE528900.1,INSD:BP787384.1,INSD:EH823620.1,
FT                   INSD:AV525275.1,INSD:BP644522.1,INSD:EG480316.1,
FT                   INSD:ES094556.1,INSD:BP789455.1,INSD:BP795547.1,
FT                   INSD:DR357273.1,INSD:AA651399.1,INSD:EL164644.1,
FT                   INSD:ES040002.1,INSD:ES165098.1,INSD:EL003644.1,
FT                   INSD:DR369116.1,INSD:AV796789.1,INSD:EH884015.1,
FT                   INSD:EG480317.1,INSD:EL111561.1,INSD:AV439510.1,
FT                   INSD:ES103097.1,INSD:ES179166.1,INSD:AV801523.1,
FT                   INSD:EL114701.1,INSD:ES144690.1,INSD:CB262139.1,
FT                   INSD:EL114559.1,INSD:EL214455.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX828866.1,INSD:BT000539.1,INSD:AY058882.1"
FT                   /protein_id="AEE81929.1"
FT                   /translation="MGNYRWPSKLSKLSLRAKQTNLYRVILIAILCVTFYFVGVWQHSG
FT                   RGISRSSISNHELTSVPCTFPHQTTPILNFASRHTAPDLPPTITDARVVQIPSCGVEFS
FT                   EYTPCEFVNRSLNFPRERLIYRERHCPEKHEIVRCRIPAPYGYSLPFRWPESRDVAWFA
FT                   NVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYIDEIGRLINLKDGSIRTAI
FT                   DTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVPAIIGVLASIRLPFPARA
FT                   FDIAHCSRCLIPWGQYNGTYLIEVDRVLRPGGYWILSGPPINWQRHWKGWERTRDDLNS
FT                   EQSQIERVARSLCWRKLVQREDLAVWQKPTNHVHCKRNRIALGRPPFCHRTLPNQGWYT
FT                   KLETCLTPLPEVTGSEIKEVAGGQLARWPERLNALPPRIKSGSLEGITEDEFVSNTEKW
FT                   QRRVSYYKKYDQQLAETGRYRNFLDMNAHLGGFASALVDDPVWVMNVVPVEASVNTLGV
FT                   IYERGLIGTYQNWCEAMSTYPRTYDFIHADSVFSLYKDRCDMEDILLEMDRILRPKGSV
FT                   IIRDDIDVLTKVKKITDAMQWEGRIGDHENGPLEREKILFLVKEYWTAPAPDQSSDP"
FT   gene            complement(315065..316037)
FT                   /locus_tag="AT4G03725"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT4G00750"
FT   ncRNA           complement(315065..316037)
FT                   /locus_tag="AT4G03725"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(317564..320935)
FT                   /locus_tag="AT4G00752"
FT   mRNA            complement(join(317564..317881,318028..318084,
FT                   318178..318306,318707..318856,319003..319119,
FT                   319397..319507,319582..319665,319751..320255,
FT                   320378..320439,320710..320935))
FT                   /locus_tag="AT4G00752"
FT                   /product="UBX domain-containing protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI994254.1,INSD:EG466150.1,INSD:ES112171.1,
FT                   INSD:DR356006.1,INSD:BP584280.1,INSD:AV558625.1,
FT                   INSD:EH858891.1,INSD:DR261766.1,INSD:BP782567.1,
FT                   INSD:AU226205.1,INSD:H37566.1,INSD:ES092198.1,
FT                   INSD:BP787384.1,INSD:BX839715.1,INSD:ES194666.1,
FT                   INSD:EL169222.1,INSD:AV440074.1,INSD:BP789455.1,
FT                   INSD:DR383840.1,INSD:EL013489.1,INSD:ES189632.1,
FT                   INSD:BP795547.1,INSD:EL140939.1,INSD:AA651399.1,
FT                   INSD:DR261767.1,INSD:AV796789.1,INSD:EL994913.1,
FT                   INSD:DR261765.1,INSD:DR261768.1,INSD:AV439510.1,
FT                   INSD:AV801523.1,INSD:AU235494.1,INSD:CB262139.1,
FT                   INSD:ES136437.1,INSD:BE039341.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX828038.1,INSD:BX827859.1,INSD:BX827387.1,
FT                   INSD:BX827588.1,INSD:AK227547.1,INSD:BT023423.1"
FT   CDS_pept        complement(join(317771..317881,318028..318084,
FT                   318178..318306,318707..318856,319003..319119,
FT                   319397..319507,319582..319665,319751..320255,
FT                   320378..320439,320710..320793))
FT                   /codon_start=1
FT                   /locus_tag="AT4G00752"
FT                   /product="UBX domain-containing protein"
FT                   /note="UBX domain-containing protein; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: cellular_component unknown; EXPRESSED
FT                   IN: cultured cell; CONTAINS InterPro DOMAIN/s: UBX
FT                   (InterPro:IPR001012), Ubiquitin interacting motif
FT                   (InterPro:IPR003903), UBA-like (InterPro:IPR009060); BEST
FT                   Arabidopsis thaliana protein match is: Ubiquitin-like
FT                   superfamily protein (TAIR:AT4G11740.1); Has 35333 Blast
FT                   hits to 34131 proteins in 2444 species: Archae - 798;
FT                   Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531;
FT                   Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4V3D3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AI994254.1,INSD:EG466150.1,INSD:ES112171.1,
FT                   INSD:DR356006.1,INSD:BP584280.1,INSD:AV558625.1,
FT                   INSD:EH858891.1,INSD:DR261766.1,INSD:BP782567.1,
FT                   INSD:AU226205.1,INSD:H37566.1,INSD:ES092198.1,
FT                   INSD:BP787384.1,INSD:BX839715.1,INSD:ES194666.1,
FT                   INSD:EL169222.1,INSD:AV440074.1,INSD:BP789455.1,
FT                   INSD:DR383840.1,INSD:EL013489.1,INSD:ES189632.1,
FT                   INSD:BP795547.1,INSD:EL140939.1,INSD:AA651399.1,
FT                   INSD:DR261767.1,INSD:AV796789.1,INSD:EL994913.1,
FT                   INSD:DR261765.1,INSD:DR261768.1,INSD:AV439510.1,
FT                   INSD:AV801523.1,INSD:AU235494.1,INSD:CB262139.1,
FT                   INSD:ES136437.1,INSD:BE039341.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX828038.1,INSD:BX827859.1,INSD:BX827387.1,
FT                   INSD:BX827588.1,INSD:AK227547.1,INSD:BT023423.1"
FT                   /protein_id="AEE81930.1"
FT                   /translation="MVSPTRDAIQSYMSITGASESLAIQRLEEHGNNLPEAINAHFRDV
FT                   ERSIYDDSSLDTRSDYNVVEDNNHVRGSETRPVNESRPVPGALPSILSAARAFRPSLLL
FT                   DPNYRRNILRQLSGSALSGSPSPSSHTGEVTGFPAHSTWGNDHTRPPGLGAVGDGYARH
FT                   SPSYGSQVHGGTHRDADSPVHSNDAEEEMIRAAIEASKKDFQEGRLNTRYSLDNNPSSV
FT                   LSPREVINREDEDIARAISMSLEMEEHESVLRDQLAEFMPQSVEHHDPCQSNTNESTRY
FT                   QPGSSSVQDNREDMNQKQPINSSSQHRHDLQNSEGSYPEEWGGIPSKELQEAIMLEKAI
FT                   FGGVANESASHNNQLGIHKESQSPNQRVVREEPERKAALPIEPSGENEDAITLLVRMPD
FT                   SSRHGRRFLKSDKLKYLFDFIDAAGLVKPGTYRVVRPYPRRAFSIQDGALTFEELSLTN
FT                   KQEALFLELLV"
FT   gene            321888..323261
FT                   /pseudo
FT                   /locus_tag="AT4G00753"
FT                   /note="Pseudogene of AT5G37890; seven in absentia (SINA)
FT                   protein, putative"
FT   misc_RNA        join(321888..322018,322373..323261)
FT                   /pseudo
FT                   /locus_tag="AT4G00753"
FT                   /note="pseudogene of Protein with RING/U-box and TRAF-like
FT                   domain; AT4G00753.1"
FT   gene            324925..327008
FT                   /locus_tag="AT4G00755"
FT   mRNA            join(324925..325047,325267..325408,325501..325920,
FT                   326009..326190,326279..326397,326490..327008)
FT                   /locus_tag="AT4G00755"
FT                   /product="F-box family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP784944.1,INSD:ES055911.1,INSD:ES177078.1,
FT                   INSD:ES071271.1,INSD:EH798725.1,INSD:BP844638.1,
FT                   INSD:EL039551.1,INSD:ES005802.1,INSD:BE521051.1,
FT                   INSD:EH904557.1,INSD:AU227553.1,INSD:AU236599.1,
FT                   INSD:AV440819.1,INSD:ES149736.1,INSD:BE521036.1,
FT                   INSD:DR370559.1,INSD:BP637092.1,INSD:BP793603.1,
FT                   INSD:ES048799.1,INSD:ES105906.1,INSD:DR288792.1,
FT                   INSD:EL163106.1,INSD:DR379482.1,INSD:BP795033.1,
FT                   INSD:DR288790.1,INSD:EL020830.1,INSD:DR288791.1,
FT                   INSD:EL121319.1,INSD:ES192224.1,INSD:EL998508.1,
FT                   INSD:ES107600.1,INSD:EH957604.1,INSD:ES005564.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT003918.1,INSD:AY084538.1,INSD:BX828324.1,
FT                   INSD:BX828083.1"
FT   mRNA            join(325026..325408,325501..325920,326009..326190,
FT                   326279..326397,326490..327008)
FT                   /locus_tag="AT4G00755"
FT                   /product="F-box family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR216651.1,INSD:BP784944.1,INSD:ES055911.1,
FT                   INSD:ES177078.1,INSD:ES071271.1,INSD:EH798725.1,
FT                   INSD:EL039551.1,INSD:ES005802.1,INSD:BE521051.1,
FT                   INSD:EH904557.1,INSD:AU227553.1,INSD:AU236599.1,
FT                   INSD:AV440819.1,INSD:ES149736.1,INSD:DR370559.1,
FT                   INSD:BP637092.1,INSD:BP793603.1,INSD:ES048799.1,
FT                   INSD:ES105906.1,INSD:EL163106.1,INSD:DR379482.1,
FT                   INSD:BP795033.1,INSD:AV442761.1,INSD:DR216650.1,
FT                   INSD:DR216647.1,INSD:BP830352.1,INSD:EL020830.1,
FT                   INSD:DR216652.1,INSD:DR216649.1,INSD:EL121319.1,
FT                   INSD:DR216648.1,INSD:ES192224.1,INSD:BP814579.1,
FT                   INSD:EL998508.1,INSD:ES107600.1,INSD:DR216646.1,
FT                   INSD:ES005564.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT003918.1,INSD:BX828083.1,INSD:BX827930.1,
FT                   INSD:BX828878.1"
FT   CDS_pept        join(325294..325408,325501..325920,326009..326190,
FT                   326279..326397,326490..326787)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00755"
FT                   /product="F-box family protein"
FT                   /note="F-box family protein; CONTAINS InterPro DOMAIN/s:
FT                   F-box domain, cyclin-like (InterPro:IPR001810), F-box
FT                   domain, Skp2-like (InterPro:IPR022364); Has 80 Blast hits
FT                   to 80 proteins in 29 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 0; Fungi - 11; Plants - 57; Viruses - 0; Other
FT                   Eukaryotes - 12 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8LG03"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LG03"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP784944.1,INSD:ES055911.1,INSD:ES177078.1,
FT                   INSD:ES071271.1,INSD:EH798725.1,INSD:BP844638.1,
FT                   INSD:EL039551.1,INSD:ES005802.1,INSD:BE521051.1,
FT                   INSD:EH904557.1,INSD:AU227553.1,INSD:AU236599.1,
FT                   INSD:AV440819.1,INSD:ES149736.1,INSD:BE521036.1,
FT                   INSD:DR370559.1,INSD:BP637092.1,INSD:BP793603.1,
FT                   INSD:ES048799.1,INSD:ES105906.1,INSD:DR288792.1,
FT                   INSD:EL163106.1,INSD:DR379482.1,INSD:BP795033.1,
FT                   INSD:DR288790.1,INSD:EL020830.1,INSD:DR288791.1,
FT                   INSD:EL121319.1,INSD:ES192224.1,INSD:EL998508.1,
FT                   INSD:ES107600.1,INSD:EH957604.1,INSD:ES005564.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT003918.1,INSD:AY084538.1,INSD:BX828324.1,
FT                   INSD:BX828083.1"
FT                   /protein_id="AEE81931.1"
FT                   /translation="MDFVNNLDTDTSLSILSCLDDPSDIVRASAVSRSWRQFVVKYSLS
FT                   KNLCLKLFHQLSNVDHIIETSNDRNGESSEAGSSSLMDTRLLEKEHRAFALLARGCMSS
FT                   PIESCIADAIRASSTDNYPVESILNTLEKRDRIGRTPSYWSSTGQHKTTVPESLLYKLI
FT                   GDLCLITEVSIHPFQAYFQRGHPIYSSHYVRFRLGHEKDNSPHYNNSQDKKGEPGKSSI
FT                   ESNYVWTYTSQEFSMAQENRLQSFQLPEPVLCIGGYLLVEFLGRVQTQEMDGQYYICVS
FT                   HVKVEGRSLAKSFRVENVDDNGKFGLKVLSYNDPKKMEEMDAEAGQDMDAEAGQSQLRN
FT                   LEQLLNLLHRHPLDVVDYVWPDESDDEYAESEDEAEP"
FT   CDS_pept        join(325294..325408,325501..325920,326009..326190,
FT                   326279..326397,326490..326787)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00755"
FT                   /product="F-box family protein"
FT                   /note="F-box family protein; CONTAINS InterPro DOMAIN/s:
FT                   F-box domain, cyclin-like (InterPro:IPR001810), F-box
FT                   domain, Skp2-like (InterPro:IPR022364); Has 80 Blast hits
FT                   to 80 proteins in 29 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 0; Fungi - 11; Plants - 57; Viruses - 0; Other
FT                   Eukaryotes - 12 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00755.1"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00755.2"
FT                   /db_xref="GOA:Q8LG03"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LG03"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR216651.1,INSD:BP784944.1,INSD:ES055911.1,
FT                   INSD:ES177078.1,INSD:ES071271.1,INSD:EH798725.1,
FT                   INSD:EL039551.1,INSD:ES005802.1,INSD:BE521051.1,
FT                   INSD:EH904557.1,INSD:AU227553.1,INSD:AU236599.1,
FT                   INSD:AV440819.1,INSD:ES149736.1,INSD:DR370559.1,
FT                   INSD:BP637092.1,INSD:BP793603.1,INSD:ES048799.1,
FT                   INSD:ES105906.1,INSD:EL163106.1,INSD:DR379482.1,
FT                   INSD:BP795033.1,INSD:AV442761.1,INSD:DR216650.1,
FT                   INSD:DR216647.1,INSD:BP830352.1,INSD:EL020830.1,
FT                   INSD:DR216652.1,INSD:DR216649.1,INSD:EL121319.1,
FT                   INSD:DR216648.1,INSD:ES192224.1,INSD:BP814579.1,
FT                   INSD:EL998508.1,INSD:ES107600.1,INSD:DR216646.1,
FT                   INSD:ES005564.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT003918.1,INSD:BX828083.1,INSD:BX827930.1,
FT                   INSD:BX828878.1"
FT                   /protein_id="AEE81932.1"
FT                   /translation="MDFVNNLDTDTSLSILSCLDDPSDIVRASAVSRSWRQFVVKYSLS
FT                   KNLCLKLFHQLSNVDHIIETSNDRNGESSEAGSSSLMDTRLLEKEHRAFALLARGCMSS
FT                   PIESCIADAIRASSTDNYPVESILNTLEKRDRIGRTPSYWSSTGQHKTTVPESLLYKLI
FT                   GDLCLITEVSIHPFQAYFQRGHPIYSSHYVRFRLGHEKDNSPHYNNSQDKKGEPGKSSI
FT                   ESNYVWTYTSQEFSMAQENRLQSFQLPEPVLCIGGYLLVEFLGRVQTQEMDGQYYICVS
FT                   HVKVEGRSLAKSFRVENVDDNGKFGLKVLSYNDPKKMEEMDAEAGQDMDAEAGQSQLRN
FT                   LEQLLNLLHRHPLDVVDYVWPDESDDEYAESEDEAEP"
FT   gene            complement(327025..333477)
FT                   /gene="APRR8"
FT                   /gene_synonym="A_TM018A10.20"
FT                   /gene_synonym="A_TM018A10_20"
FT                   /gene_synonym="PRR8"
FT                   /gene_synonym="pseudo-response regulator 8"
FT                   /gene_synonym="PSEUDO-RESPONSE REGULATOR 8"
FT                   /gene_synonym="T18A10.1"
FT                   /gene_synonym="T18A10_1"
FT                   /locus_tag="AT4G00760"
FT                   /note="Encodes a response-regulator like protein."
FT   mRNA            complement(join(327025..327498,327725..327868,
FT                   327945..328106,328226..328489,328656..328808,
FT                   328931..328990,329244..329289,330083..330279,
FT                   330392..330517,331173..331515,331715..331771,
FT                   332219..333477))
FT                   /gene="APRR8"
FT                   /gene_synonym="A_TM018A10.20"
FT                   /gene_synonym="A_TM018A10_20"
FT                   /gene_synonym="PRR8"
FT                   /gene_synonym="pseudo-response regulator 8"
FT                   /gene_synonym="PSEUDO-RESPONSE REGULATOR 8"
FT                   /gene_synonym="T18A10.1"
FT                   /gene_synonym="T18A10_1"
FT                   /locus_tag="AT4G00760"
FT                   /product="pseudo-response regulator 8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL992894.1,INSD:AU228801.1,INSD:EG512014.1,
FT                   INSD:BE521661.1,INSD:BE521662.1,INSD:BP617859.1,
FT                   INSD:BP602236.1"
FT   mRNA            complement(join(327025..327498,327725..327868,
FT                   327945..328106,328226..328569))
FT                   /gene="APRR8"
FT                   /gene_synonym="A_TM018A10.20"
FT                   /gene_synonym="A_TM018A10_20"
FT                   /gene_synonym="PRR8"
FT                   /gene_synonym="pseudo-response regulator 8"
FT                   /gene_synonym="PSEUDO-RESPONSE REGULATOR 8"
FT                   /gene_synonym="T18A10.1"
FT                   /gene_synonym="T18A10_1"
FT                   /locus_tag="AT4G00760"
FT                   /product="pseudo-response regulator 8"
FT   CDS_pept        complement(join(327236..327498,327725..327868,
FT                   327945..328106,328226..328489,328656..328808,
FT                   328931..328955))
FT                   /codon_start=1
FT                   /gene="APRR8"
FT                   /gene_synonym="A_TM018A10.20"
FT                   /gene_synonym="A_TM018A10_20"
FT                   /gene_synonym="PRR8"
FT                   /gene_synonym="pseudo-response regulator 8"
FT                   /gene_synonym="PSEUDO-RESPONSE REGULATOR 8"
FT                   /gene_synonym="T18A10.1"
FT                   /gene_synonym="T18A10_1"
FT                   /locus_tag="AT4G00760"
FT                   /product="pseudo-response regulator 8"
FT                   /note="pseudo-response regulator 8 (APRR8); FUNCTIONS IN:
FT                   two-component response regulator activity, transcription
FT                   regulator activity; INVOLVED IN: regulation of
FT                   transcription, DNA-dependent, two-component signal
FT                   transduction system (phosphorelay); LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: CheY-like (InterPro:IPR011006), Signal
FT                   transduction response regulator, receiver domain
FT                   (InterPro:IPR001789); BEST Arabidopsis thaliana protein
FT                   match is: response regulator 2 (TAIR:AT4G16110.1); Has
FT                   30201 Blast hits to 17322 proteins in 780 species: Archae -
FT                   12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants
FT                   - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00760"
FT                   /db_xref="GOA:O23100"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23100"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL992894.1,INSD:AU228801.1,INSD:EG512014.1,
FT                   INSD:BE521661.1,INSD:BE521662.1,INSD:BP617859.1,
FT                   INSD:BP602236.1"
FT                   /protein_id="AEE81933.1"
FT                   /translation="MIRKCGYKVVATTRADDLPLIINNKDKKIDLVLAEFRLIEMNKYE
FT                   LLEKIRSICEIPVVVSGAHVKDAIVECLCRGAKLCLEKPLMENDFKILWQFTVSRQRNF
FT                   RSQIDINPPEKNHSITHTQSLGAELKKNNNNSEVETEDLDKYKDELGQGNKRKERADTD
FT                   TGEHTEKNNGSDLGDQKKPKLLFADDLQNETLEAVPNIEEANNERKAPTEIKKNGESSE
FT                   KKSPELVCMEEELQKWSAESFIDLTASVENESQDPLESVGDSVGPHEIPLSPPESSNNN
FT                   VAAQLQMPTHEALDEEVMQDGLSLSDLEVDLQEGHGSNKELFDKIFTDLAKELKP"
FT   CDS_pept        complement(join(327236..327498,327725..327868,
FT                   327945..328106,328226..328499))
FT                   /codon_start=1
FT                   /gene="APRR8"
FT                   /gene_synonym="A_TM018A10.20"
FT                   /gene_synonym="A_TM018A10_20"
FT                   /gene_synonym="PRR8"
FT                   /gene_synonym="pseudo-response regulator 8"
FT                   /gene_synonym="PSEUDO-RESPONSE REGULATOR 8"
FT                   /gene_synonym="T18A10.1"
FT                   /gene_synonym="T18A10_1"
FT                   /locus_tag="AT4G00760"
FT                   /product="pseudo-response regulator 8"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B4L5"
FT                   /protein_id="ANM66535.1"
FT                   /translation="MITVSGAHVKDAIVECLCRGAKLCLEKPLMENDFKILWQFTVSRQ
FT                   RNFRSQIDINPPEKNHSITHTQSLGAELKKNNNNSEVETEDLDKYKDELGQGNKRKERA
FT                   DTDTGEHTEKNNGSDLGDQKKPKLLFADDLQNETLEAVPNIEEANNERKAPTEIKKNGE
FT                   SSEKKSPELVCMEEELQKWSAESFIDLTASVENESQDPLESVGDSVGPHEIPLSPPESS
FT                   NNNVAAQLQMPTHEALDEEVMQDGLSLSDLEVDLQEGHGSNKELFDKIFTDLAKELKP"
FT   gene            329268..330106
FT                   /locus_tag="AT4G03755"
FT                   /note="Natural antisense transcript overlaps with
FT                   AT4G00760"
FT   ncRNA           329268..330106
FT                   /locus_tag="AT4G03755"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            331157..333477
FT                   /gene="TRM9"
FT                   /gene_synonym="A_TM018A10.11"
FT                   /gene_synonym="A_TM018A10_11"
FT                   /gene_synonym="T18A10.2"
FT                   /gene_synonym="T18A10_2"
FT                   /gene_synonym="TON1 Recruiting Motif 9"
FT                   /locus_tag="AT4G00770"
FT   mRNA            join(331157..331776,332209..332326,332428..333477)
FT                   /gene="TRM9"
FT                   /gene_synonym="A_TM018A10.11"
FT                   /gene_synonym="A_TM018A10_11"
FT                   /gene_synonym="T18A10.2"
FT                   /gene_synonym="T18A10_2"
FT                   /gene_synonym="TON1 Recruiting Motif 9"
FT                   /locus_tag="AT4G00770"
FT                   /product="DUF4378 domain protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR227370.1,INSD:AU237714.1,INSD:DR375909.1,
FT                   INSD:BP806187.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT026131.1,INSD:AY087624.1"
FT   CDS_pept        join(331195..331776,332209..332326,332428..333050)
FT                   /codon_start=1
FT                   /gene="TRM9"
FT                   /gene_synonym="A_TM018A10.11"
FT                   /gene_synonym="A_TM018A10_11"
FT                   /gene_synonym="T18A10.2"
FT                   /gene_synonym="T18A10_2"
FT                   /gene_synonym="TON1 Recruiting Motif 9"
FT                   /locus_tag="AT4G00770"
FT                   /product="DUF4378 domain protein"
FT                   /note="unknown protein; Has 127 Blast hits to 120 proteins
FT                   in 33 species: Archae - 0; Bacteria - 2; Metazoa - 6; Fungi
FT                   - 8; Plants - 62; Viruses - 3; Other Eukaryotes - 46
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00770"
FT                   /db_xref="UniProtKB/TrEMBL:Q147G2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR227370.1,INSD:AU237714.1,INSD:DR375909.1,
FT                   INSD:BP806187.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT026131.1,INSD:AY087624.1"
FT                   /protein_id="AEE81934.1"
FT                   /translation="MELRSRMLKDCLLEDSNSCSSNGFKSIPRRHPLNPFPMIPKRKQS
FT                   NALQAVINAIKNLHSNTIKSAPSGILPRSLSRRLATKNKAENQASITVIRVKDIVRWHS
FT                   SKDLHEDISHFEPHQYTTKNTTTTTGSSTTSGTSCSSWSDLDFTSEFLPSSWGSNVEEC
FT                   GEKQSVKNNLHCVGEDSCTAVILADTEVGPEENLQCEKEHNSPVSVFEIQHEEYDETSD
FT                   SSFSQCLDNVERTKQKLMQTIQRFESLANISPFNLDEWGSMDEASCMEGGQETDTKYDD
FT                   DENCDTVDRESEDEYNDEVEEKAAQLWNRVKERHAIWIHEEHLIMDYFRDELMQRTNSF
FT                   HETQHFENQLVCEAKGWLQGKRESELERGTSEQRRQACAREIERRDWNEKQIEEEHEVV
FT                   VTQIEEELFSLLMDETLTTLSTKTDSSPPEHHKTVTSMLKL"
FT   gene            334573..336478
FT                   /gene_synonym="A_TM018A10.12"
FT                   /gene_synonym="A_TM018A10_12"
FT                   /gene_synonym="T18A10.3"
FT                   /gene_synonym="T18A10_3"
FT                   /locus_tag="AT4G00780"
FT   mRNA            join(334573..334803,334884..335013,335119..335264,
FT                   335349..335631,335709..335875,335972..336478)
FT                   /gene_synonym="A_TM018A10.12"
FT                   /gene_synonym="A_TM018A10_12"
FT                   /gene_synonym="T18A10.3"
FT                   /gene_synonym="T18A10_3"
FT                   /locus_tag="AT4G00780"
FT                   /product="TRAF-like family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:R65502.1,INSD:CD531048.1,INSD:EG525798.1,
FT                   INSD:AV829798.1,INSD:DR375951.1,INSD:BP630015.1,
FT                   INSD:CB257528.1,INSD:BP855163.1,INSD:DR199164.1,
FT                   INSD:T03964.1,INSD:EH864883.1,INSD:N65507.1,
FT                   INSD:DR199167.1,INSD:AV814495.1,INSD:CO048774.1,
FT                   INSD:EH922654.1,INSD:EL223608.1,INSD:DR199162.1,
FT                   INSD:BP784537.1,INSD:AV808685.1,INSD:CD532001.1,
FT                   INSD:DR199165.1,INSD:AI992841.1,INSD:BP815743.1,
FT                   INSD:EL101485.1,INSD:DR199166.1,INSD:AV522219.1,
FT                   INSD:EL006759.1,INSD:BP789981.1,INSD:EG497400.1,
FT                   INSD:EH910863.1,INSD:AV441453.1,INSD:EH985457.1,
FT                   INSD:BU635258.1,INSD:R30142.1,INSD:CB259344.1,
FT                   INSD:CB259760.1,INSD:DR199163.1,INSD:EG525797.1,
FT                   INSD:AI100443.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY091337.1,INSD:AY087644.1,INSD:AY065285.1,
FT                   INSD:BX828531.1,INSD:BX827245.1,INSD:BX828530.1"
FT   CDS_pept        join(334779..334803,334884..335013,335119..335264,
FT                   335349..335631,335709..335875,335972..336120)
FT                   /codon_start=1
FT                   /gene_synonym="A_TM018A10.12"
FT                   /gene_synonym="A_TM018A10_12"
FT                   /gene_synonym="T18A10.3"
FT                   /gene_synonym="T18A10_3"
FT                   /locus_tag="AT4G00780"
FT                   /product="TRAF-like family protein"
FT                   /note="TRAF-like family protein; CONTAINS InterPro
FT                   DOMAIN/s: TRAF-like (InterPro:IPR008974), MATH
FT                   (InterPro:IPR002083); BEST Arabidopsis thaliana protein
FT                   match is: TRAF-like family protein (TAIR:AT4G01390.1); Has
FT                   760 Blast hits to 681 proteins in 32 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 8; Fungi - 0; Plants - 739; Viruses
FT                   - 0; Other Eukaryotes - 13 (source: NCBI BLink)."
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VZ38"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:R65502.1,INSD:CD531048.1,INSD:EG525798.1,
FT                   INSD:AV829798.1,INSD:DR375951.1,INSD:BP630015.1,
FT                   INSD:CB257528.1,INSD:BP855163.1,INSD:DR199164.1,
FT                   INSD:T03964.1,INSD:EH864883.1,INSD:N65507.1,
FT                   INSD:DR199167.1,INSD:AV814495.1,INSD:CO048774.1,
FT                   INSD:EH922654.1,INSD:EL223608.1,INSD:DR199162.1,
FT                   INSD:BP784537.1,INSD:AV808685.1,INSD:CD532001.1,
FT                   INSD:DR199165.1,INSD:AI992841.1,INSD:BP815743.1,
FT                   INSD:EL101485.1,INSD:DR199166.1,INSD:AV522219.1,
FT                   INSD:EL006759.1,INSD:BP789981.1,INSD:EG497400.1,
FT                   INSD:EH910863.1,INSD:AV441453.1,INSD:EH985457.1,
FT                   INSD:BU635258.1,INSD:R30142.1,INSD:CB259344.1,
FT                   INSD:CB259760.1,INSD:DR199163.1,INSD:EG525797.1,
FT                   INSD:AI100443.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY091337.1,INSD:AY087644.1,INSD:AY065285.1,
FT                   INSD:BX828531.1,INSD:BX827245.1,INSD:BX828530.1"
FT                   /protein_id="AEE81935.1"
FT                   /translation="MSRPIPIEEMVRLFKIRHTTSHLFKIDNFSLLKKHGIEKVESSVF
FT                   DLAGHKWKLSVYPNGHKNAKGTHVSMFLVNQVPVNDMPTYELLVVSQLERKWHTHGRDE
FT                   FDINPEPASEGFLRFISLADLERKGFLIGDCCMFGVKFHGIEPANPGTAECFSLIEKPL
FT                   NHKVTWMMSKFSSFNPGKAHQSNEFVVGTRKWRLEVHPRGYMDEKDKSFSVYLSAEGFV
FT                   NNAPMTKTYAKFKLRVLDQVSWNHVEESGLSWFDAEPSDQSGFADFMPLGKLNEPYLVK
FT                   DKLYVGVEFEVVSTTYYC"
FT   gene            complement(336804..345785)
FT                   /gene="SETH5"
FT                   /gene_synonym="A_TM018A10.23"
FT                   /gene_synonym="A_TM018A10_23"
FT                   /gene_synonym="T18A10.7"
FT                   /gene_synonym="T18A10_7"
FT                   /locus_tag="AT4G00800"
FT   mRNA            complement(join(336804..337347,337424..337846,
FT                   337948..338284,338465..338574,338648..338941,
FT                   339420..339726,339811..340001,340105..340745,
FT                   340868..340923,341195..341337,341449..341550,
FT                   341628..341692,342278..342911,342986..343143,
FT                   343210..343309,343387..343626,343756..344064,
FT                   344184..345785))
FT                   /gene="SETH5"
FT                   /gene_synonym="A_TM018A10.23"
FT                   /gene_synonym="A_TM018A10_23"
FT                   /gene_synonym="T18A10.7"
FT                   /gene_synonym="T18A10_7"
FT                   /locus_tag="AT4G00800"
FT                   /product="transducin family protein / WD-40 repeat family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CO048812.1,INSD:BE523901.1,INSD:EH974708.1,
FT                   INSD:EL244907.1,INSD:BP837122.1,INSD:CF773016.1,
FT                   INSD:EH845711.1,INSD:BP790117.1,INSD:EH967830.1,
FT                   INSD:AU237725.1,INSD:ES018281.1,INSD:EL306081.1,
FT                   INSD:AU228812.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK229889.1"
FT   mRNA            complement(join(336945..337347,337424..337846,
FT                   337948..338284,338465..338574,338648..338941,
FT                   339420..339726,339811..340001,340105..340745,
FT                   340868..340923,341195..341337,341449..341550,
FT                   341628..341692,342278..342911,342986..343143,
FT                   343210..343309,343387..343626,343756..344064,
FT                   344184..344578,344712..345714))
FT                   /gene="SETH5"
FT                   /gene_synonym="A_TM018A10.23"
FT                   /gene_synonym="A_TM018A10_23"
FT                   /gene_synonym="T18A10.7"
FT                   /gene_synonym="T18A10_7"
FT                   /locus_tag="AT4G00800"
FT                   /product="transducin family protein / WD-40 repeat family
FT                   protein"
FT   CDS_pept        complement(join(337114..337347,337424..337846,
FT                   337948..338284,338465..338574,338648..338941,
FT                   339420..339726,339811..340001,340105..340745,
FT                   340868..340923,341195..341337,341449..341550,
FT                   341628..341692,342278..342911,342986..343143,
FT                   343210..343309,343387..343626,343756..344064,
FT                   344184..345581))
FT                   /codon_start=1
FT                   /gene="SETH5"
FT                   /gene_synonym="A_TM018A10.23"
FT                   /gene_synonym="A_TM018A10_23"
FT                   /gene_synonym="T18A10.7"
FT                   /gene_synonym="T18A10_7"
FT                   /locus_tag="AT4G00800"
FT                   /product="transducin family protein / WD-40 repeat family
FT                   protein"
FT                   /note="transducin family protein / WD-40 repeat family
FT                   protein; FUNCTIONS IN: binding, zinc ion binding; INVOLVED
FT                   IN: biological_process unknown; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 13 plant
FT                   structures; EXPRESSED DURING: 4 anthesis, F mature embryo
FT                   stage, petal differentiation and expansion stage, E
FT                   expanded cotyledon stage, D bilateral stage; CONTAINS
FT                   InterPro DOMAIN/s: WD40 repeat 2 (InterPro:IPR019782), Zinc
FT                   finger, RING-type (InterPro:IPR001841), WD40 repeat,
FT                   conserved site (InterPro:IPR019775), WD40 repeat
FT                   (InterPro:IPR001680), WD40 repeat-like-containing domain
FT                   (InterPro:IPR011046), WD40-repeat-containing domain
FT                   (InterPro:IPR017986), WD40/YVTN repeat-like-containing
FT                   domain (InterPro:IPR015943), Armadillo-type fold
FT                   (InterPro:IPR016024); Has 298 Blast hits to 228 proteins in
FT                   78 species: Archae - 0; Bacteria - 17; Metazoa - 93; Fungi
FT                   - 89; Plants - 34; Viruses - 0; Other Eukaryotes - 65
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00800"
FT                   /db_xref="GOA:F4JHM9"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR025941"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHM9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CO048812.1,INSD:BE523901.1,INSD:EH974708.1,
FT                   INSD:EL244907.1,INSD:BP837122.1,INSD:CF773016.1,
FT                   INSD:EH845711.1,INSD:BP790117.1,INSD:EH967830.1,
FT                   INSD:AU237725.1,INSD:ES018281.1,INSD:EL306081.1,
FT                   INSD:AU228812.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK229889.1"
FT                   /protein_id="AEE81936.1"
FT                   /translation="MELDLDSFLVSDSDSDSDLDSSSVPHRTVDEILNASSSSSASSSP
FT                   PSSPPSINRRKQDDPNRRLSEALTNVAVLRPESELHRGFPPTRRNSTSSSSLRQLPLPS
FT                   LLAGVRSNVKPGAALAAAVAASRLVPTPHAAIIKSRRASSASSELLLQVSNQEEDDHEV
FT                   LSSNGDSVGVAAGSVSADDFRSFGGESLLEDEDNGVSGVASLEDEAKVMEVQASDITES
FT                   LNPDLVTVSSGFDSEGNVSTEKEAETTMEAGNAAIDDDTDETMLVASLVESSESQHLTD
FT                   SEGKCDDAKVSNDEESSVGDVKSDKSDIIIPESKKEGGDAFIPDDGSSMSGISELVEER
FT                   IAELENERMSKRERLKSQSFRKQLVLAEEFEKKQAYTGLHWEEGAAAQPMRLEGVKIGS
FT                   TNLGYFDVDADNVISRTISSQAFKRDHGSPQVLAVHLNYIAVGTSKGVIVVVPSKYSSD
FT                   HADQMESKMIWLGLQGERSQSPVTSVCFNQIGSLLLAGYGDGHVTVWDMQRASIAKVIT
FT                   EHTAPVVYAFFLGRDSQGSRQFKVITSDTKGVVFKHSFSYARLLNMYTVETQCLLDGQK
FT                   NGTVLSASPLPDENFGSSLVSSKGGNSAVPSSSISSMMGGVVGVGSTWKLFNEDSTSVE
FT                   EGVVIFATYQTGLVVKLIPNLEVYAQLPRPEGVREGSMPYTAWRRSTENYSKEAEDRVS
FT                   FLVIAWDRRVQVAKLVKSDIKEYAKWSLDSPAIGVVWLDDQLLVIPTVTGHLYLFTRDG
FT                   VVIHQTNFSVAGSSGNDLISYHTYFTNVFGNPEKAYHNSMGVRGASVYILGTAHLVISR
FT                   LLPWKERVDVLRRGGDWMGAFNMAMSLFNGQAHGVVDLPKTVDAIREAIAPSLAELLLS
FT                   YVDEVFSYISIAFSNQIENNGVTHEPSSGINNVNLEIEEQYNRVGGVAVEFCVHINRMD
FT                   LLFDEIFSRFVAVQQRDTFLELLEPYILRDMLGSLPPEIMQALVEHYSRKGWLQRIEQC
FT                   VLHMDISSLDFNQVVRICREHGLYGALLYLFNKGLDDFRSPLEELLIVLRNSEKQRATA
FT                   IGYRMLVYLKYCFLGLAFPPGHGTLNPTRWPSLRSELIQFLLEKSNAHDSSTCVTSRLN
FT                   YLNLYHLLEMDTEATLDVLRYAFVENEMVKHESHLLEYGEVSVESKTDGSLPEVSNDIL
FT                   IQNLVDALVHVPDWGVSNESGDPIDSKSDKNWPSKEDTSHLFEFVAYYAARGRVSISKS
FT                   VLAQILDYLTSDHILPTYNVSSKMRENQLLNLLKAVPETDWDADYVSQLCEKAHFYQVC
FT                   GYIHIIDRRYVAALDSYVKEADEPIHLFCYVNKMLSQLSGDEFTAFQSAIISRIPELLD
FT                   LSRQGAFFLIICNLKDTIKRIQEQLHSHPRSLFLYLKTVIEVYLSGSLDFSRLRKHEAV
FT                   DSSGENIRRDIPKEAKIYLEGLNDFPKFIQDNPVNVTDDMIELYVELLCKYEPKSVLKF
FT                   LETFDSYRVEHCLRLCQEYGIVDAAAFLLERVGDAGSALSLTLSGLNEKYVELEIAVEC
FT                   LMSEMKLGASEGASLEHFSSALELKEVHDIQGVLQACIGLCQRNTPRLNPEESEILWFR
FT                   FLDTFCEPLMESYREPKNTDGINKGSLGVKSLERHVNESDVAIKWRIPRSDTAATHILR
FT                   KLISQFIKEIVEGMIGYVRLPTIMTKLLSDNGTQEFGDFKLTILGMLGTYGFERRILDT
FT                   AKSLIEDDTFYSMNLLKKGASHGYAPRSLLCCICSCPLTKTFSALRVRVFNCGHATHLQ
FT                   CEPSENETSTSASSIHVSSSGCPVCMTKKTSKSSLKGKSFYRDYGLISTVSSNAGSSQR
FT                   ASPYSHENEMSDHSHNQQLSRFEILTNLQKDQRLVQIESLPRLRLAPPAVYHEKVSRLS
FT                   GFTPGESSGKDTKPVKTGQGKKPKTKGSIFGSTFGKSFL"
FT   CDS_pept        complement(join(337114..337347,337424..337846,
FT                   337948..338284,338465..338574,338648..338941,
FT                   339420..339726,339811..340001,340105..340745,
FT                   340868..340923,341195..341337,341449..341550,
FT                   341628..341692,342278..342911,342986..343143,
FT                   343210..343309,343387..343626,343756..344064,
FT                   344184..344537))
FT                   /codon_start=1
FT                   /gene="SETH5"
FT                   /gene_synonym="A_TM018A10.23"
FT                   /gene_synonym="A_TM018A10_23"
FT                   /gene_synonym="T18A10.7"
FT                   /gene_synonym="T18A10_7"
FT                   /locus_tag="AT4G00800"
FT                   /product="transducin family protein / WD-40 repeat family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00800"
FT                   /db_xref="GOA:A0A1P8B773"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR025941"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B773"
FT                   /protein_id="ANM67431.1"
FT                   /translation="MSKRERLKSQSFRKQLVLAEEFEKKQAYTGLHWEEGAAAQPMRLE
FT                   GVKIGSTNLGYFDVDADNVISRTISSQAFKRDHGSPQVLAVHLNYIAVGTSKGVIVVVP
FT                   SKYSSDHADQMESKMIWLGLQGERSQSPVTSVCFNQIGSLLLAGYGDGHVTVWDMQRAS
FT                   IAKVITEHTAPVVYAFFLGRDSQGSRQFKVITSDTKGVVFKHSFSYARLLNMYTVETQC
FT                   LLDGQKNGTVLSASPLPDENFGSSLVSSKGGNSAVPSSSISSMMGGVVGVGSTWKLFNE
FT                   DSTSVEEGVVIFATYQTGLVVKLIPNLEVYAQLPRPEGVREGSMPYTAWRRSTENYSKE
FT                   AEDRVSFLVIAWDRRVQVAKLVKSDIKEYAKWSLDSPAIGVVWLDDQLLVIPTVTGHLY
FT                   LFTRDGVVIHQTNFSVAGSSGNDLISYHTYFTNVFGNPEKAYHNSMGVRGASVYILGTA
FT                   HLVISRLLPWKERVDVLRRGGDWMGAFNMAMSLFNGQAHGVVDLPKTVDAIREAIAPSL
FT                   AELLLSYVDEVFSYISIAFSNQIENNGVTHEPSSGINNVNLEIEEQYNRVGGVAVEFCV
FT                   HINRMDLLFDEIFSRFVAVQQRDTFLELLEPYILRDMLGSLPPEIMQALVEHYSRKGWL
FT                   QRIEQCVLHMDISSLDFNQVVRICREHGLYGALLYLFNKGLDDFRSPLEELLIVLRNSE
FT                   KQRATAIGYRMLVYLKYCFLGLAFPPGHGTLNPTRWPSLRSELIQFLLEKSNAHDSSTC
FT                   VTSRLNYLNLYHLLEMDTEATLDVLRYAFVENEMVKHESHLLEYGEVSVESKTDGSLPE
FT                   VSNDILIQNLVDALVHVPDWGVSNESGDPIDSKSDKNWPSKEDTSHLFEFVAYYAARGR
FT                   VSISKSVLAQILDYLTSDHILPTYNVSSKMRENQLLNLLKAVPETDWDADYVSQLCEKA
FT                   HFYQVCGYIHIIDRRYVAALDSYVKEADEPIHLFCYVNKMLSQLSGDEFTAFQSAIISR
FT                   IPELLDLSRQGAFFLIICNLKDTIKRIQEQLHSHPRSLFLYLKTVIEVYLSGSLDFSRL
FT                   RKHEAVDSSGENIRRDIPKEAKIYLEGLNDFPKFIQDNPVNVTDDMIELYVELLCKYEP
FT                   KSVLKFLETFDSYRVEHCLRLCQEYGIVDAAAFLLERVGDAGSALSLTLSGLNEKYVEL
FT                   EIAVECLMSEMKLGASEGASLEHFSSALELKEVHDIQGVLQACIGLCQRNTPRLNPEES
FT                   EILWFRFLDTFCEPLMESYREPKNTDGINKGSLGVKSLERHVNESDVAIKWRIPRSDTA
FT                   ATHILRKLISQFIKEIVEGMIGYVRLPTIMTKLLSDNGTQEFGDFKLTILGMLGTYGFE
FT                   RRILDTAKSLIEDDTFYSMNLLKKGASHGYAPRSLLCCICSCPLTKTFSALRVRVFNCG
FT                   HATHLQCEPSENETSTSASSIHVSSSGCPVCMTKKTSKSSLKGKSFYRDYGLISTVSSN
FT                   AGSSQRASPYSHENEMSDHSHNQQLSRFEILTNLQKDQRLVQIESLPRLRLAPPAVYHE
FT                   KVSRLSGFTPGESSGKDTKPVKTGQGKKPKTKGSIFGSTFGKSFL"
FT   gene            complement(345911..347293)
FT                   /gene_synonym="A_TM018A10.9"
FT                   /gene_synonym="A_TM018A10_9"
FT                   /gene_synonym="T18A10.8"
FT                   /gene_synonym="T18A10_8"
FT                   /locus_tag="AT4G00810"
FT   mRNA            complement(join(345911..346232,346325..346540,
FT                   346886..346962,347083..347191))
FT                   /gene_synonym="A_TM018A10.9"
FT                   /gene_synonym="A_TM018A10_9"
FT                   /gene_synonym="T18A10.8"
FT                   /gene_synonym="T18A10_8"
FT                   /locus_tag="AT4G00810"
FT                   /product="60S acidic ribosomal protein family"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR332456.1,INSD:DR332413.1,INSD:BP819264.1,
FT                   INSD:DR332432.1,INSD:DR332426.1,INSD:EH951224.1,
FT                   INSD:EL123905.1,INSD:EL289584.1,INSD:BP654111.1,
FT                   INSD:DR332438.1,INSD:EL152215.1,INSD:EL982643.1,
FT                   INSD:DR332416.1,INSD:ES079751.1,INSD:DR332425.1,
FT                   INSD:DR332440.1,INSD:BP637763.1,INSD:EL002699.1,
FT                   INSD:BP649786.1,INSD:ES038161.1,INSD:ES202918.1,
FT                   INSD:AV787661.1,INSD:DR332428.1,INSD:AV522332.1,
FT                   INSD:EH808334.1,INSD:EH916352.1,INSD:BP840399.1,
FT                   INSD:DR332441.1,INSD:BP797530.1,INSD:BP822939.1,
FT                   INSD:ES073730.1,INSD:BP619526.1,INSD:DR332406.1,
FT                   INSD:EL077109.1,INSD:CK118948.1,INSD:DR332417.1,
FT                   INSD:ES009177.1,INSD:BP630041.1,INSD:EL056866.1,
FT                   INSD:BP862553.1,INSD:BP651912.1,INSD:EL981729.1,
FT                   INSD:DR332439.1,INSD:EL030029.1,INSD:EL109532.1,
FT                   INSD:DR332446.1,INSD:AV534095.1,INSD:ES006086.1,
FT                   INSD:ES194815.1,INSD:EL286312.1,INSD:ES132030.1,
FT                   INSD:DR332397.1,INSD:BP653503.1,INSD:DR332431.1,
FT                   INSD:EH852574.1,INSD:DR332437.1,INSD:EL052578.1,
FT                   INSD:BP797271.1,INSD:BP643145.1,INSD:ES152339.1,
FT                   INSD:BP583745.1,INSD:DR332415.1,INSD:ES149884.1,
FT                   INSD:EH934583.1,INSD:EH828305.1,INSD:ES158470.1,
FT                   INSD:BP800780.2,INSD:DR375751.1,INSD:EL277672.1,
FT                   INSD:BP815522.1,INSD:BP648139.1,INSD:BP636772.1,
FT                   INSD:BP817540.1,INSD:DR332398.1,INSD:ES009414.1,
FT                   INSD:ES168607.1,INSD:BP640751.1,INSD:DR332399.1,
FT                   INSD:BP599673.1,INSD:EH974719.1,INSD:EL044639.1,
FT                   INSD:DR332423.1,INSD:BP606615.1,INSD:DR332418.1,
FT                   INSD:BP828960.1,INSD:BP580835.1,INSD:BP651080.1,
FT                   INSD:BP835163.2,INSD:DR332459.1,INSD:ES146006.1,
FT                   INSD:ES205814.1,INSD:AV533575.1,INSD:BP837474.2,
FT                   INSD:EG420487.1,INSD:BP841801.1,INSD:DR332443.1,
FT                   INSD:EL226857.1,INSD:DR332448.1,INSD:EL213574.1,
FT                   INSD:BP631532.1,INSD:DR332445.1,INSD:BP602403.1,
FT                   INSD:BP644558.1,INSD:AV787514.1,INSD:BP642135.1,
FT                   INSD:ES159220.1,INSD:AV820221.1,INSD:BP839457.1,
FT                   INSD:ES211984.1,INSD:DR332453.1,INSD:BP827082.1,
FT                   INSD:EL059183.1,INSD:BP591111.1,INSD:DR332407.1,
FT                   INSD:DR332395.1,INSD:BP582511.1,INSD:DR332393.1,
FT                   INSD:DR332411.1,INSD:BP847119.1,INSD:EH942019.1,
FT                   INSD:DR332408.1,INSD:AV820583.1,INSD:BP649623.1,
FT                   INSD:DR332422.1,INSD:DR332450.1,INSD:EL305603.1,
FT                   INSD:BE662857.1,INSD:EL156366.1,INSD:EL304328.1,
FT                   INSD:DR332419.1,INSD:EL313131.1,INSD:EL140417.1,
FT                   INSD:AV788767.1,INSD:BP642528.1,INSD:DR332405.1,
FT                   INSD:ES184700.1,INSD:DR332424.1,INSD:DR332394.1,
FT                   INSD:BP628121.1,INSD:BP634140.1,INSD:EH804371.1,
FT                   INSD:ES000768.1,INSD:EL317298.1,INSD:EH942706.1,
FT                   INSD:ES178984.1,INSD:EL175592.1,INSD:DR332434.1,
FT                   INSD:EH857046.1,INSD:EH834735.1,INSD:EL327851.1,
FT                   INSD:ES086585.1,INSD:BP590880.1,INSD:BP656141.1,
FT                   INSD:EL103574.1,INSD:BP582837.1,INSD:ES104500.1,
FT                   INSD:EL202091.1,INSD:BP657674.1,INSD:AV532041.1,
FT                   INSD:CF652211.1,INSD:ES175177.1,INSD:DR332409.1,
FT                   INSD:AV797560.1,INSD:DR332412.1,INSD:DR332433.1,
FT                   INSD:DR332396.1,INSD:BP597404.1,INSD:DR332404.1,
FT                   INSD:EL149718.1,INSD:ES184586.1,INSD:BP648905.1,
FT                   INSD:DR332451.1,INSD:EL047440.1,INSD:BP814431.1,
FT                   INSD:EH904571.1,INSD:DR332455.1,INSD:EL211548.1,
FT                   INSD:ES167786.1,INSD:BP671329.1,INSD:ES052951.1,
FT                   INSD:ES083842.1,INSD:ES101434.1,INSD:BP560717.1,
FT                   INSD:BP821392.1,INSD:EH872870.1,INSD:BP831326.1,
FT                   INSD:DR332403.1,INSD:DR332457.1,INSD:ES015297.1,
FT                   INSD:EL293924.1,INSD:ES095910.1,INSD:BP637686.1,
FT                   INSD:EL319799.1,INSD:ES060621.1,INSD:EL140466.1,
FT                   INSD:EH907140.1,INSD:BP638557.1,INSD:EH966149.1,
FT                   INSD:DR332430.1,INSD:ES094285.1,INSD:DR332447.1,
FT                   INSD:BP656309.1,INSD:EH825486.1,INSD:DR332458.1,
FT                   INSD:BP641474.1,INSD:EH981413.1,INSD:EH961213.1,
FT                   INSD:BP841375.1,INSD:ES172439.1,INSD:DR374330.1,
FT                   INSD:DR332401.1,INSD:EL214903.1,INSD:CD532060.1,
FT                   INSD:BP641531.1,INSD:ES072466.1,INSD:BP577926.1,
FT                   INSD:EH828225.1,INSD:EL064439.1,INSD:DR332410.1,
FT                   INSD:DR332435.1,INSD:EG420475.1,INSD:EH830573.1,
FT                   INSD:EL106545.1,INSD:DR332436.1,INSD:ES047820.1,
FT                   INSD:EL008513.1,INSD:AV827219.2,INSD:ES206899.1,
FT                   INSD:BP650516.1,INSD:EL027798.1,INSD:EH985253.1,
FT                   INSD:DR332427.1,INSD:DR332454.1,INSD:AA728671.1,
FT                   INSD:BP841437.1,INSD:EH883350.1,INSD:DR332421.1,
FT                   INSD:DR332420.1,INSD:ES084480.1,INSD:EH841814.1,
FT                   INSD:BP839157.1,INSD:ES159090.1,INSD:ES001726.1,
FT                   INSD:BP581274.1,INSD:BP658733.1,INSD:BP823129.1,
FT                   INSD:BP826774.1,INSD:BP618264.1,INSD:EL324495.1,
FT                   INSD:EL291111.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF361624.1,INSD:AY055096.1"
FT   mRNA            complement(join(345952..346232,346325..346540,
FT                   346886..346962,347169..347293))
FT                   /gene_synonym="A_TM018A10.9"
FT                   /gene_synonym="A_TM018A10_9"
FT                   /gene_synonym="T18A10.8"
FT                   /gene_synonym="T18A10_8"
FT                   /locus_tag="AT4G00810"
FT                   /product="60S acidic ribosomal protein family"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL313131.1,INSD:EL140417.1,INSD:BP642528.1,
FT                   INSD:AV788767.1,INSD:DR200502.1,INSD:DR200494.1,
FT                   INSD:ES184700.1,INSD:EH951224.1,INSD:BP634140.1,
FT                   INSD:BP628121.1,INSD:EH804371.1,INSD:EL289584.1,
FT                   INSD:BP654111.1,INSD:EL152215.1,INSD:EL982643.1,
FT                   INSD:ES079751.1,INSD:DR200497.1,INSD:EH942706.1,
FT                   INSD:ES178984.1,INSD:EL175592.1,INSD:EH857046.1,
FT                   INSD:BP637763.1,INSD:BP649786.1,INSD:EH834735.1,
FT                   INSD:ES038161.1,INSD:ES118525.1,INSD:AV787661.1,
FT                   INSD:EH808334.1,INSD:ES086585.1,INSD:BP590880.1,
FT                   INSD:BP656141.1,INSD:EL103574.1,INSD:BP582837.1,
FT                   INSD:ES104500.1,INSD:BP657674.1,INSD:EL202091.1,
FT                   INSD:AV532041.1,INSD:ES073730.1,INSD:BP619526.1,
FT                   INSD:CF652211.1,INSD:CK118948.1,INSD:ES175177.1,
FT                   INSD:BP630041.1,INSD:AV797560.1,INSD:EL056866.1,
FT                   INSD:BP651912.1,INSD:EL981729.1,INSD:BP597404.1,
FT                   INSD:EL109532.1,INSD:ES184586.1,INSD:BP648905.1,
FT                   INSD:AV534095.1,INSD:ES006086.1,INSD:EL047440.1,
FT                   INSD:EH904571.1,INSD:EL286312.1,INSD:ES132030.1,
FT                   INSD:DR200499.1,INSD:EL211548.1,INSD:BP653503.1,
FT                   INSD:EH852574.1,INSD:DR332437.1,INSD:EL052578.1,
FT                   INSD:BP643145.1,INSD:ES167786.1,INSD:BP671329.1,
FT                   INSD:ES052951.1,INSD:ES083842.1,INSD:DR200504.1,
FT                   INSD:ES101434.1,INSD:BP583745.1,INSD:EH872870.1,
FT                   INSD:DR200503.1,INSD:ES149884.1,INSD:EH934583.1,
FT                   INSD:EH828305.1,INSD:ES158470.1,INSD:DR375751.1,
FT                   INSD:EL293924.1,INSD:ES015297.1,INSD:EL277672.1,
FT                   INSD:BP648139.1,INSD:BP637686.1,INSD:EL319799.1,
FT                   INSD:ES060621.1,INSD:BP636772.1,INSD:EL140466.1,
FT                   INSD:ES168607.1,INSD:DR200500.1,INSD:EH907140.1,
FT                   INSD:BP638557.1,INSD:BP796782.2,INSD:CB254964.1,
FT                   INSD:BP640751.1,INSD:BP599673.1,INSD:EH974719.1,
FT                   INSD:ES094285.1,INSD:DR374091.1,INSD:BP656309.1,
FT                   INSD:EH825486.1,INSD:BP606615.1,INSD:BP641474.1,
FT                   INSD:EH961213.1,INSD:BP580835.1,INSD:BP651080.1,
FT                   INSD:EL214903.1,INSD:CD532060.1,INSD:ES205814.1,
FT                   INSD:ES146006.1,INSD:DR200498.1,INSD:AV533575.1,
FT                   INSD:BP641531.1,INSD:DR200496.1,INSD:ES072466.1,
FT                   INSD:BP577926.1,INSD:EL064439.1,INSD:EL226857.1,
FT                   INSD:EL106545.1,INSD:BP631532.1,INSD:BP644558.1,
FT                   INSD:BP602403.1,INSD:AV787514.1,INSD:DR200506.1,
FT                   INSD:BP642135.1,INSD:ES206899.1,INSD:ES159220.1,
FT                   INSD:AV820221.1,INSD:BP650516.1,INSD:EL027798.1,
FT                   INSD:EH985253.1,INSD:ES132079.1,INSD:DR200495.1,
FT                   INSD:CB254300.1,INSD:BP591111.1,INSD:EL059183.1,
FT                   INSD:AA728671.1,INSD:EH883350.1,INSD:DR332421.1,
FT                   INSD:ES084480.1,INSD:BP582511.1,INSD:EH841814.1,
FT                   INSD:DR200493.1,INSD:BP649623.1,INSD:AV820583.1,
FT                   INSD:ES159090.1,INSD:ES001726.1,INSD:BP658733.1,
FT                   INSD:BE662857.1,INSD:BP581274.1,INSD:DR200501.1,
FT                   INSD:DR200505.1,INSD:BP618264.1,INSD:EL291111.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY086636.1,INSD:AY055096.1"
FT   CDS_pept        complement(join(346179..346232,346325..346540,
FT                   346886..346957))
FT                   /codon_start=1
FT                   /gene_synonym="A_TM018A10.9"
FT                   /gene_synonym="A_TM018A10_9"
FT                   /gene_synonym="T18A10.8"
FT                   /gene_synonym="T18A10_8"
FT                   /locus_tag="AT4G00810"
FT                   /product="60S acidic ribosomal protein family"
FT                   /note="60S acidic ribosomal protein family; FUNCTIONS IN:
FT                   structural constituent of ribosome; INVOLVED IN:
FT                   translational elongation; LOCATED IN: cytosol, cytosolic
FT                   ribosome, ribosome, nucleus; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Ribosomal protein 60S
FT                   (InterPro:IPR001813); BEST Arabidopsis thaliana protein
FT                   match is: 60S acidic ribosomal protein family
FT                   (TAIR:AT5G47700.2); Has 2192 Blast hits to 2192 proteins in
FT                   389 species: Archae - 91; Bacteria - 0; Metazoa - 852;
FT                   Fungi - 488; Plants - 457; Viruses - 0; Other Eukaryotes -
FT                   304 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00810"
FT                   /db_xref="GOA:O23095"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23095"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL313131.1,INSD:EL140417.1,INSD:BP642528.1,
FT                   INSD:AV788767.1,INSD:DR200502.1,INSD:DR200494.1,
FT                   INSD:ES184700.1,INSD:EH951224.1,INSD:BP634140.1,
FT                   INSD:BP628121.1,INSD:EH804371.1,INSD:EL289584.1,
FT                   INSD:BP654111.1,INSD:EL152215.1,INSD:EL982643.1,
FT                   INSD:ES079751.1,INSD:DR200497.1,INSD:EH942706.1,
FT                   INSD:ES178984.1,INSD:EL175592.1,INSD:EH857046.1,
FT                   INSD:BP637763.1,INSD:BP649786.1,INSD:EH834735.1,
FT                   INSD:ES038161.1,INSD:ES118525.1,INSD:AV787661.1,
FT                   INSD:EH808334.1,INSD:ES086585.1,INSD:BP590880.1,
FT                   INSD:BP656141.1,INSD:EL103574.1,INSD:BP582837.1,
FT                   INSD:ES104500.1,INSD:BP657674.1,INSD:EL202091.1,
FT                   INSD:AV532041.1,INSD:ES073730.1,INSD:BP619526.1,
FT                   INSD:CF652211.1,INSD:CK118948.1,INSD:ES175177.1,
FT                   INSD:BP630041.1,INSD:AV797560.1,INSD:EL056866.1,
FT                   INSD:BP651912.1,INSD:EL981729.1,INSD:BP597404.1,
FT                   INSD:EL109532.1,INSD:ES184586.1,INSD:BP648905.1,
FT                   INSD:AV534095.1,INSD:ES006086.1,INSD:EL047440.1,
FT                   INSD:EH904571.1,INSD:EL286312.1,INSD:ES132030.1,
FT                   INSD:DR200499.1,INSD:EL211548.1,INSD:BP653503.1,
FT                   INSD:EH852574.1,INSD:DR332437.1,INSD:EL052578.1,
FT                   INSD:BP643145.1,INSD:ES167786.1,INSD:BP671329.1,
FT                   INSD:ES052951.1,INSD:ES083842.1,INSD:DR200504.1,
FT                   INSD:ES101434.1,INSD:BP583745.1,INSD:EH872870.1,
FT                   INSD:DR200503.1,INSD:ES149884.1,INSD:EH934583.1,
FT                   INSD:EH828305.1,INSD:ES158470.1,INSD:DR375751.1,
FT                   INSD:EL293924.1,INSD:ES015297.1,INSD:EL277672.1,
FT                   INSD:BP648139.1,INSD:BP637686.1,INSD:EL319799.1,
FT                   INSD:ES060621.1,INSD:BP636772.1,INSD:EL140466.1,
FT                   INSD:ES168607.1,INSD:DR200500.1,INSD:EH907140.1,
FT                   INSD:BP638557.1,INSD:BP796782.2,INSD:CB254964.1,
FT                   INSD:BP640751.1,INSD:BP599673.1,INSD:EH974719.1,
FT                   INSD:ES094285.1,INSD:DR374091.1,INSD:BP656309.1,
FT                   INSD:EH825486.1,INSD:BP606615.1,INSD:BP641474.1,
FT                   INSD:EH961213.1,INSD:BP580835.1,INSD:BP651080.1,
FT                   INSD:EL214903.1,INSD:CD532060.1,INSD:ES205814.1,
FT                   INSD:ES146006.1,INSD:DR200498.1,INSD:AV533575.1,
FT                   INSD:BP641531.1,INSD:DR200496.1,INSD:ES072466.1,
FT                   INSD:BP577926.1,INSD:EL064439.1,INSD:EL226857.1,
FT                   INSD:EL106545.1,INSD:BP631532.1,INSD:BP644558.1,
FT                   INSD:BP602403.1,INSD:AV787514.1,INSD:DR200506.1,
FT                   INSD:BP642135.1,INSD:ES206899.1,INSD:ES159220.1,
FT                   INSD:AV820221.1,INSD:BP650516.1,INSD:EL027798.1,
FT                   INSD:EH985253.1,INSD:ES132079.1,INSD:DR200495.1,
FT                   INSD:CB254300.1,INSD:BP591111.1,INSD:EL059183.1,
FT                   INSD:AA728671.1,INSD:EH883350.1,INSD:DR332421.1,
FT                   INSD:ES084480.1,INSD:BP582511.1,INSD:EH841814.1,
FT                   INSD:DR200493.1,INSD:BP649623.1,INSD:AV820583.1,
FT                   INSD:ES159090.1,INSD:ES001726.1,INSD:BP658733.1,
FT                   INSD:BE662857.1,INSD:BP581274.1,INSD:DR200501.1,
FT                   INSD:DR200505.1,INSD:BP618264.1,INSD:EL291111.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY086636.1,INSD:AY055096.1"
FT                   /protein_id="AEE81937.1"
FT                   /translation="MSTVGELACSYAVMILEDEGIAITSDKIATLVKAAGVEIESYWPM
FT                   LFAKMAEKRNVTDLIMNVGAGGGGGGAPVSAAAPAAAGGAAAAAPAKEEKKDEPAEESD
FT                   GDLGFGLFD"
FT   CDS_pept        complement(join(346179..346232,346325..346540,
FT                   346886..346957))
FT                   /codon_start=1
FT                   /gene_synonym="A_TM018A10.9"
FT                   /gene_synonym="A_TM018A10_9"
FT                   /gene_synonym="T18A10.8"
FT                   /gene_synonym="T18A10_8"
FT                   /locus_tag="AT4G00810"
FT                   /product="60S acidic ribosomal protein family"
FT                   /note="60S acidic ribosomal protein family; FUNCTIONS IN:
FT                   structural constituent of ribosome; INVOLVED IN:
FT                   translational elongation; LOCATED IN: cytosol, cytosolic
FT                   ribosome, ribosome, nucleus; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Ribosomal protein 60S
FT                   (InterPro:IPR001813); BEST Arabidopsis thaliana protein
FT                   match is: 60S acidic ribosomal protein family
FT                   (TAIR:AT5G47700.2); Has 2191 Blast hits to 2191 proteins in
FT                   389 species: Archae - 90; Bacteria - 0; Metazoa - 852;
FT                   Fungi - 488; Plants - 457; Viruses - 0; Other Eukaryotes -
FT                   304 (source: NCBI BLink)."
FT                   /db_xref="GOA:O23095"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23095"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR332456.1,INSD:DR332413.1,INSD:BP819264.1,
FT                   INSD:DR332432.1,INSD:DR332426.1,INSD:EH951224.1,
FT                   INSD:EL123905.1,INSD:EL289584.1,INSD:BP654111.1,
FT                   INSD:DR332438.1,INSD:EL152215.1,INSD:EL982643.1,
FT                   INSD:DR332416.1,INSD:ES079751.1,INSD:DR332425.1,
FT                   INSD:DR332440.1,INSD:BP637763.1,INSD:EL002699.1,
FT                   INSD:BP649786.1,INSD:ES038161.1,INSD:ES202918.1,
FT                   INSD:AV787661.1,INSD:DR332428.1,INSD:AV522332.1,
FT                   INSD:EH808334.1,INSD:EH916352.1,INSD:BP840399.1,
FT                   INSD:DR332441.1,INSD:BP797530.1,INSD:BP822939.1,
FT                   INSD:ES073730.1,INSD:BP619526.1,INSD:DR332406.1,
FT                   INSD:EL077109.1,INSD:CK118948.1,INSD:DR332417.1,
FT                   INSD:ES009177.1,INSD:BP630041.1,INSD:EL056866.1,
FT                   INSD:BP862553.1,INSD:BP651912.1,INSD:EL981729.1,
FT                   INSD:DR332439.1,INSD:EL030029.1,INSD:EL109532.1,
FT                   INSD:DR332446.1,INSD:AV534095.1,INSD:ES006086.1,
FT                   INSD:ES194815.1,INSD:EL286312.1,INSD:ES132030.1,
FT                   INSD:DR332397.1,INSD:BP653503.1,INSD:DR332431.1,
FT                   INSD:EH852574.1,INSD:DR332437.1,INSD:EL052578.1,
FT                   INSD:BP797271.1,INSD:BP643145.1,INSD:ES152339.1,
FT                   INSD:BP583745.1,INSD:DR332415.1,INSD:ES149884.1,
FT                   INSD:EH934583.1,INSD:EH828305.1,INSD:ES158470.1,
FT                   INSD:BP800780.2,INSD:DR375751.1,INSD:EL277672.1,
FT                   INSD:BP815522.1,INSD:BP648139.1,INSD:BP636772.1,
FT                   INSD:BP817540.1,INSD:DR332398.1,INSD:ES009414.1,
FT                   INSD:ES168607.1,INSD:BP640751.1,INSD:DR332399.1,
FT                   INSD:BP599673.1,INSD:EH974719.1,INSD:EL044639.1,
FT                   INSD:DR332423.1,INSD:BP606615.1,INSD:DR332418.1,
FT                   INSD:BP828960.1,INSD:BP580835.1,INSD:BP651080.1,
FT                   INSD:BP835163.2,INSD:DR332459.1,INSD:ES146006.1,
FT                   INSD:ES205814.1,INSD:AV533575.1,INSD:BP837474.2,
FT                   INSD:EG420487.1,INSD:BP841801.1,INSD:DR332443.1,
FT                   INSD:EL226857.1,INSD:DR332448.1,INSD:EL213574.1,
FT                   INSD:BP631532.1,INSD:DR332445.1,INSD:BP602403.1,
FT                   INSD:BP644558.1,INSD:AV787514.1,INSD:BP642135.1,
FT                   INSD:ES159220.1,INSD:AV820221.1,INSD:BP839457.1,
FT                   INSD:ES211984.1,INSD:DR332453.1,INSD:BP827082.1,
FT                   INSD:EL059183.1,INSD:BP591111.1,INSD:DR332407.1,
FT                   INSD:DR332395.1,INSD:BP582511.1,INSD:DR332393.1,
FT                   INSD:DR332411.1,INSD:BP847119.1,INSD:EH942019.1,
FT                   INSD:DR332408.1,INSD:AV820583.1,INSD:BP649623.1,
FT                   INSD:DR332422.1,INSD:DR332450.1,INSD:EL305603.1,
FT                   INSD:BE662857.1,INSD:EL156366.1,INSD:EL304328.1,
FT                   INSD:DR332419.1,INSD:EL313131.1,INSD:EL140417.1,
FT                   INSD:AV788767.1,INSD:BP642528.1,INSD:DR332405.1,
FT                   INSD:ES184700.1,INSD:DR332424.1,INSD:DR332394.1,
FT                   INSD:BP628121.1,INSD:BP634140.1,INSD:EH804371.1,
FT                   INSD:ES000768.1,INSD:EL317298.1,INSD:EH942706.1,
FT                   INSD:ES178984.1,INSD:EL175592.1,INSD:DR332434.1,
FT                   INSD:EH857046.1,INSD:EH834735.1,INSD:EL327851.1,
FT                   INSD:ES086585.1,INSD:BP590880.1,INSD:BP656141.1,
FT                   INSD:EL103574.1,INSD:BP582837.1,INSD:ES104500.1,
FT                   INSD:EL202091.1,INSD:BP657674.1,INSD:AV532041.1,
FT                   INSD:CF652211.1,INSD:ES175177.1,INSD:DR332409.1,
FT                   INSD:AV797560.1,INSD:DR332412.1,INSD:DR332433.1,
FT                   INSD:DR332396.1,INSD:BP597404.1,INSD:DR332404.1,
FT                   INSD:EL149718.1,INSD:ES184586.1,INSD:BP648905.1,
FT                   INSD:DR332451.1,INSD:EL047440.1,INSD:BP814431.1,
FT                   INSD:EH904571.1,INSD:DR332455.1,INSD:EL211548.1,
FT                   INSD:ES167786.1,INSD:BP671329.1,INSD:ES052951.1,
FT                   INSD:ES083842.1,INSD:ES101434.1,INSD:BP560717.1,
FT                   INSD:BP821392.1,INSD:EH872870.1,INSD:BP831326.1,
FT                   INSD:DR332403.1,INSD:DR332457.1,INSD:ES015297.1,
FT                   INSD:EL293924.1,INSD:ES095910.1,INSD:BP637686.1,
FT                   INSD:EL319799.1,INSD:ES060621.1,INSD:EL140466.1,
FT                   INSD:EH907140.1,INSD:BP638557.1,INSD:EH966149.1,
FT                   INSD:DR332430.1,INSD:ES094285.1,INSD:DR332447.1,
FT                   INSD:BP656309.1,INSD:EH825486.1,INSD:DR332458.1,
FT                   INSD:BP641474.1,INSD:EH981413.1,INSD:EH961213.1,
FT                   INSD:BP841375.1,INSD:ES172439.1,INSD:DR374330.1,
FT                   INSD:DR332401.1,INSD:EL214903.1,INSD:CD532060.1,
FT                   INSD:BP641531.1,INSD:ES072466.1,INSD:BP577926.1,
FT                   INSD:EH828225.1,INSD:EL064439.1,INSD:DR332410.1,
FT                   INSD:DR332435.1,INSD:EG420475.1,INSD:EH830573.1,
FT                   INSD:EL106545.1,INSD:DR332436.1,INSD:ES047820.1,
FT                   INSD:EL008513.1,INSD:AV827219.2,INSD:ES206899.1,
FT                   INSD:BP650516.1,INSD:EL027798.1,INSD:EH985253.1,
FT                   INSD:DR332427.1,INSD:DR332454.1,INSD:AA728671.1,
FT                   INSD:BP841437.1,INSD:EH883350.1,INSD:DR332421.1,
FT                   INSD:DR332420.1,INSD:ES084480.1,INSD:EH841814.1,
FT                   INSD:BP839157.1,INSD:ES159090.1,INSD:ES001726.1,
FT                   INSD:BP581274.1,INSD:BP658733.1,INSD:BP823129.1,
FT                   INSD:BP826774.1,INSD:BP618264.1,INSD:EL324495.1,
FT                   INSD:EL291111.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF361624.1,INSD:AY055096.1"
FT                   /protein_id="AEE81938.1"
FT                   /translation="MSTVGELACSYAVMILEDEGIAITSDKIATLVKAAGVEIESYWPM
FT                   LFAKMAEKRNVTDLIMNVGAGGGGGGAPVSAAAPAAAGGAAAAAPAKEEKKDEPAEESD
FT                   GDLGFGLFD"
FT   gene            349025..351550
FT                   /gene="iqd17"
FT                   /gene_synonym="A_TM018A10.13"
FT                   /gene_synonym="A_TM018A10_13"
FT                   /gene_synonym="IQ-domain 17"
FT                   /gene_synonym="T18A10.11"
FT                   /gene_synonym="T18A10_11"
FT                   /locus_tag="AT4G00820"
FT   mRNA            join(349025..349425,349548..349859,349938..350183,
FT                   350308..350451,350531..351550)
FT                   /gene="iqd17"
FT                   /gene_synonym="A_TM018A10.13"
FT                   /gene_synonym="A_TM018A10_13"
FT                   /gene_synonym="IQ-domain 17"
FT                   /gene_synonym="T18A10.11"
FT                   /gene_synonym="T18A10_11"
FT                   /locus_tag="AT4G00820"
FT                   /product="IQ-domain 17"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV535611.1,INSD:BP619162.1,INSD:EL226171.1,
FT                   INSD:AV555515.1,INSD:ES147377.1,INSD:BX834735.1,
FT                   INSD:EL117089.1,INSD:BX837601.1,INSD:ES017509.1,
FT                   INSD:BP609198.1,INSD:ES003426.1,INSD:AV550999.1,
FT                   INSD:ES145896.1,INSD:ES105016.1,INSD:EL157082.1,
FT                   INSD:AV555048.1,INSD:BP617490.1,INSD:BX837875.1,
FT                   INSD:BP608547.1,INSD:BP611481.1,INSD:ES002641.1,
FT                   INSD:AU237438.1,INSD:AV564029.1,INSD:EH818810.1,
FT                   INSD:AU228505.1,INSD:EL982268.1,INSD:AV554032.1,
FT                   INSD:ES215070.1,INSD:ES152741.1,INSD:BX834494.1,
FT                   INSD:EH913466.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX826435.1,INSD:AK228943.1"
FT   CDS_pept        join(349300..349425,349548..349859,349938..350183,
FT                   350308..350451,350531..351307)
FT                   /codon_start=1
FT                   /gene="iqd17"
FT                   /gene_synonym="A_TM018A10.13"
FT                   /gene_synonym="A_TM018A10_13"
FT                   /gene_synonym="IQ-domain 17"
FT                   /gene_synonym="T18A10.11"
FT                   /gene_synonym="T18A10_11"
FT                   /locus_tag="AT4G00820"
FT                   /product="IQ-domain 17"
FT                   /note="IQ-domain 17 (iqd17); CONTAINS InterPro DOMAIN/s: IQ
FT                   calmodulin-binding region (InterPro:IPR000048); BEST
FT                   Arabidopsis thaliana protein match is: IQ-domain 18
FT                   (TAIR:AT1G01110.2); Has 1332 Blast hits to 1131 proteins in
FT                   120 species: Archae - 0; Bacteria - 14; Metazoa - 172;
FT                   Fungi - 58; Plants - 857; Viruses - 43; Other Eukaryotes -
FT                   188 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00820"
FT                   /db_xref="GOA:F4JHN2"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR025064"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHN2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV535611.1,INSD:BP619162.1,INSD:EL226171.1,
FT                   INSD:AV555515.1,INSD:ES147377.1,INSD:BX834735.1,
FT                   INSD:EL117089.1,INSD:BX837601.1,INSD:ES017509.1,
FT                   INSD:BP609198.1,INSD:ES003426.1,INSD:AV550999.1,
FT                   INSD:ES145896.1,INSD:ES105016.1,INSD:EL157082.1,
FT                   INSD:AV555048.1,INSD:BP617490.1,INSD:BX837875.1,
FT                   INSD:BP608547.1,INSD:BP611481.1,INSD:ES002641.1,
FT                   INSD:AU237438.1,INSD:AV564029.1,INSD:EH818810.1,
FT                   INSD:AU228505.1,INSD:EL982268.1,INSD:AV554032.1,
FT                   INSD:ES215070.1,INSD:ES152741.1,INSD:BX834494.1,
FT                   INSD:EH913466.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX826435.1,INSD:AK228943.1"
FT                   /protein_id="AEE81939.1"
FT                   /translation="MGKKSGSSSSWLTAVKRAFRSPTKKEHNNNAHGNEVDEDEDKKKE
FT                   KRRWLFRKSTNHDSPVKTSGVGKDAPAQKSTETTTIINPTVLSSVTEQRYDASTPPATV
FT                   SAASETHPPSTTKELPNLTRRTYTAREDYAAVVIQTGFRGYLARRALRALKGLVKLQAL
FT                   VRGHNVRKQAKMTLRCMQALVRVQSRVLDQRKRLSHDGSRKSAFSDTQSVLESRYLQEI
FT                   SDRRSMSREGSSIAEDWDDRPHTIEEVKAMLQQRRDNALRRESNNSISQAFSHQVRRTR
FT                   GSYSTGDEYEEERPKWLDRWMASKPWDKRASTDQRVPPVYKTVEIDTSQPYLTRGNSRT
FT                   GASPSRSQRPSSPSRTSHHYQQHNFSSATPSPAKSRPIQIRSASPRIQRDDRSAYNYTS
FT                   NTPSLRSNYSFTARSGYSVCTTTTTATNAALPNYMAITESAKARIRSQSAPRQRPSTPE
FT                   KERISSARKRLSFPVPPLPQQMDGQSLRSPSFKSIGGSQLGALEQQSNYSSCCTESLGG
FT                   GGEISPASTSDYRRWLR"
FT   gene            351969..355248
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /locus_tag="AT4G00830"
FT   mRNA            join(351969..352196,352782..353213,353301..353417,
FT                   353518..353658,353738..353917,354016..354217,
FT                   354356..354537,354635..354720,354818..355248)
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT   mRNA            join(351973..352379,352782..353213,353301..353417,
FT                   353518..353658,353738..353917,354016..354217,
FT                   354356..354537,354635..354720,354818..355235)
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES122551.1,INSD:EL116580.1,INSD:CK121166.1,
FT                   INSD:EG444204.1,INSD:BP580957.1,INSD:ES036279.1,
FT                   INSD:BP665027.1,INSD:EG421526.1,INSD:AV827082.1,
FT                   INSD:BP660873.1,INSD:BE038302.1,INSD:EH798773.1,
FT                   INSD:BP859537.1,INSD:AV792730.1,INSD:BP792198.1,
FT                   INSD:EG455568.1,INSD:EL254448.1,INSD:EH833259.1,
FT                   INSD:EL247883.1,INSD:EL198854.1,INSD:BP786446.1,
FT                   INSD:EG455567.1,INSD:ES139201.1,INSD:ES136095.1,
FT                   INSD:BP784848.1,INSD:EL058195.1,INSD:ES121389.1,
FT                   INSD:EH817526.1,INSD:ES051613.1,INSD:EL088489.1,
FT                   INSD:BE526658.1,INSD:BP621777.1,INSD:BP584872.1,
FT                   INSD:EH909436.1,INSD:W43801.1,INSD:EL223471.1,
FT                   INSD:ES136835.1,INSD:T46180.1,INSD:ES020452.1,
FT                   INSD:AI997398.1,INSD:BP607230.1,INSD:BP785000.1,
FT                   INSD:BP583239.1,INSD:AV538227.1,INSD:ES035481.1,
FT                   INSD:EG459743.1,INSD:ES107889.1,INSD:ES106100.1,
FT                   INSD:BP791477.1,INSD:ES178472.1,INSD:EG445133.1,
FT                   INSD:EG519019.1,INSD:EL979017.1,INSD:EG430511.1,
FT                   INSD:EL129806.1,INSD:CK117838.1,INSD:DR356090.1,
FT                   INSD:AA586258.1,INSD:ES024221.1,INSD:EL106186.1,
FT                   INSD:ES059621.1,INSD:DR382891.1,INSD:ES093234.1,
FT                   INSD:ES140291.1,INSD:DR356089.1,INSD:EH962809.1,
FT                   INSD:EG430480.1,INSD:EG421527.1,INSD:DR356350.1,
FT                   INSD:EH837679.1,INSD:BP667793.1,INSD:ES059519.1,
FT                   INSD:BP862247.1,INSD:ES179105.1,INSD:EG519017.1,
FT                   INSD:AV550426.1,INSD:EL159860.1,INSD:CK119405.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY113171.1,INSD:BX841533.1,INSD:BX826993.1,
FT                   INSD:BX827625.1,INSD:AF367357.1"
FT   mRNA            join(351974..352379,352782..353213,353301..353453,
FT                   353554..353658,353738..353917,354016..354217,
FT                   354356..354537,354635..354720,354818..355230)
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT   mRNA            join(351974..352196,352782..353213,353301..353417,
FT                   353518..353634,353738..353917,354016..354217,
FT                   354356..354537,354635..354720,354818..355230)
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES122551.1,INSD:EL116580.1,INSD:CK121166.1,
FT                   INSD:EG444204.1,INSD:BP580957.1,INSD:ES036279.1,
FT                   INSD:BP665027.1,INSD:EG421526.1,INSD:BP660873.1,
FT                   INSD:EH798773.1,INSD:AV792730.1,INSD:BP792198.1,
FT                   INSD:EG455568.1,INSD:EL254448.1,INSD:EH833259.1,
FT                   INSD:EL247883.1,INSD:EL198854.1,INSD:BP786446.1,
FT                   INSD:EG455567.1,INSD:ES139201.1,INSD:ES136095.1,
FT                   INSD:BP784848.1,INSD:EL058195.1,INSD:ES121389.1,
FT                   INSD:EH817526.1,INSD:ES051613.1,INSD:EL088489.1,
FT                   INSD:BE526658.1,INSD:BP621777.1,INSD:BP584872.1,
FT                   INSD:EH909436.1,INSD:EL223471.1,INSD:ES136835.1,
FT                   INSD:T46180.1,INSD:ES020452.1,INSD:AI997398.1,
FT                   INSD:BP607230.1,INSD:BP562701.1,INSD:BP785000.1,
FT                   INSD:BP583239.1,INSD:AV538227.1,INSD:ES035481.1,
FT                   INSD:EG459743.1,INSD:ES107889.1,INSD:ES106100.1,
FT                   INSD:BP791477.1,INSD:ES178472.1,INSD:EG445133.1,
FT                   INSD:EL979017.1,INSD:EG430511.1,INSD:EL129806.1,
FT                   INSD:CK117838.1,INSD:AA586258.1,INSD:ES024221.1,
FT                   INSD:EL106186.1,INSD:ES059621.1,INSD:DR382891.1,
FT                   INSD:ES165477.1,INSD:ES093234.1,INSD:ES140291.1,
FT                   INSD:EH962809.1,INSD:EG430480.1,INSD:EG421527.1,
FT                   INSD:DR356350.1,INSD:EH837679.1,INSD:BP667793.1,
FT                   INSD:ES059519.1,INSD:BP862247.1,INSD:ES179105.1,
FT                   INSD:AV550426.1,INSD:EL159860.1,INSD:CK119405.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY113171.1,INSD:AK227578.1,INSD:BX826993.1,
FT                   INSD:BX827625.1"
FT   mRNA            join(352016..352407,352782..353213,353301..353417,
FT                   353518..353634,353738..353917,354016..354217,
FT                   354356..354537,354635..354720,354818..355230)
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT   mRNA            join(352752..353213,353301..353417,353518..353658,
FT                   353738..353917,354016..354217,354356..354537,
FT                   354635..354720,354818..355230)
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT   CDS_pept        join(352782..353213,353301..353453,353554..353658,
FT                   353738..353917,354016..354217,354356..354537,
FT                   354635..354720,354818..354965)
FT                   /codon_start=1
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /note="RNA-binding (RRM/RBD/RNP motifs) family protein;
FT                   FUNCTIONS IN: RNA binding, nucleotide binding, nucleic acid
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: RNA recognition motif, RNP-1
FT                   (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait
FT                   (InterPro:IPR012677); BEST Arabidopsis thaliana protein
FT                   match is: RNA-binding (RRM/RBD/RNP motifs) family protein
FT                   (TAIR:AT3G52660.2)."
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00830.4"
FT                   /db_xref="GOA:Q9ASP6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ASP6"
FT                   /protein_id="AEE81943.1"
FT                   /translation="MSDARDNDDRVDFEEGSYSEMEDEVEEEQVEEYEEEEEEDDDDDD
FT                   VGNQNAEEREVEDYGDTKGGDMEDVQEEIAEDDDNHIDIETADDDEKPPSPIDDEDREK
FT                   YSHLLSLPPHGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVA
FT                   FKTKDVAQKAIEELHSKEFKASSTANCSLSLSNRLFIGNIPKNWTEDEFRKVIEDVGPG
FT                   VENIELIKDPTNTTRNRGFAFVLYYNNACADYSRQKMIDSNFKLEGNAPTVTWADPKSS
FT                   PEHSAAAAQVKALYVKNIPENTSTEQLKELFQRHGEVTKIVTPPGKGGKRDFGFVHYAE
FT                   RSSALKAVKDTERYEVNGQPLEVVLAKPQAERKHDPSSYSYGAAPTPAPFVHPTFGGFA
FT                   AAPYGAMGAGLGIAGSFSQPMIYGRGAMPTGMQMVPMLLPDGRVGYVLQQPGMPMAAAP
FT                   PQRPRRNDRNNGSSGGSGRDNSHEHDGNRGGRRYRPY"
FT   CDS_pept        join(352782..353213,353301..353417,353518..353658,
FT                   353738..353917,354016..354217,354356..354537,
FT                   354635..354720,354818..354965)
FT                   /codon_start=1
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00830"
FT                   /db_xref="GOA:Q9ASP6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ASP6"
FT                   /protein_id="ANM66434.1"
FT                   /translation="MSDARDNDDRVDFEEGSYSEMEDEVEEEQVEEYEEEEEEDDDDDD
FT                   VGNQNAEEREVEDYGDTKGGDMEDVQEEIAEDDDNHIDIETADDDEKPPSPIDDEDREK
FT                   YSHLLSLPPHGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVA
FT                   FKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRLFIGNIPKNWTEDEFRKVIEDVGPG
FT                   VENIELIKDPTNTTRNRGFAFVLYYNNACADYSRQKMIDSNFKLEGNAPTVTWADPKSS
FT                   PEHSAAAAQVKALYVKNIPENTSTEQLKELFQRHGEVTKIVTPPGKGGKRDFGFVHYAE
FT                   RSSALKAVKDTERYEVNGQPLEVVLAKPQAERKHDPSSYSYGAAPTPAPFVHPTFGGFA
FT                   AAPYGAMGAGLGIAGSFSQPMIYGRGAMPTGMQMVPMLLPDGRVGYVLQQPGMPMAAAP
FT                   PQRPRRNDRNNGSSGGSGRDNSHEHDGNRGGRRYRPY"
FT   CDS_pept        join(352782..353213,353301..353417,353518..353658,
FT                   353738..353917,354016..354217,354356..354537,
FT                   354635..354720,354818..354965)
FT                   /codon_start=1
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /note="RNA-binding (RRM/RBD/RNP motifs) family protein;
FT                   FUNCTIONS IN: RNA binding, nucleotide binding, nucleic acid
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: RNA recognition motif, RNP-1
FT                   (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait
FT                   (InterPro:IPR012677); BEST Arabidopsis thaliana protein
FT                   match is: RNA-binding (RRM/RBD/RNP motifs) family protein
FT                   (TAIR:AT3G52660.2); Has 49171 Blast hits to 28860 proteins
FT                   in 1092 species: Archae - 87; Bacteria - 2901; Metazoa -
FT                   24152; Fungi - 5892; Plants - 6872; Viruses - 415; Other
FT                   Eukaryotes - 8852 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9ASP6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ASP6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES122551.1,INSD:EL116580.1,INSD:CK121166.1,
FT                   INSD:EG444204.1,INSD:BP580957.1,INSD:ES036279.1,
FT                   INSD:BP665027.1,INSD:EG421526.1,INSD:AV827082.1,
FT                   INSD:BP660873.1,INSD:BE038302.1,INSD:EH798773.1,
FT                   INSD:BP859537.1,INSD:AV792730.1,INSD:BP792198.1,
FT                   INSD:EG455568.1,INSD:EL254448.1,INSD:EH833259.1,
FT                   INSD:EL247883.1,INSD:EL198854.1,INSD:BP786446.1,
FT                   INSD:EG455567.1,INSD:ES139201.1,INSD:ES136095.1,
FT                   INSD:BP784848.1,INSD:EL058195.1,INSD:ES121389.1,
FT                   INSD:EH817526.1,INSD:ES051613.1,INSD:EL088489.1,
FT                   INSD:BE526658.1,INSD:BP621777.1,INSD:BP584872.1,
FT                   INSD:EH909436.1,INSD:W43801.1,INSD:EL223471.1,
FT                   INSD:ES136835.1,INSD:T46180.1,INSD:ES020452.1,
FT                   INSD:AI997398.1,INSD:BP607230.1,INSD:BP785000.1,
FT                   INSD:BP583239.1,INSD:AV538227.1,INSD:ES035481.1,
FT                   INSD:EG459743.1,INSD:ES107889.1,INSD:ES106100.1,
FT                   INSD:BP791477.1,INSD:ES178472.1,INSD:EG445133.1,
FT                   INSD:EG519019.1,INSD:EL979017.1,INSD:EG430511.1,
FT                   INSD:EL129806.1,INSD:CK117838.1,INSD:DR356090.1,
FT                   INSD:AA586258.1,INSD:ES024221.1,INSD:EL106186.1,
FT                   INSD:ES059621.1,INSD:DR382891.1,INSD:ES093234.1,
FT                   INSD:ES140291.1,INSD:DR356089.1,INSD:EH962809.1,
FT                   INSD:EG430480.1,INSD:EG421527.1,INSD:DR356350.1,
FT                   INSD:EH837679.1,INSD:BP667793.1,INSD:ES059519.1,
FT                   INSD:BP862247.1,INSD:ES179105.1,INSD:EG519017.1,
FT                   INSD:AV550426.1,INSD:EL159860.1,INSD:CK119405.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY113171.1,INSD:BX841533.1,INSD:BX826993.1,
FT                   INSD:BX827625.1,INSD:AF367357.1"
FT                   /protein_id="AEE81940.1"
FT                   /translation="MSDARDNDDRVDFEEGSYSEMEDEVEEEQVEEYEEEEEEDDDDDD
FT                   VGNQNAEEREVEDYGDTKGGDMEDVQEEIAEDDDNHIDIETADDDEKPPSPIDDEDREK
FT                   YSHLLSLPPHGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVA
FT                   FKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRLFIGNIPKNWTEDEFRKVIEDVGPG
FT                   VENIELIKDPTNTTRNRGFAFVLYYNNACADYSRQKMIDSNFKLEGNAPTVTWADPKSS
FT                   PEHSAAAAQVKALYVKNIPENTSTEQLKELFQRHGEVTKIVTPPGKGGKRDFGFVHYAE
FT                   RSSALKAVKDTERYEVNGQPLEVVLAKPQAERKHDPSSYSYGAAPTPAPFVHPTFGGFA
FT                   AAPYGAMGAGLGIAGSFSQPMIYGRGAMPTGMQMVPMLLPDGRVGYVLQQPGMPMAAAP
FT                   PQRPRRNDRNNGSSGGSGRDNSHEHDGNRGGRRYRPY"
FT   CDS_pept        join(352782..353213,353301..353417,353518..353658,
FT                   353738..353917,354016..354217,354356..354537,
FT                   354635..354720,354818..354965)
FT                   /codon_start=1
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /note="RNA-binding (RRM/RBD/RNP motifs) family protein;
FT                   FUNCTIONS IN: RNA binding, nucleotide binding, nucleic acid
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: RNA recognition motif, RNP-1
FT                   (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait
FT                   (InterPro:IPR012677); BEST Arabidopsis thaliana protein
FT                   match is: RNA-binding (RRM/RBD/RNP motifs) family protein
FT                   (TAIR:AT3G52660.2); Has 35333 Blast hits to 34131 proteins
FT                   in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
FT                   974; Fungi - 991; Plants - 531; Viruses - 0; Other
FT                   Eukaryotes - 9610 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9ASP6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ASP6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES122551.1,INSD:EL116580.1,INSD:CK121166.1,
FT                   INSD:EG444204.1,INSD:BP580957.1,INSD:ES036279.1,
FT                   INSD:BP665027.1,INSD:EG421526.1,INSD:BP660873.1,
FT                   INSD:EH798773.1,INSD:AV792730.1,INSD:BP792198.1,
FT                   INSD:EG455568.1,INSD:EL254448.1,INSD:EH833259.1,
FT                   INSD:EL247883.1,INSD:EL198854.1,INSD:BP786446.1,
FT                   INSD:EG455567.1,INSD:ES139201.1,INSD:ES136095.1,
FT                   INSD:BP784848.1,INSD:EL058195.1,INSD:ES121389.1,
FT                   INSD:EH817526.1,INSD:ES051613.1,INSD:EL088489.1,
FT                   INSD:BE526658.1,INSD:BP621777.1,INSD:BP584872.1,
FT                   INSD:EH909436.1,INSD:EL223471.1,INSD:ES136835.1,
FT                   INSD:T46180.1,INSD:ES020452.1,INSD:AI997398.1,
FT                   INSD:BP607230.1,INSD:BP562701.1,INSD:BP785000.1,
FT                   INSD:BP583239.1,INSD:AV538227.1,INSD:ES035481.1,
FT                   INSD:EG459743.1,INSD:ES107889.1,INSD:ES106100.1,
FT                   INSD:BP791477.1,INSD:ES178472.1,INSD:EG445133.1,
FT                   INSD:EL979017.1,INSD:EG430511.1,INSD:EL129806.1,
FT                   INSD:CK117838.1,INSD:AA586258.1,INSD:ES024221.1,
FT                   INSD:EL106186.1,INSD:ES059621.1,INSD:DR382891.1,
FT                   INSD:ES165477.1,INSD:ES093234.1,INSD:ES140291.1,
FT                   INSD:EH962809.1,INSD:EG430480.1,INSD:EG421527.1,
FT                   INSD:DR356350.1,INSD:EH837679.1,INSD:BP667793.1,
FT                   INSD:ES059519.1,INSD:BP862247.1,INSD:ES179105.1,
FT                   INSD:AV550426.1,INSD:EL159860.1,INSD:CK119405.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY113171.1,INSD:AK227578.1,INSD:BX826993.1,
FT                   INSD:BX827625.1"
FT                   /protein_id="AEE81941.1"
FT                   /translation="MSDARDNDDRVDFEEGSYSEMEDEVEEEQVEEYEEEEEEDDDDDD
FT                   VGNQNAEEREVEDYGDTKGGDMEDVQEEIAEDDDNHIDIETADDDEKPPSPIDDEDREK
FT                   YSHLLSLPPHGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVA
FT                   FKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRLFIGNIPKNWTEDEFRKVIEDVGPG
FT                   VENIELIKDPTNTTRNRGFAFVLYYNNACADYSRQKMIDSNFKLEGNAPTVTWADPKSS
FT                   PEHSAAAAQVKALYVKNIPENTSTEQLKELFQRHGEVTKIVTPPGKGGKRDFGFVHYAE
FT                   RSSALKAVKDTERYEVNGQPLEVVLAKPQAERKHDPSSYSYGAAPTPAPFVHPTFGGFA
FT                   AAPYGAMGAGLGIAGSFSQPMIYGRGAMPTGMQMVPMLLPDGRVGYVLQQPGMPMAAAP
FT                   PQRPRRNDRNNGSSGGSGRDNSHEHDGNRGGRRYRPY"
FT   CDS_pept        join(352782..353213,353301..353417,353518..353634,
FT                   353738..353917,354016..354217,354356..354537,
FT                   354635..354720,354818..354965)
FT                   /codon_start=1
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /note="RNA-binding (RRM/RBD/RNP motifs) family protein;
FT                   FUNCTIONS IN: RNA binding, nucleotide binding, nucleic acid
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: RNA recognition motif, RNP-1
FT                   (InterPro:IPR000504), Nucleotide-binding, alpha-beta plait
FT                   (InterPro:IPR012677), RNA recognition, domain 1
FT                   (InterPro:IPR003954); BEST Arabidopsis thaliana protein
FT                   match is: RNA-binding (RRM/RBD/RNP motifs) family protein
FT                   (TAIR:AT3G52660.2)."
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00830.3"
FT                   /db_xref="GOA:Q9ASP6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ASP6"
FT                   /protein_id="AEE81942.2"
FT                   /translation="MSDARDNDDRVDFEEGSYSEMEDEVEEEQVEEYEEEEEEDDDDDD
FT                   VGNQNAEEREVEDYGDTKGGDMEDVQEEIAEDDDNHIDIETADDDEKPPSPIDDEDREK
FT                   YSHLLSLPPHGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVA
FT                   FKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRLFIGNIPKNWTEDEFRKVIEDVGPG
FT                   DPTNTTRNRGFAFVLYYNNACADYSRQKMIDSNFKLEGNAPTVTWADPKSSPEHSAAAA
FT                   QVKALYVKNIPENTSTEQLKELFQRHGEVTKIVTPPGKGGKRDFGFVHYAERSSALKAV
FT                   KDTERYEVNGQPLEVVLAKPQAERKHDPSSYSYGAAPTPAPFVHPTFGGFAAAPYGAMG
FT                   AGLGIAGSFSQPMIYGRGAMPTGMQMVPMLLPDGRVGYVLQQPGMPMAAAPPQRPRRND
FT                   RNNGSSGGSGRDNSHEHDGNRGGRRYRPY"
FT   CDS_pept        join(352782..353213,353301..353417,353518..353634,
FT                   353738..353917,354016..354217,354356..354537,
FT                   354635..354720,354818..354965)
FT                   /codon_start=1
FT                   /gene="LIF2"
FT                   /gene_synonym="A_TM018A10.14"
FT                   /gene_synonym="A_TM018A10_14"
FT                   /gene_synonym="LHP1-Interacting Factor 2"
FT                   /gene_synonym="T18A10.13"
FT                   /gene_synonym="T18A10_13"
FT                   /locus_tag="AT4G00830"
FT                   /product="RNA-binding (RRM/RBD/RNP motifs) family protein"
FT                   /db_xref="GOA:Q9ASP6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ASP6"
FT                   /protein_id="ANM66433.1"
FT                   /translation="MSDARDNDDRVDFEEGSYSEMEDEVEEEQVEEYEEEEEEDDDDDD
FT                   VGNQNAEEREVEDYGDTKGGDMEDVQEEIAEDDDNHIDIETADDDEKPPSPIDDEDREK
FT                   YSHLLSLPPHGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVA
FT                   FKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRLFIGNIPKNWTEDEFRKVIEDVGPG
FT                   DPTNTTRNRGFAFVLYYNNACADYSRQKMIDSNFKLEGNAPTVTWADPKSSPEHSAAAA
FT                   QVKALYVKNIPENTSTEQLKELFQRHGEVTKIVTPPGKGGKRDFGFVHYAERSSALKAV
FT                   KDTERYEVNGQPLEVVLAKPQAERKHDPSSYSYGAAPTPAPFVHPTFGGFAAAPYGAMG
FT                   AGLGIAGSFSQPMIYGRGAMPTGMQMVPMLLPDGRVGYVLQQPGMPMAAAPPQRPRRND
FT                   RNNGSSGGSGRDNSHEHDGNRGGRRYRPY"
FT   gene            complement(355211..357296)
FT                   /gene_synonym="A_TM018A10.8"
FT                   /gene_synonym="A_TM018A10_8"
FT                   /gene_synonym="T18A10.14"
FT                   /gene_synonym="T18A10_14"
FT                   /locus_tag="AT4G00840"
FT   mRNA            complement(join(355211..355599,355678..355743,
FT                   355831..355916,356031..356157,356265..356356,
FT                   356452..356650,356917..357296))
FT                   /gene_synonym="A_TM018A10.8"
FT                   /gene_synonym="A_TM018A10_8"
FT                   /gene_synonym="T18A10.14"
FT                   /gene_synonym="T18A10_14"
FT                   /locus_tag="AT4G00840"
FT                   /product="DHHC-type zinc finger family protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL289853.1,INSD:EH853560.1,INSD:AV538227.1,
FT                   INSD:EH873348.1,INSD:EL082912.1,INSD:BP609217.1,
FT                   INSD:DR256753.1,INSD:AV442237.1,INSD:ES010344.1,
FT                   INSD:ES005299.1,INSD:EL128918.1,INSD:EL988044.1,
FT                   INSD:ES081107.1,INSD:AU237782.1,INSD:Z17978.1,
FT                   INSD:AV441356.1,INSD:EL975071.1,INSD:DR256754.1,
FT                   INSD:ES140376.1,INSD:DR256755.1,INSD:EG473786.1,
FT                   INSD:DR256751.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT020511.1,INSD:BX828745.1,INSD:AK229293.1,
FT                   INSD:BT020391.1"
FT   mRNA            complement(join(355211..355599,355678..355743,
FT                   355831..355936,356031..356157,356265..356356,
FT                   356452..356650,356917..357296))
FT                   /gene_synonym="A_TM018A10.8"
FT                   /gene_synonym="A_TM018A10_8"
FT                   /gene_synonym="T18A10.14"
FT                   /gene_synonym="T18A10_14"
FT                   /locus_tag="AT4G00840"
FT                   /product="DHHC-type zinc finger family protein"
FT   CDS_pept        complement(join(355483..355599,355678..355743,
FT                   355831..355916,356031..356157,356265..356356,
FT                   356452..356650,356917..357105))
FT                   /codon_start=1
FT                   /gene_synonym="A_TM018A10.8"
FT                   /gene_synonym="A_TM018A10_8"
FT                   /gene_synonym="T18A10.14"
FT                   /gene_synonym="T18A10_14"
FT                   /locus_tag="AT4G00840"
FT                   /product="DHHC-type zinc finger family protein"
FT                   /note="DHHC-type zinc finger family protein; FUNCTIONS IN:
FT                   zinc ion binding; INVOLVED IN: biological_process unknown;
FT                   LOCATED IN: endomembrane system; EXPRESSED IN: male
FT                   gametophyte, pollen tube; EXPRESSED DURING: L mature pollen
FT                   stage, M germinated pollen stage; CONTAINS InterPro
FT                   DOMAIN/s: Zinc finger, DHHC-type (InterPro:IPR001594); BEST
FT                   Arabidopsis thaliana protein match is: DHHC-type zinc
FT                   finger family protein (TAIR:AT3G60800.1); Has 5117 Blast
FT                   hits to 5115 proteins in 251 species: Archae - 0; Bacteria
FT                   - 0; Metazoa - 2189; Fungi - 766; Plants - 830; Viruses -
FT                   0; Other Eukaryotes - 1332 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00840"
FT                   /db_xref="GOA:Q5M757"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5M757"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL289853.1,INSD:EH853560.1,INSD:AV538227.1,
FT                   INSD:EH873348.1,INSD:EL082912.1,INSD:BP609217.1,
FT                   INSD:DR256753.1,INSD:AV442237.1,INSD:ES010344.1,
FT                   INSD:ES005299.1,INSD:EL128918.1,INSD:EL988044.1,
FT                   INSD:ES081107.1,INSD:AU237782.1,INSD:Z17978.1,
FT                   INSD:AV441356.1,INSD:EL975071.1,INSD:DR256754.1,
FT                   INSD:ES140376.1,INSD:DR256755.1,INSD:EG473786.1,
FT                   INSD:DR256751.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT020511.1,INSD:BX828745.1,INSD:AK229293.1,
FT                   INSD:BT020391.1"
FT                   /protein_id="AEE81944.1"
FT                   /translation="MNLFRFCSGLKVLGYFMILLVVAVVGVSYYAVVVSTWWPILIRGD
FT                   HGALSALAALIIFVFHFLLIMLLWSYFTTVFTDPGSVPEHFRREMGGGDSLEAGTSTDQ
FT                   GAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYT
FT                   FLETMLDVIVLLPSFIEFFSQAIKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVMHISL
FT                   LSSNTTSVEVHEKNGEVRWKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDIDNITSLEGL
FT                   EFPTCSDIDP"
FT   CDS_pept        complement(join(355875..355936,356031..356157,
FT                   356265..356356,356452..356650,356917..357105))
FT                   /codon_start=1
FT                   /gene_synonym="A_TM018A10.8"
FT                   /gene_synonym="A_TM018A10_8"
FT                   /gene_synonym="T18A10.14"
FT                   /gene_synonym="T18A10_14"
FT                   /locus_tag="AT4G00840"
FT                   /product="DHHC-type zinc finger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00840"
FT                   /db_xref="GOA:A0A1P8B6M5"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B6M5"
FT                   /protein_id="ANM67242.1"
FT                   /translation="MNLFRFCSGLKVLGYFMILLVVAVVGVSYYAVVVSTWWPILIRGD
FT                   HGALSALAALIIFVFHFLLIMLLWSYFTTVFTDPGSVPEHFRREMGGGDSLEAGTSTDQ
FT                   GAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYT
FT                   FLETMLDVIVLLPSFIEFFSQAIKHSSSPGKLASLVLAFDSIPLMQFLTLRSFSAFFVS
FT                   "
FT   gene            357345..359337
FT                   /gene="GIF3"
FT                   /gene_synonym="A_TM018A10.22"
FT                   /gene_synonym="A_TM018A10_22"
FT                   /gene_synonym="GRF1-interacting factor 3"
FT                   /gene_synonym="T18A10.15"
FT                   /gene_synonym="T18A10_15"
FT                   /locus_tag="AT4G00850"
FT                   /note="Arabidopsis thaliana GRF1-interacting factor 3
FT                   (GIF3) mRNA"
FT   mRNA            join(357345..357758,358091..358167,358269..358377,
FT                   358453..358726,358801..359337)
FT                   /gene="GIF3"
FT                   /gene_synonym="A_TM018A10.22"
FT                   /gene_synonym="A_TM018A10_22"
FT                   /gene_synonym="GRF1-interacting factor 3"
FT                   /gene_synonym="T18A10.15"
FT                   /gene_synonym="T18A10_15"
FT                   /locus_tag="AT4G00850"
FT                   /product="GRF1-interacting factor 3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:T45454.1,INSD:AI993161.1,INSD:CB254540.1,
FT                   INSD:BP564449.1,INSD:BP861260.1,INSD:ES204098.1,
FT                   INSD:EL236049.1,INSD:AV821335.1,INSD:AV781734.1,
FT                   INSD:AV559559.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY052732.1,INSD:AF378866.1,INSD:AY102641.1"
FT   mRNA            join(357397..357758,358091..358167,358269..358377,
FT                   358453..359248)
FT                   /gene="GIF3"
FT                   /gene_synonym="A_TM018A10.22"
FT                   /gene_synonym="A_TM018A10_22"
FT                   /gene_synonym="GRF1-interacting factor 3"
FT                   /gene_synonym="T18A10.15"
FT                   /gene_synonym="T18A10_15"
FT                   /locus_tag="AT4G00850"
FT                   /product="GRF1-interacting factor 3"
FT   CDS_pept        join(357675..357758,358091..358167,358269..358377,
FT                   358453..358726,358801..358928)
FT                   /codon_start=1
FT                   /gene="GIF3"
FT                   /gene_synonym="A_TM018A10.22"
FT                   /gene_synonym="A_TM018A10_22"
FT                   /gene_synonym="GRF1-interacting factor 3"
FT                   /gene_synonym="T18A10.15"
FT                   /gene_synonym="T18A10_15"
FT                   /locus_tag="AT4G00850"
FT                   /product="GRF1-interacting factor 3"
FT                   /note="GRF1-interacting factor 3 (GIF3); CONTAINS InterPro
FT                   DOMAIN/s: SSXT (InterPro:IPR007726); BEST Arabidopsis
FT                   thaliana protein match is: GRF1-interacting factor 2
FT                   (TAIR:AT1G01160.1); Has 414 Blast hits to 414 proteins in
FT                   93 species: Archae - 0; Bacteria - 2; Metazoa - 279; Fungi
FT                   - 27; Plants - 81; Viruses - 0; Other Eukaryotes - 25
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q93VH6"
FT                   /db_xref="InterPro:IPR007726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93VH6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:T45454.1,INSD:AI993161.1,INSD:CB254540.1,
FT                   INSD:BP564449.1,INSD:BP861260.1,INSD:ES204098.1,
FT                   INSD:EL236049.1,INSD:AV821335.1,INSD:AV781734.1,
FT                   INSD:AV559559.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY052732.1,INSD:AF378866.1,INSD:AY102641.1"
FT                   /protein_id="AEE81945.1"
FT                   /translation="MQQSPQMIPMVLPSFPPTNNITTEQIQKYLDENKKLIMAILENQN
FT                   LGKLAECAQYQALLQKNLMYLAAIADAQPQPPAATLTSGAMTPQAMAPNPSSMQPPPSY
FT                   FMQQHQAVGMAQQIPPGIFPPRGPLQFGSPHQFLDPQQQLHQQAMQGHMGIRPMGLNNN
FT                   NGLQHQMHHHETALAANNAGPNDASGGGKPDGTNMSQSGADGQGGSAARHGGGDAKTEG
FT                   K"
FT   CDS_pept        join(357675..357758,358091..358167,358269..358377,
FT                   358453..358851)
FT                   /codon_start=1
FT                   /gene="GIF3"
FT                   /gene_synonym="A_TM018A10.22"
FT                   /gene_synonym="A_TM018A10_22"
FT                   /gene_synonym="GRF1-interacting factor 3"
FT                   /gene_synonym="T18A10.15"
FT                   /gene_synonym="T18A10_15"
FT                   /locus_tag="AT4G00850"
FT                   /product="GRF1-interacting factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00850"
FT                   /db_xref="GOA:A0A1P8B4F6"
FT                   /db_xref="InterPro:IPR007726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B4F6"
FT                   /protein_id="ANM66479.1"
FT                   /translation="MQQSPQMIPMVLPSFPPTNNITTEQIQKYLDENKKLIMAILENQN
FT                   LGKLAECAQYQALLQKNLMYLAAIADAQPQPPAATLTSGAMTPQAMAPNPSSMQPPPSY
FT                   FMQQHQAVGMAQQIPPGIFPPRGPLQFGSPHQFLDPQQQLHQQAMQGHMGIRPMGLNNN
FT                   NGLQHQMHHHETALAANNGNIWFYSSLELIITLLIFTFFLYQKRVLTMLVEEVNRMGPI
FT                   "
FT   gene            complement(359223..360505)
FT                   /gene="ATOZI1"
FT                   /gene_synonym="Arabidopsis thaliana ozone-induced protein
FT                   1"
FT                   /gene_synonym="AT0ZI1"
FT                   /gene_synonym="T18A10.16"
FT                   /gene_synonym="T18A10_16"
FT                   /locus_tag="AT4G00860"
FT                   /note="putative pathogenesis-related protein whose
FT                   transcript level is induced in response to ozone and
FT                   pathogenic Pseudomonas strains."
FT   mRNA            complement(join(359223..359693,359772..359875,
FT                   360381..360505))
FT                   /gene="ATOZI1"
FT                   /gene_synonym="Arabidopsis thaliana ozone-induced protein
FT                   1"
FT                   /gene_synonym="AT0ZI1"
FT                   /gene_synonym="T18A10.16"
FT                   /gene_synonym="T18A10_16"
FT                   /locus_tag="AT4G00860"
FT                   /product="monopolar spindle protein (DUF1138)"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR358079.1,INSD:ES084308.1,INSD:EH986359.1,
FT                   INSD:DR358096.1,INSD:DR358066.1,INSD:N38538.1,
FT                   INSD:DR358101.1,INSD:CB255179.1,INSD:DR358106.1,
FT                   INSD:DR358078.1,INSD:BP865889.1,INSD:DR358119.1,
FT                   INSD:ES001713.1,INSD:DR358086.1,INSD:DR358103.1,
FT                   INSD:ES208253.1,INSD:DR358072.1,INSD:DR358088.1,
FT                   INSD:DR358091.1,INSD:DR358093.1,INSD:DR358065.1,
FT                   INSD:DR358116.1,INSD:DR358115.1,INSD:DR358105.1,
FT                   INSD:EL203193.1,INSD:ES118178.1,INSD:EL304858.1,
FT                   INSD:BP574144.1,INSD:EL066568.1,INSD:T44530.1,
FT                   INSD:DR358082.1,INSD:T04138.1,INSD:DR358077.1,
FT                   INSD:DR358114.1,INSD:EH921768.1,INSD:EH855217.1,
FT                   INSD:DR358083.1,INSD:DR358121.1,INSD:EL312067.1,
FT                   INSD:EH886215.1,INSD:EL300618.1,INSD:EL297283.1,
FT                   INSD:ES121182.1,INSD:EL317854.1,INSD:BP564253.1,
FT                   INSD:DR358118.1,INSD:BP563337.1,INSD:AV533286.1,
FT                   INSD:ES158533.1,INSD:DR358080.1,INSD:ES112592.1,
FT                   INSD:DR358120.1,INSD:EL982287.1,INSD:ES195680.1,
FT                   INSD:DR358084.1,INSD:EH967244.1,INSD:EL208424.1,
FT                   INSD:ES092631.1,INSD:DR358087.1,INSD:AV532802.1,
FT                   INSD:EL273359.1,INSD:DR358094.1,INSD:DR358089.1,
FT                   INSD:ES198367.1,INSD:AV823929.1,INSD:ES091924.1,
FT                   INSD:CD533768.1,INSD:DR358085.1,INSD:CD529219.1,
FT                   INSD:CB254454.1,INSD:DR358070.1,INSD:DR358113.1,
FT                   INSD:ES129610.1,INSD:EL212512.1,INSD:DR358076.1,
FT                   INSD:BP568999.1,INSD:EL173229.1,INSD:DR358099.1,
FT                   INSD:EL323501.1,INSD:ES001240.1,INSD:EL274654.1,
FT                   INSD:EL320132.1,INSD:EL315554.1,INSD:DR358081.1,
FT                   INSD:ES190310.1,INSD:ES071917.1,INSD:DR358071.1,
FT                   INSD:CD531099.1,INSD:DR358069.1,INSD:DR358068.1,
FT                   INSD:DR358073.1,INSD:EH920453.1,INSD:AA597398.1,
FT                   INSD:DR358098.1,INSD:BP863739.1,INSD:ES152709.1,
FT                   INSD:EL271310.1,INSD:DR358067.1,INSD:EH959737.1,
FT                   INSD:EL132385.1,INSD:DR358095.1,INSD:DR358112.1,
FT                   INSD:ES063328.1,INSD:BP860410.1,INSD:DR358117.1,
FT                   INSD:ES068963.1,INSD:DR382763.1,INSD:DR358100.1,
FT                   INSD:BP798689.1,INSD:EH945054.1,INSD:DR358092.1,
FT                   INSD:ES139005.1,INSD:DR358104.1,INSD:EH928868.1,
FT                   INSD:ES141343.1,INSD:ES040430.1,INSD:DR358109.1,
FT                   INSD:DR358111.1,INSD:DR358097.1,INSD:EH909408.1,
FT                   INSD:AA597471.1,INSD:BP582700.1,INSD:EL299478.1,
FT                   INSD:AV785017.1,INSD:BP834396.1,INSD:DR358102.1,
FT                   INSD:CD533766.1,INSD:ES109955.1,INSD:AV790241.1,
FT                   INSD:BP583747.1,INSD:EL185845.1,INSD:ES190003.1,
FT                   INSD:ES127669.1,INSD:BP580821.1,INSD:CD532964.1,
FT                   INSD:EL079979.1,INSD:DR358074.1,INSD:ES199855.1,
FT                   INSD:DR358090.1,INSD:ES081777.1,INSD:EH994141.1,
FT                   INSD:DR358108.1,INSD:DR358110.1,INSD:DR358107.1,
FT                   INSD:DR358075.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY093001.1,INSD:U20347.1,INSD:BX828910.1,
FT                   INSD:AY114604.1"
FT   CDS_pept        complement(join(359548..359693,359772..359868))
FT                   /codon_start=1
FT                   /gene="ATOZI1"
FT                   /gene_synonym="Arabidopsis thaliana ozone-induced protein
FT                   1"
FT                   /gene_synonym="AT0ZI1"
FT                   /gene_synonym="T18A10.16"
FT                   /gene_synonym="T18A10_16"
FT                   /locus_tag="AT4G00860"
FT                   /product="monopolar spindle protein (DUF1138)"
FT                   /note="ATOZI1; FUNCTIONS IN: molecular_function unknown;
FT                   INVOLVED IN: response to reactive oxygen species, response
FT                   to bacterium, response to ozone; LOCATED IN: mitochondrion,
FT                   peroxisome, plastid, membrane; EXPRESSED IN: 25 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF1138
FT                   (InterPro:IPR009515); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF1138)
FT                   (TAIR:AT1G01170.2); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q38842"
FT                   /db_xref="InterPro:IPR009515"
FT                   /db_xref="UniProtKB/TrEMBL:Q38842"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR358079.1,INSD:ES084308.1,INSD:EH986359.1,
FT                   INSD:DR358096.1,INSD:DR358066.1,INSD:N38538.1,
FT                   INSD:DR358101.1,INSD:CB255179.1,INSD:DR358106.1,
FT                   INSD:DR358078.1,INSD:BP865889.1,INSD:DR358119.1,
FT                   INSD:ES001713.1,INSD:DR358086.1,INSD:DR358103.1,
FT                   INSD:ES208253.1,INSD:DR358072.1,INSD:DR358088.1,
FT                   INSD:DR358091.1,INSD:DR358093.1,INSD:DR358065.1,
FT                   INSD:DR358116.1,INSD:DR358115.1,INSD:DR358105.1,
FT                   INSD:EL203193.1,INSD:ES118178.1,INSD:EL304858.1,
FT                   INSD:BP574144.1,INSD:EL066568.1,INSD:T44530.1,
FT                   INSD:DR358082.1,INSD:T04138.1,INSD:DR358077.1,
FT                   INSD:DR358114.1,INSD:EH921768.1,INSD:EH855217.1,
FT                   INSD:DR358083.1,INSD:DR358121.1,INSD:EL312067.1,
FT                   INSD:EH886215.1,INSD:EL300618.1,INSD:EL297283.1,
FT                   INSD:ES121182.1,INSD:EL317854.1,INSD:BP564253.1,
FT                   INSD:DR358118.1,INSD:BP563337.1,INSD:AV533286.1,
FT                   INSD:ES158533.1,INSD:DR358080.1,INSD:ES112592.1,
FT                   INSD:DR358120.1,INSD:EL982287.1,INSD:ES195680.1,
FT                   INSD:DR358084.1,INSD:EH967244.1,INSD:EL208424.1,
FT                   INSD:ES092631.1,INSD:DR358087.1,INSD:AV532802.1,
FT                   INSD:EL273359.1,INSD:DR358094.1,INSD:DR358089.1,
FT                   INSD:ES198367.1,INSD:AV823929.1,INSD:ES091924.1,
FT                   INSD:CD533768.1,INSD:DR358085.1,INSD:CD529219.1,
FT                   INSD:CB254454.1,INSD:DR358070.1,INSD:DR358113.1,
FT                   INSD:ES129610.1,INSD:EL212512.1,INSD:DR358076.1,
FT                   INSD:BP568999.1,INSD:EL173229.1,INSD:DR358099.1,
FT                   INSD:EL323501.1,INSD:ES001240.1,INSD:EL274654.1,
FT                   INSD:EL320132.1,INSD:EL315554.1,INSD:DR358081.1,
FT                   INSD:ES190310.1,INSD:ES071917.1,INSD:DR358071.1,
FT                   INSD:CD531099.1,INSD:DR358069.1,INSD:DR358068.1,
FT                   INSD:DR358073.1,INSD:EH920453.1,INSD:AA597398.1,
FT                   INSD:DR358098.1,INSD:BP863739.1,INSD:ES152709.1,
FT                   INSD:EL271310.1,INSD:DR358067.1,INSD:EH959737.1,
FT                   INSD:EL132385.1,INSD:DR358095.1,INSD:DR358112.1,
FT                   INSD:ES063328.1,INSD:BP860410.1,INSD:DR358117.1,
FT                   INSD:ES068963.1,INSD:DR382763.1,INSD:DR358100.1,
FT                   INSD:BP798689.1,INSD:EH945054.1,INSD:DR358092.1,
FT                   INSD:ES139005.1,INSD:DR358104.1,INSD:EH928868.1,
FT                   INSD:ES141343.1,INSD:ES040430.1,INSD:DR358109.1,
FT                   INSD:DR358111.1,INSD:DR358097.1,INSD:EH909408.1,
FT                   INSD:AA597471.1,INSD:BP582700.1,INSD:EL299478.1,
FT                   INSD:AV785017.1,INSD:BP834396.1,INSD:DR358102.1,
FT                   INSD:CD533766.1,INSD:ES109955.1,INSD:AV790241.1,
FT                   INSD:BP583747.1,INSD:EL185845.1,INSD:ES190003.1,
FT                   INSD:ES127669.1,INSD:BP580821.1,INSD:CD532964.1,
FT                   INSD:EL079979.1,INSD:DR358074.1,INSD:ES199855.1,
FT                   INSD:DR358090.1,INSD:ES081777.1,INSD:EH994141.1,
FT                   INSD:DR358108.1,INSD:DR358110.1,INSD:DR358107.1,
FT                   INSD:DR358075.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY093001.1,INSD:U20347.1,INSD:BX828910.1,
FT                   INSD:AY114604.1"
FT                   /protein_id="AEE81946.1"
FT                   /translation="MSRATYIIGALAGSAVVAYVCDKVISDDKLFGGTTPGTITNKEWG
FT                   AATEERLQAWPRVAGPPVVMNPISRQNFIVKSRPE"
FT   gene            complement(361933..363709)
FT                   /gene_synonym="A_TM018A10.7"
FT                   /gene_synonym="A_TM018A10_7"
FT                   /gene_synonym="T18A10.17"
FT                   /gene_synonym="T18A10_17"
FT                   /locus_tag="AT4G00870"
FT   mRNA            complement(join(361933..363240,363379..363709))
FT                   /gene_synonym="A_TM018A10.7"
FT                   /gene_synonym="A_TM018A10_7"
FT                   /gene_synonym="T18A10.17"
FT                   /gene_synonym="T18A10_17"
FT                   /locus_tag="AT4G00870"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR342296.1,INSD:ES091902.1,INSD:ES059762.1,
FT                   INSD:ES026240.1,INSD:EL995297.1,INSD:ES130193.1,
FT                   INSD:ES140547.1,INSD:ES188114.1,INSD:T43872.1,
FT                   INSD:ES035136.1,INSD:ES014980.1,INSD:DR750068.1,
FT                   INSD:ES199123.1,INSD:ES046175.1,INSD:EL998750.1,
FT                   INSD:ES066864.1,INSD:ES128826.1,INSD:ES127393.1,
FT                   INSD:ES005289.1,INSD:ES168777.1,INSD:DR373529.1,
FT                   INSD:DR750069.1,INSD:ES056482.1,INSD:ES010790.1,
FT                   INSD:EL979403.1,INSD:EL968403.1,INSD:EL973502.1,
FT                   INSD:CF774310.1,INSD:AA395080.1,INSD:ES019128.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX826915.1,INSD:AJ519812.1"
FT   CDS_pept        complement(join(362230..363240,363379..363639))
FT                   /codon_start=1
FT                   /gene_synonym="A_TM018A10.7"
FT                   /gene_synonym="A_TM018A10_7"
FT                   /gene_synonym="T18A10.17"
FT                   /gene_synonym="T18A10_17"
FT                   /locus_tag="AT4G00870"
FT                   /product="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein"
FT                   /note="basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein; FUNCTIONS IN: DNA binding,
FT                   sequence-specific DNA binding transcription factor
FT                   activity; INVOLVED IN: regulation of transcription; LOCATED
FT                   IN: nucleus; EXPRESSED IN: 9 plant structures; EXPRESSED
FT                   DURING: 6 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Helix-loop-helix DNA-binding domain (InterPro:IPR001092),
FT                   Helix-loop-helix DNA-binding (InterPro:IPR011598); BEST
FT                   Arabidopsis thaliana protein match is: basic
FT                   helix-loop-helix (bHLH) DNA-binding superfamily protein
FT                   (TAIR:AT4G16430.1); Has 3066 Blast hits to 2737 proteins in
FT                   159 species: Archae - 0; Bacteria - 0; Metazoa - 62; Fungi
FT                   - 39; Plants - 2956; Viruses - 0; Other Eukaryotes - 9
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:O23090"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR025610"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23090"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR342296.1,INSD:ES091902.1,INSD:ES059762.1,
FT                   INSD:ES026240.1,INSD:EL995297.1,INSD:ES130193.1,
FT                   INSD:ES140547.1,INSD:ES188114.1,INSD:T43872.1,
FT                   INSD:ES035136.1,INSD:ES014980.1,INSD:DR750068.1,
FT                   INSD:ES199123.1,INSD:ES046175.1,INSD:EL998750.1,
FT                   INSD:ES066864.1,INSD:ES128826.1,INSD:ES127393.1,
FT                   INSD:ES005289.1,INSD:ES168777.1,INSD:DR373529.1,
FT                   INSD:DR750069.1,INSD:ES056482.1,INSD:ES010790.1,
FT                   INSD:EL979403.1,INSD:EL968403.1,INSD:EL973502.1,
FT                   INSD:CF774310.1,INSD:AA395080.1,INSD:ES019128.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX826915.1,INSD:AJ519812.1"
FT                   /protein_id="AEE81947.1"
FT                   /translation="MYNLTFSPSLSSSLLSFTQQTPAAIVSSSPPDLVLQQKLRFVVET
FT                   SPDRWAYVIFWQKMFDDQSDRSYLVWVDGHFCGNKNNNSQENYTTNSIECELMMDGGDD
FT                   LELFYAASFYGEDRSPRKEVSDESLVWLTGPDELRFSNYERAKEAGFHGVHTLVSIPIN
FT                   NGIIELGSSESIIQNRNFINRVKSIFGSGKTTKHTNQTGSYPKPAVSDHSKSGNQQFGS
FT                   ERKRRRKLETTRVAAATKEKHHPAVLSHVEAEKQRREKLNHRFYALRAIVPKVSRMDKA
FT                   SLLSDAVSYIESLKSKIDDLETEIKKMKMTETDKLDNSSSNTSPSSVEYQVNQKPSKSN
FT                   RGSDLEVQVKIVGEEAIIRVQTENVNHPTSALMSALMEMDCRVQHANASRLSQVMVQDV
FT                   VVLVPEGLRSEDRLRTTLVRTLSL"
FT   gene            complement(364027..364757)
FT                   /locus_tag="AT4G00872"
FT   mRNA            complement(join(364027..364441,364516..364757))
FT                   /locus_tag="AT4G00872"
FT                   /product="Plant invertase/pectin methylesterase inhibitor
FT                   superfamily protein"
FT   CDS_pept        complement(join(364147..364441,364516..364736))
FT                   /codon_start=1
FT                   /locus_tag="AT4G00872"
FT                   /product="Plant invertase/pectin methylesterase inhibitor
FT                   superfamily protein"
FT                   /note="Plant invertase/pectin methylesterase inhibitor
FT                   superfamily protein; FUNCTIONS IN: enzyme inhibitor
FT                   activity, pectinesterase activity; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: endomembrane
FT                   system; CONTAINS InterPro DOMAIN/s: Pectinesterase
FT                   inhibitor (InterPro:IPR006501); BEST Arabidopsis thaliana
FT                   protein match is: Plant invertase/pectin methylesterase
FT                   inhibitor superfamily protein (TAIR:AT1G56100.2); Has 34
FT                   Blast hits to 34 proteins in 6 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 34; Viruses
FT                   - 0; Other Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00872"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00872.1"
FT                   /db_xref="GOA:F4JHP1"
FT                   /db_xref="InterPro:IPR006501"
FT                   /db_xref="InterPro:IPR034086"
FT                   /db_xref="InterPro:IPR035513"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHP1"
FT                   /protein_id="AEE81948.2"
FT                   /translation="MKTMIKFLLLILVISPMSICAEKDMMINECHNADVPAICMQCLES
FT                   DPNSIHADHIGIAGIVINCLESHLHIITNNITNLSSKKDKGEVKTALEICKKDLSTNAS
FT                   TILSEAKTSLKTGDYDKTNKSIKLALGFPLRCMFNLKRVKFTSPQLFSQINIYAQLSDA
FT                   AMRIIDRF"
FT   gene            complement(366373..367274)
FT                   /gene_synonym="A_TM018A10.6"
FT                   /gene_synonym="A_TM018A10_6"
FT                   /gene_synonym="T18A10.18"
FT                   /gene_synonym="T18A10_18"
FT                   /gene_synonym="SAUR31"
FT                   /gene_synonym="SMALL AUXIN UPREGULATED RNA 31"
FT                   /locus_tag="AT4G00880"
FT   mRNA            complement(366373..367274)
FT                   /gene_synonym="A_TM018A10.6"
FT                   /gene_synonym="A_TM018A10_6"
FT                   /gene_synonym="T18A10.18"
FT                   /gene_synonym="T18A10_18"
FT                   /gene_synonym="SAUR31"
FT                   /gene_synonym="SMALL AUXIN UPREGULATED RNA 31"
FT                   /locus_tag="AT4G00880"
FT                   /product="SAUR-like auxin-responsive protein family"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AA395073.1,INSD:EH852137.1,INSD:EH971977.1,
FT                   INSD:AV788388.1,INSD:AV544423.1,INSD:T43845.1,
FT                   INSD:EH864221.1,INSD:EH920007.1,INSD:AV442564.1,
FT                   INSD:AI998664.1,INSD:BE844828.1,INSD:EL050590.1,
FT                   INSD:AV824430.1,INSD:DR212501.1,INSD:AV786131.1,
FT                   INSD:BP841543.1,INSD:EL310651.1,INSD:EH837434.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY063950.1,INSD:AY096716.1"
FT   CDS_pept        complement(366692..367060)
FT                   /codon_start=1
FT                   /gene_synonym="A_TM018A10.6"
FT                   /gene_synonym="A_TM018A10_6"
FT                   /gene_synonym="T18A10.18"
FT                   /gene_synonym="T18A10_18"
FT                   /gene_synonym="SAUR31"
FT                   /gene_synonym="SMALL AUXIN UPREGULATED RNA 31"
FT                   /locus_tag="AT4G00880"
FT                   /product="SAUR-like auxin-responsive protein family"
FT                   /note="SAUR-like auxin-responsive protein family; CONTAINS
FT                   InterPro DOMAIN/s: Auxin responsive SAUR protein
FT                   (InterPro:IPR003676); BEST Arabidopsis thaliana protein
FT                   match is: SAUR-like auxin-responsive protein family
FT                   (TAIR:AT2G46690.1); Has 1421 Blast hits to 1407 proteins in
FT                   27 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 1420; Viruses - 0; Other Eukaryotes - 1
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:O23089"
FT                   /db_xref="InterPro:IPR003676"
FT                   /db_xref="UniProtKB/TrEMBL:O23089"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AA395073.1,INSD:EH852137.1,INSD:EH971977.1,
FT                   INSD:AV788388.1,INSD:AV544423.1,INSD:T43845.1,
FT                   INSD:EH864221.1,INSD:EH920007.1,INSD:AV442564.1,
FT                   INSD:AI998664.1,INSD:BE844828.1,INSD:EL050590.1,
FT                   INSD:AV824430.1,INSD:DR212501.1,INSD:AV786131.1,
FT                   INSD:BP841543.1,INSD:EL310651.1,INSD:EH837434.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY063950.1,INSD:AY096716.1"
FT                   /protein_id="AEE81949.1"
FT                   /translation="MGNGDKVMSHWSFHIPRLHHHEHDHEKVPKGCLAVKVGQGEEQER
FT                   FVIPVMYFNHPLFGQLLKEAEEEFGFAQKGTITIPCHVEEFRYVQGLIDRENTRFLGTN
FT                   LLDHHHHHHNHLIRCFRV"
FT   gene            366716..367231
FT                   /locus_tag="AT4G00883"
FT   mRNA            join(366716..367075,367178..367231)
FT                   /locus_tag="AT4G00883"
FT                   /product="transmembrane protein"
FT   CDS_pept        join(366716..367075,367178..367231)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00883"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00883"
FT                   /db_xref="GOA:A0A1P8B666"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B666"
FT                   /protein_id="ANM67081.1"
FT                   /translation="MVVMMMVMIKEISTEKSSVFSIDQSLNIPKLLNVTRDRDCPFLSK
FT                   TKLFFSFLQELSKQRMIKVHNGNHKSLLLFSLSYLHCQTPFWYLFMIMLMMMETWDVEA
FT                   PVAHDFVSVTHGPIILKVKENSQCSWRVVRDGW"
FT   gene            complement(369831..370012)
FT                   /gene="MIR165b"
FT                   /gene_synonym="MICRORNA 165"
FT                   /gene_synonym="microRNA165B"
FT                   /gene_synonym="MIR165"
FT                   /gene_synonym="MIR165B"
FT                   /gene_synonym="p_MI0000200"
FT                   /locus_tag="AT4G00885"
FT                   /note="Encodes a microRNA that targets several HD-ZIPIII
FT                   family members including PHV, PHB, REV, ATHB-8, and
FT                   ATHB-15. MicroRNAs are regulatory RNAs with a mature length
FT                   of 21-nucleotides that are processed from hairpin
FT                   precursors by Dicer-like enzymes. MicroRNAs can negatively
FT                   regulate gene expression by attenuating translation or by
FT                   directing mRNA cleavage.Mature sequence:
FT                   UCGGACCAGGCUUCAUCCCC"
FT   precursor_RNA   complement(369831..370012)
FT                   /gene="MIR165b"
FT                   /gene_synonym="MICRORNA 165"
FT                   /gene_synonym="microRNA165B"
FT                   /gene_synonym="MIR165"
FT                   /gene_synonym="MIR165B"
FT                   /gene_synonym="p_MI0000200"
FT                   /locus_tag="AT4G00885"
FT                   /product="microRNA ath-MIR165b precursor"
FT   ncRNA           complement(369856..369876)
FT                   /gene="MIR165b"
FT                   /gene_synonym="MICRORNA 165"
FT                   /gene_synonym="microRNA165B"
FT                   /gene_synonym="MIR165"
FT                   /gene_synonym="MIR165B"
FT                   /gene_synonym="p_MI0000200"
FT                   /locus_tag="AT4G00885"
FT                   /product="microRNA ath-miR165b"
FT                   /note="mature miRNA accession:MIMAT0000188"
FT                   /ncRNA_class="miRNA"
FT   gene            complement(373960..375350)
FT                   /gene_synonym="ATXYN5"
FT                   /gene_synonym="A_TM018A10.5"
FT                   /gene_synonym="A_TM018A10_5"
FT                   /gene_synonym="T18A10.19"
FT                   /gene_synonym="T18A10_19"
FT                   /locus_tag="AT4G00890"
FT                   /note="Encodes a putative glycosyl hydrolase family 10
FT                   protein (xylanase)."
FT   mRNA            complement(373960..375350)
FT                   /gene_synonym="ATXYN5"
FT                   /gene_synonym="A_TM018A10.5"
FT                   /gene_synonym="A_TM018A10_5"
FT                   /gene_synonym="T18A10.19"
FT                   /gene_synonym="T18A10_19"
FT                   /locus_tag="AT4G00890"
FT                   /product="proline-rich family protein"
FT                   /inference="similar to RNA sequence, EST:INSD:AA664488.1"
FT   CDS_pept        complement(374055..375350)
FT                   /codon_start=1
FT                   /gene_synonym="ATXYN5"
FT                   /gene_synonym="A_TM018A10.5"
FT                   /gene_synonym="A_TM018A10_5"
FT                   /gene_synonym="T18A10.19"
FT                   /gene_synonym="T18A10_19"
FT                   /locus_tag="AT4G00890"
FT                   /product="proline-rich family protein"
FT                   /note="proline-rich family protein; Has 74402 Blast hits to
FT                   44432 proteins in 1604 species: Archae - 100; Bacteria -
FT                   7075; Metazoa - 32308; Fungi - 16616; Plants - 5983;
FT                   Viruses - 2030; Other Eukaryotes - 10290 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:O23088"
FT                   /db_xref="UniProtKB/TrEMBL:O23088"
FT                   /inference="similar to RNA sequence, EST:INSD:AA664488.1"
FT                   /protein_id="AEE81950.1"
FT                   /translation="MFNNRQSRRRFRLGNLARLVQLRQSVSSQPPRRTVQETLSQSPPQ
FT                   SPLFHPQSPPEPKSLPLSPLSPKSKEEPESQTMTPLMSKHVKTHRNLLIQSPPKSPPES
FT                   TESQQQFLASVPLRPLTTEPKTPLSPSSTLKATEESQSQPSPPLESIVETWFRPSPPTS
FT                   TETGDETQLPIPPPQEAKTPPSSPSMMLNATEEFESQPKPPLLPSKSIDETRLRSPLMS
FT                   QASSPPPLPSKSIDENETRSQSPPISPPKSDKQARSQTHSSPSPPPLLSPKASENHQSK
FT                   SPMPPPSPTAQISLSSLKSPIPSPATITAPPPPFSSPLSQTTPSPKPSLPQIEPNQIKS
FT                   PSPKLTNTESHASPEQNLVKPDANLMNKIPAKNEVPKNRGTLEKKTEPMIMMFINSNVQ
FT                   GFNTSLSLDSSSIDHKPGVHLTIDYDQSCDFS"
FT   gene            374116..375204
FT                   /locus_tag="AT4G00889"
FT   mRNA            join(374116..374269,374348..374503,374597..374833,
FT                   375134..375204)
FT                   /locus_tag="AT4G00889"
FT                   /product="transmembrane protein"
FT   CDS_pept        join(374116..374269,374348..374503,374597..374833,
FT                   375134..375204)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00889"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00889"
FT                   /db_xref="GOA:A0A1P8B664"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B664"
FT                   /protein_id="ANM67082.1"
FT                   /translation="MEDESSEREVLNPWTLLFMNIIIIGSVFFSNVPLFFGTSFLAGIL
FT                   FMRLASGSIWGNDGLGDGVVWESGEENGGGGAVIVAGEGIGDFRDDSDICAVGDGGGID
FT                   FGGEIGGDWDLVSFSSMDLDGKGGGDDACDISGDRSRVSSMDLDGKSGGFGWDSNSSVA
FT                   FNIIDGEDGGVLASCGGGIGSSFDFGDNGDKGKDFGSGGDCG"
FT   gene            complement(377481..377908)
FT                   /pseudo
FT                   /locus_tag="AT4G00891"
FT                   /note="pseudogene of APUM24 (RNA binding)"
FT   misc_RNA        complement(join(377481..377525,377608..377763,
FT                   377846..377908))
FT                   /pseudo
FT                   /locus_tag="AT4G00891"
FT                   /note="pseudogene of pumilio 24; AT4G00891.1"
FT   gene            378588..379024
FT                   /locus_tag="AT4G03765"
FT   ncRNA           378588..379024
FT                   /locus_tag="AT4G03765"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   gene            complement(379793..381455)
FT                   /locus_tag="AT4G00893"
FT   mRNA            complement(join(379793..381042,381302..381455))
FT                   /locus_tag="AT4G00893"
FT                   /product="F-box/kelch-repeat protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG502056.1,INSD:EG456437.1,INSD:EG486004.1,
FT                   INSD:EG502030.1,INSD:EG529269.1,INSD:EG451143.1,
FT                   INSD:EG501991.1,INSD:EG486010.1,INSD:EG485988.1,
FT                   INSD:EG485994.1,INSD:EG451145.1,INSD:EG451146.1,
FT                   INSD:EG502025.1,INSD:EG451144.1,INSD:EG504221.1,
FT                   INSD:EG451147.1,INSD:EG486003.1,INSD:EG451155.1,
FT                   INSD:EG451149.1,INSD:EG486000.1,INSD:EG451156.1,
FT                   INSD:EG486009.1,INSD:EG451159.1,INSD:EG485996.1,
FT                   INSD:EG502007.1,INSD:EG485993.1,INSD:EG486006.1,
FT                   INSD:EG485985.1,INSD:EG486007.1,INSD:EG486001.1,
FT                   INSD:EG486005.1,INSD:EG432407.1,INSD:EG451148.1,
FT                   INSD:EG485990.1,INSD:EG486002.1,INSD:EG485991.1,
FT                   INSD:EG485999.1,INSD:EG504234.1,INSD:EG451158.1,
FT                   INSD:EG451157.1,INSD:EG485998.1,INSD:EG451142.1,
FT                   INSD:EG456438.1,INSD:EG451150.1,INSD:EG485995.1,
FT                   INSD:EG451154.1,INSD:EG485992.1,INSD:EG504229.1,
FT                   INSD:EG529270.1,INSD:EG485989.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ652790.1,INSD:DQ487693.1,INSD:EF183028.1"
FT   CDS_pept        complement(join(379971..381042,381302..381396))
FT                   /codon_start=1
FT                   /locus_tag="AT4G00893"
FT                   /product="F-box/kelch-repeat protein"
FT                   /note="unknown protein; LOCATED IN: chloroplast; BEST
FT                   Arabidopsis thaliana protein match is: unknown protein
FT                   (TAIR:AT4G12370.1); Has 220 Blast hits to 215 proteins in
FT                   11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
FT                   0; Plants - 220; Viruses - 0; Other Eukaryotes - 0 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00893"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00893.1"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1G391"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG502056.1,INSD:EG456437.1,INSD:EG486004.1,
FT                   INSD:EG502030.1,INSD:EG529269.1,INSD:EG451143.1,
FT                   INSD:EG501991.1,INSD:EG486010.1,INSD:EG485988.1,
FT                   INSD:EG485994.1,INSD:EG451145.1,INSD:EG451146.1,
FT                   INSD:EG502025.1,INSD:EG451144.1,INSD:EG504221.1,
FT                   INSD:EG451147.1,INSD:EG486003.1,INSD:EG451155.1,
FT                   INSD:EG451149.1,INSD:EG486000.1,INSD:EG451156.1,
FT                   INSD:EG486009.1,INSD:EG451159.1,INSD:EG485996.1,
FT                   INSD:EG502007.1,INSD:EG485993.1,INSD:EG486006.1,
FT                   INSD:EG485985.1,INSD:EG486007.1,INSD:EG486001.1,
FT                   INSD:EG486005.1,INSD:EG432407.1,INSD:EG451148.1,
FT                   INSD:EG485990.1,INSD:EG486002.1,INSD:EG485991.1,
FT                   INSD:EG485999.1,INSD:EG504234.1,INSD:EG451158.1,
FT                   INSD:EG451157.1,INSD:EG485998.1,INSD:EG451142.1,
FT                   INSD:EG456438.1,INSD:EG451150.1,INSD:EG485995.1,
FT                   INSD:EG451154.1,INSD:EG485992.1,INSD:EG504229.1,
FT                   INSD:EG529270.1,INSD:EG485989.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ652790.1,INSD:DQ487693.1,INSD:EF183028.1"
FT                   /protein_id="AEE81951.1"
FT                   /translation="MLPSPSVHMASPPPSLNMASHPPSPATASRKRFQDSSKKIMNPSF
FT                   ADLPSSLIEEIMLLLVLKDNIRASAACKSWYEAGVSVRVVDKHPWLMCFPKRGNLFEFR
FT                   DPLHWKLHTLDLPELAESTVCYSRFGWLLMRKASSNDVFFFNPFSRDIISLPMCELDFQ
FT                   QIAFSCPPTSDDCVLLAIKFVPGEVNRVTVSTCNPGATKWITNDFPTFLRLFYMQSNLV
FT                   YRRDRFYCFNAEGTLYSFEPSYREWSYICADKLRCPYVHENQYMWCGKAVFLVEKKGEL
FT                   FVMFTCSNEKPMVYKLFSMKWKELSRTTLDGMTFFVSFYNSELRNNLPWMRNNVYFSRF
FT                   GYNRKHCVSFSFDESRYNTPKEWEQWVELCPPQSLWIDTPKNVLDYFL"
FT   gene            381788..382643
FT                   /locus_tag="AT4G00895"
FT   mRNA            381788..382643
FT                   /locus_tag="AT4G00895"
FT                   /product="ATPase, F1 complex, OSCP/delta subunit protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL113692.1,INSD:EL316298.1,INSD:EH813803.1,
FT                   INSD:EL171995.1,INSD:EL971828.1,INSD:CD534541.1,
FT                   INSD:AV816074.1,INSD:BP631413.1,INSD:EH876579.1,
FT                   INSD:DR371735.1,INSD:BP812275.2,INSD:BP667599.1,
FT                   INSD:DR323210.1,INSD:EH870016.1,INSD:BP842154.1,
FT                   INSD:DR323201.1,INSD:ES110236.1,INSD:EH822833.1,
FT                   INSD:BP812312.1,INSD:EL197034.1,INSD:ES021377.1,
FT                   INSD:EL202727.1,INSD:ES026724.1,INSD:EH866796.1,
FT                   INSD:EL301149.1,INSD:DR323207.1,INSD:EL055825.1,
FT                   INSD:BP625637.1,INSD:BP849058.1,INSD:DR379535.1,
FT                   INSD:BP785729.1,INSD:ES162538.1,INSD:EL286709.1,
FT                   INSD:EL255839.1,INSD:EL107471.1,INSD:AI997950.1,
FT                   INSD:DR323211.1,INSD:EL326740.1,INSD:EH814085.1,
FT                   INSD:AV785059.1,INSD:AV831447.1,INSD:EH901745.1,
FT                   INSD:ES067279.1,INSD:EL156896.1,INSD:DR323200.1,
FT                   INSD:BP630371.1,INSD:EL299082.1,INSD:AV823960.1,
FT                   INSD:EL111281.1,INSD:BP663926.1,INSD:EL983479.1,
FT                   INSD:BP630719.1,INSD:EH893700.1,INSD:EH924263.1,
FT                   INSD:DR251563.1,INSD:EL073292.1,INSD:EL173983.1,
FT                   INSD:EH967831.1,INSD:EH871110.1,INSD:DR323206.1,
FT                   INSD:ES209587.1,INSD:AV794802.1,INSD:EL027438.1,
FT                   INSD:DR323204.1,INSD:EL327142.1,INSD:EH949724.1,
FT                   INSD:DR323209.1,INSD:EH888521.1,INSD:DR323205.1,
FT                   INSD:ES045059.1,INSD:EL006984.1,INSD:DR323208.1,
FT                   INSD:EL168446.1,INSD:EL283528.1,INSD:ES073533.1,
FT                   INSD:EH951114.1,INSD:EL082942.1,INSD:EH902512.1,
FT                   INSD:CD532313.1,INSD:EL172583.1,INSD:EL202473.1,
FT                   INSD:EL255881.1,INSD:ES002437.1,INSD:EH860378.1,
FT                   INSD:BP778217.1,INSD:DR323202.1,INSD:EL270336.1,
FT                   INSD:EL260936.1,INSD:EL088915.1,INSD:EL064588.1,
FT                   INSD:BP669368.1,INSD:EL039682.1,INSD:EL307349.1,
FT                   INSD:EH828047.1,INSD:BP864072.1,INSD:BP863310.1,
FT                   INSD:ES099110.1,INSD:EH947072.1,INSD:BU635313.1,
FT                   INSD:EL327797.1,INSD:EL137758.1,INSD:DR323212.1,
FT                   INSD:DR323203.1,INSD:EL114084.1,INSD:EH872566.1,
FT                   INSD:ES069312.1,INSD:EH932234.1,INSD:EL119217.1,
FT                   INSD:EH924910.1,INSD:CD534229.1,INSD:EL306146.1,
FT                   INSD:BP640295.1,INSD:EH991418.1,INSD:EL006067.1,
FT                   INSD:EH889756.1,INSD:BP861164.1,INSD:BP816738.2"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY081648.1,INSD:BX828690.1,INSD:BX828741.1,
FT                   INSD:AY062778.1,INSD:AY084518.1"
FT   CDS_pept        381823..382398
FT                   /codon_start=1
FT                   /locus_tag="AT4G00895"
FT                   /product="ATPase, F1 complex, OSCP/delta subunit protein"
FT                   /note="ATPase, F1 complex, OSCP/delta subunit protein;
FT                   FUNCTIONS IN: hydrogen ion transporting ATP synthase
FT                   activity, rotational mechanism; INVOLVED IN: ATP synthesis
FT                   coupled proton transport; LOCATED IN: proton-transporting
FT                   ATP synthase complex, catalytic core F(1), plasma membrane,
FT                   chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   ATPase, F1 complex, OSCP/delta subunit
FT                   (InterPro:IPR000711); Has 48 Blast hits to 48 proteins in
FT                   22 species: Archae - 0; Bacteria - 0; Metazoa - 6; Fungi -
FT                   13; Plants - 26; Viruses - 0; Other Eukaryotes - 3 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00895"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00895.1"
FT                   /db_xref="GOA:Q8W481"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:Q8W481"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL113692.1,INSD:EL316298.1,INSD:EH813803.1,
FT                   INSD:EL171995.1,INSD:EL971828.1,INSD:CD534541.1,
FT                   INSD:AV816074.1,INSD:BP631413.1,INSD:EH876579.1,
FT                   INSD:DR371735.1,INSD:BP812275.2,INSD:BP667599.1,
FT                   INSD:DR323210.1,INSD:EH870016.1,INSD:BP842154.1,
FT                   INSD:DR323201.1,INSD:ES110236.1,INSD:EH822833.1,
FT                   INSD:BP812312.1,INSD:EL197034.1,INSD:ES021377.1,
FT                   INSD:EL202727.1,INSD:ES026724.1,INSD:EH866796.1,
FT                   INSD:EL301149.1,INSD:DR323207.1,INSD:EL055825.1,
FT                   INSD:BP625637.1,INSD:BP849058.1,INSD:DR379535.1,
FT                   INSD:BP785729.1,INSD:ES162538.1,INSD:EL286709.1,
FT                   INSD:EL255839.1,INSD:EL107471.1,INSD:AI997950.1,
FT                   INSD:DR323211.1,INSD:EL326740.1,INSD:EH814085.1,
FT                   INSD:AV785059.1,INSD:AV831447.1,INSD:EH901745.1,
FT                   INSD:ES067279.1,INSD:EL156896.1,INSD:DR323200.1,
FT                   INSD:BP630371.1,INSD:EL299082.1,INSD:AV823960.1,
FT                   INSD:EL111281.1,INSD:BP663926.1,INSD:EL983479.1,
FT                   INSD:BP630719.1,INSD:EH893700.1,INSD:EH924263.1,
FT                   INSD:DR251563.1,INSD:EL073292.1,INSD:EL173983.1,
FT                   INSD:EH967831.1,INSD:EH871110.1,INSD:DR323206.1,
FT                   INSD:ES209587.1,INSD:AV794802.1,INSD:EL027438.1,
FT                   INSD:DR323204.1,INSD:EL327142.1,INSD:EH949724.1,
FT                   INSD:DR323209.1,INSD:EH888521.1,INSD:DR323205.1,
FT                   INSD:ES045059.1,INSD:EL006984.1,INSD:DR323208.1,
FT                   INSD:EL168446.1,INSD:EL283528.1,INSD:ES073533.1,
FT                   INSD:EH951114.1,INSD:EL082942.1,INSD:EH902512.1,
FT                   INSD:CD532313.1,INSD:EL172583.1,INSD:EL202473.1,
FT                   INSD:EL255881.1,INSD:ES002437.1,INSD:EH860378.1,
FT                   INSD:BP778217.1,INSD:DR323202.1,INSD:EL270336.1,
FT                   INSD:EL260936.1,INSD:EL088915.1,INSD:EL064588.1,
FT                   INSD:BP669368.1,INSD:EL039682.1,INSD:EL307349.1,
FT                   INSD:EH828047.1,INSD:BP864072.1,INSD:BP863310.1,
FT                   INSD:ES099110.1,INSD:EH947072.1,INSD:BU635313.1,
FT                   INSD:EL327797.1,INSD:EL137758.1,INSD:DR323212.1,
FT                   INSD:DR323203.1,INSD:EL114084.1,INSD:EH872566.1,
FT                   INSD:ES069312.1,INSD:EH932234.1,INSD:EL119217.1,
FT                   INSD:EH924910.1,INSD:CD534229.1,INSD:EL306146.1,
FT                   INSD:BP640295.1,INSD:EH991418.1,INSD:EL006067.1,
FT                   INSD:EH889756.1,INSD:BP861164.1,INSD:BP816738.2"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY081648.1,INSD:BX828690.1,INSD:BX828741.1,
FT                   INSD:AY062778.1,INSD:AY084518.1"
FT                   /protein_id="AEE81952.1"
FT                   /translation="MDTLSASVSSLNLPSLPPPPQPPLRSISSRFKSTVNATTSASSTN
FT                   LSKPTSSSPSSASYSQNRNPNFLKAISFHLPQTKPSRVVTPPPPPVHDKAASGFAAALV
FT                   SVCQSKNCLGRTQEDVRRLMEFLVGEEKKRNKVLVNDVVERGKFGKHFKGLVKMLIARG
FT                   KSGILVDVLMEFERICNELVSKKLVWVS"
FT   gene            complement(382663..386850)
FT                   /gene="ECA2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 2"
FT                   /gene_synonym="ATECA2"
FT                   /gene_synonym="A_TM018A10.4"
FT                   /gene_synonym="A_TM018A10_4"
FT                   /gene_synonym="ER-type Ca2+-ATPase 2"
FT                   /gene_synonym="T18A10.20"
FT                   /gene_synonym="T18A10_20"
FT                   /locus_tag="AT4G00900"
FT                   /note="Type IIA (SERCA-type) Ca2+ ATPase, catalyzes the
FT                   efflux of calcium from the cytoplasm."
FT   mRNA            complement(join(382663..383494,383590..383699,
FT                   383792..384454,384541..384662,384762..386300,
FT                   386497..386850))
FT                   /gene="ECA2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 2"
FT                   /gene_synonym="ATECA2"
FT                   /gene_synonym="A_TM018A10.4"
FT                   /gene_synonym="A_TM018A10_4"
FT                   /gene_synonym="ER-type Ca2+-ATPase 2"
FT                   /gene_synonym="T18A10.20"
FT                   /gene_synonym="T18A10_20"
FT                   /locus_tag="AT4G00900"
FT                   /product="ER-type Ca2+-ATPase 2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES137717.1,INSD:ES016748.1,INSD:EH955802.1,
FT                   INSD:CD532795.1,INSD:CD529148.1,INSD:EH816461.1,
FT                   INSD:ES165159.1,INSD:ES121244.1,INSD:EL983479.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ989373.1,INSD:DQ989374.1,INSD:AJ132387.1"
FT   mRNA            complement(join(382663..383494,383590..383699,
FT                   383792..384454,384541..384662,384762..386479))
FT                   /gene="ECA2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 2"
FT                   /gene_synonym="ATECA2"
FT                   /gene_synonym="A_TM018A10.4"
FT                   /gene_synonym="A_TM018A10_4"
FT                   /gene_synonym="ER-type Ca2+-ATPase 2"
FT                   /gene_synonym="T18A10.20"
FT                   /gene_synonym="T18A10_20"
FT                   /locus_tag="AT4G00900"
FT                   /product="ER-type Ca2+-ATPase 2"
FT   CDS_pept        complement(join(382690..383494,383590..383699,
FT                   383792..384454,384541..384662,384762..386226))
FT                   /codon_start=1
FT                   /gene="ECA2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 2"
FT                   /gene_synonym="ATECA2"
FT                   /gene_synonym="A_TM018A10.4"
FT                   /gene_synonym="A_TM018A10_4"
FT                   /gene_synonym="ER-type Ca2+-ATPase 2"
FT                   /gene_synonym="T18A10.20"
FT                   /gene_synonym="T18A10_20"
FT                   /locus_tag="AT4G00900"
FT                   /product="ER-type Ca2+-ATPase 2"
FT                   /db_xref="GOA:O23087"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23087"
FT                   /protein_id="ANM67918.1"
FT                   /translation="MEEEKSFSAWSWSVEQCLKEYKTRLDKGLTSEDVQIRRQKYGFNE
FT                   LAKEKGKPLWHLVLEQFDDTLVKILLGAAFISFVLAFLGEEHGSGSGFEAFVEPFVIVL
FT                   ILILNAVVGVWQESNAEKALEALKEMQCESAKVLRDGNVLPNLPARELVPGDIVELNVG
FT                   DKVPADMRVSGLKTSTLRVEQSSLTGEAMPVLKGANLVVMDDCELQGKENMVFAGTTVV
FT                   NGSCVCIVTSIGMDTEIGKIQRQIHEASLEESETPLKKKLDEFGSRLTTAICIVCVLVW
FT                   MINYKNFVSWDVVDGYKPVNIKFSFEKCTYYFKIAVALAVAAIPEGLPAVITTCLALGT
FT                   RKMAQKNAIVRKLPSVETLGCTTVICSDKTGTLTTNQMSATEFFTLGGKTTTTRVFSVS
FT                   GTTYDPKDGGIVDWGCNNMDANLQAVAEICSICNDAGVFYEGKLFRATGLPTEAALKVL
FT                   VEKMGIPEKKNSENIEEVTNFSDNGSSVKLACCDWWNKRSKKVATLEFDRVRKSMSVIV
FT                   SEPNGQNRLLVKGAAESILERSSFAQLADGSLVALDESSREVILKKHSEMTSKGLRCLG
FT                   LAYKDELGEFSDYSSEEHPSHKKLLDPSSYSNIETNLIFVGVVGLRDPPREEVGRAIED
FT                   CRDAGIRVMVITGDNKSTAEAICCEIRLFSENEDLSQSSFTGKEFMSLPASRRSEILSK
FT                   SGGKVFSRAEPRHKQEIVRMLKEMGEIVAMTGDGVNDAPALKLADIGIAMGITGTEVAK
FT                   EASDMVLADDNFSTIVSAVAEGRSIYNNMKAFIRYMISSNVGEVISIFLTAALGIPECM
FT                   IPVQLLWVNLVTDGPPATALGFNPADIDIMKKPPRKSDDCLIDSWVLIRYLVIGSYVGV
FT                   ATVGIFVLWYTQASFLGISLISDGHTLVSFTQLQNWSECSSWGTNFTATPYTVAGGLRT
FT                   IAFENNPCDYFTLGKVKPMTLSLTVLVAIEMFNSLNALSEDNSLLTMPPWRNPWLLVAM
FT                   TVSFALHCVILYVPFLANVFGIVPLSFREWFVVILVSFPVILIDEALKFIGRCRRTRIK
FT                   KKIKTM"
FT   CDS_pept        complement(join(382690..383494,383590..383699,
FT                   383792..384454,384541..384662,384762..386226))
FT                   /codon_start=1
FT                   /gene="ECA2"
FT                   /gene_synonym="ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 2"
FT                   /gene_synonym="ATECA2"
FT                   /gene_synonym="A_TM018A10.4"
FT                   /gene_synonym="A_TM018A10_4"
FT                   /gene_synonym="ER-type Ca2+-ATPase 2"
FT                   /gene_synonym="T18A10.20"
FT                   /gene_synonym="T18A10_20"
FT                   /locus_tag="AT4G00900"
FT                   /product="ER-type Ca2+-ATPase 2"
FT                   /note="ER-type Ca2+-ATPase 2 (ECA2); FUNCTIONS IN:
FT                   calcium-transporting ATPase activity; INVOLVED IN: calcium
FT                   ion transport; LOCATED IN: integral to membrane, membrane;
FT                   EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: ATPase, P-type,
FT                   ATPase-associated domain (InterPro:IPR008250), ATPase,
FT                   P-type, calcium-transporting (InterPro:IPR005782), ATPase,
FT                   P-type cation-transporter, N-terminal (InterPro:IPR004014),
FT                   ATPase, P-type cation exchange, alpha subunit
FT                   (InterPro:IPR006069), Haloacid dehalogenase-like hydrolase
FT                   (InterPro:IPR005834), ATPase, P-type,
FT                   K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter (InterPro:IPR001757),
FT                   ATPase, P-type phosphorylation site (InterPro:IPR018303),
FT                   ATPase, P-type cation-transporter, C-terminal
FT                   (InterPro:IPR006068); BEST Arabidopsis thaliana protein
FT                   match is: ER-type Ca2+-ATPase 1 (TAIR:AT1G07810.1); Has
FT                   1807 Blast hits to 1807 proteins in 277 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00900"
FT                   /db_xref="GOA:O23087"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23087"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES137717.1,INSD:ES016748.1,INSD:EH955802.1,
FT                   INSD:CD532795.1,INSD:CD529148.1,INSD:EH816461.1,
FT                   INSD:ES165159.1,INSD:ES121244.1,INSD:EL983479.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ989373.1,INSD:DQ989374.1,INSD:AJ132387.1"
FT                   /protein_id="AEE81953.1"
FT                   /translation="MEEEKSFSAWSWSVEQCLKEYKTRLDKGLTSEDVQIRRQKYGFNE
FT                   LAKEKGKPLWHLVLEQFDDTLVKILLGAAFISFVLAFLGEEHGSGSGFEAFVEPFVIVL
FT                   ILILNAVVGVWQESNAEKALEALKEMQCESAKVLRDGNVLPNLPARELVPGDIVELNVG
FT                   DKVPADMRVSGLKTSTLRVEQSSLTGEAMPVLKGANLVVMDDCELQGKENMVFAGTTVV
FT                   NGSCVCIVTSIGMDTEIGKIQRQIHEASLEESETPLKKKLDEFGSRLTTAICIVCVLVW
FT                   MINYKNFVSWDVVDGYKPVNIKFSFEKCTYYFKIAVALAVAAIPEGLPAVITTCLALGT
FT                   RKMAQKNAIVRKLPSVETLGCTTVICSDKTGTLTTNQMSATEFFTLGGKTTTTRVFSVS
FT                   GTTYDPKDGGIVDWGCNNMDANLQAVAEICSICNDAGVFYEGKLFRATGLPTEAALKVL
FT                   VEKMGIPEKKNSENIEEVTNFSDNGSSVKLACCDWWNKRSKKVATLEFDRVRKSMSVIV
FT                   SEPNGQNRLLVKGAAESILERSSFAQLADGSLVALDESSREVILKKHSEMTSKGLRCLG
FT                   LAYKDELGEFSDYSSEEHPSHKKLLDPSSYSNIETNLIFVGVVGLRDPPREEVGRAIED
FT                   CRDAGIRVMVITGDNKSTAEAICCEIRLFSENEDLSQSSFTGKEFMSLPASRRSEILSK
FT                   SGGKVFSRAEPRHKQEIVRMLKEMGEIVAMTGDGVNDAPALKLADIGIAMGITGTEVAK
FT                   EASDMVLADDNFSTIVSAVAEGRSIYNNMKAFIRYMISSNVGEVISIFLTAALGIPECM
FT                   IPVQLLWVNLVTDGPPATALGFNPADIDIMKKPPRKSDDCLIDSWVLIRYLVIGSYVGV
FT                   ATVGIFVLWYTQASFLGISLISDGHTLVSFTQLQNWSECSSWGTNFTATPYTVAGGLRT
FT                   IAFENNPCDYFTLGKVKPMTLSLTVLVAIEMFNSLNALSEDNSLLTMPPWRNPWLLVAM
FT                   TVSFALHCVILYVPFLANVFGIVPLSFREWFVVILVSFPVILIDEALKFIGRCRRTRIK
FT                   KKIKTM"
FT   gene            complement(387388..391441)
FT                   /gene_synonym="A_TM018A10.3"
FT                   /gene_synonym="A_TM018A10_3"
FT                   /gene_synonym="T18A10.21"
FT                   /gene_synonym="T18A10_21"
FT                   /locus_tag="AT4G00910"
FT   mRNA            complement(join(387388..389810,389897..390040,
FT                   390138..390262,390342..390614,390718..390855,
FT                   390951..391441))
FT                   /gene_synonym="A_TM018A10.3"
FT                   /gene_synonym="A_TM018A10_3"
FT                   /gene_synonym="T18A10.21"
FT                   /gene_synonym="T18A10_21"
FT                   /locus_tag="AT4G00910"
FT                   /product="aluminum activated malate transporter family
FT                   protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH865215.1,INSD:AI992907.1,INSD:AA586261.1,
FT                   INSD:DR233754.1"
FT   gene            387451..389403
FT                   /locus_tag="AT4G00905"
FT   mRNA            join(387451..387958,388363..389403)
FT                   /locus_tag="AT4G00905"
FT                   /product="NC domain-containing protein-like protein"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES140721.1,INSD:EL309667.1,INSD:EL333481.1,
FT                   INSD:DR231703.1,INSD:AV560292.1"
FT   CDS_pept        join(387865..387958,388363..389060)
FT                   /codon_start=1
FT                   /locus_tag="AT4G00905"
FT                   /product="NC domain-containing protein-like protein"
FT                   /note="NC domain-containing protein-related; CONTAINS
FT                   InterPro DOMAIN/s: NC (InterPro:IPR007053); BEST
FT                   Arabidopsis thaliana protein match is: NC domain-containing
FT                   protein-related (TAIR:AT1G01225.1); Has 30201 Blast hits to
FT                   17322 proteins in 780 species: Archae - 12; Bacteria -
FT                   1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses
FT                   - 0; Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00905"
FT                   /db_xref="EnsemblGenomes-Tr:AT4G00905.1"
FT                   /db_xref="GOA:Q3EAE0"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3EAE0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES140721.1,INSD:EL309667.1,INSD:EL333481.1,
FT                   INSD:DR231703.1,INSD:AV560292.1"
FT                   /protein_id="AEE81954.1"
FT                   /translation="MGVLTNKVERDELKPGDHIYTYRAVFAYSHHGVFVGGCKVVHFKP
FT                   EHSLISPTLASSSSSSSSSVSEVNDSSEAPCPTYPDCGYKRPKSGVVLSCLDCFLKKGS
FT                   LYRFDYGVSSSIFLTRFRGGTCTTAPSDPLQTVIHRAMHLLQNGFGNYNVFQNNCEDFA
FT                   LYCKTGLLILDKNGVGRSGQASSIIGAPLAALLSSPLTLLIPNPVGVATVTAGMYCMSR
FT                   YATDIGVRNDVIKVPVEDLALNLGLKPLKRKRKACDTSISR"
FT   CDS_pept        complement(join(389370..389810,389897..390040,
FT                   390138..390262,390342..390614,390718..390855,
FT                   390951..391287))
FT                   /codon_start=1
FT                   /gene_synonym="A_TM018A10.3"
FT                   /gene_synonym="A_TM018A10_3"
FT                   /gene_synonym="T18A10.21"
FT                   /gene_synonym="T18A10_21"
FT                   /locus_tag="AT4G00910"
FT                   /product="aluminum activated malate transporter family
FT                   protein"
FT                   /note="Aluminium activated malate transporter family
FT                   protein; FUNCTIONS IN: molecular_function unknown; INVOLVED
FT                   IN: response to aluminum ion; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: sepal, root,
FT                   pedicel; EXPRESSED DURING: 4 anthesis; CONTAINS InterPro
FT                   DOMAIN/s: Malate transporter, aliminium toerance
FT                   (InterPro:IPR020966); BEST Arabidopsis thaliana protein
FT                   match is: Aluminium activated malate transporter family
FT                   protein (TAIR:AT1G08440.1); Has 1015 Blast hits to 1014
FT                   proteins in 357 species: Archae - 0; Bacteria - 624;
FT                   Metazoa - 0; Fungi - 16; Plants - 351; Viruses - 0; Other
FT                   Eukaryotes - 24 (source: NCBI BLink)."
FT                   /db_xref="GOA:A0A178UU23"
FT                   /db_xref="InterPro:IPR020966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178UU23"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH865215.1,INSD:AI992907.1,INSD:AA586261.1,
FT                   INSD:DR233754.1"
FT                   /protein_id="AEE81955.2"
FT                   /translation="MATQEAGKLEWRISVDNGTTERLVPRSGLSKRIFLWLKDLVMKVI
FT                   MERVAKFMRKAWRIGADDPAKVVHCLKVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTV
FT                   VVVFESNVGATFCKCVNRVVATILAGSLGIAVHWVATQSGKAEVFVIGCSVFLFAFAAT
FT                   YSRFVPSFKARFDYGAMIFILTFSLVSVGGYRVDKLVELAQQRVSTIAIGTSICIIITV
FT                   FFCPIWAGSQLHRLIERNLEKLADSLDGCVAEYFKENEVSTNRNEDENTNMKLQGFKCV
FT                   LNSKGTEEAMANLARWEPAHGSFNFRHPWKLYVKIGAAMRRCAYCLENLSICINYETEA
FT                   PDQVKNHFGEACMKLSSASSKILRELADMMKNTRKSSKMDFLVFDMNSAVQELQETLKN
FT                   VPIETNKPEEVPSEEENKVDSEERTTSMSLHEVLPVATLVSLLIENAARIQTAVEAVDE
FT                   LANLADFEQDSKKKTGDNNTKQPPLSS"
FT   gene            393767..395382
FT                   /gene_synonym="A_TM018A10.16"
FT                   /gene_synonym="A_TM018A10_16"
FT                   /gene_synonym="T18A10.22"
FT                   /gene_synonym="T18A10_22"
FT                   /locus_tag="AT4G00920"
FT   mRNA            join(393767..393884,393965..394032,394113..394422,
FT                   394724..394819,394933..395076,395174..395382)
FT                   /gene_synonym="A_TM018A10.16"
FT                   /gene_synonym="A_TM018A10_16"
FT                   /gene_synonym="T18A10.22"
FT                   /gene_synonym="T18A10_22"
FT                   /locus_tag="AT4G00920"
FT                   /product="COP1-interacting protein-like protein"
FT                   /inference="similar to RNA sequence, EST:INSD:ES074535.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ056636.1"
FT   CDS_pept        join(393767..393884,393965..394032,394113..394422,
FT                   394724..394819,394933..395076,395174..395382)
FT                   /codon_start=1
FT                   /gene_synonym="A_TM018A10.16"
FT                   /gene_synonym="A_TM018A10_16"
FT                   /gene_synonym="T18A10.22"
FT                   /gene_synonym="T18A10_22"
FT                   /locus_tag="AT4G00920"
FT                   /product="COP1-interacting protein-like protein"
FT                   /note="COP1-interacting protein-related; BEST Arabidopsis
FT                   thaliana protein match is: 4'-phosphopantetheinyl
FT                   transferase superfamily (TAIR:AT2G02770.1); Has 278 Blast
FT                   hits to 253 proteins in 77 species: Archae - 0; Bacteria -
FT                   14; Metazoa - 72; Fungi - 22; Plants - 72; Viruses - 1;
FT                   Other Eukaryotes - 97 (source: NCBI BLink)."
FT                   /db_xref="UniProtKB/TrEMBL:O23085"
FT                   /inference="similar to RNA sequence, EST:INSD:ES074535.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ056636.1"
FT                   /protein_id="AEE81956.1"
FT                   /translation="MATRETNSSPEIRCVFVETNLDTRLGVLMERDDIVSTFKEKICKE
FT                   HETCFPSFGNITISALKVKCGGQFYHLVDSLILNTAFPSKETFLVVDVLRVEEKGKMLT
FT                   GETPLSNPNLLERETKTIKDVDKTKKRKLKSLDSAKRSRKKLSLVDQSSGKGVVEPFAI
FT                   GKDLEKGEKSVATDIALVDDENESHKDDDVRVVEDINQSADVENEGINKDDGVDATSES
FT                   FPNSTGEKKPVTNILVLMAPVPNKKKVGTKNNGGKDADDKASTKEVTEVASSSRNVDHD
FT                   VVMGDLQENVEKVVKKSTKKSKKKQSSDVVEEA"
FT   gene            395931..396357
FT                   /locus_tag="AT4G00925"
FT   mRNA            join(395931..396046,396130..396357)
FT                   /locus_tag="AT4G00925"
FT                   /product="hypothetical protein"
FT   gene            complement(395956..396236)
FT                   /locus_tag="AT4G03785"
FT   ncRNA           complement(395956..396236)
FT                   /locus_tag="AT4G03785"
FT                   /product="other RNA"
FT                   /ncRNA_class="lncRNA"
FT   CDS_pept        396219..396344
FT                   /codon_start=1
FT                   /locus_tag="AT4G00925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B8C5"
FT                   /protein_id="ANM67846.1"
FT                   /translation="MVPKFVRKWRSEEDSDGNLQAKRIMHRNKSLVPYIVKRIKY"
FT   gene            396444..400994
FT                   /gene="CIP4.1"
FT                   /gene_synonym="A_TM018A10.17"
FT                   /gene_synonym="A_TM018A10_17"
FT                   /gene_synonym="COP1-interacting protein 4.1"
FT                   /gene_synonym="T18A10.23"
FT                   /gene_synonym="T18A10_23"
FT                   /locus_tag="AT4G00930"
FT                   /note="Encodes COP1-interacting protein CIP4.1."
FT   mRNA            join(396444..396675,396764..396831,396908..397322,
FT                   397436..397645,397724..398155,398230..398538,
FT                   398616..398963,399066..400502,400590..400939)
FT                   /gene="CIP4.1"
FT                   /gene_synonym="A_TM018A10.17"
FT                   /gene_synonym="A_TM018A10_17"
FT                   /gene_synonym="COP1-interacting protein 4.1"
FT                   /gene_synonym="T18A10.23"
FT                   /gene_synonym="T18A10_23"
FT                   /locus_tag="AT4G00930"
FT                   /product="COP1-interacting protein 4.1"
FT   mRNA            join(396444..396675,396764..396831,396908..397322,
FT                   397436..397645,397724..398155,398230..398538,
FT                   398616..398963,399066..400394,400475..400939)
FT                   /gene="CIP4.1"
FT                   /gene_synonym="A_TM018A10.17"
FT                   /gene_synonym="A_TM018A10_17"
FT                   /gene_synonym="COP1-interacting protein 4.1"
FT                   /gene_synonym="T18A10.23"
FT                   /gene_synonym="T18A10_23"
FT                   /locus_tag="AT4G00930"
FT                   /product="COP1-interacting protein 4.1"
FT   mRNA            join(396444..396675,396764..396831,396908..397322,
FT                   397436..397645,397724..398155,398230..398538,
FT                   398616..398963,399066..400394,400475..400502,
FT                   400590..400939)
FT                   /gene="CIP4.1"
FT                   /gene_synonym="A_TM018A10.17"
FT                   /gene_synonym="A_TM018A10_17"
FT                   /gene_synonym="COP1-interacting protein 4.1"
FT                   /gene_synonym="T18A10.23"
FT                   /gene_synonym="T18A10_23"
FT                   /locus_tag="AT4G00930"
FT                   /product="COP1-interacting protein 4.1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES200143.1,INSD:ES183568.1,INSD:ES087001.1,
FT                   INSD:EH903048.1,INSD:EH830506.1,INSD:ES041631.1,
FT                   INSD:ES082942.1,INSD:ES145623.1,INSD:ES005058.1"
FT   mRNA            join(396448..396675,396764..396831,396908..397322,
FT                   397436..397645,397724..398155,398230..398538,
FT                   398616..398963,399066..399544,399662..400394,
FT                   400475..400502,400590..400949)
FT                   /gene="CIP4.1"
FT                   /gene_synonym="A_TM018A10.17"
FT                   /gene_synonym="A_TM018A10_17"
FT                   /gene_synonym="COP1-interacting protein 4.1"
FT                   /gene_synonym="T18A10.23"
FT                   /gene_synonym="T18A10_23"
FT                   /locus_tag="AT4G00930"
FT                   /product="COP1-interacting protein 4.1"
FT   mRNA            join(396454..396675,396764..396831,396908..397322,
FT                   397436..397645,397724..398155,398230..398368,
FT                   398779..398963,399066..400394,400475..400502,
FT                   400590..400994)
FT                   /gene="CIP4.1"
FT                   /gene_synonym="A_TM018A10.17"
FT                   /gene_synonym="A_TM018A10_17"
FT                   /gene_synonym="COP1-interacting protein 4.1"
FT                   /gene_synonym="T18A10.23"
FT                   /gene_synonym="T18A10_23"
FT                   /locus_tag="AT4G00930"
FT                   /product="COP1-interacting protein 4.1"
FT   CDS_pept        join(396558..396675,396764..396831,396908..397322,
FT                   397436..397645,397724..398155,398230..398538,
FT                   398616..398963,399066..400394,400475..400502,
FT                   400590..400734)
FT                   /codon_start=1
FT                   /gene="CIP4.1"
FT                   /gene_synonym="A_TM018A10.17"
FT                   /gene_synonym="A_TM018A10_17"
FT                   /gene_synonym="COP1-interacting protein 4.1"
FT                   /gene_synonym="T18A10.23"
FT                   /gene_synonym="T18A10_23"
FT                   /locus_tag="AT4G00930"
FT                   /product="COP1-interacting protein 4.1"
FT                   /note="COP1-interacting protein 4.1 (CIP4.1); FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: cellular_component unknown; EXPRESSED
FT                   IN: cultured cell; BEST Arabidopsis thaliana protein match
FT                   is: COP1-interacting protein 4 (TAIR:AT5G37190.1); Has
FT                   16041 Blast hits to 11566 proteins in 1061 species: Archae
FT                   - 57; Bacteria - 4473; Metazoa - 4631; Fungi - 1351; Plants
FT                   - 620; Viruses - 68; Other Eukaryotes - 4841 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT4G00930"
FT                   /db_xref="GOA:F4JHQ0"
FT                   /db_xref="UniProtKB/TrEMBL:F4JHQ0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES200143.1,INSD:ES183568.1,INSD:ES087001.1,
FT                   INSD:EH903048.1,INSD:EH830506.1,INSD:ES041631.1,
FT                   INSD:ES082942.1,INSD:ES145623.1,INSD:ES005058.1"
FT                   /protein_id="AEE81957.1"
FT                   /translat