(data stored in SCRATCH3701 zone)

EMBL: CP015020

ID   CP015020; SV 1; circular; genomic DNA; STD; PRO; 5561698 BP.
XX
AC   CP015020;
XX
PR   Project:PRJNA299666;
XX
DT   08-APR-2016 (Rel. 128, Created)
DT   08-APR-2016 (Rel. 128, Last updated, Version 1)
XX
DE   Escherichia coli strain 28RC1, complete genome.
XX
KW   .
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-5561698
RA   Baranzoni G.M., Fratamico P., Reichenberger E., Kim G.-H., Breidt F.,
RA   Kay K.;
RT   "Complete Genome Sequences of Escherichia coli O157:H7 strains SRCC 1675
RT   and 28RC";
RL   Unpublished.
XX
RN   [2]
RP   1-5561698
RA   Baranzoni G.M., Fratamico P., Reichenberger E., Kim G.-H., Breidt F.,
RA   Kay K.;
RT   ;
RL   Submitted (30-MAR-2016) to the INSDC.
RL   ARS, USDA, 600 E Mermaid Lane, Wyndmoor, PA 19038, USA
XX
DR   MD5; 5454c4526839993cfb40e59388e2260b.
DR   BioSample; SAMN04202540.
DR   EnsemblGenomes-Gn; ARC77_00005.
DR   EnsemblGenomes-Gn; ARC77_00015.
DR   EnsemblGenomes-Gn; ARC77_00020.
DR   EnsemblGenomes-Gn; ARC77_00025.
DR   EnsemblGenomes-Gn; ARC77_00030.
DR   EnsemblGenomes-Gn; ARC77_00035.
DR   EnsemblGenomes-Gn; ARC77_00040.
DR   EnsemblGenomes-Gn; ARC77_00690.
DR   EnsemblGenomes-Gn; ARC77_00935.
DR   EnsemblGenomes-Gn; ARC77_01080.
DR   EnsemblGenomes-Gn; ARC77_01195.
DR   EnsemblGenomes-Gn; ARC77_01200.
DR   EnsemblGenomes-Gn; ARC77_01455.
DR   EnsemblGenomes-Gn; ARC77_01465.
DR   EnsemblGenomes-Gn; ARC77_01640.
DR   EnsemblGenomes-Gn; ARC77_01775.
DR   EnsemblGenomes-Gn; ARC77_01780.
DR   EnsemblGenomes-Gn; ARC77_01785.
DR   EnsemblGenomes-Gn; ARC77_01810.
DR   EnsemblGenomes-Gn; ARC77_01925.
DR   EnsemblGenomes-Gn; ARC77_01995.
DR   EnsemblGenomes-Gn; ARC77_02130.
DR   EnsemblGenomes-Gn; ARC77_02135.
DR   EnsemblGenomes-Gn; ARC77_02250.
DR   EnsemblGenomes-Gn; ARC77_02295.
DR   EnsemblGenomes-Gn; ARC77_02300.
DR   EnsemblGenomes-Gn; ARC77_02545.
DR   EnsemblGenomes-Gn; ARC77_02645.
DR   EnsemblGenomes-Gn; ARC77_02950.
DR   EnsemblGenomes-Gn; ARC77_02975.
DR   EnsemblGenomes-Gn; ARC77_03060.
DR   EnsemblGenomes-Gn; ARC77_03145.
DR   EnsemblGenomes-Gn; ARC77_03185.
DR   EnsemblGenomes-Gn; ARC77_03485.
DR   EnsemblGenomes-Gn; ARC77_03720.
DR   EnsemblGenomes-Gn; ARC77_03820.
DR   EnsemblGenomes-Gn; ARC77_04130.
DR   EnsemblGenomes-Gn; ARC77_04135.
DR   EnsemblGenomes-Gn; ARC77_04140.
DR   EnsemblGenomes-Gn; ARC77_04565.
DR   EnsemblGenomes-Gn; ARC77_04600.
DR   EnsemblGenomes-Gn; ARC77_04605.
DR   EnsemblGenomes-Gn; ARC77_04610.
DR   EnsemblGenomes-Gn; ARC77_04730.
DR   EnsemblGenomes-Gn; ARC77_04745.
DR   EnsemblGenomes-Gn; ARC77_04885.
DR   EnsemblGenomes-Gn; ARC77_05030.
DR   EnsemblGenomes-Gn; ARC77_05100.
DR   EnsemblGenomes-Gn; ARC77_05105.
DR   EnsemblGenomes-Gn; ARC77_05110.
DR   EnsemblGenomes-Gn; ARC77_05230.
DR   EnsemblGenomes-Gn; ARC77_05240.
DR   EnsemblGenomes-Gn; ARC77_05270.
DR   EnsemblGenomes-Gn; ARC77_05280.
DR   EnsemblGenomes-Gn; ARC77_05295.
DR   EnsemblGenomes-Gn; ARC77_05495.
DR   EnsemblGenomes-Gn; ARC77_05635.
DR   EnsemblGenomes-Gn; ARC77_05640.
DR   EnsemblGenomes-Gn; ARC77_05645.
DR   EnsemblGenomes-Gn; ARC77_05715.
DR   EnsemblGenomes-Gn; ARC77_05955.
DR   EnsemblGenomes-Gn; ARC77_06155.
DR   EnsemblGenomes-Gn; ARC77_06370.
DR   EnsemblGenomes-Gn; ARC77_06575.
DR   EnsemblGenomes-Gn; ARC77_06655.
DR   EnsemblGenomes-Gn; ARC77_06710.
DR   EnsemblGenomes-Gn; ARC77_06715.
DR   EnsemblGenomes-Gn; ARC77_06720.
DR   EnsemblGenomes-Gn; ARC77_06865.
DR   EnsemblGenomes-Gn; ARC77_07270.
DR   EnsemblGenomes-Gn; ARC77_07405.
DR   EnsemblGenomes-Gn; ARC77_07435.
DR   EnsemblGenomes-Gn; ARC77_07545.
DR   EnsemblGenomes-Gn; ARC77_07560.
DR   EnsemblGenomes-Gn; ARC77_08050.
DR   EnsemblGenomes-Gn; ARC77_08285.
DR   EnsemblGenomes-Gn; ARC77_08290.
DR   EnsemblGenomes-Gn; ARC77_08320.
DR   EnsemblGenomes-Gn; ARC77_08325.
DR   EnsemblGenomes-Gn; ARC77_08330.
DR   EnsemblGenomes-Gn; ARC77_08335.
DR   EnsemblGenomes-Gn; ARC77_08400.
DR   EnsemblGenomes-Gn; ARC77_09020.
DR   EnsemblGenomes-Gn; ARC77_09260.
DR   EnsemblGenomes-Gn; ARC77_09265.
DR   EnsemblGenomes-Gn; ARC77_09270.
DR   EnsemblGenomes-Gn; ARC77_09275.
DR   EnsemblGenomes-Gn; ARC77_09280.
DR   EnsemblGenomes-Gn; ARC77_09420.
DR   EnsemblGenomes-Gn; ARC77_09430.
DR   EnsemblGenomes-Gn; ARC77_09475.
DR   EnsemblGenomes-Gn; ARC77_09495.
DR   EnsemblGenomes-Gn; ARC77_09675.
DR   EnsemblGenomes-Gn; ARC77_09680.
DR   EnsemblGenomes-Gn; ARC77_09685.
DR   EnsemblGenomes-Gn; ARC77_09690.
DR   EnsemblGenomes-Gn; ARC77_09695.
DR   EnsemblGenomes-Gn; ARC77_09735.
DR   EnsemblGenomes-Gn; ARC77_09740.
DR   EnsemblGenomes-Gn; ARC77_10085.
DR   EnsemblGenomes-Gn; ARC77_10180.
DR   EnsemblGenomes-Gn; ARC77_10315.
DR   EnsemblGenomes-Gn; ARC77_10320.
DR   EnsemblGenomes-Gn; ARC77_10325.
DR   EnsemblGenomes-Gn; ARC77_10575.
DR   EnsemblGenomes-Gn; ARC77_10595.
DR   EnsemblGenomes-Gn; ARC77_10635.
DR   EnsemblGenomes-Gn; ARC77_10670.
DR   EnsemblGenomes-Gn; ARC77_10775.
DR   EnsemblGenomes-Gn; ARC77_10785.
DR   EnsemblGenomes-Gn; ARC77_10905.
DR   EnsemblGenomes-Gn; ARC77_11220.
DR   EnsemblGenomes-Gn; ARC77_11230.
DR   EnsemblGenomes-Gn; ARC77_11245.
DR   EnsemblGenomes-Gn; ARC77_11280.
DR   EnsemblGenomes-Gn; ARC77_11340.
DR   EnsemblGenomes-Gn; ARC77_11365.
DR   EnsemblGenomes-Gn; ARC77_11785.
DR   EnsemblGenomes-Gn; ARC77_11860.
DR   EnsemblGenomes-Gn; ARC77_11875.
DR   EnsemblGenomes-Gn; ARC77_12045.
DR   EnsemblGenomes-Gn; ARC77_12170.
DR   EnsemblGenomes-Gn; ARC77_12305.
DR   EnsemblGenomes-Gn; ARC77_12320.
DR   EnsemblGenomes-Gn; ARC77_12760.
DR   EnsemblGenomes-Gn; ARC77_12795.
DR   EnsemblGenomes-Gn; ARC77_12800.
DR   EnsemblGenomes-Gn; ARC77_12805.
DR   EnsemblGenomes-Gn; ARC77_12810.
DR   EnsemblGenomes-Gn; ARC77_12815.
DR   EnsemblGenomes-Gn; ARC77_12820.
DR   EnsemblGenomes-Gn; ARC77_12825.
DR   EnsemblGenomes-Gn; ARC77_13540.
DR   EnsemblGenomes-Gn; ARC77_13760.
DR   EnsemblGenomes-Gn; ARC77_13780.
DR   EnsemblGenomes-Gn; ARC77_13940.
DR   EnsemblGenomes-Gn; ARC77_14305.
DR   EnsemblGenomes-Gn; ARC77_14325.
DR   EnsemblGenomes-Gn; ARC77_14515.
DR   EnsemblGenomes-Gn; ARC77_14875.
DR   EnsemblGenomes-Gn; ARC77_15175.
DR   EnsemblGenomes-Gn; ARC77_15210.
DR   EnsemblGenomes-Gn; ARC77_15630.
DR   EnsemblGenomes-Gn; ARC77_15720.
DR   EnsemblGenomes-Gn; ARC77_15725.
DR   EnsemblGenomes-Gn; ARC77_15730.
DR   EnsemblGenomes-Gn; ARC77_15735.
DR   EnsemblGenomes-Gn; ARC77_15740.
DR   EnsemblGenomes-Gn; ARC77_15745.
DR   EnsemblGenomes-Gn; ARC77_15915.
DR   EnsemblGenomes-Gn; ARC77_15920.
DR   EnsemblGenomes-Gn; ARC77_15925.
DR   EnsemblGenomes-Gn; ARC77_15930.
DR   EnsemblGenomes-Gn; ARC77_15935.
DR   EnsemblGenomes-Gn; ARC77_15940.
DR   EnsemblGenomes-Gn; ARC77_16205.
DR   EnsemblGenomes-Gn; ARC77_16210.
DR   EnsemblGenomes-Gn; ARC77_16215.
DR   EnsemblGenomes-Gn; ARC77_16220.
DR   EnsemblGenomes-Gn; ARC77_16225.
DR   EnsemblGenomes-Gn; ARC77_16255.
DR   EnsemblGenomes-Gn; ARC77_16555.
DR   EnsemblGenomes-Gn; ARC77_16795.
DR   EnsemblGenomes-Gn; ARC77_16815.
DR   EnsemblGenomes-Gn; ARC77_16920.
DR   EnsemblGenomes-Gn; ARC77_16925.
DR   EnsemblGenomes-Gn; ARC77_16930.
DR   EnsemblGenomes-Gn; ARC77_16935.
DR   EnsemblGenomes-Gn; ARC77_16960.
DR   EnsemblGenomes-Gn; ARC77_16965.
DR   EnsemblGenomes-Gn; ARC77_16970.
DR   EnsemblGenomes-Gn; ARC77_16975.
DR   EnsemblGenomes-Gn; ARC77_17130.
DR   EnsemblGenomes-Gn; ARC77_17135.
DR   EnsemblGenomes-Gn; ARC77_17140.
DR   EnsemblGenomes-Gn; ARC77_17145.
DR   EnsemblGenomes-Gn; ARC77_17395.
DR   EnsemblGenomes-Gn; ARC77_17875.
DR   EnsemblGenomes-Gn; ARC77_17945.
DR   EnsemblGenomes-Gn; ARC77_17980.
DR   EnsemblGenomes-Gn; ARC77_18090.
DR   EnsemblGenomes-Gn; ARC77_18095.
DR   EnsemblGenomes-Gn; ARC77_18100.
DR   EnsemblGenomes-Gn; ARC77_18425.
DR   EnsemblGenomes-Gn; ARC77_18600.
DR   EnsemblGenomes-Gn; ARC77_18765.
DR   EnsemblGenomes-Gn; ARC77_18780.
DR   EnsemblGenomes-Gn; ARC77_18885.
DR   EnsemblGenomes-Gn; ARC77_18965.
DR   EnsemblGenomes-Gn; ARC77_19115.
DR   EnsemblGenomes-Gn; ARC77_19215.
DR   EnsemblGenomes-Gn; ARC77_19475.
DR   EnsemblGenomes-Gn; ARC77_20345.
DR   EnsemblGenomes-Gn; ARC77_20350.
DR   EnsemblGenomes-Gn; ARC77_20355.
DR   EnsemblGenomes-Gn; ARC77_20360.
DR   EnsemblGenomes-Gn; ARC77_20365.
DR   EnsemblGenomes-Gn; ARC77_20370.
DR   EnsemblGenomes-Gn; ARC77_20420.
DR   EnsemblGenomes-Gn; ARC77_20555.
DR   EnsemblGenomes-Gn; ARC77_20645.
DR   EnsemblGenomes-Gn; ARC77_20725.
DR   EnsemblGenomes-Gn; ARC77_20770.
DR   EnsemblGenomes-Gn; ARC77_21035.
DR   EnsemblGenomes-Gn; ARC77_21060.
DR   EnsemblGenomes-Gn; ARC77_21095.
DR   EnsemblGenomes-Gn; ARC77_21165.
DR   EnsemblGenomes-Gn; ARC77_21205.
DR   EnsemblGenomes-Gn; ARC77_21285.
DR   EnsemblGenomes-Gn; ARC77_21500.
DR   EnsemblGenomes-Gn; ARC77_21515.
DR   EnsemblGenomes-Gn; ARC77_21955.
DR   EnsemblGenomes-Gn; ARC77_22265.
DR   EnsemblGenomes-Gn; ARC77_22385.
DR   EnsemblGenomes-Gn; ARC77_22525.
DR   EnsemblGenomes-Gn; ARC77_22745.
DR   EnsemblGenomes-Gn; ARC77_22865.
DR   EnsemblGenomes-Gn; ARC77_22930.
DR   EnsemblGenomes-Gn; ARC77_22935.
DR   EnsemblGenomes-Gn; ARC77_22940.
DR   EnsemblGenomes-Gn; ARC77_22945.
DR   EnsemblGenomes-Gn; ARC77_22950.
DR   EnsemblGenomes-Gn; ARC77_22955.
DR   EnsemblGenomes-Gn; ARC77_22960.
DR   EnsemblGenomes-Gn; ARC77_23160.
DR   EnsemblGenomes-Gn; ARC77_23365.
DR   EnsemblGenomes-Gn; ARC77_23370.
DR   EnsemblGenomes-Gn; ARC77_23375.
DR   EnsemblGenomes-Gn; ARC77_23380.
DR   EnsemblGenomes-Gn; ARC77_23385.
DR   EnsemblGenomes-Gn; ARC77_23390.
DR   EnsemblGenomes-Gn; ARC77_23395.
DR   EnsemblGenomes-Gn; ARC77_23420.
DR   EnsemblGenomes-Gn; ARC77_23565.
DR   EnsemblGenomes-Gn; ARC77_23630.
DR   EnsemblGenomes-Gn; ARC77_23980.
DR   EnsemblGenomes-Gn; ARC77_24040.
DR   EnsemblGenomes-Gn; ARC77_24395.
DR   EnsemblGenomes-Gn; ARC77_24675.
DR   EnsemblGenomes-Gn; ARC77_24840.
DR   EnsemblGenomes-Gn; ARC77_24980.
DR   EnsemblGenomes-Gn; ARC77_24985.
DR   EnsemblGenomes-Gn; ARC77_24990.
DR   EnsemblGenomes-Gn; ARC77_24995.
DR   EnsemblGenomes-Gn; ARC77_25075.
DR   EnsemblGenomes-Gn; ARC77_25190.
DR   EnsemblGenomes-Gn; ARC77_25340.
DR   EnsemblGenomes-Gn; ARC77_25505.
DR   EnsemblGenomes-Gn; ARC77_25620.
DR   EnsemblGenomes-Gn; ARC77_25665.
DR   EnsemblGenomes-Gn; ARC77_25900.
DR   EnsemblGenomes-Gn; ARC77_25930.
DR   EnsemblGenomes-Gn; ARC77_26060.
DR   EnsemblGenomes-Gn; ARC77_26155.
DR   EnsemblGenomes-Gn; ARC77_26270.
DR   EnsemblGenomes-Gn; ARC77_27330.
DR   EnsemblGenomes-Gn; ARC77_27335.
DR   EnsemblGenomes-Gn; ARC77_27580.
DR   EnsemblGenomes-Gn; ARC77_27755.
DR   EnsemblGenomes-Gn; ARC77_27760.
DR   EnsemblGenomes-Gn; ARC77_27765.
DR   EnsemblGenomes-Gn; ARC77_27770.
DR   EnsemblGenomes-Gn; ARC77_27775.
DR   EnsemblGenomes-Gn; ARC77_27970.
DR   EnsemblGenomes-Gn; ARC77_28030.
DR   EnsemblGenomes-Gn; ARC77_28035.
DR   EnsemblGenomes-Gn; ARC77_28040.
DR   EnsemblGenomes-Gn; ARC77_28380.
DR   EnsemblGenomes-Gn; ARC77_28385.
DR   EnsemblGenomes-Gn; ARC77_28390.
DR   EnsemblGenomes-Gn; ARC77_28405.
DR   EnsemblGenomes-Gn; ARC77_28415.
DR   EnsemblGenomes-Gn; ARC77_28420.
DR   EnsemblGenomes-Gn; ARC77_28455.
DR   EuropePMC; PMC4966468; 27469964.
DR   EuropePMC; PMC5526969; 28798736.
DR   EuropePMC; PMC5734025; 29054868.
DR   EuropePMC; PMC5930371; 29523546.
DR   SILVA-LSU; CP015020.
DR   SILVA-SSU; CP015020.
XX
CC   Annotation was added by the NCBI Prokaryotic Genome Annotation
CC   Pipeline (released 2013). Information about the Pipeline can be
CC   found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
CC   ##Genome-Assembly-Data-START##
CC   Assembly Method       :: SMRT Analysis v. 2.3.0
CC   Genome Coverage       :: 107.5X
CC   Sequencing Technology :: PacBio; IonTorrent
CC   ##Genome-Assembly-Data-END##
CC   ##Genome-Annotation-Data-START##
CC   Annotation Provider               :: NCBI
CC   Annotation Date                   :: 03/31/2016 14:46:44
CC   Annotation Pipeline               :: NCBI Prokaryotic Genome
CC                                        Annotation Pipeline
CC   Annotation Method                 :: Best-placed reference protein
CC                                        set; GeneMarkS+
CC   Annotation Software revision      :: 3.1
CC   Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
CC                                        repeat_region
CC   Genes (total)                     :: 5,782
CC   CDS (total)                       :: 5,641
CC   Genes (coding)                    :: 5,504
CC   CDS (coding)                      :: 5,504
CC   Genes (RNA)                       :: 141
CC   rRNAs                             :: 8, 7, 7 (5S, 16S, 23S)
CC   complete rRNAs                    :: 8, 7, 7 (5S, 16S, 23S)
CC   tRNAs                             :: 110
CC   ncRNAs                            :: 9
CC   Pseudo Genes (total)              :: 137
CC   Pseudo Genes (ambiguous residues) :: 0 of 137
CC   Pseudo Genes (frameshifted)       :: 72 of 137
CC   Pseudo Genes (incomplete)         :: 38 of 137
CC   Pseudo Genes (internal stop)      :: 38 of 137
CC   Pseudo Genes (multiple problems)  :: 11 of 137
CC   CRISPR Arrays                     :: 1
CC   ##Genome-Annotation-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5561698
FT                   /organism="Escherichia coli"
FT                   /strain="28RC1"
FT                   /serotype="O157:H7"
FT                   /mol_type="genomic DNA"
FT                   /country="USA:midwest"
FT                   /isolation_source="Bovine carcass"
FT                   /collected_by="Genevieve A. Barkocy-Gallagher et al."
FT                   /collection_date="Aug-1999"
FT                   /db_xref="taxon:562"
FT   gene            join(5560284..5561698,1..592)
FT                   /pseudo
FT                   /locus_tag="ARC77_00005"
FT   CDS_pept        join(5560284..5561698,1..592)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00005"
FT                   /product="terminase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001360570.1"
FT   gene            565..801
FT                   /locus_tag="ARC77_00010"
FT   CDS_pept        565..801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00010"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DSR4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000368824.1"
FT                   /protein_id="AMW40738.1"
FT                   /translation="MDNIRRLVVSTEEAREMIQRYREAEMAVLEEKSVIFNGQQLTLES
FT                   LSQIRAGRQEWERRLAAMVSRRRGKPGFKLARF"
FT   gene            801..1817
FT                   /pseudo
FT                   /locus_tag="ARC77_00015"
FT   CDS_pept        801..1817
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00015"
FT                   /product="phage portal protein"
FT                   /note="frameshifted; incomplete; partial on complete
FT                   genome; missing stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001417030.1"
FT   gene            1935..2295
FT                   /pseudo
FT                   /locus_tag="ARC77_00020"
FT   CDS_pept        1935..2295
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00020"
FT                   /product="phage portal protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303853.1"
FT   gene            2309..4256
FT                   /pseudo
FT                   /locus_tag="ARC77_00025"
FT   CDS_pept        2309..4256
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00025"
FT                   /product="peptidase S14"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001385855.1"
FT   gene            4344..4658
FT                   /pseudo
FT                   /locus_tag="ARC77_00030"
FT   CDS_pept        4344..4658
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00030"
FT                   /product="recombinase RecA"
FT                   /note="incomplete; partial on complete genome; missing
FT                   stop; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001097059.1"
FT   gene            4945..5567
FT                   /pseudo
FT                   /locus_tag="ARC77_00035"
FT   CDS_pept        4945..5567
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00035"
FT                   /product="phage tail protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000974957.1"
FT   gene            5643..5976
FT                   /pseudo
FT                   /locus_tag="ARC77_00040"
FT   CDS_pept        5643..5976
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00040"
FT                   /product="phage tail protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001479743.1"
FT   gene            6132..6737
FT                   /locus_tag="ARC77_00045"
FT   CDS_pept        6132..6737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00045"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00045"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR032494"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DSR0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001454438.1"
FT                   /protein_id="AMW40739.1"
FT                   /translation="MTAEPYDDNYLDDEDADWTATGQGQKSAGDTSFTLAWKPGEEGQK
FT                   GLIGWFESGDVRAYKIRFPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGKPSVAE
FT                   ERSEITPATAIKVTPTSGTVAKGKTTTLTVSFEPESATDKTFRAVSADPSKATISVKDM
FT                   TITVNGVATGKVQIPVVSGNGQFAAVAEVTVTEAGAAG"
FT   gene            6751..7173
FT                   /locus_tag="ARC77_00050"
FT   CDS_pept        6751..7173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00050"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00050"
FT                   /db_xref="InterPro:IPR010027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H0MQB4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000479043.1"
FT                   /protein_id="AMW40740.1"
FT                   /translation="MFLKTEQFEYNGVSVTLSELSALQRFDYIKFVSDAEQQETTKHDV
FT                   VHINQRYLETASLLVAMSLWHSHSLKGTLASPETEMQQIRREVMLGWPADALNQATNRV
FT                   LYLSGMLDNRHDADPEPTGKTEATEPVTSKKHSKAS"
FT   gene            7200..7508
FT                   /locus_tag="ARC77_00055"
FT   CDS_pept        7200..7508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00055"
FT                   /product="phage tail assembly protein T"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00055"
FT                   /db_xref="InterPro:IPR009350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3TH65"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000532073.1"
FT                   /protein_id="AMW40741.1"
FT                   /translation="MGRADWRAMLAGMTSTEYADWRRFYCTHYFQDTQLDMHFSGLMYA
FT                   VLSLFFCDPDMHPADFSLFAPEAEEGQAETPDENDVLMQKAAGLAGGVRFGEEGRRL"
FT   gene            7552..10197
FT                   /locus_tag="ARC77_00060"
FT   CDS_pept        7552..10197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00060"
FT                   /product="phage tail tape measure protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00060"
FT                   /db_xref="InterPro:IPR006431"
FT                   /db_xref="InterPro:IPR009628"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWG1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000918269.1"
FT                   /protein_id="AMW40742.1"
FT                   /translation="MAGNFADLTAVLTLDSARFSEEAARVKKELGETSALADLMSGKVS
FT                   QSFRKQADAAEQSLSRQALAAQKAGISVGQYKAAMRTLPAQFTDIVTQLAGGQNPFLIM
FT                   LQQGGQISDSFGGPLSLLTLLKEELLGIRDASESSEESLSDTANALAENARNAGELGRF
FT                   MSVARVAAGGGVAVLAALAAAAWQAEQADRALLRSLTLTGGAAATTTAELWKMAGVISD
FT                   EAGGGIRQAAENLARLAESGKYTAGQLRIMGETSQRWLQTVGDDAGKVEKAFEGIAADP
FT                   VKALASLNQQYNFLSVSQLRHIDELERTKGKQAAVTEAMSLFADVMNARLEQLDKAATP
FT                   VEKIWDDVKTWTSDAWAWIGDHTLGALSLITDVVAGTVEQVKLLLVQGDLALAEFIQSA
FT                   WETTKNVPGVGALFGELAEENRVFIEKTKRDELALRKSIAERDARIRQGEMGYINRSRA
FT                   TGVSKGPGQQEAVSRLAEELTGKKHTSPKTRSAGEREEEQAREALLALEAELRTLEKHS
FT                   GANEKISRQRRDLWKAESQYAVLKEAATKRQLSEQEKSLLAHKDETLEYKRQLAELGDK
FT                   VEYQKRLNELAQQAVRFEEQQSAKQAAISAKARGLTDRQAQRESEAQRLRDVYGDNPAA
FT                   LAKATSALKNTWSAEEQLRGSWMAGLKSGWGEWAESATDSFSQVKSAATQTFDGIAQNM
FT                   AAMLTGAEADWRGFTRSVLSMMTEILLKQAMVGIVGRIGSAIGGAFGGGASASTGTAIQ
FT                   AAAANFHFATGGFTGTGGKYEPAGIVHRGEFVFTKEATSRIGVGNLYRLMRGYAEGGYV
FT                   GGAGSPAQMRRTEGINFNQNNHVVIQNDGTNGQAGPQLMKAVYDMARKGAQDELRLQLR
FT                   DGGMLSGSRR"
FT   gene            10194..10523
FT                   /locus_tag="ARC77_00065"
FT   CDS_pept        10194..10523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00065"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00065"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066RCK8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000847385.1"
FT                   /protein_id="AMW40743.1"
FT                   /translation="MKTFRWKVKPDMEVNSQPSVREVRFGDGYSQRMAAGLNADLKTYR
FT                   VTLSVTREEARHLEAFLAEHGGWKAFLWKPPYAYRQIKVTCAGWSARVGMLRVEFSAEF
FT                   KQVVN"
FT   gene            10523..11221
FT                   /locus_tag="ARC77_00070"
FT   CDS_pept        10523..11221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00070"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00070"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DSR9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:YP_001449306.1"
FT                   /protein_id="AMW40744.1"
FT                   /translation="MQDIHEESLNESVKSEQSPRVVLWEIDLTAQGGERYFFCNELNEK
FT                   GEAVTWQGRQYQAYPIDGSGFEMNGKGSSARPSLTVSNLFGLVTGMAEDLQSLVGATVV
FT                   RRRVYARFLDAVNFVAGNPEADPEQELTDRWVVEQMSSLTAMTASFVLATPTETDGALF
FT                   PGRIMLANTCMWDYRGDECGYNGPAVADEFDNPTTDIRKDRCSKCMRGCEMRGMVANFG
FT                   GFLSINKLSQ"
FT   gene            11232..11975
FT                   /locus_tag="ARC77_00075"
FT   CDS_pept        11232..11975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00075"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00075"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DU13"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001448519.1"
FT                   /protein_id="AMW40745.1"
FT                   /translation="MTQTESAILVHARRCAPAESCGFVIGTPEGERYQPCVNISAEPEA
FT                   YFRIAPEDWLQAEMQGEIVALVHSHPGGLPWLSEADRRLQIKSALPWWLVCRGEIHKFR
FT                   CVPHLTGRRFEHGVTDCYTLFRDAYHLAGITLPDFVREDDWWRNGQNLYLDNMAATGFY
FT                   RISLPSAQPGDILLCCFGASVANHAAIYCGNGELLHHLPEQLSKRERYSEKWQRRTHSV
FT                   WRHRHWHASAFTGICNDLAAASACT"
FT   gene            11873..12553
FT                   /locus_tag="ARC77_00080"
FT   CDS_pept        11873..12553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00080"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00080"
FT                   /db_xref="GOA:A0A143DT64"
FT                   /db_xref="InterPro:IPR010654"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DT64"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000246273.1"
FT                   /protein_id="AMW40746.1"
FT                   /translation="MATTNAFCLASPPLARICLHGDLQRFGRRLSLYVNTAAEAIRALS
FT                   LQMPGFRRQMNEGWYQIRIRGEDTAPEAVYARLHEQLGEGTVIHIVPRLAGAGKGGLQI
FT                   VLGAAAIVGSFFTAGASMALWGSALAAGGFSATTMLFSLGASMILGGVAQMLAPKPKTP
FT                   EYRATDNGKQNTYFSSLDNMIAQGNPMPVPYGEMLVGSRRISQDISTRDEGGDGKVVVI
FT                   GRQG"
FT   gene            12800..16276
FT                   /locus_tag="ARC77_00085"
FT   CDS_pept        12800..16276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00085"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00085"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR015406"
FT                   /db_xref="InterPro:IPR021034"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DT92"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000514870.1"
FT                   /protein_id="AMW40747.1"
FT                   /translation="MGKGGGKAHTPVEAKDNLKSTQMMSVIDAIGEGPIEGPVKGLQSI
FT                   LVNKTPLTDTDGNPVIHGVTAVWRAGEQEQTPPEGFESSGAETGLGVEVTKAKPVTRTI
FT                   TSANIDRLRVTFGVQSLVETTSKGDRNPASVRLLIQLQRNGNWVTEKDVTINGKTTSQF
FT                   LASVILDNLPPRPFNIRMVRETADSTTDQLQNKTLWSSYTEIIDVKQCYPNTAIVGLQV
FT                   DAEQFGGQQMTVNYHIRGRIIQVPSNYDPEKRTYSGIWDGSLKPAYSNNPAWCLWDMLT
FT                   HPRYGMGKRLGTADVDKWALYAIGQYCDQRVPDGFGGTEPRMTFNAYLSQQRKAWDVLS
FT                   DFCSAMRCMPVWNGQTLTFVQDRPSDVVWPYTNCDVVVDDNGVGFRYSFSALKDRHTAV
FT                   EVNYTDPQNGWQTSTELVEDPEAILRYGRNLLKMDAFGCTSRGQAHRAGLWVIKTGLLE
FT                   TQTVDFTLGSQGLRHTPGDIIEICDNDYAGTMTGGRVLSIDAASRTLTLDREVTLPETG
FT                   AATVNLINGSGKPVSVAITAHPAPDRIQVSTLPDGVETYGVWGLSLPSLRRRLFRCVSI
FT                   RENTDGTFAITAVQHVPEKEAIVDNGASFEPQSGTLNSVIPPAVQHLTVEVSAADGQYL
FT                   AQAKWDTPRVVKGVRFSLRLTSGSGEGSRLVTTAITADTEHRSSGLPLGEYTLTVRAIN
FT                   SYGQQGEPATTTFRINAPAKPATIELTPGYFQITAVPRLAVYDPTVQFEFWFSETKIAD
FT                   TSQVETSARYLGTGSQWSVSGPHIKPGKDFWFYVRSVNLVGKSAFVEVSGQPSNDGEGY
FT                   LEFFREKIGKLHLAQGLWELIDNSQLADEMAEMKTTITETRNEITQTVSKTLEDQSATI
FT                   QQIQRVQKDTNDDLAALYMLKVQKTKDGIPYVAGIGAGIEDTDGQPLSNILLLADRIAM
FT                   INPESGNSTPLFVAQGNQLFMNDVFLKRLFAVSITSSGNPPAFSLTPDGRLTAKNADIS
FT                   GSVNANSGTLNNVTINENCQIKGKLSANQIEGDIVKTVSKSFPRTSTYASGTITVRISD
FT                   DQKFDRQVMIPPVLFRGGKHENFNSNNQQSYWYSTCRLRVTRNGQEIFNQSTTDAQGVF
FT                   SSVIDMPAGQGTLTLTFTVSSSGANNWTPTTSISDLLVVVMKKATAGISIS"
FT   gene            16344..16943
FT                   /locus_tag="ARC77_00090"
FT   CDS_pept        16344..16943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00090"
FT                   /product="enterobacterial Ail/Lom family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00090"
FT                   /db_xref="GOA:A0A143DW47"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DW47"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001230282.1"
FT                   /protein_id="AMW40748.1"
FT                   /translation="MRKLYAAILSAAICLAVSGAPAWASEHQSTLSAGYLHVSTNVPGS
FT                   DELNGINVKYRYEFTDTLGMVTSFSYAGDRNRQLTHYSDTRWHEDFVRNRWFSVMAGPS
FT                   VRVNEWFSAYAMAGVAYSRVSTFSGDYLRVTDNKGKTHDVLTGSDDGRHSNTSLAWGAG
FT                   VQFNPIESVAIDIAYEGSGSGDWRTDGFIVGVGYKF"
FT   gene            17008..18321
FT                   /locus_tag="ARC77_00095"
FT   CDS_pept        17008..18321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00095"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00095"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR009640"
FT                   /db_xref="InterPro:IPR013609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DUU5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000279191.1"
FT                   /protein_id="AMW40749.1"
FT                   /translation="MAVKISGVLKDGTGKPVENCTIQLKARRTSSTVVVNTVASENPDE
FT                   AGRYSMDVEYGQYSVILLVEGFPPSHAGTITVYEDSRPGTLNDFLGAMTEGDVRPEALR
FT                   RFELMVEEVARHAEEAKKNAGEAETSARNAGISASQAEESAANADTSAGEASESARQAA
FT                   ESAAAAKQSEDASSSSASAAAQKASESSQSAAEAELSKKTAESAAGNAARDATTATEKA
FT                   RESAESAQSAEQSRIAAEEAVNRIPTVVGPPGPKGEQGPAGPQGPKGDKGERGDTGPVG
FT                   ATGERGPAGDAGPAGPQGPKGDRGERGETGLTGNAGPQGPKGDTGAAGPAGPQGPKGET
FT                   GAAGPVGATGPQGPKGDPGETQIRFRLGPGNIIETNSNGWFPDTDGALITGLTFLAPKD
FT                   ATRVQGFFQHLQVRFGDGPWQDVKGLDEVGSDTGRTGE"
FT   gene            18323..18592
FT                   /locus_tag="ARC77_00100"
FT   CDS_pept        18323..18592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00100"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00100"
FT                   /db_xref="InterPro:IPR009640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7C2R5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001358861.1"
FT                   /protein_id="AMW40750.1"
FT                   /translation="MNILKKLMQRLCGCGKHDDREHGELLTAQLRLGPADILESDENGI
FT                   IPEQDRVITQVVILDADKKQIQCVVRPLQILRADGTWENIGGMK"
FT   gene            19022..20008
FT                   /locus_tag="ARC77_00105"
FT   CDS_pept        19022..20008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00105"
FT                   /product="peptidase M85"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00105"
FT                   /db_xref="InterPro:IPR025208"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152GZQ2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000701340.1"
FT                   /protein_id="AMW40751.1"
FT                   /translation="MKIPVLQPGFNFFAPAGYSAAVAPNRAENAYADYVLDIGKRIPLS
FT                   AADLSNVYESVISAVHDSRSRLIDQHTVDMIGNTVLDALSRSQTFRDAVSYGIHNEEVH
FT                   IGCIKYRNEYELNGESAIKIDDIQSLTCNELYGYDVGQEPILPICEAGENENEEPYVSF
FT                   SVAPDTDSYEMPSWQEGLIHEIIHHVTGASDPSGDSNIELGPTEILARRVAQELGWSVP
FT                   DFKGYADPEREAHLRLRNLNALRQAAMRHEKNERAFFERLGTISDRYEASPDFTEYSAV
FT                   SNIGYGFIQQHDFPGVAIDENLQDVNQIQLYHGAPYIFTFGDVDRHN"
FT   gene            complement(20380..20628)
FT                   /locus_tag="ARC77_00110"
FT   CDS_pept        complement(20380..20628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00110"
FT                   /product="damage-inducible protein DinI"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00110"
FT                   /db_xref="InterPro:IPR010391"
FT                   /db_xref="InterPro:IPR036687"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152JV43"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001217546.1"
FT                   /protein_id="AMW40752.1"
FT                   /translation="MRVEICIAKEKISKMPNGAVDALKEELTRRISKRYDDVEVIVKAT
FT                   SNDGLSVTRTADKDSAKTFVQETLKDTWESADEWFVH"
FT   gene            complement(20946..21512)
FT                   /locus_tag="ARC77_00115"
FT   CDS_pept        complement(20946..21512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00115"
FT                   /product="hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00115"
FT                   /db_xref="GOA:E2QN71"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E2QN71"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000891641.1"
FT                   /protein_id="AMW40753.1"
FT                   /translation="MLELNAKTTALVVIDLQEGILPFAGGPHTADEVVNRAGKLAAKFR
FT                   ASGQPVFLVRVGWSADYAEALKQPVDAPSPAKVLPENWWQHPAALGATDSDIEIIKRQW
FT                   GAFYGTDLELQLRRRGIDTIVLCGISTNIGVESTARNAWELGFNLVIAEDACSAASAEQ
FT                   HNNSINHIYPRIARVRSVEEILNAL"
FT   gene            21822..23594
FT                   /locus_tag="ARC77_00120"
FT   CDS_pept        21822..23594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00120"
FT                   /product="aspartate--tRNA ligase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00120"
FT                   /db_xref="GOA:C3T5N7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5N7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120685.1"
FT                   /protein_id="AMW40754.1"
FT                   /translation="MRTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIV
FT                   QVFFDPDRADALKLASELRNEFCIQVTGTVRARDEKNINRDMATGEIEVLASSLTIINR
FT                   ADVLPLDSNHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETP
FT                   MLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLR
FT                   ADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFPVMTFAEAERRYGS
FT                   DKPDLRNPMELTDVADLLRSVEFAVFAGPANDPKGRVAALRVPGGASLTRKQIDEYGNF
FT                   VKIYGAKGLAYIKVNERAKGLEGINSPVAKFLNAEIIEAILDRTAAQDGDMIFFGADNK
FT                   KIVADAMGALRLKVGKDLGLTDESKWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMT
FT                   AAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGINEEEQREKFGFL
FT                   LDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLMTEAPSFANPAAL
FT                   AELSIQVVKKAENN"
FT   gene            23682..24164
FT                   /gene="nudB"
FT                   /locus_tag="ARC77_00125"
FT   CDS_pept        23682..24164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudB"
FT                   /locus_tag="ARC77_00125"
FT                   /product="dihydroneopterin triphosphate diphosphatase"
FT                   /note="catalyzes the formation of dihydroneopterin
FT                   phosphate from dihydroneopterin triphosphate; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00125"
FT                   /db_xref="GOA:A0A0F0AFN5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F0AFN5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001289128.1"
FT                   /protein_id="AMW45887.1"
FT                   /translation="MSEGSQRRGSVKDKVYKRPVSILVVIYAQDTKRVLMLQRRDDPDF
FT                   WQSVTGSVEEGETAPQAAMREVKEEVTIDVVAEQLTLIDCQRTVEFEIFSHLRHRYAPG
FT                   VTRNTESWFCLALPHERQIVFTEHLAYKWLDAPAAAALTKSWSNRQAIEQFVINAA"
FT   gene            24193..24933
FT                   /locus_tag="ARC77_00130"
FT   CDS_pept        24193..24933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00130"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00130"
FT                   /db_xref="GOA:C3T5P7"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5P7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000907234.1"
FT                   /protein_id="AMW40755.1"
FT                   /translation="MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDA
FT                   NPRLRAAIDKALSNNMTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSD
FT                   NRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKGVISFEKGDEDTIMEAALEAGAEDVV
FT                   TYDDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDAETAPKLMRLIDM
FT                   LEDCDDVQEVYHNGEISDEVAATL"
FT   gene            24968..25489
FT                   /gene="ruvC"
FT                   /locus_tag="ARC77_00135"
FT   CDS_pept        24968..25489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="ARC77_00135"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /note="endonuclease; resolves Holliday structures; forms a
FT                   complex of RuvABC; the junction binding protein RuvA forms
FT                   a hexameric ring along with the RuvB helicase and catalyzes
FT                   branch migration; RuvC then interacts with RuvAB to resolve
FT                   the Holliday junction by nicking DNA strands of like
FT                   polarity; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00135"
FT                   /db_xref="GOA:C3T5Q2"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5Q2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005068993.1"
FT                   /protein_id="AMW40756.1"
FT                   /translation="MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRL
FT                   KLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAA
FT                   RQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSES
FT                   RLNLARGRLR"
FT   gene            complement(25491..26093)
FT                   /locus_tag="ARC77_00140"
FT   CDS_pept        complement(25491..26093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00140"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00140"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DT98"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001024941.1"
FT                   /protein_id="AMW40757.1"
FT                   /translation="MNINYPAEYEIGDKVFTCIGAALFGQISAASNCWSNHVGIIIGHN
FT                   GEDFLVAESRVPLSTITTLSRFIKRSSNQRYAIKRLDAGLTEQQKQRIVEQVPSRLRKL
FT                   YHTGFKYESSRQFCSKFVFDIYKEALCIPVGEIETFGELLNSNPNAKLTFWKFWFLGSI
FT                   PWERKTVTPASLWHHPGLVLIHAEGVETPQPELTEAV"
FT   gene            26368..26979
FT                   /gene="ruvA"
FT                   /locus_tag="ARC77_00145"
FT   CDS_pept        26368..26979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="ARC77_00145"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="plays an essential role in ATP-dependent branch
FT                   migration of the Holliday junction; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00145"
FT                   /db_xref="GOA:C3T5R2"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5R2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8AFI0.1"
FT                   /protein_id="AMW40758.1"
FT                   /translation="MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEA
FT                   IVFTHFVVREDAQLLYGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVER
FT                   EEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEA
FT                   VAALVALGYKPQEASRMVSKIARPDASSETLIREALRAAL"
FT   gene            26988..27998
FT                   /locus_tag="ARC77_00150"
FT   CDS_pept        26988..27998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00150"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00150"
FT                   /db_xref="GOA:C3T5R7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5R7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017441950.1"
FT                   /protein_id="AMW40759.1"
FT                   /translation="MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFI
FT                   KAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNL
FT                   EPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTR
FT                   AGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRI
FT                   ANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPV
FT                   GLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP"
FT   gene            complement(28244..29029)
FT                   /gene="znuB"
FT                   /locus_tag="ARC77_00155"
FT   CDS_pept        complement(28244..29029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="ARC77_00155"
FT                   /product="high-affinity zinc transporter membrane
FT                   component"
FT                   /note="involved in transport of zinc(II) with ZnuA and C;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00155"
FT                   /db_xref="GOA:C3T5S2"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5S2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120698.1"
FT                   /protein_id="AMW40760.1"
FT                   /translation="MIELLFPGWLAGIMLACAAGPLGSFVVWRRMSYFGDTLAHASLLG
FT                   VAFGLLLDVNPFYAVIAVTLLLAGGLVWLEKRPQLAIDTLLGIMAHSALSLGLVVVSLM
FT                   SNIRVDLMAYLFGDLLAVTPEDLISIAIGVVIVVAILFWQWRNLLSMTISPDLAFVDGV
FT                   KLQRVKLLLMLVTALTIGVAMKFVGALIITSLLIIPAATARRFARTPEQMAGVAVLVGM
FT                   VAVTDGLTFSAFYDTPAGPSVVLCAALLFIISMMKKQAS"
FT   gene            complement(29026..29781)
FT                   /gene="znuC"
FT                   /locus_tag="ARC77_00160"
FT   CDS_pept        complement(29026..29781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="ARC77_00160"
FT                   /product="Mn2+/Zn2+ABC transporter ATP-binding protein"
FT                   /note="involved in transport of zinc(II) with ZnuA and C;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00160"
FT                   /db_xref="GOA:C3T5S7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5S7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001696320.1"
FT                   /protein_id="AMW40761.1"
FT                   /translation="MTSLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKST
FT                   LVRVVLGLVTPDEGVIKRNGKLRIGYVPQKLYLDTTLPLTVNRFLRLRPGTHKEDILPA
FT                   LKRVQAGHLINAPMQKLSGGETQRVLLARALLNRPQLLVLDEPTQGVDVNGQVALYDLI
FT                   DQLRRELDCGVLMVSHDLHLVMAKTDEVLCLNHHICCSGTPEVVSLHPEFISMFGPRGA
FT                   EQLGIYRHHHNHRHDLQGRIVLRRGNDRS"
FT   gene            29845..30792
FT                   /gene="znuA"
FT                   /locus_tag="ARC77_00165"
FT   CDS_pept        29845..30792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="ARC77_00165"
FT                   /product="zinc ABC transporter substrate-binding protein"
FT                   /note="involved in transport of zinc(II) with ZnuA and C;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00165"
FT                   /db_xref="GOA:A0A143DVC5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DVC5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006684141.1"
FT                   /protein_id="AMW40762.1"
FT                   /translation="MIGRIMLHKKTLLFAALFAALWGGATQAADAAVVASLKPVGFIAS
FT                   AIADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPEA
FT                   KQVTIAQLEDVKPLLMKSINGDDDDHDHAEKSDEDHHHGDFNMHLWLSPEIARATAVAI
FT                   HGKLVELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQF
FT                   GLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMG
FT                   TLDPLGTNIKLGKTSYSEFLSQLANQYASCLKGD"
FT   gene            30808..32130
FT                   /locus_tag="ARC77_00170"
FT   CDS_pept        30808..32130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00170"
FT                   /product="peptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00170"
FT                   /db_xref="GOA:E2QN60"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:E2QN60"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012906131.1"
FT                   /protein_id="AMW40763.1"
FT                   /translation="MQQIARSVALAFNNLPRPHRVMLGSLTVLTLAVAVWRPYVYHRDA
FT                   TPIVKTIELEQNEIRSLLPEASEPIDQAAQEDEAIPQDELDDKIAGEAGVHEYVVSTGD
FT                   TLSSILNQYGIDMGDITQLAAADKELRNLKIGQQLSWTLTADGELQRLTWEVSRRETRT
FT                   YDRTAANGFKMTSEMQQGEWVNNLLKGTVGGSFVASARNAGLTSAEVSAVIKAMQWQMD
FT                   FRKLKKGDEFAVLMSREMLDGKREQSQLLGVRLRSEGKDYYAIRAEDGKFYDRNGTGLA
FT                   KGFLRFPTAKQFRISSNFNPRRTNPVTGRVAPHRGVDFAMPQGTPVLSVGDGEVVVAKR
FT                   SGAAGYYVAIRHGRSYTTRYMHLRKILVKPGQKVKRGDRIALSGNTGRSTGPHLHYEVW
FT                   INQQAVNPLTAKLPRTEGLTGSDRREFLAQAKEIVPQLRFD"
FT   gene            32250..33221
FT                   /locus_tag="ARC77_00175"
FT   CDS_pept        32250..33221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00175"
FT                   /product="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
FT                   acyltransferase"
FT                   /note="Transfers myristate or laurate, activated on ACP, to
FT                   the lipid IVA moiety of (KDO)2-(lauroyl)-lipid IVA; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00175"
FT                   /db_xref="GOA:C3T5U2"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011921"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5U2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001392256.1"
FT                   /protein_id="AMW40764.1"
FT                   /translation="METKKNNSEYIPEFDKSFRHPRYWGAWLGVAAMAGIALTPPKFRD
FT                   PILARLGRIAGRLGKSSRRRALINLSLCFPERSEAEREAIVDEMFATAPQAMAMMAELA
FT                   IRGPEKIQPRVDWQGLEIIEEMRRNNEKVIFLVPHGWAVDIPAMLMASQGQKMAAMFHN
FT                   QGNPVFDYVWNTVRRRFGGRLHARNDGIKPFIQSVRQGYWGYYLPDQDHGPEHSEFVDF
FT                   FATYKATLPAIGRLMKVCRARVVPLFPIYDGKTHRLTIQVRPPMDDLLEADDHTIARRM
FT                   NEEVEIFVGPRPEQYTWILKLLKTRKPGEIQPYKRKDLYPIK"
FT   gene            complement(33352..34794)
FT                   /locus_tag="ARC77_00180"
FT   CDS_pept        complement(33352..34794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00180"
FT                   /product="pyruvate kinase"
FT                   /note="catalyzes the formation of phosphoenolpyruvate from
FT                   pyruvate; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00180"
FT                   /db_xref="GOA:C3T5U8"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5U8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120709.1"
FT                   /protein_id="AMW40765.1"
FT                   /translation="MSRRLRRTKIVTTLGPATDRDNNLEKVIAAGANVVRMNFSHGSPE
FT                   DHKMRADKVREIAAKLGRHVAILGDLQGPKIRVSTFKEGKVFLNIGDKFLLDANLGKGE
FT                   GDKEKVGINYKGLPADVVPGDILLLDDGRVQLKVLEVQGMKVFTEVTVGGPLSNNKGIN
FT                   KLGGGLSAEALTEKDKADIKTAALIGVDYLAVSFPRCGEDLNYARRLARDAGCDAKIVA
FT                   KVERAEAVCSQDAMDDIILASDVVMVARGDLGVEIGDPELVGIQKALIRRARQLNRAVI
FT                   TATQMMESMITNPMPTRAEVMDVANAVLDGTDAVMLSAETAAGQYPSETVAAMARVCLG
FT                   AEKIPSINVSKHRLDVQFDNVEEAIAMSAMYAANHLKGVTAIITMTESGRTALMTSRIS
FT                   SGLPIFAMSRHERTLNLTALYRGVTPVHFDSANDGVAAASEAVNLLRDKGYLMSGDLVI
FT                   VTQGDVMSTVGSTNTTRILTVE"
FT   gene            complement(34922..35791)
FT                   /locus_tag="ARC77_00185"
FT   CDS_pept        complement(34922..35791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00185"
FT                   /product="transcriptional regulator HexR"
FT                   /note="Represses the expression of the zwf, eda, glp and
FT                   gap; Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00185"
FT                   /db_xref="GOA:C3T5V2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5V2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120711.1"
FT                   /protein_id="AMW40766.1"
FT                   /translation="MNMLEKIQSQLEHLSKSERKVAEVILASPDNAIHSSIAALALEAN
FT                   VSEPTVNRFCRSMDTRGFPDFKLHLAQSLANGTPYVNRNVNEDDSVESYTGKIFESAMA
FT                   TLDHVRHSLDKSAINRAVDLLTQAKKIAFFGLGSSAAVAHDAMNKFFRFNVPVVYSDDI
FT                   VLQRMSCMNCSDGDVVVLISHTGRTKNLVELAQLARENDAMVIALTSAGTPLAREATLA
FT                   ITLDVPEDTDIYMPMVSRLAQLTVIDVLATGFTLRRGAKFRDNLKRVKEALKESRFDKQ
FT                   LLNLSDDR"
FT   gene            35814..35963
FT                   /locus_tag="ARC77_00190"
FT   CDS_pept        35814..35963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00190"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066SSE6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000155622.1"
FT                   /protein_id="AMW40767.1"
FT                   /translation="MTISALKEIEMQFCQILRLCAVLMTKADKKVVIFFHNMISVRFLP
FT                   NGKR"
FT   gene            36129..37604
FT                   /locus_tag="ARC77_00195"
FT   CDS_pept        36129..37604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00195"
FT                   /product="glucose-6-phosphate dehydrogenase"
FT                   /note="catalyzes the formation of D-glucono-1,5-lactone
FT                   6-phosphate from D-glucose 6-phosphate; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00195"
FT                   /db_xref="GOA:C3T5V7"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5V7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120712.1"
FT                   /protein_id="AMW40768.1"
FT                   /translation="MAVTQTAQVCDLVIFGAKGDLARRKLLPSLYQLEKAGQLNPDTRI
FT                   IGVGRADWDKAAYTKVVREALETFMKETIDEGLWDTLSARLDFCNLDVNDTAAFSRLGA
FT                   MLDQKNRITINYFAMPPSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSQEINDQV
FT                   GEYFEECQVYRIDHYLGKETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGR
FT                   WGYFDKAGQMRDMIQNHLLQILCMIAMSPPSDLSADSIRDEKVKVLKSLRRIDRSNVRE
FT                   KTVRGQYTAGFAQGKKVPGYLEEEGANKSSNTETFVAIRVDIDNWRWAGVPFYLRTGKR
FT                   LPTKCSEVVVYFKTPELNLFKESWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNL
FT                   QITKLDLSYSETFNQTHLADAYERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAM
FT                   DNDAPKPYQAGTWGPVASVAMITRDGRSWNEFE"
FT   gene            37839..39650
FT                   /locus_tag="ARC77_00200"
FT   CDS_pept        37839..39650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00200"
FT                   /product="phosphogluconate dehydratase"
FT                   /note="catalyzes the formation of
FT                   2-dehydro-3-deoxy-6-phospho-D-gluconate from
FT                   6-phospho-D-gluconate; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00200"
FT                   /db_xref="GOA:C3T5W2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5W2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020244583.1"
FT                   /protein_id="AMW40769.1"
FT                   /translation="MNPQLLRVTNRIIERSRETRSAYLARIEQAKTSTVHRSQLACGNL
FT                   AHGFAACQPEDKASLKSMLRNNIAIITSYNDMLSAHQPYEHYPEIIRKALHEANAVGQV
FT                   AGGVPAMCDGVTQGQDGMELSLLSREVIAMSAAVGLSHNMFDGALFLGVCDKIVPGLTM
FT                   AALSFGHLPAVFVPSGPMASGLPNKEKVRIRQLYAEGKVDRMALLESEAASYHAPGTCT
FT                   FYGTANTNQMVVEFMGMQLPGSSFVHPDSPLRDALTAAAARQVTRMTGNGNEWMPIGKM
FT                   IDEKVVVNGIVALLATGGSTNHTMHLVAMARAAGIQINWDDFSDLSDVVPLMARLYPNG
FT                   PADINHFQAAGGVPVLVRELLKAGLLHEDVNTVAGFGLSRYTLEPWLNNGELDWREGAE
FT                   KSLDSNVIASFEQPFSHHGGTKVLSGNLGRAVMKTSAVPVENQVIEAPAVVFESQHDVM
FT                   PAFEAGLLDRDCVVVVRHQGPKANGMPELHKLMPPLGVLLDRCFKIALVTDGRLSGASG
FT                   KVPSAIHVTPEAYDGGLLAKVRDGDIIRVNGQTGELTLLVDEAELAAREPHIPDLSASR
FT                   VGTGRELFSALREKLSGAEQGATCITF"
FT   gene            39687..40328
FT                   /locus_tag="ARC77_00205"
FT   CDS_pept        39687..40328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00205"
FT                   /product="keto-deoxy-phosphogluconate aldolase"
FT                   /note="catalyzes the formation of pyruvate and glyoxylate
FT                   from 4-hydroxy-2-oxoglutarate; or pyruvate and
FT                   D-glyceraldehyde 3-phosphate from
FT                   2-dehydro-3-deoxy-D-glyconate 6-phosphate; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00205"
FT                   /db_xref="GOA:C3T5W7"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5W7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000800514.1"
FT                   /protein_id="AMW40770.1"
FT                   /translation="MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLE
FT                   VTLRTECAVDAIRAIAKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPLLKAA
FT                   TEGTIPLIPGISTVSELMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCPTGG
FT                   ISPANYRDYLALKSVLCIGGSWLVPADALEAGDYDRITKLAREAVEGAKL"
FT   gene            complement(40384..41562)
FT                   /locus_tag="ARC77_00210"
FT   CDS_pept        complement(40384..41562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00210"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00210"
FT                   /db_xref="GOA:C3T5X2"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5X2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:B2U494.1"
FT                   /protein_id="AMW40771.1"
FT                   /translation="MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYA
FT                   DAPAMHVAHRSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEEGLNVVPC
FT                   ARATKLTMNREGIRRLAAEELQLPTSTYRFADSESLFREAVAAIGYPCIVKPVMSSSGK
FT                   GQTFIRSAEQLAQAWEYAQQGGRAGAGRVIVEGVVKFDFEITLLTVSAVDGVHFCAPVG
FT                   HRQEDGDYCESWQPQQMSPLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVS
FT                   PRPHDTGMVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVTFDNV
FT                   QNAVGADLQIRLFGKPEIDGSRRLGVALATAESVVDAIERAKHAAGQVKVQG"
FT   gene            41696..41986
FT                   /locus_tag="ARC77_00215"
FT   CDS_pept        41696..41986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00215"
FT                   /product="damage-inducible protein YebG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00215"
FT                   /db_xref="InterPro:IPR009813"
FT                   /db_xref="InterPro:IPR038627"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5X7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000257736.1"
FT                   /protein_id="AMW40772.1"
FT                   /translation="MAVEVKYVVIREGEEKMSFTSKKEADAYDKMLDTADLLDTWLTNS
FT                   PVQMEDEQREALSLWLAEQKDVLSTILKTGKLPSPQVVGAESEEEDASHAA"
FT   gene            42053..42409
FT                   /locus_tag="ARC77_00220"
FT   CDS_pept        42053..42409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00220"
FT                   /product="hypothetical protein"
FT                   /note="secreted protein; unknown function; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00220"
FT                   /db_xref="GOA:W8T990"
FT                   /db_xref="InterPro:IPR020236"
FT                   /db_xref="InterPro:IPR025603"
FT                   /db_xref="InterPro:IPR038703"
FT                   /db_xref="UniProtKB/TrEMBL:W8T990"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001295500.1"
FT                   /protein_id="AMW40773.1"
FT                   /translation="MKKRGAFLGLLLVSACASVFAANNETSKSVTFPKCEGLDAAGIAA
FT                   SVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQV
FT                   SVDCKAGMAEYQRR"
FT   gene            complement(42566..42676)
FT                   /locus_tag="ARC77_00225"
FT   CDS_pept        complement(42566..42676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00225"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00225"
FT                   /db_xref="UniProtKB/TrEMBL:J7R1Z9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000275186.1"
FT                   /protein_id="AMW40774.1"
FT                   /translation="MYIETKDAQISGAVGRYSKKFAPGKVFTVYQVIRVF"
FT   gene            42736..43395
FT                   /locus_tag="ARC77_00230"
FT   CDS_pept        42736..43395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00230"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00230"
FT                   /db_xref="GOA:C3T5Y7"
FT                   /db_xref="InterPro:IPR007486"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5Y7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020245218.1"
FT                   /protein_id="AMW40775.1"
FT                   /translation="MANWLNQLQSLLGQSSSSTSSSADQGLGKLLVPGALGGLAGLLVA
FT                   NKSARKLLTKYGTNALLIGGGAVAGTVLWNKYKDKIRAAHQDEPQFGSQSTPLDERTER
FT                   LILALVFAAKSDGHIDAKERAAIDQQLREAGVEEQGRVLIEQAIEQPLDPQRLATGVRN
FT                   EEEALEIYFLSCAAIDIDHFMERSYLNALGDALKIPQDVREGIERDLEQQKRTLAE"
FT   gene            43604..45664
FT                   /locus_tag="ARC77_00235"
FT   CDS_pept        43604..45664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00235"
FT                   /product="oligopeptidase B"
FT                   /note="PtrB; oligopeptidase that cleaves peptide bonds
FT                   following arginine and lysine residues; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00235"
FT                   /db_xref="GOA:C3T5Z3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5Z3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001716634.1"
FT                   /protein_id="AMW40776.1"
FT                   /translation="MLPKAARIPHAMTLHGDTRIDNYYWLRDDTRSQPEVLDYLQQENS
FT                   YGHRVMASQQALQDRILKEIIDRIPQREVSAPYIKNGYRYRHIYEPGCEYAIYQRQSAF
FT                   SEEWDEWEILLDANKRAAHSEFYSMGGMAITPDNTIMALAEDFLSRRQYGIRFRNLETG
FT                   NWYPELLDNVEPSFVWANDSWTFYYVRKHPVTLLPYQVWRHAIGTPASQDKLIYEEKDD
FT                   TYYVSLHKTTSKHYVVIHLASATTSEVRLLDAEMADAEPFVFLPRRKDHEYSLDHYQHR
FT                   FYLRSNRHGKNFGLYRTRMRDEQQWEELIPPRENIMLEGFTLFTDWLVVEERQRGLTSL
FT                   RQINRKTREVIGIAFDDPAYVTWIAYNPEPETARLRYGYSSMTTPDTLFELDMDTGERR
FT                   VLKQTEVPGFDAANYRSEHLWIVARDGVEVPVSLVYHRNHFRKGHNPLLVYGYGSYGAS
FT                   IDADFSFSRLSLLDRGFVYAIVHVRGGGELGQQWYEDGKFLKKKNTFNDYLDACDALLK
FT                   LGYGSPSLCYAMGGSAGGMLMGVAINQRPELFHGVIAQVPFVDVVTTMLDESIPLTTGE
FT                   FEEWGNPQDLQYYEYMKSYSPYDNVTAQAYPHLLVTTGLHDSQVQYWEPAKWVAKLREL
FT                   KTDNHLLLLCTDMDSGHGGKSGRFKSYEGVAMEYAFLVALAQGTLPARPAD"
FT   gene            complement(45661..46323)
FT                   /locus_tag="ARC77_00240"
FT   CDS_pept        complement(45661..46323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00240"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /note="3'-5' exonuclease activity on single or
FT                   double-strand DNA; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00240"
FT                   /db_xref="GOA:C3T5Z9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C3T5Z9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000944269.1"
FT                   /protein_id="AMW40777.1"
FT                   /translation="MLRIIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVHPDRPISP
FT                   QAMAIHRITEAMVADKPWIEDVIPHYYGSEWYVAHNASFDRRVLPEMPGEWICTMKLAR
FT                   RLWPGIKYSNMALYKTRKLNVQTPPGLHHHRALYDCYITAALLIDIMNTSGWTAEQMAD
FT                   MTGRPSLMTTFTFGKYRGKAVSDVAERDPGYLRWLFNNLDSMSPELRLTLKHYLENT"
FT   gene            complement(46347..47003)
FT                   /locus_tag="ARC77_00245"
FT   CDS_pept        complement(46347..47003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00245"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00245"
FT                   /db_xref="GOA:C3T602"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C3T602"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001565614.1"
FT                   /protein_id="AMW40778.1"
FT                   /translation="MSFWKVAAAQYEPRKTSLTEQVAHHLEFVRAAARQQCQLLVFPSL
FT                   SLLGCDYSRRALPAPPDLSLLDPLCYAATTWRMTIIAGLPVEYNDRFIRGIAVFAPWRK
FT                   TPGIYHQSHGACLGRRSRTITVVDEQPQGMDMDPTCSLFTTGQCLGEPDLLASARRLQF
FT                   FSHQYSIAVLMANARGNSALWDEHGRLIVRADRGSLLLVGQRSSQGWQGDIIPLR"
FT   gene            complement(47105..47335)
FT                   /locus_tag="ARC77_00250"
FT   CDS_pept        complement(47105..47335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00250"
FT                   /product="DNA polymerase III subunit theta"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00250"
FT                   /db_xref="GOA:C3T607"
FT                   /db_xref="InterPro:IPR009052"
FT                   /db_xref="InterPro:IPR036745"
FT                   /db_xref="UniProtKB/TrEMBL:C3T607"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000916769.1"
FT                   /protein_id="AMW40779.1"
FT                   /translation="MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQP
FT                   EHLRSWFRERLIAHRLASVNLSRLPYEPKLK"
FT   gene            47474..47848
FT                   /locus_tag="ARC77_00255"
FT   CDS_pept        47474..47848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00255"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00255"
FT                   /db_xref="GOA:C3T612"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C3T612"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000168735.1"
FT                   /protein_id="AMW40780.1"
FT                   /translation="MASTARSLRYALAILTTSLVTPSVWAHAHLTHQYPAANAQVTAAP
FT                   QAITLNFSEGVETGFSGAKITGPKNENIKTLPAKRNEQDQKRLIVPLADSLKPGTYTVD
FT                   WHVVSVDGHKTKGHYTFSVK"
FT   gene            47852..48724
FT                   /locus_tag="ARC77_00260"
FT   CDS_pept        47852..48724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00260"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00260"
FT                   /db_xref="GOA:A0A143DUE5"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DUE5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001551232.1"
FT                   /protein_id="AMW40781.1"
FT                   /translation="MLAFTWIALRFIHFTSLMLVFGFAMYGAWLAPLTIRRLLTKRFLR
FT                   LQQHAAVWSLISATAMLAVQGGLMGTGWKDVFSPNIWQAVLQTQFGGVWLWQIVLALVT
FT                   LIVALMQPRNMPRLLFMLTTAQFILLAGVGHATLNEGVTAKIHQTNHAIHLICAAVWFG
FT                   GLLPVLWCMQLIKGRWRHQAIQALMRFSWCGHFAVIGVLASGVLNALLITGFPPTLTTY
FT                   WGQLLLLKAILVMIMVVIALANRYVLVPRMRQDEDRAAPWFVWMTKLEWAIGAVVLLII
FT                   SLLATLEPF"
FT   gene            48740..49078
FT                   /locus_tag="ARC77_00265"
FT   CDS_pept        48740..49078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00265"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00265"
FT                   /db_xref="InterPro:IPR019648"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143E7L8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003034934.1"
FT                   /protein_id="AMW45888.1"
FT                   /translation="MKKSILAFLLLTSSAAALAAPQVITVSRFEVGKDKWAFNREEVML
FT                   TCRPGNALYVINPSTLVQYPLNDVAQKEVASGKTKAQPISVIQIDDPNNPGEKMSLAPF
FT                   IERAEKLC"
FT   gene            49163..49249
FT                   /locus_tag="ARC77_00270"
FT   CDS_pept        49163..49249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00270"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00270"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0A6V5X2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000214009.1"
FT                   /protein_id="AMW40782.1"
FT                   /translation="MTTALFIDHFARKLENLASSSILKGQGN"
FT   gene            49474..50130
FT                   /locus_tag="ARC77_00275"
FT   CDS_pept        49474..50130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00275"
FT                   /product="serine/threonine protein phosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00275"
FT                   /db_xref="GOA:A0A0K3GV38"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3GV38"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001752599.1"
FT                   /protein_id="AMW40783.1"
FT                   /translation="MKQPAPVYQRIAGHQWRHIWLSGDIHGCLEQLRRKLWHCRFDPWR
FT                   DLLISVGDVIDRGPQSLRCLQLLEQHWVRAVRGNHEQMAMDALASQQMSLWLMNGGDWF
FT                   IALADNQQKQAKTALEKCQHLPFILEVHSRTGKHVIAHADYPDDVYEWQKDVDLHQVLW
FT                   SRSRLSERQKGQGITGADHFWFGHTPLRHRVDIGNLHYIDTGAVFGGELTFVQLQ"
FT   gene            complement(50131..50322)
FT                   /locus_tag="ARC77_00280"
FT   CDS_pept        complement(50131..50322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00280"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00280"
FT                   /db_xref="InterPro:IPR009954"
FT                   /db_xref="UniProtKB/TrEMBL:W8SY60"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014728646.1"
FT                   /protein_id="AMW45889.1"
FT                   /translation="MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRHGGCFP
FT                   IEDFIDGFWRPAQEYGDF"
FT   gene            complement(50427..50663)
FT                   /locus_tag="ARC77_00285"
FT   CDS_pept        complement(50427..50663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00285"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00285"
FT                   /db_xref="InterPro:IPR009950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J3VAR7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001295499.1"
FT                   /protein_id="AMW40784.1"
FT                   /translation="MKTSVRIGAFEIDDGELHGESPGDRTLTIPCKSDPDLCMQLDAWD
FT                   AETSIPALLNGEHSVLYRTRYDQQSDAWIMRLA"
FT   gene            complement(50781..52220)
FT                   /gene="yebU"
FT                   /locus_tag="ARC77_00290"
FT   CDS_pept        complement(50781..52220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebU"
FT                   /locus_tag="ARC77_00290"
FT                   /product="16S rRNA (cytosine(1407)-C(5))-methyltransferase
FT                   RsmF"
FT                   /note="in Escherichia coli this enzyme specifically
FT                   methylates C1407 of the 16S rRNA; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00290"
FT                   /db_xref="GOA:A0A152V2V6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023545"
FT                   /db_xref="InterPro:IPR027391"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V2V6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q0TGZ7.2"
FT                   /protein_id="AMW45890.1"
FT                   /translation="MAQHTVYFPDAFLTQMREAMPSTLSFDDFLAACQRPLRRSIRVNT
FT                   LKTSVADFLRLTAPYGWTLTPIPWCEEGFWIERDDEDALPLGSTAEHLSGLFYIQEASS
FT                   MLPVAALFADGNAPQRVMDVAAAPGSKTTQIAARMNNEGAILANEFSASRVKVLHANIS
FT                   RCGISNVALTHFDGRVFGAALPEMFDAILLDAPCSGEGVVRKDPDALKNWSPESNQEIA
FT                   ATQRELIDSAFHALRSGGTLVYSTCTLNREENESVCLWLKETYPDAVEFLPLGDLFPGA
FT                   NKALTEEGFLHVFPQIYDCEGFFVARLRKTQAIPALPTPKYKVGNFPFSPVKDREAAQI
FT                   RQAAASVGLNWDGNLRLWQRDKEVWLFPVGIEALIGKVRFSRLGIKLAETHNKGYRWQH
FT                   EAVIALASPDNENAFELTPQEAEEWYRGRDVYPQAAPVADDVLVTFQHQPIGLAKRIGS
FT                   RLKNSYPRELVRDGKLFTSNA"
FT   gene            complement(52301..54934)
FT                   /locus_tag="ARC77_00295"
FT   CDS_pept        complement(52301..54934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00295"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00295"
FT                   /db_xref="GOA:A0A152V2M9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V2M9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001529214.1"
FT                   /protein_id="AMW40785.1"
FT                   /translation="MSQETPASTTEAQIKNKRRISPFWLLPFIALMIAGWLIWDSYQDR
FT                   GNTVTIDFMSADGIVPGRTPVRYQGVEVGTVQDISLSDDLRKIEVKVSIKSDMKDALRE
FT                   ETQFWLVTPKASLAGVSGLDALVGGNYIGMMPGKGKEQDHFVALDTQPKYRLDNGDLMI
FT                   HLQAPDLGSLNSGSLVYFRKIPVGKVYDYAINPNKQGVVIDVLIERRFTDLVKKGSRFW
FT                   NVSGVDANVSISGAKVKLESLAALVNGAIAFDSPEESKPAEAEDTFGLYEDLAHSQRGV
FT                   IIKLELPSGAGLTADSTPLMYQGLEVGQLTKLDLNPGGKVTGEMTVDPSVVTLLRENTR
FT                   IELRNPKLSLSDANLSALLTGKTFELVPGDGEPRKEFVVVPGEKALLHEPDVLTLTLTA
FT                   PESYGIDAGQPLILHGVQVGQVIDRKLTSKGVTFTVAIEPQHRELVKGDSKFVVNSRVD
FT                   VKVGLDGVEFLGASASEWINGGIRILPGDKGEMKASYPLYANLEKALENSLSDLPTTTV
FT                   SLSAETLPDVQAGSVVLYRKFEVGEVITVRPRANAFDIDLHIKPEYRNLLTNNSVFWAE
FT                   GGAKVQLNGSGLTVQASPLSRALKGAISFDNLSGASASQRKGDKRILYASETAARAVGG
FT                   QITLHAFDAGKLAVGMPIRYLGIDIGQIQTLDLITARNEVQAKAVLYPEYVQTFARGGT
FT                   RFSVVTPQISAAGVEHLDTILQPYINVEPGRGNPRRDFELQEATITDSRYLDGLSIIVE
FT                   APEACSLGIGTPVLFRGLEVGTVTGMTLGTLSDRVMIAMRISKRYQHLVRNNSVFWLAS
FT                   GYSLDFGLTGGVVKTGTFNQFIRGGIAFATPPGTPLAPKAQEGKHFLLQESEPKEWREW
FT                   GTALPK"
FT   gene            complement(54903..56186)
FT                   /locus_tag="ARC77_00300"
FT   CDS_pept        complement(54903..56186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00300"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00300"
FT                   /db_xref="GOA:C3T652"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniProtKB/TrEMBL:C3T652"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016152782.1"
FT                   /protein_id="AMW40786.1"
FT                   /translation="MALNTPQITPTKKITVRAIGEELPRGDYQRCPQCDMLFSLPEINS
FT                   HQSAYCPRCQAKIRDGRDWSLTRLAAMAFTMLLLMPFAWGEPLLHIWLLGIRIDANVMQ
FT                   GIWQMTKQGDAITGSMVFFCVIGAPLILVTSIAYLWFGNRLGMNLRPVLLMLERLKEWV
FT                   MLDIYLVGIGVASIKVQDYAHIQAGVGLFSFVALVILTTVTLSHLNVEELWERFYPQRP
FT                   ATRRDEKLRVCLGCHFTGYPDQRGRCPRCHIPLRLRRRHSLQKCWAALLASIVLLLPAN
FT                   LLPISIIYLNGGRQEDTILSGIMSLASSNIAVAGIVFIASILVPFTKVIVMFTLLLSIH
FT                   FKCQQGLRTRILLLRMVTWIGRWSMLDLFVISLTMSLINRDQILAFTMGPAAFYFGAAV
FT                   ILTILAVEWLDSRLLWDAHESGNARFDD"
FT   gene            56316..56813
FT                   /locus_tag="ARC77_00305"
FT   CDS_pept        56316..56813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00305"
FT                   /product="Free methionine-R-sulfoxide reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00305"
FT                   /db_xref="GOA:W8SY64"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:W8SY64"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001043884.1"
FT                   /protein_id="AMW40787.1"
FT                   /translation="MNKTEFYADLNRDFNALMAGETSFLATLANTSALLYERLTDVNWA
FT                   GFYLLEDDTLVLGPFQGKIACVRIPVGRGVCGTAVARNQVQRIEDVHAFDGHIACDAAS
FT                   NSEIVLPLVVKNQIIGVLDIDSTVFGRFTDEDEQGLRQLVAQLEKVLATTDYKKFFASV
FT                   AG"
FT   gene            56910..57608
FT                   /locus_tag="ARC77_00310"
FT   CDS_pept        56910..57608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00310"
FT                   /product="RNA chaperone ProQ"
FT                   /note="affects solute and DNA transport through an unknown
FT                   mechanism; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00310"
FT                   /db_xref="GOA:C3T662"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR035236"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:C3T662"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120752.1"
FT                   /protein_id="AMW40788.1"
FT                   /translation="MENQPKLNSSKEVIAFLAERFPHCFSAEGEARPLKIGIFQDLVDR
FT                   VAGEMNLSKTQLRSALRLYTSSWRYLYGVKPGATRVDLDGNPCGELDEQHVEHARKQLE
FT                   EAKARVQAQRAEQQAKKREAAAAAGEKEDAPRRERKPRPTTPRRKEGAERKPRAQKPVE
FT                   KAPKTAKAPREEQHTPVSDISALTVGQALKVKAGQNAMDATVLEITKDGVRVQLNSGMS
FT                   LIVRAEHLVF"
FT   gene            57628..59676
FT                   /locus_tag="ARC77_00315"
FT   CDS_pept        57628..59676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00315"
FT                   /product="C-terminal processing peptidase"
FT                   /note="Involved in the cleavage of a C-terminal peptide of
FT                   11 residues from the precursor form of penicillin-binding
FT                   protein 3; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00315"
FT                   /db_xref="GOA:C3T667"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR020992"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040573"
FT                   /db_xref="UniProtKB/TrEMBL:C3T667"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001731075.1"
FT                   /protein_id="AMW40789.1"
FT                   /translation="MNMFFRLTALAGLLAIAGQTFAVEDITRADQIPVLKEETQHATVS
FT                   ERVTSRFTRSHYRQFDLDQAFSAKIFDRYLNLLDYSHNVLLASDVEQFAKKKTELGDEL
FT                   RSGKLDVFYDLYNLAQKRRFERYQYALSVLEKPMDFTGNDTYNLDRSKAPWPKNEAELN
FT                   ALWDSKVKFDELSLKLAGKTDKEIRETLTRRYKFAIRRLAQTNSEDVFSLAMTAFAREI
FT                   DPHTNYLSPRNTEQFNTEMSLSLEGIGAVLQMDDDYTVINSMVAGGPAAKSKAISVGDK
FT                   IVGVGQTGKPMVDVIGWRLDDVVALIKGPKGSKVRLEILPAGKGTKTRTVTLTRERIRL
FT                   EDRAVKMSVKTVGKEKVGVLDIPGFYVGLTDDVKVQLQKLEKQNVSSVIIDLRSNGGGA
FT                   LTEAVSLSGLFIPAGPIVQVRDNNGKVREDSDTDGQVFYKGPLVVLVDRFSASASEIFA
FT                   AAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPALGSVQYTIQKFYRVNGG
FT                   STQRKGVTPDIIMPTGNEETETGEKFEDNALPWDSIDAATYVKSGDLTAFEPELLKEHN
FT                   ARIAKDPEFQNIMKDIARFNAMKDKRNIVSLNYAVREKENNEDDATRLARLNERFKREG
FT                   KPELKKLDDLPKDYQEPDPYLDETVNIALDLAKLEKARPAEQPAPVK"
FT   gene            59868..60749
FT                   /locus_tag="ARC77_00320"
FT   CDS_pept        59868..60749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00320"
FT                   /product="zinc metalloprotease HtpX"
FT                   /note="metalloprotease; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00320"
FT                   /db_xref="GOA:C3T672"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:C3T672"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014229823.1"
FT                   /protein_id="AMW40790.1"
FT                   /translation="MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFG
FT                   GSFVSLLMSKWMALRSVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDI
FT                   NAFATGARRDASLVAVSTGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFV
FT                   IFISRILAQLAAGFMGGNRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHRE
FT                   FHADAGSAKLVGREKMIAALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDK
FT                   RIEALRTGEYLK"
FT   gene            complement(60795..62168)
FT                   /locus_tag="ARC77_00325"
FT   CDS_pept        complement(60795..62168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00325"
FT                   /product="multidrug MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00325"
FT                   /db_xref="GOA:A0A0K3FV86"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3FV86"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001432884.1"
FT                   /protein_id="AMW40791.1"
FT                   /translation="MPKVQADGLPLPQRYGAILTIVIGISMAVLDGAIANVALPTIATD
FT                   LHATPASSIWVVNAYQIAIVISLLSFSFLGDMFGYRRIYKCGLVVFLLSSLFCALSDSL
FT                   QILTLARVIQGFGGAALMSVNTALIRLIYPQRFLGRGMGINSFIVAVSSAAGPTIAAAI
FT                   LSIASWKWLFLINVPLGIIALLLAMRFLPPNGSRASKPRFDLPSAVMNALTFGLLITAL
FT                   SGFAQGQSLTLIAAELVVMVVVGIFFIRRQLSLPVPLLPVDLLRIPLFSLSICTSVCSF
FT                   CAQMLAMVSLPFYLQTVLGRSEVETGLLLTPWPLATMVMAPLAGYLIERVHAGLLGALG
FT                   LFIMAAGLFSLVLLPASPADINIIWPMILCGAGFGLFQSPNNHTIITSAPRERSGGASG
FT                   MLGTARLLGQSSGAALVALMLNQFGDNGTHVSLMAAAILAVIAACISGLRITQPRSRA"
FT   gene            62345..63136
FT                   /locus_tag="ARC77_00330"
FT   CDS_pept        62345..63136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00330"
FT                   /product="DNA-binding transcriptional regulator KdgR"
FT                   /note="regulates the genes involved in 2-keto-3-deoxy
FT                   gluconate transport and catabolism; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00330"
FT                   /db_xref="GOA:C3T682"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3T682"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012132042.1"
FT                   /protein_id="AMW40792.1"
FT                   /translation="MANADLDKQPDSVSSVLKVFGILQALGEEREIGITELSQRVMMSK
FT                   STVYRFLQTMKTLGYVAQEGESEKYSLTLKLFELGARALQNVDLIRSADIQMREISRLT
FT                   KETIHLGALDEDSIVYIHKIDSMYNLRMYSRIGRRNPLYSTAIGKVLLAWRDRDEVKQI
FT                   LEGVEYKRSTERTITSTEALLPVLDQVREQGYGEDNEEQEEGLRCIAVPVFDRFGVVIA
FT                   GLSISFPTLRFSEERLQEYVAMLHTAARKISAQMGYHDYPF"
FT   gene            complement(63280..63519)
FT                   /locus_tag="ARC77_00335"
FT   CDS_pept        complement(63280..63519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00335"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00335"
FT                   /db_xref="InterPro:IPR025611"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DVA3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016153403.1"
FT                   /protein_id="AMW40793.1"
FT                   /translation="MRFIIRTVMLIALVWIGLLLSGYGVLIGSKENAAELGLQCTYLTA
FT                   RGTSTVQYLHTKSGFLGITDCPLLRKSNIVVDNG"
FT   gene            63679..63822
FT                   /locus_tag="ARC77_00340"
FT   CDS_pept        63679..63822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00340"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00340"
FT                   /db_xref="GOA:C3T687"
FT                   /db_xref="InterPro:IPR020907"
FT                   /db_xref="UniProtKB/TrEMBL:C3T687"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003034977.1"
FT                   /protein_id="AMW40794.1"
FT                   /translation="MKKFRWVVLVVVVLACLLLWAQVFNMMCDQDVQFFSGICAINQFI
FT                   PW"
FT   gene            63897..64184
FT                   /locus_tag="ARC77_00345"
FT   CDS_pept        63897..64184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00345"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00345"
FT                   /db_xref="GOA:C3T692"
FT                   /db_xref="InterPro:IPR025594"
FT                   /db_xref="UniProtKB/TrEMBL:C3T692"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003034980.1"
FT                   /protein_id="AMW40795.1"
FT                   /translation="MNEVVNSGVMNIASLVVSVVVLLIGLILWFFINRASSRTNEQIEL
FT                   LEALLDQQKRQNALLRRLCEANEPEKADKKTIESQKSVEDEDIIRLVAER"
FT   gene            complement(64685..64891)
FT                   /locus_tag="ARC77_00350"
FT   CDS_pept        complement(64685..64891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00350"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00350"
FT                   /db_xref="UniProtKB/TrEMBL:W8U2W4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001308705.1"
FT                   /protein_id="AMW45891.1"
FT                   /translation="MFTQDFFTENATHKQNCTSFNPKSVITYNVNYGKPFLNMSRSDAQ
FT                   ISIRLPLFLHTYATEYAPIYHCA"
FT   gene            64853..64996
FT                   /locus_tag="ARC77_00355"
FT   CDS_pept        64853..64996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00355"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00355"
FT                   /db_xref="InterPro:IPR019672"
FT                   /db_xref="UniProtKB/TrEMBL:C3T697"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016536904.1"
FT                   /protein_id="AMW40796.1"
FT                   /translation="MCGIFSKEVLSKHVDVEYRFSAEPYIGASCSNVSVLSMLCLRAKK
FT                   TI"
FT   gene            65009..65218
FT                   /locus_tag="ARC77_00360"
FT   CDS_pept        65009..65218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00360"
FT                   /product="cold-shock protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00360"
FT                   /db_xref="GOA:C3T6A2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6A2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001062678.1"
FT                   /protein_id="AMW40797.1"
FT                   /translation="MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLA
FT                   EGQNVEFEIQDGQKGPAAVNVTAI"
FT   gene            65384..66193
FT                   /gene="rrmA"
FT                   /locus_tag="ARC77_00365"
FT   CDS_pept        65384..66193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrmA"
FT                   /locus_tag="ARC77_00365"
FT                   /product="23S rRNA (guanine(745)-N(1))-methyltransferase"
FT                   /note="methylates the guanosine in position 745 of 23S
FT                   rRNA; required for translation and cell growth; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00365"
FT                   /db_xref="GOA:C3T6A7"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6A7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001631524.1"
FT                   /protein_id="AMW40798.1"
FT                   /translation="MSFSCPLCHQPLTREKNSYICPQRHQFDMAKEGYVNLLPVQHKRS
FT                   RDPGDSAEMMQARRAFLDAGHYQPLRDAIVAQLRERLNEKATAVLDIGCGEGYYTHAFA
FT                   DALPEITTFGLDVSKVAIKAAAKRYPQVTLCVASSHRLPFSDTSMDAIIRIYAPCKAEE
FT                   LARVVKPGGWVITATPGPRHLMELKGLIYNEVHLHAPHAEQLEGFTLQKSDELCYPMRL
FT                   RGDEAVALLQMTPFAWRAKPEVWQILAAKEVFDCQTDFNIHLWQRSY"
FT   gene            complement(66190..66756)
FT                   /locus_tag="ARC77_00370"
FT   CDS_pept        complement(66190..66756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00370"
FT                   /product="hypothetical protein"
FT                   /note="membrane protein YebN; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00370"
FT                   /db_xref="GOA:E2QN23"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:E2QN23"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001296134.1"
FT                   /protein_id="AMW40799.1"
FT                   /translation="MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGA
FT                   VETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHG
FT                   FWLLVTTAIATSLDAMAVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIG
FT                   KKAEILGGLVLIGIGVQILWTHFHG"
FT   gene            complement(67186..67644)
FT                   /locus_tag="ARC77_00375"
FT   CDS_pept        complement(67186..67644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00375"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00375"
FT                   /db_xref="GOA:C3T6B7"
FT                   /db_xref="InterPro:IPR009328"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6B7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001538832.1"
FT                   /protein_id="AMW40800.1"
FT                   /translation="MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRI
FT                   DSVIFVGLIVILIYNNVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANV
FT                   WIEYSRIKAMNLSEDGVLVMQLEQRRLLIRVRNIDDLERIYKLLVSTQ"
FT   gene            complement(67699..68550)
FT                   /locus_tag="ARC77_00380"
FT   CDS_pept        complement(67699..68550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00380"
FT                   /product="PTS mannose transporter subunit IID"
FT                   /note="hosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system catalyzes the phosphorylation of
FT                   incoming sugar substrates concomitant with their
FT                   translocation across the cell membrane; IID with IIC forms
FT                   the translocation channel; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00380"
FT                   /db_xref="GOA:A0A0J3YAP3"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J3YAP3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000228655.1"
FT                   /protein_id="AMW40801.1"
FT                   /translation="MVDTTQTTTEKKLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFS
FT                   MVPAIRRLYPENNEARKQAIRRHLEFFNTQPFVAAPILGVTLALEEQRANGAEIDDGAI
FT                   NGIKVGLMGPLAGVGDPIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLATRY
FT                   YGVAYGYSKGIDIVKDMGGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSRITDQ
FT                   TGKEHVTTVQTILDQLMPGLVPLLLTFACMWLLRKKVNPLWIIVGFFVIGIAGYACGLL
FT                   GL"
FT   gene            complement(68563..69363)
FT                   /locus_tag="ARC77_00385"
FT   CDS_pept        complement(68563..69363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00385"
FT                   /product="PTS mannose/fructose/sorbose transporter subunit
FT                   IIC"
FT                   /note="catalyzes the phosphorylation of incoming sugar
FT                   substrates concomitant with their translocation across the
FT                   cell membrane; the IIC domain forms the PTS system
FT                   translocation channel and contains the specific
FT                   substrate-binding site; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00385"
FT                   /db_xref="GOA:C3T6C7"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6C7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002910918.1"
FT                   /protein_id="AMW40802.1"
FT                   /translation="MEITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGD
FT                   MKTGIIIGGTLEMIALGWMNIGAAVAPDAALASIISTILVIAGHQSIGAGIALAIPLAA
FT                   AGQVLTIIVRTITVAFQHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVG
FT                   TSEVQNMLNAIPEVVTNGLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNF
FT                   NLVALGVIGTVMAVLYIQLSPKYNRVAGAPAQAAGNNDLDNELD"
FT   gene            complement(69426..70397)
FT                   /locus_tag="ARC77_00390"
FT   CDS_pept        complement(69426..70397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00390"
FT                   /product="PTS mannose transporter subunit EIIAB"
FT                   /note="catalyzes the phosphorylation of incoming sugar
FT                   substrates concomitant with their translocation across the
FT                   cell membrane; subunit IIA transfers a phosphoryl group to
FT                   subunit IIB; subunit IIB transfers the phosphoryl group to
FT                   the substrate; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00390"
FT                   /db_xref="GOA:C3T6D2"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="InterPro:IPR018455"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6D2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000150548.1"
FT                   /protein_id="AMW40803.1"
FT                   /translation="MTIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETL
FT                   IEKYNAQLAKLDTTKGVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMA
FT                   RDDDPSFDELVALAVETGREGVKALKAKPVEKAAPAPAAAAPKAAPTPAKPMGPNDYMV
FT                   IGLARIDDRLIHGQVATRWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVD
FT                   VAKMIRVYNNPKYAGERVMLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAV
FT                   SVDEKDIEAFKKLNARGIELEVRKVSTDPKLKMMDLISKIDK"
FT   gene            70663..70872
FT                   /locus_tag="ARC77_00395"
FT   CDS_pept        70663..70872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00395"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00395"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6D7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303534.1"
FT                   /protein_id="AMW40804.1"
FT                   /translation="MFNSRLTIMEYRAVARSMDRHRRHFSIRPFNACLSGTLCRTFRLH
FT                   FVVTPALFLASNSYSLSRSLSWNS"
FT   gene            70860..72410
FT                   /locus_tag="ARC77_00400"
FT   CDS_pept        70860..72410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00400"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00400"
FT                   /db_xref="GOA:A0A0D7IJM3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7IJM3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020233072.1"
FT                   /protein_id="AMW40805.1"
FT                   /translation="MEFLMDPSIWAGLLTLVVLEIVLGIDNLVFIAILADKLPPKQRDK
FT                   ARLLGLSLALIMRLGLLSLISWMVTLTKPLFTVMDFSFSGRDLIMLFGGIFLLFKATTE
FT                   LHERLENRDHDSGHGKGYASFWVVVTQIVILDAVFSLDAVITAVGMVNHLPVMMAAVVI
FT                   AMAVMLLASKPLTRFVNQHPTVVVLCLSFLLMIGLSLVAEGFGFHIPKGYLYAAIGFSI
FT                   IIEVFNQIARRNFIRHQSTLPLRARTADAILRLMGGKRQANVQHDADNPMPIPEGAFAE
FT                   EERYMINGVLTLASRSLRGIMTPRGEISWVDANLGVDEIREQLLSSPHSLFPVCRGELD
FT                   EIIGIVRAKELLVALEEGVDVAAIASASPAIIVPETLDPINLLGVLRRARGSFVIVTNE
FT                   FGVVQGLVTPLDVLEAIAGEFPDADETPEIITDGDGWLVKGGTDLHALQQALDVEHLAD
FT                   DDDIATVAGLVISANGHIPRVGDVIDVGPLHITIIEANDYRVDLVRIVKEQPAHDEDE"
FT   gene            complement(72414..74012)
FT                   /locus_tag="ARC77_00405"
FT   CDS_pept        complement(72414..74012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00405"
FT                   /product="c-di-GMP phosphodiesterase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00405"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V2R1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001295494.1"
FT                   /protein_id="AMW40806.1"
FT                   /translation="MQKAQRIIKTYRRNRMIVCTICALVTLASTLSVRFISQRNLNQQR
FT                   VVQFANHAVEELDKVLLPLQAGSEVLLPLIGLPCSVAHLPLRKQAAKLQTVRSIGLVQD
FT                   GTLYCSSIFGYRNVPVVDILAELPAPQPLLRLTTDRVLIKGSPVLIQWTPAASSSNAGV
FT                   MEMINIDLLTAMLLEPQLPQISSASLTVDKRHLLYGNGLVDSLPQPEDNENYQVSSQRF
FT                   SFTINVNGPGAPALAWHYLPTQLPLAVLLSLLVGYIAWLATAYRMSFSREINLGLAQHE
FT                   FELFCQPLLNARSQQCIGVEILLRWNNPRQGWISPDVFIPIAEEHHLIVPLTRYVMAET
FT                   IRQRHVFPMSSQFHVGINVAPSHFRRGVLIKDLNQYWFSAHPIQQLILEITERDALLDV
FT                   DYRIARELHRKNVKLAIDDFGTGNSSFSWLETLRPDVLKIDKSFTAAIGSDAVNSTVTD
FT                   IIIALGQRLNIELVAEGVETQEQAKYLRRHGVHILQGYLYAQPMPLRDFPKWLAGSQPP
FT                   PARHNGHITPIMPLR"
FT   gene            complement(74143..75507)
FT                   /locus_tag="ARC77_00410"
FT   CDS_pept        complement(74143..75507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00410"
FT                   /product="L-serine ammonia-lyase"
FT                   /note="catalyzes the formation of pyruvate from serine;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00410"
FT                   /db_xref="GOA:C3T6E7"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6E7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_004863895.1"
FT                   /protein_id="AMW40807.1"
FT                   /translation="MISLFDMFKVGIGPSSSHTVGPMKAGKQFVDDLVEKGLLDSVTRV
FT                   AVDVYGSLSLTGKGHHTDIAIIMGLAGNEPATVDIDSIPGFIRDVEERERLLLAQGRHE
FT                   VDFPRDNGMRFHNGNLPLHENGMQIHAYNGDEVVYSKTYYSIGGGFIVDEEHFGQDTAN
FT                   EVSVPYPFKSATELLAYCNETGYSLSGLAMQNELALHSKKEIDEYFAHVWQTMQACIDR
FT                   GMNTEGVLPGPLRVPRRASALRRMLVSSDKLSNDPMNVIDWVNMFALAVNEENAAGGRV
FT                   VTAPTNGACGIVPAVLAYYDHFIESVSPDIYTRYFMAAGAIGALYKMNASISGAEVGCQ
FT                   GEVGVACSMAAAGLAELLGGSPEQVCVAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIA
FT                   SVKAINAARMALRRTSAPRVSLDKVIETMYETGKDMNAKYRETSRGGLAIKVQCD"
FT   gene            complement(75691..76269)
FT                   /locus_tag="ARC77_00415"
FT   CDS_pept        complement(75691..76269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00415"
FT                   /product="coenzyme A pyrophosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00415"
FT                   /db_xref="GOA:C3T6F2"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023735"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6F2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000456734.1"
FT                   /protein_id="AMW40808.1"
FT                   /translation="MEYRSLTLDDFLSRFQLLRPQINRETLNHRQAAVLIPIVRRPQPG
FT                   LLLTQRSIHLRKHAGQVAFPGGAVDDTDASVIAAALREAEEEVAIPPSAVEVIGVLPPV
FT                   DSVTGYQVTPVVGIIPPDLPYRASEDEVSAVFEMPLAQALHLGRYHPLDIYRRGDSHRV
FT                   WLSWYEQYFVWGMTAGIIRELALQIGVKP"
FT   gene            complement(76273..77634)
FT                   /gene="pabB"
FT                   /locus_tag="ARC77_00420"
FT   CDS_pept        complement(76273..77634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="ARC77_00420"
FT                   /product="aminodeoxychorismate synthase component I"
FT                   /note="para-aminobenzoate synthase component 1; catalyzes
FT                   the formation of 4-amino-4-deoxychorismate from chorismate
FT                   and L-glutamine; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00420"
FT                   /db_xref="GOA:C3T6F8"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6F8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000854994.1"
FT                   /protein_id="AMW40809.1"
FT                   /translation="MKTLSPAVITLPWRQDAAEFYFSRLSHLPWAMLLHSGYADHPYSR
FT                   FDIVVADPICTLTTLGKETVVSESEKRTTTTDDPLQVLQQVLDRADIRPTHNEDLPFQG
FT                   GALGLFGYDLGRRFESLPEIAEQDIVLPDMAVGIYDWALIVDHQRHTVSLLSHNDVNAR
FT                   RAWLESQQFSPQEDFTLTSDWQSNMTREQYGEKFRRVQEYLHSGDCYQVNLAQRFHATY
FT                   SGDEWQAFLQLNQANRAPFSAFLRLEQGAILSLSPERFILCDNSEIQTRPIKGTLPRLP
FT                   APQEDSKQAEKLANSAKDRAENLMIVDLMRNDIGRVAVAGSVKVPELFVVEPFPAVHHL
FT                   VSTITAQLPEQLHASDLLRAAFPGGSITGAPKVRAMEIIDELEPQRRNAWCGSIGYLSF
FT                   CGNMDTSITIRTLTAINGQIYCSAGGGIVADSQEEAEYQETFDKVNKILRQLEK"
FT   gene            77708..77887
FT                   /locus_tag="ARC77_00425"
FT   CDS_pept        77708..77887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00425"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00425"
FT                   /db_xref="InterPro:IPR005371"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6G2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P0A2M3.1"
FT                   /protein_id="AMW40810.1"
FT                   /translation="MFAGLPSLTHEQQQKAVERIQELMAQGMSSGQAIALVAEELRANH
FT                   SGERIVARFEDEDE"
FT   gene            complement(78007..78306)
FT                   /locus_tag="ARC77_00430"
FT   CDS_pept        complement(78007..78306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00430"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00430"
FT                   /db_xref="InterPro:IPR015079"
FT                   /db_xref="InterPro:IPR037210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A037YBL6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001544618.1"
FT                   /protein_id="AMW40811.1"
FT                   /translation="MPAVIDKALDFIGAMDVSAPTPSSMNESTAKGIFKYLKELGVPAS
FT                   AADITARADQEGWNPGFTEKMVGWAKKMETGERSVIKNPEYFSTYMQEELKALV"
FT   gene            complement(78728..79072)
FT                   /locus_tag="ARC77_00435"
FT   CDS_pept        complement(78728..79072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00435"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00435"
FT                   /db_xref="GOA:W8SY87"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:W8SY87"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005122186.1"
FT                   /protein_id="AMW40812.1"
FT                   /translation="MTIVRIDAEARWSDVVIHNNTLYYTGVPENLDADAFEQTANTLAQ
FT                   IDAVLEKQGSNKSSILDATIFLADKNDFAAMNKAWDAWVVAGHAPVRCTVQAGLMNPKY
FT                   KVEIKIVAAV"
FT   gene            79204..81114
FT                   /locus_tag="ARC77_00440"
FT   CDS_pept        79204..81114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00440"
FT                   /product="ATP-dependent helicase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00440"
FT                   /db_xref="GOA:C3T6H7"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6H7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001474343.1"
FT                   /protein_id="AMW40813.1"
FT                   /translation="MTDDFAPDGQLAKAIPGFKPREPQRQMAVAVTQAIEKGQPLVVEA
FT                   GTGTGKTYAYLAPALRAKKKVIISTGSKALQDQLYSRDLPTVSKALKYTGNVALLKGRS
FT                   NYLCLERLEQQALAGGDLPVQILSDVILLRSWSNQTVDGDISTCVSVAEDSQAWPLVTS
FT                   TNDNCLGSDCPMYKDCFVVKARKKAMDADVVVVNHHLFLADMVVKESGFGELIPEADVM
FT                   IFDEAHQLPDIASQYFGQSLSSRQLLDLAKDITIAYRTELKDTQQLQKCADRLAQSAQD
FT                   FRLQLGEPGYRGNLRELLANPQIQRAFLLLDDTLELCYDVAKLSLGRSALLDAAFERAT
FT                   LYRTRLKRLKEINQPGYSYWYECTSRHFTLALTPLSVADKFKELMAQKPGSWIFTSATL
FT                   SVNDDLHHFTSRLGIEQAESLLLPSPFDYSRQALLCVPRNLPQTNQPGSARQLAAMLRP
FT                   IIEANNGRCFMLCTSHAMMRDLAEQFRATMTLPVLLQGETSKGQLLQQFVSAGNALLVA
FT                   TSSFWEGVDVRGDTLSLVIIDKLPFTSPDDPLLKARMEDCRLRGGDPFDEVQLPDAVIT
FT                   LKQGVGRLIRDADDRGVLVICDNRLVMRPYGATFLASLPPAPRTRDIARAVRFLAIPSS
FT                   R"
FT   gene            81172..81867
FT                   /locus_tag="ARC77_00445"
FT   CDS_pept        81172..81867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00445"
FT                   /product="tRNA
FT                   N6-adenosine(37)-N6-threonylcarbamoyltransferase complex
FT                   dimerization subunit TsaB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00445"
FT                   /db_xref="GOA:B5B0M4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B5B0M4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016161378.1"
FT                   /protein_id="AMW40814.1"
FT                   /translation="MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDI
FT                   LTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWR
FT                   KNGATRVLSAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPELVHERMQQLSGEWVTV
FT                   GTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNV
FT                   AWKKLPGKE"
FT   gene            81907..82488
FT                   /locus_tag="ARC77_00450"
FT   CDS_pept        81907..82488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00450"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00450"
FT                   /db_xref="GOA:C3T6I7"
FT                   /db_xref="InterPro:IPR004658"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6I7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005122191.1"
FT                   /protein_id="AMW40815.1"
FT                   /translation="MAVQKNVIKGILAGTFALMLSGCVTVPDAIKGSSPTPQQDLVRVM
FT                   SAPQLYVGQEARFGGKVVAVQNQQGKTRLEIATVPLDSGARPTLGEPSRGRIYADVNGF
FT                   LDPVDFRGQLVTVVGPITGAVDGKIGNTPYKFMVMQATGYKRWHLTQQVIMPPQPIDPW
FT                   FYGGRGWPYGHGGWGWYNPGPARVQTVVTE"
FT   gene            82660..84378
FT                   /locus_tag="ARC77_00455"
FT   CDS_pept        82660..84378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00455"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /note="Activates fatty acids by binding to coenzyme A;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00455"
FT                   /db_xref="GOA:A0A152V2S1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V2S1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001443143.1"
FT                   /protein_id="AMW45892.1"
FT                   /translation="MTTNTHFRGEELKKVWLNRYPADVPTEINPDRYQSLVDMFEQSVA
FT                   RYADQPAFVNMGEVMTFRKLEERSRAFAAYLQQGLGLKKGDRVALMMPNLLQYPVALFG
FT                   ILRAGMIVVNVNPLYTPRELEHQLNDSGASAIVIVSNFAHTLEKVVDKTAVQHVILTRM
FT                   GDQLSTAKGTLVNFVVKYIKRLVPKYHLPDAISFRSALHNGYRMQYVKPELVPEDLAFL
FT                   QYTGGTTGVAKGAMLTHRNMLANLEQVNATYGPLLHPGKELVVTALPLYHIFALTINCL
FT                   LFIELGGQNLLITNPRDIPGLVKELAKYPFTAITGVNTLFNALLNNKEFQQLDFSSLHL
FT                   SAGGGMPVQQVVAERWVKLTGQYLLEGYGLTECAPLVSVNPYDIDYHSGSIGLPVPSTE
FT                   AKLVDDDDNEVSPGQPGELCVRGPQVMLGYWQRPDATDEIIKNGWLHTGDIAVMDEEGF
FT                   LRIVDRKKDMILVSGFNVYPNEIEDVVMQHPGVQEVAAVGVPSGSSGEAVKIFVVKKDP
FT                   SLTEESLVTFCRRQLTGYKVPKLVEFRDELPKSNVGKILRRELRDEARGKVDNKA"
FT   gene            84460..85575
FT                   /locus_tag="ARC77_00460"
FT   CDS_pept        84460..85575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00460"
FT                   /product="ribonuclease D"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00460"
FT                   /db_xref="GOA:A0A023KKF7"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR006292"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A023KKF7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019076968.1"
FT                   /protein_id="AMW40816.1"
FT                   /translation="MITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDG
FT                   EHLALIDPLGITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAA
FT                   FCGRPMSWGFASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLM
FT                   VETEASGWLPAALDECRLMQMRRQEVVAPEDAWRDITNAWQLRTRQLACLQLLADWRLR
FT                   KARERDLAVNFVVREEHLWSVARYMPGSLGELDSLGLSGSEIRFHGKTLLALVEKAQTL
FT                   PEEALPQPMLNLMDMPGYRKAFKAIKSLITDVSETHKISAELLASRRQINQLLNWHWKL
FT                   KPQNNLPELISGWRGELMAEALHNLLQEYPQ"
FT   gene            complement(85629..86594)
FT                   /locus_tag="ARC77_00465"
FT   CDS_pept        complement(85629..86594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00465"
FT                   /product="ferredoxin--NADP(+) reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00465"
FT                   /db_xref="GOA:C3T6K4"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039003"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6K4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_004224047.1"
FT                   /protein_id="AMW40817.1"
FT                   /translation="MSDYQMFEVQVSQVEPLTEQVKRFTPVATDGKPLPAFTGGSHIIV
FT                   QMSDGDNQYSNAYSLLSSPHNTSSYQIAVRLEENSRGGSRFLHQQVKVGDRLTISTPNN
FT                   LFALIPSARKHLFIAGGIGITPFLSHMAELQHSDVDWQLHYCSRNPESCAFRDELVQHP
FT                   QAEKVHLHHSSTGTRLELARLLADIEPGTHVYTCGPEALIEAVRSEAARLDIAADTLHF
FT                   EQFAIEDKTGDAFTLVLARSGKEFVVPEEMTILQVIENNKAAKVECLCREGVCGTCETA
FT                   ILEGEADHRDQYFSDEERASQQSMLICCSRAKGKRLVLDL"
FT   gene            complement(86650..87774)
FT                   /locus_tag="ARC77_00470"
FT   CDS_pept        complement(86650..87774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00470"
FT                   /product="ring-hydroxylating oxygenase subunit alpha"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00470"
FT                   /db_xref="GOA:C3T6K7"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR039004"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6K7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000067809.1"
FT                   /protein_id="AMW40818.1"
FT                   /translation="MSNLSPDFVLPENFCANPQEAWTIPARFYTDQNAFEHEKENVFAK
FT                   SWICVAHSSELANANDYVTREIIGESIVLVRGRDKVLRAFYNVCPHRGHQLLSGEGKAK
FT                   NVITCPYHAWAFKLDGNLAHARNCENVANFDSDKAQLVPVRLEEYAGFVFINMDPNATS
FT                   VEDQLPGLGAKVLEACPEVHDLKLAARFTTRTPANWKNIVDNYLECYHCGPAHPGFSDS
FT                   VQVDRYWHTMHGNWTLQYGFAKPSEQSFKFEEGTDAAFHGFWLWPCTMLNVTPIKGMMT
FT                   VIYEFPVDSETTLQNYDIYFTNEELTDEQKSLIEWYRDVFRPEDLRLVESVQKGLKSRG
FT                   YRGQGRIMADSSGSGISEHGIAHFHNLLAQVFKD"
FT   gene            complement(87806..89416)
FT                   /locus_tag="ARC77_00475"
FT   CDS_pept        complement(87806..89416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00475"
FT                   /product="transporter"
FT                   /note="member of the betaine, carnitine, choline
FT                   transporter (BCCT) family; unknown function; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00475"
FT                   /db_xref="GOA:A0A143DT14"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DT14"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000987525.1"
FT                   /protein_id="AMW40819.1"
FT                   /translation="MMSNVKKKDVPLISISLVAILFIAAALSLFPQQSADAANAIYTFV
FT                   TRTLGSAVQVLVLLAMGLVIYLATSKYGNIRLGEGKPEYSTLSWLFMFICAGLGSSTLY
FT                   WGGAEWAYYYQTPGLNIAPRSQQALEFSVPYSFFHWGISAWATYTLASLIMAYHFHVRK
FT                   NKGLSLSGIIAAITGVRPQGPWGKLVDLMFLIATVGALTISLVVTAATFTRGLSALTGL
FT                   PDNFTVQAFVILLSGGIFCLSSWIGINNGLQRLSKMVGWGAFLLPLLVLIVGPTEFITN
FT                   SIINAIGLTTQNFLQMSLFTDPLGDGSFTRNWTVFYWLWWISYTPGVAMFVTRVSRGRK
FT                   IKEVIWGLILGSTVGCWFFFGVMESYAIHQFINGVINVPQVLETLGGETAVQQVLMSLP
FT                   AGKLFLAAYLGVMIIFLASHMDAVAYTMAATSTRNLQEGDDPDRGLRLFWCVVITLIPL
FT                   SILFTGASLETMKTTVVLTALPFLVILLVKVGGFIRWLKQDYADIPAHQVEHYLPQTPV
FT                   EALEKTPVLPAGTVFKGDN"
FT   gene            complement(89667..90752)
FT                   /locus_tag="ARC77_00480"
FT   CDS_pept        complement(89667..90752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00480"
FT                   /product="tartrate dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00480"
FT                   /db_xref="GOA:C3T6L2"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6L2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000973819.1"
FT                   /protein_id="AMW40820.1"
FT                   /translation="MMKTMRIAAIPGDGIGKEVLPEGIRVLQAAAERWGFALSFEQMEW
FT                   ASCEYYSHHGKMMPDDWHEQLSRFDAIYFGAVGWPDTVPDHISLWGSLLKFRREFDQYV
FT                   NLRPVRLFPGVPCPLAGKQPGDIDFYVVRENTEGEYSSLGGRVNEGTEHEVVIQESVFT
FT                   RRGVDRILRYAFELAQSRPRKTLTSATKSNGLAISMPYWDERVEAMAENYPEIRWDKQH
FT                   IDILCARFVMQPERFDVVVASNLFGDILSDLGPACTGTIGIAPSANLNPERTFPSLFEP
FT                   VHGSAPDIYGKNIANPIATIWAGAMMLDFLGNGDERFQQAHNGILAAIEEVIAHGPKTP
FT                   DMKGSATTPQVADAICKIILR"
FT   gene            90855..91778
FT                   /locus_tag="ARC77_00485"
FT   CDS_pept        90855..91778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00485"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00485"
FT                   /db_xref="GOA:A0A066QAJ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066QAJ0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001061578.1"
FT                   /protein_id="AMW45893.1"
FT                   /translation="MNNLPLLNDLRVFMLVARRAGFAAVAEELGVSPAFVSKRIALLEQ
FT                   TLNVVLLHRTTRRVTITEEGERIYEWAQRILQDVGQMMDELSDVRQVPQGMLRIISSFG
FT                   FGRQVVAPALSALAKAYPQLELRFDVEDRLVDLVNEGVDLDIRIGDDIAPNLIARKLAT
FT                   NYRILCASPEFIAQHGAPKHLTDLSALPCLVIKERDHPFGVWQLRNKEGHHAIKVTGPL
FT                   SSNHGEIVHQWCLDGQGIALRSWWDVSENIASGHLVQVLPEYYQPANVWAVYVSRLATS
FT                   AKVRITVEFLRQYFAEHYPNFSLEHA"
FT   gene            91905..92543
FT                   /locus_tag="ARC77_00490"
FT   CDS_pept        91905..92543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00490"
FT                   /product="leucine efflux protein LeuE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00490"
FT                   /db_xref="GOA:C3T6M2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6M2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120378.1"
FT                   /protein_id="AMW40821.1"
FT                   /translation="MFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVSSGMKGGYL
FT                   AACGVFIGDAVLMFLAWAGMATLIKTTPILFNIVRYLGAFYLLYLGSKILYATLKGKNN
FT                   EAKSDEPQYGAIFKRALILSLTNPKAILFYVSFFVQFIDVNAPHTGISFFILATTLELV
FT                   SFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLATLQS"
FT   gene            92716..93075
FT                   /locus_tag="ARC77_00495"
FT   CDS_pept        92716..93075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00495"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00495"
FT                   /db_xref="GOA:C3T6M7"
FT                   /db_xref="InterPro:IPR014510"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015392"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6M7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120376.1"
FT                   /protein_id="AMW40822.1"
FT                   /translation="MLQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSV
FT                   MHGAVKYLGYADEHSAEPDQVILIEAGQFAVFPPEKWHNIEAMTDDTYFNIDFFVAPEV
FT                   LMEGAQQRKVIHNGK"
FT   gene            93079..93261
FT                   /locus_tag="ARC77_00500"
FT   CDS_pept        93079..93261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00500"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00500"
FT                   /db_xref="InterPro:IPR015051"
FT                   /db_xref="InterPro:IPR036489"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6N2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003856955.1"
FT                   /protein_id="AMW40823.1"
FT                   /translation="MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNT
FT                   VRSYDTENEHDVCGW"
FT   gene            93408..93656
FT                   /locus_tag="ARC77_00505"
FT   CDS_pept        93408..93656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00505"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00505"
FT                   /db_xref="GOA:C3T6N7"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6N7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003851381.1"
FT                   /protein_id="AMW40824.1"
FT                   /translation="MGILSWIIFGLIAGILAKWIMPGKDGGGFFMTILLGIVGAVVGGW
FT                   ISTLFGFGKVDGFNFGSFVVAVIGAIVVLFIYRKIKS"
FT   gene            complement(93792..93890)
FT                   /locus_tag="ARC77_00510"
FT   CDS_pept        complement(93792..93890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00510"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00510"
FT                   /db_xref="GOA:A0A024L2N9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024L2N9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013366625.1"
FT                   /protein_id="AMW45894.1"
FT                   /translation="MRIGIIFPVVIFITAVVFLAWFFIGGYAAPGA"
FT   gene            complement(93923..94948)
FT                   /locus_tag="ARC77_00515"
FT   CDS_pept        complement(93923..94948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00515"
FT                   /product="diguanylate cyclase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00515"
FT                   /db_xref="GOA:A0A0K3WJ15"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3WJ15"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001356265.1"
FT                   /protein_id="AMW40825.1"
FT                   /translation="MSDQIIARISQSLAKEQSLESLVRQLLEMLEMVTDMESTYLTKVD
FT                   VEARLQHIMFARNSQKMHIPENFTVSWDYSLCKRAIDENCFFSDEVPDRWGDCIAARNL
FT                   GITTFLSTPIHLPDGSFYGTLCAASSEKRQWSERAEQVLQLFAGLIAQYIQKEALVEQL
FT                   REANAALIAQSYTDSLTGLPNRRAIFENLTTLFSLARHLNQKIMIAFIDLDNFKLINDR
FT                   FGHNSGDLFLIQVGERLNTLQQNGEVIGRLGGDEFLVVSLNNENADISSLRERIQQQIR
FT                   GEYHLGDVDLYYPGASLGIVEVDPETTDADSALHAADIAMYQEKKHKQKTPFVAHSAPH
FT                   S"
FT   gene            95131..95385
FT                   /locus_tag="ARC77_00520"
FT   CDS_pept        95131..95385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00520"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00520"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6P2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000691902.1"
FT                   /protein_id="AMW40826.1"
FT                   /translation="MKIISFVLPCLLVLAGCSTPSQPEAPKPPQIGMANPASVYCQQKG
FT                   GTLIPVQTAQGVSNNCKLPGGETIDEWALWRLDHPAGEK"
FT   gene            complement(95407..95754)
FT                   /locus_tag="ARC77_00525"
FT   CDS_pept        complement(95407..95754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00525"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00525"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A023KPY3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001025381.1"
FT                   /protein_id="AMW40827.1"
FT                   /translation="MNIQCKRVYDPAEQSDGYRVLVDRLWPRGIKKTDLALDEWDKEIT
FT                   PSTELRKAFHGEVVDFATFREQYLAELAQHEQEGKRLADIAKKQPLTLLYSAKNTTQNH
FT                   ALVLADWLRSL"
FT   gene            complement(95809..96990)
FT                   /locus_tag="ARC77_00530"
FT   CDS_pept        complement(95809..96990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00530"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00530"
FT                   /db_xref="GOA:C3T6Q2"
FT                   /db_xref="InterPro:IPR004747"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6Q2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000128498.1"
FT                   /protein_id="AMW40828.1"
FT                   /translation="MTCSTSLSGKNRIVLIAGILMIATTLRVTFTGAAPLLDTIRSAYS
FT                   LTTAQTGLLTTLPLLAFALISPLAAPVARRFGMERSLFAALLLICAGIAIRSLPSPYLL
FT                   FGGTAVIGGGIALGNVLLPGLIKRDFPHSVARLTGAYSLTMGAAAALGSAMVVPLALNG
FT                   FGWQGALLMLMCFPLLALFLWLPQWRSQQHANLSTSRALHTRGIWRSPLAWQVTLFLGI
FT                   NSLVYYVIIGWLPAILISHGYSEAQAGSLHGLLQLATAAPGLLIPLFLHHVKDQRGIAA
FT                   FVALMCAVGAVGLCFMPAHAITWTLLFGFGSGATMILGLTFIGLRASSAHQAAALSGMA
FT                   QSVGYLLAACGPPLMGKIHDANGDWSVPLMGVAILSLLMAIFGLCAGRDKEIR"
FT   gene            97087..97908
FT                   /locus_tag="ARC77_00535"
FT   CDS_pept        97087..97908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00535"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00535"
FT                   /db_xref="GOA:C3T6Q7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6Q7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000972267.1"
FT                   /protein_id="AMW40829.1"
FT                   /translation="MMHRLNLNGYEPDRHHEAAVAFCIHAGTDELTSPVHQHRKGQLIL
FT                   ALHGAITCTVENALWMVPPQYAVWIPGGVEHSNQVTANAELCFLFIEPSAVTMPTTCYT
FT                   LKISPLCRELILTLANRTTTQRAEPMTRRLIQVLFDELPQQPQQQLHLPVSSHPKIRAM
FT                   VEMMAKEPVEWGALGQWAGFFAMSERNLARLIVKETGLSFRQWRQQLQLIMALQGLVKG
FT                   DTVQKVAHTLGYDSTTAFITMFKKGLGQTPGRYIAGLTTVSPQSAKPDPWQ"
FT   gene            complement(97865..98311)
FT                   /locus_tag="ARC77_00540"
FT   CDS_pept        complement(97865..98311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00540"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00540"
FT                   /db_xref="GOA:C3T6R2"
FT                   /db_xref="InterPro:IPR007382"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6R2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003030713.1"
FT                   /protein_id="AMW40830.1"
FT                   /translation="MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPLSTFFPW
FT                   IEKQGLSIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVT
FT                   LMGSQPQLVAGLLVGTVLGVALFRGVPVGPLIATGLVSLIVGKQ"
FT   gene            98433..98585
FT                   /locus_tag="ARC77_00545"
FT   CDS_pept        98433..98585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00545"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00545"
FT                   /db_xref="GOA:C3T6R7"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6R7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001297649.1"
FT                   /protein_id="AMW40831.1"
FT                   /translation="MHANNNVKTAISRGYAMNDQMFVETLIITSSFFAIAVVLVLSVLL
FT                   IERTG"
FT   gene            complement(98586..99089)
FT                   /locus_tag="ARC77_00550"
FT   CDS_pept        complement(98586..99089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00550"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00550"
FT                   /db_xref="GOA:C3T6S2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6S2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001710368.1"
FT                   /protein_id="AMW40832.1"
FT                   /translation="MTEMAKGSVTHQRLIALLSQEGADFRVVTHEAVGKCEAVSEIRGT
FT                   ALGQGAKALVCKVKGNGVNQHVLAILAADQQADLSQLASHIGGLRASLASPAEVDELTG
FT                   CVFGAIPPFSFHPKLKLVADPLLFERFDEIAFNAGMLDKSVILKTADYLRIAQPELVNF
FT                   RRTA"
FT   gene            complement(99132..100622)
FT                   /locus_tag="ARC77_00555"
FT   CDS_pept        complement(99132..100622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00555"
FT                   /product="diguanylate cylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00555"
FT                   /db_xref="GOA:A0A143DVE8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DVE8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016242186.1"
FT                   /protein_id="AMW40833.1"
FT                   /translation="MKLHHRMLRHFIAASVIVLTSSFLIFELVASDRAMSAYLRYIVQK
FT                   ADSSFLYDKYQNQSIAAHVMRALAAEQSEVSPEQRRAICEAFESANNTHGLNLTAHKYP
FT                   GLRGTLQTASTDCDTIVEAAALLPAFDQAVEGNRHQDDYGSGLGMAEEKFHYYLDLNDR
FT                   YVYFYEPVNVEYFAMNNWSILQSGSIGIDRKDIEKVFTGRTVLSSIYQDQRTKQNVMSL
FT                   LTPVYVAGQLKGIVLLDINKNNLRNIFYTHDRPLLWRFLNVTLTDTDSGRDIIINQSED
FT                   NLFQYVSYVHDLPGGIRVSLSIDILYFITSSWKSVLFWILTALILLNMVRMHFRLYQNV
FT                   SRENISDAMTGLYNRKILTPELEQRLQKLVQSGSSVMFIAIDMDKLKLINDTLGHQEGD
FT                   LAITLLAQAIKQSIRKSDYAIRLGGDEFCIILVDSTPQIAAQLPERIEKRLQHIAPQKE
FT                   IGFSSGIYAMKENDTLHDAYKASDERLYVNKQNKNSRS"
FT   gene            complement(100803..102137)
FT                   /locus_tag="ARC77_00560"
FT   CDS_pept        complement(100803..102137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00560"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00560"
FT                   /db_xref="GOA:A0A090JAL4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A090JAL4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012311644.1"
FT                   /protein_id="AMW40834.1"
FT                   /translation="MGTQKLKAQSFFIFSLLLTLILFCITTLYNENTNVKLIPQMNYLM
FT                   VVVALFFLNAVIFLFMLMKYFTNKQILPTLILSLAFLSGLIYLVETIVIIHKPINGSTL
FT                   IQTKSNDVSIFYIFRQLSFICLTSLALFCYGKDNILDNNKKKTGILLLALIPFLVFPLL
FT                   AHNLSSYNADYSLYVVDYCPDNHTATWGINYTKILVCLWAFLLFFIIMRTRLASELWPL
FT                   IALLCLASLCCNLLLLTLDEYNYTIWYISRGIEVSSKLFVVSFLIYNIFQELQLSSKLA
FT                   VHDVLTNIYNRRYFFNSVESLLSRPVVKDFCVMLVDINQFKRINAQWGHRVGDKVLVSI
FT                   VDIIQQSIRPDDILARLEGEVFGLLFTELNSAQAKIIAERMRKNVELLTGFSNRYDVPE
FT                   QMTISIGTVFSTGDTRNISLVMTEADKALREAKSEGGNKVIIHHI"
FT   gene            complement(102425..103708)
FT                   /locus_tag="ARC77_00565"
FT   CDS_pept        complement(102425..103708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00565"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00565"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6T7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q0TH44.1"
FT                   /protein_id="AMW40835.1"
FT                   /translation="MTWFIDRRLNGKNKSMVNRQRFLRRYKAQIKQSISEAINKRSVTD
FT                   VDSGESVSIPTEDISEPMFHQGRGGLRHRVHPGNDHFVQNDRIERPQGGGGGSGSGQGQ
FT                   ASQDGEGQDEFVFQISKDEYLDLLFEDLALPNLKQNQQRQLTEYKTHRAGYTANGVPAN
FT                   ISVVRSLQNSLARRTAMTAGKRRELHALEENLAIISNSEPAQLLEEERLRKEIAELRAK
FT                   IERVPFIDTFDLRYKNYEKRPDPSSQAVMFCLMDVSGSMDQSTKDMAKRFYILLYLFLS
FT                   RTYKNVEVVYIRHHTQAKEVDEHEFFYSQETGGTIVSSALKLMDEVVKERYNPAQWNIY
FT                   AAQASDGDNWADDSPLCHEILAKKLLPVVRYYSYIEITRRAHQTLWREYEHLQSTFDNF
FT                   AMQHIRDQDDIYPVFRELFHKQNATAKD"
FT   gene            complement(103821..105755)
FT                   /locus_tag="ARC77_00570"
FT   CDS_pept        complement(103821..105755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00570"
FT                   /product="PrkA family serine protein kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00570"
FT                   /db_xref="GOA:C3T6U2"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6U2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_011411173.1"
FT                   /protein_id="AMW40836.1"
FT                   /translation="MNIFDHYRQRYEAAKDEEFTLQEFLTTCRQDRSAYANAAERLLMA
FT                   IGEPVMVDTAQEPRLSRLFSNRVIARYPAFEEFYGMEDAIEQIVSYLKHAAQGLEEKKQ
FT                   ILYLLGPVGGGKSSLAERLKSLMQLVPIYVLSANGERSPVNDHPFCLFNPQEDAQILEK
FT                   EYGIPRRYLGTIMSPWAAKRLHEFGGDITKFRVVKVWPSILQQIAIAKTEPGDENNQDI
FT                   SALVGKVDIRKLEHYAQNDPDAYGYSGALCRANQGIMEFVEMFKAPIKVLHPLLTATQE
FT                   GNYNGTEGISALPFNGIILAHSNESEWVTFRNNKNNEAFLDRVYIVKVPYCLRISEEIK
FT                   IYEKLLNHSELTHAPCAPGTLETLSRFSILSRLKEPENSSIYSKMRVYDGESLKDTDPK
FT                   AKSYQEYRDYAGVDEGMNGLSTRFAFKILSRVFNFDHVEVAANPVHLFYVLEQQIEREQ
FT                   FPQEQAERYLEFLKGYLIPKYAEFIGKEIQTAYLESYSEYGQNIFDRYVTYADFWIQDQ
FT                   EYRDPDTGQLFDRESLNAELEKIEKPAGISNPKDFRNEIVNFVLRARANNSGRNPNWTS
FT                   YEKLRTVIEKKMFSNTEELLPVISFNAKTSTDEQKKHDDFVDRMMEKGYTRKQVRLLCE
FT                   WYLRVRKSS"
FT   gene            106191..106937
FT                   /locus_tag="ARC77_00575"
FT   CDS_pept        106191..106937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00575"
FT                   /product="MltA-interacting protein MipA"
FT                   /note="scaffolding protein for the murein polymerase MrcB
FT                   and the lytic transglycosylase MltA; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00575"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6U8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001489632.1"
FT                   /protein_id="AMW40837.1"
FT                   /translation="MTKLKLLALGVLIATSAGVAHAEGKFSLGAGVGVVEHPYKDYDTD
FT                   VYPVPVINYEGDNFWFRGLGGGYYLWNDATDKLSITAYWSPLYFKAKDSGDHQMRHLDD
FT                   RKSTMMAGLSYAHFTQYGYLRTTLAGDTLDNSNGIVWDMAWLYRYTNGGLTVTPGIGVQ
FT                   WNSENQNEYYYGVSRKESARSGLRGYNSNDSWSPYLELSASYNFLGDWSVYGTARYTRL
FT                   SDEVTDSPIVDKSWTGLISTGITYKF"
FT   gene            107027..107881
FT                   /locus_tag="ARC77_00580"
FT   CDS_pept        107027..107881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00580"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00580"
FT                   /db_xref="GOA:C3T6V2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6V2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001535389.1"
FT                   /protein_id="AMW40838.1"
FT                   /translation="MQQKMIQFSGDVSLPAIGQGTWYMGEDASQRKTEVAALRAGIELG
FT                   LTLIDTAEMYADGGAEKVVGEALTGLREKVFLVSKVYPWNAGGQKAINACEASLRRLNT
FT                   DYLDLYLLHWSGSFAFEETVAVMEKLIAQGKIRRWGVSNLDYADMQELWQLPGGNQCAT
FT                   NQVLYHLGSRGIEYDLLPWCQQQQMPVMAYSPLAQAGRLRNGLLKNAVVNEIAHAHNIS
FT                   AAQVLLAWVISHQGVMAIPKAATIAHVQQNAAVLEVELSSAELAMLDKAYPAPKGKTAL
FT                   DMV"
FT   gene            complement(107932..108816)
FT                   /locus_tag="ARC77_00585"
FT   CDS_pept        complement(107932..108816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00585"
FT                   /product="D-hexose-6-phosphate mutarotase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00585"
FT                   /db_xref="GOA:A0A0K3G0E3"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3G0E3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120345.1"
FT                   /protein_id="AMW40839.1"
FT                   /translation="MIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGA
FT                   HLLSWKPAGEEEVLWLSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWT
FT                   LKSHREDANGVALTFELTQSEETKKFWLHDFTLLAHFRVDKNCEIDLEAHGEFETTSAL
FT                   HTYFNVGDIAKVSVSGLGDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVIND
FT                   EALNRIIAVGHQHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETAYASEMQKVTKEK
FT                   PAHLAQSIRVAKR"
FT   gene            complement(108900..109895)
FT                   /locus_tag="ARC77_00590"
FT   CDS_pept        complement(108900..109895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00590"
FT                   /product="type I glyceraldehyde-3-phosphate dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00590"
FT                   /db_xref="GOA:C3T6W2"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6W2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006322611.1"
FT                   /protein_id="AMW40840.1"
FT                   /translation="MTIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYML
FT                   KYDSTHGRFDGTVEVKDGHLIVNGKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDE
FT                   TARKHITAGAKKVVMTGPSKDNTPMFVKGANFDKYAGQDIVSNASCTTNCLAPLAKVIN
FT                   DNFGIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPEL
FT                   NGKLTGMAFRVPTPNVSVVDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVS
FT                   TDFNGEVCTSVFDAKAGIALNDNFVKLVSWYDNETGYSNKVLDLIAHISK"
FT   gene            110237..110650
FT                   /locus_tag="ARC77_00595"
FT   CDS_pept        110237..110650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00595"
FT                   /product="peptide-methionine (R)-S-oxide reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00595"
FT                   /db_xref="GOA:C3T6W7"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6W7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001405294.1"
FT                   /protein_id="AMW40841.1"
FT                   /translation="MANKPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYH
FT                   CLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGH
FT                   VFPDGPQPTGERYCVNSASLRFTDGENGEEING"
FT   gene            110692..110964
FT                   /locus_tag="ARC77_00600"
FT   CDS_pept        110692..110964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00600"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00600"
FT                   /db_xref="InterPro:IPR009749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A023LEZ0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001046790.1"
FT                   /protein_id="AMW40842.1"
FT                   /translation="MNLDDIINSMTPEVYQRLSTAVELGKWPDGVALTEEQKENCLQLV
FT                   MLWQARNNTEAQHMTIDTNGQMVMKSKQQLKEDFGISAKPIAMFK"
FT   gene            111334..112410
FT                   /locus_tag="ARC77_00605"
FT   CDS_pept        111334..112410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00605"
FT                   /product="alcohol dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00605"
FT                   /db_xref="GOA:C3SDG4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDG4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000645191.1"
FT                   /protein_id="AMW40843.1"
FT                   /translation="MKALARFGKAFGGYKMIDVPQPICGPEDVVIEIKAAAICGADMKH
FT                   YNVDSGSDEFNSIRGHEFAGCIAQVGEKVKDWKVGQRVVSDNSGHVCGVCPACEQGDFL
FT                   CCTEKVNLGLDNNTWGGGFSKYCLVPGEILKIHRHALWEIPDGVDYEDAAVLDPICNAY
FT                   KSIAQQSKFLPGQDVVVIGTGPLGLFSVQMARIMGAVNIVVVGLQEDVAVRFPVAKELG
FT                   ATAVVNGSTEDVVARCQQICGKDNLGLVIECSGANIALKQAIEMLRPNGEVVRVGMGFK
FT                   PLDFSINDITAWNKSIIGHMAYDSTSWRNAIRLLASGAIKVKPMITHRIGLSQWREGFD
FT                   AMVDKTAIKVIMTYDFDE"
FT   gene            112437..113816
FT                   /locus_tag="ARC77_00610"
FT   CDS_pept        112437..113816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00610"
FT                   /product="transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00610"
FT                   /db_xref="GOA:C3SDG7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDG7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016236698.1"
FT                   /protein_id="AMW40844.1"
FT                   /translation="MDQITKPHCGARLDRLPDCRWHSSMFAIVAFGLLVCWSNAVGGLI
FT                   LAQLKALGWTDNSTTATFSAITTAGMFLGALVGGIIGDKTGRRNAFILYEAIHIASMVV
FT                   GAFSPNMDFLIACRFVMGVGLGALLVTLFAGFTEYMPGRNRGTWSSRVSFIGNWSYPLC
FT                   SLIAMGLTPLISAEWNWRVQLLIPAILSLIATALAWRYFPESPRWLESRGRYQEAEKVM
FT                   RSIEEGVIRHTGKPLPPVVIADDGKAPQAVPYSALLTGVLLKRVILGSCVLIAMNVVQY
FT                   TLINWLPTIFMTQGINLKDSIVLNTMSMFGTPFGIFIAMLVMDKIPRKTMGVGLLILIA
FT                   VLGYIYSLQTSMLLITLIGFFLITFVYMYVCYASAVYVPEIWPTEAKLRGSGLANAVGR
FT                   ISGIAAPYAVAVLLSSYGVTGVFILLGAVSIIVAIAIATIGIETKGVSVESLSIDAVAN
FT                   K"
FT   gene            113833..114876
FT                   /locus_tag="ARC77_00615"
FT   CDS_pept        113833..114876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00615"
FT                   /product="alcohol dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00615"
FT                   /db_xref="GOA:C3T6X7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6X7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016233269.1"
FT                   /protein_id="AMW40845.1"
FT                   /translation="MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHG
FT                   FESGPFIPPKDPNQEIGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEG
FT                   KYNICPDVDFMATQPNYRGALTHYLCHPESFTYKLPDNMDTMEGTLVEPAAVGMHAAML
FT                   ADVKPGKKIIILGAGCIGLMTLQACKCLGATEIAVVDVLEKRLAMAEQLGATVVINGAK
FT                   EDTIARCQQFTEDMGADIVFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGASAINFLKI
FT                   NREVTIQTVFRYANRYPVTIEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKRDIIK
FT                   GVIKISD"
FT   gene            114897..115733
FT                   /locus_tag="ARC77_00620"
FT   CDS_pept        114897..115733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00620"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00620"
FT                   /db_xref="GOA:C3T6Y2"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6Y2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000878896.1"
FT                   /protein_id="AMW40846.1"
FT                   /translation="MLADIRYWENDATNKRYAIAHFNVWNAEMLMGVIDAAEEAKSPVI
FT                   ISFGTGFVGNTSFEDFSHMMVSMAQKATVPVITHWDHGRSMEIIHNAWTHGMNSLMRDA
FT                   SAFDFEENIRLTKEAVDFFHPLGIPVEAELGHVGNETVYEEALAGYHYTDPDQAAEFVE
FT                   RTGCDSLAVAIGNQHGVYTSEPQLNFEVVKRVRDAVSVPLVLHGASGISDADIKTAISL
FT                   GIAKINIHTELCQAAMVAVKENQDQPFLHLEREVRKAVKERALEKIKLFGSDGKAE"
FT   gene            115738..116670
FT                   /locus_tag="ARC77_00625"
FT   CDS_pept        115738..116670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00625"
FT                   /product="sugar kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00625"
FT                   /db_xref="GOA:C3T6Y9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6Y9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003030681.1"
FT                   /protein_id="AMW40847.1"
FT                   /translation="MDNLDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAI
FT                   NEATIISRLGHRTALMSRIGKDAAGQFILDHCRKENIDIQSLKQDVNIDTSINVGLVTE
FT                   DGERTFVTNRNGSLWKLNIDDVDFARFSQAKLLSLASIFNSPLLDGKALTEIFTQAKAR
FT                   QMNICADMIKPRLNETLDDICEALSYVNYAEAKLLTGKETLDEIADSFLACGVKTVVIK
FT                   TGKDGCFIKRGDMTMKVPAVAGITAIDTIGAGDNFASGFIAALLEGKNLRECARFANAT
FT                   AAISVLSVGATTGVKNRKLVEQLLEEYEG"
FT   gene            116680..117660
FT                   /locus_tag="ARC77_00630"
FT   CDS_pept        116680..117660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00630"
FT                   /product="oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00630"
FT                   /db_xref="GOA:C3T6Z2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6Z2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000723713.1"
FT                   /protein_id="AMW40848.1"
FT                   /translation="MKKIPLGTTDITLSRMGLGTWAIGGGPAWNGDLDRQICIDTILEA
FT                   HRCGINLIDTAPGYNFGNSEVIVGQALKKLPREQVVVETKCGIVWERKGSLFNKVGDRQ
FT                   LYKNLSPESIREEVEASLQRLGFDYIDIYMTHWQSVPPFYTPIAETVAVLNELKAEGKI
FT                   RAIGAANVDADHIREYLQYGELDIIQAKYSILDRAMENELLPLCRDNGIVVQVYSPLEQ
FT                   GLLTGTITRDYVPGGARANKVWFQRENMLKVIDMLEQWQPLCARYQCTIPTLALAWILK
FT                   QSDLISILSGATAPEQVRENVAALNINLSDADATLMREMAEVLGR"
FT   gene            117797..118555
FT                   /locus_tag="ARC77_00635"
FT   CDS_pept        117797..118555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00635"
FT                   /product="DeoR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00635"
FT                   /db_xref="GOA:C3T6Z7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C3T6Z7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016152825.1"
FT                   /protein_id="AMW40849.1"
FT                   /translation="MAAKDRIQAIKQMVANDKKVTVSNLSGIFQVTEETIRRDLEKLED
FT                   EGFLTRTYGGAVLNTAMLTENIHFYKRASSFYEEKQLIARKALPFIDNKTTMAADSSST
FT                   VMELLKLLQDRSDLTLLTNSAEAIHVLAQSEIKVVSTGGELNKNTLSLQGRITKEIISR
FT                   YHVDIMVMSCKGLDINSGALDSNEAEAEIKKTMIRQATEVALLVDHSKFDRKAFVQLAD
FT                   FSHINYIITDKSPGAEWIAFCKDNNIQLVW"
FT   gene            118673..120031
FT                   /locus_tag="ARC77_00640"
FT   CDS_pept        118673..120031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00640"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00640"
FT                   /db_xref="GOA:A0A090J1P5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A090J1P5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P38055.2"
FT                   /protein_id="AMW40850.1"
FT                   /translation="MEQYDQIGARLDRLPLARFHYRIFGIISFSLLLTGFLSYSGNVVL
FT                   AKLVSNGWSNNFLNAAFTSALMFGYFIGSLTGGFIGDYFGRRRAFRINLLIVGIAATGA
FT                   AFVPDMYWLIFFRFLMGTGMGALIMVGYASFTEFIPATVRGKWSARLSFVGNWSPMLSA
FT                   AIGVVVIAFFSWRIMFLLGGIGILLAWFLSGKYFIESPRWLAGKGQIAGAECQLREVEQ
FT                   QIEREKSIRLPPLTSYQSNSKVKVIKGTFWLLFKGEMLRRTLVAITVLIAMNISLYTIT
FT                   VWIPTIFVNSGIDVDKSILMTAVIMIGAPVGIFIAALIIDHFPRRLFGSTLLIIIAVLG
FT                   YIYSIQTTEWAILIYGLVMIFFLYMYVCFASAVYIPELWPTHLRLRGSGFVNAVGRIVA
FT                   VFTPYGVAALLTHYGSITVFMVLGVMLLLCALVLSIFGIETRKVSLEEISEVN"
FT   gene            complement(120124..120765)
FT                   /locus_tag="ARC77_00645"
FT   CDS_pept        complement(120124..120765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00645"
FT                   /product="nicotinamidase/pyrazinamidase"
FT                   /note="catalyzes the formation of nicotinate from
FT                   nicotinamide in NAD biosynthesis and the formation of
FT                   pyrazinoate from pyrazinamide; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00645"
FT                   /db_xref="GOA:A0A143DUM4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DUM4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001525983.1"
FT                   /protein_id="AMW40851.1"
FT                   /translation="MPRRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGE
FT                   AVIASQDWHPANHGSFASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLNQKA
FT                   IAAVFHKGENPLVDSYSAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLD
FT                   ALQLGYKVNVITDGCRGVNIQPQDSAHAFMEMSAAGATLYTLADWEETQG"
FT   gene            complement(120776..121792)
FT                   /gene="ansA"
FT                   /locus_tag="ARC77_00650"
FT   CDS_pept        complement(120776..121792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansA"
FT                   /locus_tag="ARC77_00650"
FT                   /product="L-asparaginase 1"
FT                   /note="converts asparagine to aspartate and ammonia;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00650"
FT                   /db_xref="GOA:C3T712"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:C3T712"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014729098.1"
FT                   /protein_id="AMW40852.1"
FT                   /translation="MQKKSIYVAYTGGTIGMQRSEQGYIPVSGHLQRQLALMPEFHRPE
FT                   MPDFTIHEYTPLMDSSDMTPEDWQHIAEDIKAHYDDYDGFVILHGTDTMAYTASALSFM
FT                   LENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYPINEVTLFFNNRLYRGNRTTK
FT                   AHADGFDAFASPNLPPLLEAGIHIRRLNTPPAPHGEGELIVHPITPQPIGVVTIYPGIS
FT                   ADVVRNFLRQPVKALILRSYGVGNAPQNKAFLQELQEASDRGIVVVNLTQCMSGKVNMG
FT                   GYATGNALAHAGVIGGADMTVEATLTKLHYLLSQELDTETIRKAMSQNLRGELTPDD"
FT   gene            complement(121924..122634)
FT                   /locus_tag="ARC77_00655"
FT   CDS_pept        complement(121924..122634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00655"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00655"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7C4U9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001030441.1"
FT                   /protein_id="AMW40853.1"
FT                   /translation="MNKAPSLIAAIVLGLGISACGYFVGDGVKHLKTNNRYVNVRGLSE
FT                   KEVRADTAELTIAINFKGNVPGELFPKLEEAQKKIVAELNAQGINEKEIILGQWTSKRT
FT                   DSFYLKDDPTMPRYNADGSVTIKTHNVAAVEKVVAKLNELQVATDGAIAESKVAYRFNG
FT                   IGALRAEMIAAATKDARNAALQFATDSGSQVGSISDASQGVFQIFASGSDEDDPTAINK
FT                   TVRVVTTVTYALQD"
FT   gene            complement(122750..124606)
FT                   /locus_tag="ARC77_00660"
FT   CDS_pept        complement(122750..124606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00660"
FT                   /product="signal peptide peptidase SppA"
FT                   /note="SppA; catalyzes the degradation of cleaved signal
FT                   peptides; essential to maintain secretion of mature
FT                   proteins across the membrane; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00660"
FT                   /db_xref="GOA:C3T718"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033854"
FT                   /db_xref="UniProtKB/TrEMBL:C3T718"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001259851.1"
FT                   /protein_id="AMW40854.1"
FT                   /translation="MRTLWRFIAGFFKWTWRLLNFVREMVLNLFFIFLVLVGVGIWMQV
FT                   SGGDSKETASRGALLLDISGVIVDKPDSSQRFSKLSRQLLGASSDRLQENSLFDIVNTI
FT                   RQAKDDRNITGIVMDLKNFAGGDQPSMQYIGKALKEFRDSGKPVYAVGENYSQGQYYLA
FT                   SFANKIWLSPQGVVDLHGFATNGLYYKSLLDKLKVSTHVFRVGTYKSAVEPFIRDDMSP
FT                   AAREADSRWIGELWQNYLNTVAANRQIPAQQVFPGAQGLLEGLTKTGGDTAKYALENKL
FT                   VDALASSAEIEKALTKEFGWSKADKNYRAISYYDYALKTPADTGDSIGVVFANGAIMDG
FT                   EETQGNVGGDTTAAQIRDARLDPKVKAIVLRVNSPGGSVTASEVIRAELAAARAAGKPV
FT                   VVSMGGMAASGGYWISTPANYIVANPSTLTGSIGIFGVITTVENSLDSIGVHTDGVSTS
FT                   PLADVSITRALPPEAQQMMQLSIENGYKRFITLVADARHSTPEQIDKIAQGHVWTGQDA
FT                   KANGLVDSLGDFDDAVAKAAELAKAKQWHLEYYVDEPTFFDKVMDNMSGSVRAMLPDAF
FT                   QAMLPAPLASVASTVKSESDKLAAFNDPQNRYAFCLTCANVR"
FT   gene            complement(124549..124713)
FT                   /locus_tag="ARC77_00665"
FT   CDS_pept        complement(124549..124713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00665"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00665"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B1NPG3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001453023.1"
FT                   /protein_id="AMW40855.1"
FT                   /translation="MLQHSPQFLLTSAGWVITITTSIAPVTGVTLSWENTCEPFGDLLP
FT                   DFLNGRGVC"
FT   gene            124767..125318
FT                   /locus_tag="ARC77_00670"
FT   CDS_pept        124767..125318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00670"
FT                   /product="NAD(P)H nitroreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00670"
FT                   /db_xref="GOA:C3T722"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C3T722"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005121118.1"
FT                   /protein_id="AMW40856.1"
FT                   /translation="MDALELLINRRSASRLAEPAPTGEQLQNILRAGMRAPDHKSMQPW
FT                   HFFVIEGEGRERFSAVLEQGAIAAGSDDKAIDKARNAPFRAPLIITVVAKCEENHKVPR
FT                   WEQEMSAGCAVMAMQMAAVAQGFGGIWRSGALTESPVVREAFGCREQDKIVGFLYLGTP
FT                   QLKASTSINVPDPTPFVTYF"
FT   gene            125344..125493
FT                   /locus_tag="ARC77_00675"
FT   CDS_pept        125344..125493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00675"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0A6SGD8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012601546.1"
FT                   /protein_id="AMW40857.1"
FT                   /translation="MSKGAGIQTLSLITSRNEGYHTRIALTGDVHERELDSFDPIQPRS
FT                   WLRL"
FT   gene            125435..126478
FT                   /locus_tag="ARC77_00680"
FT   CDS_pept        125435..126478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00680"
FT                   /product="selenide,water dikinase SelD"
FT                   /note="catalyzes the formation of selenophosphate from
FT                   selenide and ATP; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00680"
FT                   /db_xref="GOA:C3T727"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C3T727"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005121117.1"
FT                   /protein_id="AMW40858.1"
FT                   /translation="MSENSIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVG
FT                   NETRDDAAVYDLGNGTSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIA
FT                   ILGWPINKLSPEIAREVTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIVPTERVK
FT                   KNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNIAGASFANIEGV
FT                   KAMTDVTGFGLLGHLSEMCQGAGVQARVDYDAIPKLPGVEEYIKLGAVPGGTERNFASY
FT                   GHLMGEMPREVRDLLCDPQTSGGLLLAVMPEAENEVKATAAEFGIELTAIGELVPARGG
FT                   RAMVEIR"
FT   gene            126483..128444
FT                   /locus_tag="ARC77_00685"
FT   CDS_pept        126483..128444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00685"
FT                   /product="DNA topoisomerase III"
FT                   /note="decatenates replicating daughter chromosomes;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00685"
FT                   /db_xref="GOA:C3T733"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:C3T733"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001235852.1"
FT                   /protein_id="AMW40859.1"
FT                   /translation="MRLFIAEKPSLARAIADVLPKPHRKGDGFIECGNGQVVTWCIGHL
FT                   LEQAQPDAYDSRYARWNLADLPIVPEKWQLQPRPSVTKQLNVIKRYLHEASEIVHAGDP
FT                   DREGQLLVDEVLDYLQLAPEKRQQVQRCLINDLNPQAVERAIDRLRSNSEFVPLCVSAL
FT                   ARARADWLYGINMTRAYTILGRNAGYQGVLSVGRVQTPVLGLVVRRDEEIENFVAKDFF
FT                   EVKAHIVTPADERFTAIWQPSEACEPYQDEEGRLLHRPLAEHVVNRISGQPAIVTSYND
FT                   KRESESAPLPFSLSALQIEAAKRFGLSAQNVLDICQKLYETHKLITYPRSDCRYLPEEH
FT                   FAGRHAVMNAISVHAPDLLPQPVVDPDIRNRCWDDKKVDAHHAIIPTARSSAINLTENE
FT                   AKVYNLISRQYLMQFCPDAVFRKCVIELDIAKGKFVAKARFLAEAGWRTLLGSKERDEE
FT                   NDGTPLPVVAKGDELLCEKGEVVERQTQPPRHFTDATLLSAMTGIARFVQDKDLKKILR
FT                   ATDGLGTEATRAGIIELLFKRGFLIKKGRYIHSTDAGKALFHSLPEMATRPDMTAHWES
FT                   VLTQISEKQCRYQDFMQPLVGTLYQLIDQAKRTPVRQFRGIVAPGSGGSADKKKAAPRK
FT                   RSAKKSPPADEAGSGAIA"
FT   gene            complement(128444..128642)
FT                   /pseudo
FT                   /locus_tag="ARC77_00690"
FT   CDS_pept        complement(128444..128642)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00690"
FT                   /product="glutamate decarboxylase"
FT                   /note="frameshifted; incomplete; partial on complete
FT                   genome; missing start and stop; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005022919.1"
FT   gene            128572..129612
FT                   /locus_tag="ARC77_00695"
FT   CDS_pept        128572..129612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00695"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00695"
FT                   /db_xref="GOA:C3T737"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:C3T737"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000756914.1"
FT                   /protein_id="AMW40860.1"
FT                   /translation="MKKVLLQNHPGSEKYSFNGWEIFNSNFERMIKENKTMLLCKWGFY
FT                   LTCVVAVMFVFAAITSNGLNERGLITAGCSFLYLLIMMGLIVRAGFKAKKEQLHYYQAK
FT                   GIEPLSIEKLQALQLIAPYRFYHKQWSETLEFWPRKPEPGKDTFQYHVLPFDSIDIISK
FT                   RRESLEEQWGIEDSESYCALMEHFLSGDHGANTFKANMEEAPEQVIALLNKFAVFPSDY
FT                   ISDCANHSSGKSSAKLIWAAELSWMISISSTAFQNGTIEEELAWHYIMLASRKAHELFE
FT                   SEEDYQKNSLMGFLYWHICCYRRKLTDAELEACYRYDKQFWEHYSKKCRWPIRNVPWGA
FT                   SSVKYS"
FT   gene            complement(129729..131072)
FT                   /locus_tag="ARC77_00700"
FT   CDS_pept        complement(129729..131072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00700"
FT                   /product="glutamate dehydrogenase"
FT                   /note="converts 2-oxoglutarate to glutamate; in Escherichia
FT                   coli this enzyme plays a role in glutamate synthesis when
FT                   the cell is under energy restriction; uses NADPH; forms a
FT                   homohexamer; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00700"
FT                   /db_xref="GOA:C3T742"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3T742"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013366584.1"
FT                   /protein_id="AMW40861.1"
FT                   /translation="MDQTYSLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKY
FT                   RQMSLLERLVEPERVIQFRVVWVDDRNQVQVNRAWRVQFSSAIGPYKGGMRFHPSVNLS
FT                   ILKFLGFEQTFKNALTTLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTD
FT                   VPAGDIGVGGREVGFMAGMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAM
FT                   LKRHGMGFEGMRVSVSGSGNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLAR
FT                   LIEIKSSRDGRVADYAKEFGLVYLEGQQPWSVPVDIALPCATQNELDVDAAHQLIANGV
FT                   KAVAEGANMPTTIEATELFQQAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVD
FT                   ARLHHIMLDIHHACVEHGGEGEQTNYVQGANIAGFVKVADAMLAQGVI"
FT   gene            131308..131580
FT                   /locus_tag="ARC77_00705"
FT   CDS_pept        131308..131580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00705"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00705"
FT                   /db_xref="InterPro:IPR009971"
FT                   /db_xref="UniProtKB/TrEMBL:C3T747"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000085220.1"
FT                   /protein_id="AMW40862.1"
FT                   /translation="MSRALFAVVLAFPLIALANPHYGPDVEVNVPPEVVSSGGQSAQPC
FT                   TQCCVYQDKNYSEGAVIKAEGILLQCQRDDKTLSTNPLVWRRVKP"
FT   gene            complement(131546..131953)
FT                   /locus_tag="ARC77_00710"
FT   CDS_pept        complement(131546..131953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00710"
FT                   /product="NTP pyrophosphohydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00710"
FT                   /db_xref="GOA:C3T752"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C3T752"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000781863.1"
FT                   /protein_id="AMW40863.1"
FT                   /translation="MKMIEVVAAIIERDGKILLAQRPAQSDQAGLWEFAGGKVEPDESQ
FT                   QQALVRELNEELGIEATVGEYVASHQREVSGRIIHLHAWHVPDFHGTLQAHEHQALVWC
FT                   SPEEALQYPLAPADIPLLEAFMALRAARPAD"
FT   gene            132040..132660
FT                   /locus_tag="ARC77_00715"
FT   CDS_pept        132040..132660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00715"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00715"
FT                   /db_xref="GOA:A0A0K4FSK6"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K4FSK6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001469178.1"
FT                   /protein_id="AMW40864.1"
FT                   /translation="MLDRHLHPRIKPLLHQCVRVLDKPGITPDGLTLVGFAIGVLALPF
FT                   LALGWYLAALVVILLNRLLDGLDGALARRRGLTDAGGFLDISLDFLFYALVPFGFILAA
FT                   PQQNALAGGWLLFAFIGTGSSFLAFAALAAKYQIDNPGYAHKSFYYLGGLTEGTETILL
FT                   FVLGCLFPAWFAWFAWIFGALCWMTTFTRVWSGYLTLKSLQRQ"
FT   gene            complement(132669..133976)
FT                   /locus_tag="ARC77_00720"
FT   CDS_pept        complement(132669..133976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00720"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00720"
FT                   /db_xref="GOA:A0A143DUC7"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DUC7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010356787.1"
FT                   /protein_id="AMW40865.1"
FT                   /translation="MKRVSQMTALAMALGLACASSWAAELAKPLTLDQLQQQNGKAIDT
FT                   RSSAFYNGWPQTLNGPSGHEPAALNLSASWLDKMSTEQLNAWIKQHNLKADAPVALYGN
FT                   GKDVDAVKTRLQKAGFTHISILSDALSEPSRLQKLPHFEQLVYPQWLHDLQQGKEVTAK
FT                   PAGDWKVIEAARGAPKLYLISHIPGADYIDTNEVESEPLWNKVSDEQLKAMLAKHGIRH
FT                   DTTVILYGRDVYAAARVAQIMLYAGVKDVRLLDGGWQTWSDAGLPVERGTPPKVKAEPD
FT                   FGVKIPAQPQLMLDMEQARGLLHRQDASLVSIRSWPEFIGTTSGYSYIKPKGEIAGARW
FT                   GHAGSDSTHMEDFHNPDGTMRSADDITAMWKAWNIKPDQQVSFYCGTGWRASETFMYAR
FT                   AMGWNNVSVYDGGWYEWSSDPKNPVATGERGPDSSK"
FT   gene            complement(134043..134696)
FT                   /locus_tag="ARC77_00725"
FT   CDS_pept        complement(134043..134696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00725"
FT                   /product="sulfate ABC transporter ATP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00725"
FT                   /db_xref="GOA:C3T769"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3T769"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001299561.1"
FT                   /protein_id="AMW40866.1"
FT                   /translation="MLCVKNVSLRLPESCLLTNVNFTVDKGDIVTLMGPSGCGKSTLFS
FT                   WMIGALAGQFSCTGELWLNEQRIDMLPTAQRQIGILFQDALLFDQFSVGQNLLLALPAT
FT                   LKGNTRRNAVNDALERSGLDGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSR
FT                   LDVALRDNFRQWVFSEVRELAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKLR"
FT   gene            complement(134696..136231)
FT                   /locus_tag="ARC77_00730"
FT   CDS_pept        complement(134696..136231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00730"
FT                   /product="thiamine ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00730"
FT                   /db_xref="GOA:A0A143DTL8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTL8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015364491.1"
FT                   /protein_id="AMW40867.1"
FT                   /translation="MATPLRYALIFLLWAMVAVIYAPLIPAALTLISPALSLTHWQALF
FT                   ADPQLPQALLATLVSTTIAAVGALLIALLVIVALWPGPKWQRMCTRLPWLLAIPHVAFA
FT                   TSALLLFADGGLLYDYFPYFTPPMDKLGIGLGFTLAVKESAFLLWILAAVLSEKRLLQQ
FT                   VIVLDSLGYSRWQCLNWLLLPSVAPALAMAMLAIVAWSLSVVDVAIILGPGNPPTLAVI
FT                   SWQWLTQGDADQQTKGALASLLLMLLLAAYVLLGYLLWCTWRRTIPRVDGVRKPATPLL
FT                   PGITLASFLPLTSVLCVVLLAILADQSTINSEALINSLTMGLVATFIALLLLLLWLEWG
FT                   PQRRQLWLWLPILLPALPLVAGQYTLALWLNMDGSWTAVVWGHLLWVMPWMLFILQPAW
FT                   QRIDSRLILIAQTLGWSRAKIFFYVKCPLMLRPTLIAFAVGFSVSIAQYMPTLWLGAGR
FT                   FPTLTTEAVALSSGGSNGILAALALWQLLLPLIIFALTALVAKWVGYVRQGLR"
FT   gene            complement(136204..137370)
FT                   /locus_tag="ARC77_00735"
FT   CDS_pept        complement(136204..137370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00735"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00735"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR027020"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UJ50"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016150116.1"
FT                   /protein_id="AMW40868.1"
FT                   /translation="MRHCGWLLGLLSLFSLATHASDWQEIKNEAKGQTVWFNAWGGDTA
FT                   INRYLDWVSGEMKTHYAINLKIVRLADAADAVKRIQTEAAAGRKTGGSVDLLWVNGENF
FT                   RTLKEANLLQTDWAETLPNWRYVDTQLPVREDFSVPTEGAESPWGGAQLTFIARRDVTP
FT                   QPPQTPQALLEFAKANPGTVTYPRPPDFTGTAFLEQLLIMLTPDPAALNEAPNDATFAR
FT                   VTAPLWQYLDALHPYLWREGKDFPPSPARMDALLKAGTFRLSLTFNPAHAQQKIASGDL
FT                   PASSYSFGFREGMIGNVHFVTIPANANASAAAKVVANFLLSPDAQLRKADPAVWGDPSV
FT                   LDPQKLPDGQRETLQSRMPQDLPPVLAEPHAGWVNALEQEWLHRYGTH"
FT   gene            complement(137380..137928)
FT                   /locus_tag="ARC77_00740"
FT   CDS_pept        complement(137380..137928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00740"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00740"
FT                   /db_xref="GOA:C3T782"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C3T782"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000524076.1"
FT                   /protein_id="AMW40869.1"
FT                   /translation="MGLPPLSKIPFILRPQAWLHRRHYGEVLSPIRWWGRIPFIFYLVS
FT                   MFVGWLERKRSPLDPVVRSLVSARIAQMCLCEFCVDITSMKVAERTGSSDKLLAVADWR
FT                   QSPLFSDEERLALEYAEAASVTPPTVDDALRTRLAAHFDAQELTELTALIGLQNLSARF
FT                   NSAMDIPAQGLCRIPEKRS"
FT   gene            complement(137928..138635)
FT                   /locus_tag="ARC77_00745"
FT   CDS_pept        complement(137928..138635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00745"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00745"
FT                   /db_xref="GOA:C3T787"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C3T787"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001718377.1"
FT                   /protein_id="AMW40870.1"
FT                   /translation="MMKMQSRKIWYYRITLIILLFAMLLAWALLPGVHEFINRSVAAFA
FT                   AVDQQGIERFIQSYGALAAVVSFLLMILQAIAAPLPAFLITFANASLFGAFWGGSLSWT
FT                   SSMAGAALCFFIARVMGREVVEKLTGKTVLDSMDGFFTRYGKHTILVCRLLPFVPFDPI
FT                   SYAAGLTSIRFRSFFIATGLGQLPATIVYSWAGSMLTGGTFWFVTGLFILFALTVVIFM
FT                   AKKIWLERQKRNA"
FT   gene            complement(138650..139327)
FT                   /locus_tag="ARC77_00750"
FT   CDS_pept        complement(138650..139327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00750"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00750"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3G2T6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005022884.1"
FT                   /protein_id="AMW40871.1"
FT                   /translation="MLQHYSVSWKKGLTALCLLAVAGLSGCDQKENAAAKVEYDGLSNS
FT                   QPLRVDANNHTVTMLVQINGRFLTDDTRHGIVFKDGSNGHKSLFMGYATPKAFYEALKE
FT                   AGGTPGENMTMDNKETTHVTGSKLDISVNWQGAAKTYSFDEVIVDSNGKKLDMRFGGNL
FT                   TAAEEKKTGCLVCLDSCPVGIVSNATYTYGAVEKRGEVKFKGNASVLPANNTLATVTFK
FT                   ITE"
FT   gene            complement(139332..140042)
FT                   /locus_tag="ARC77_00755"
FT   CDS_pept        complement(139332..140042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00755"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00755"
FT                   /db_xref="GOA:A0A0K6CFS2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K6CFS2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000990847.1"
FT                   /protein_id="AMW40872.1"
FT                   /translation="MNAERKFLFACLIFALAIYAIHAFGLFDLLTDLPHLQTLIRQSGL
FT                   FGYSLYILLFIIATLFLLPGSILVIAGGIVFGPFLGTLLSLIAATLASSCSFLLARWMG
FT                   RDLLLKYVGHSHTFQAIEKGIARNGIDFLILTRLIPLFPYNIQNYAYGLTTIAFWPYTL
FT                   ISALTTLPGIVIYTVMASDLANEGITLRFILQLCLAGLALFILVQLAKLYARHKHVDLS
FT                   ASRRNPLTHPKNEG"
FT   gene            complement(140209..141015)
FT                   /locus_tag="ARC77_00760"
FT   CDS_pept        complement(140209..141015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00760"
FT                   /product="exodeoxyribonuclease III"
FT                   /note="removes the damaged DNA at cytosines and guanines by
FT                   cleaving on the 3' side of the AP site by a
FT                   beta-elimination reaction; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00760"
FT                   /db_xref="GOA:C3T7A2"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7A2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000673907.1"
FT                   /protein_id="AMW40873.1"
FT                   /translation="MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLE
FT                   EVAKLGYNVFYHGQKGHYGVALLTKETPIAVRRGFPGDEEEAQRRIIMAEIPSPLGNVT
FT                   VINGYFPQGESRDHPIKFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGI
FT                   GEENRKRWLRTGKCSFLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDD
FT                   NRGLRIDLLLASQPLAECCVETGIDYEIRSMEKPSDHAPVWATFRR"
FT   gene            141461..142681
FT                   /locus_tag="ARC77_00765"
FT   CDS_pept        141461..142681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00765"
FT                   /product="acetylornithine aminotransferase"
FT                   /note="catalyzes the transamination of
FT                   2-N-succinylornithine and alpha-ketoglutarate into
FT                   2-N-succinylglutamate semialdehyde and glutamate; also
FT                   functions as the catabolic acetylornithine aminotransferase
FT                   catalyzing the formation of 2-N-acetylglutamate
FT                   semialdehyde and glutamate from 2-N-acetylornithine and
FT                   alpha-ketoglutarate; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00765"
FT                   /db_xref="GOA:C3T7A9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="InterPro:IPR026330"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7A9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000080457.1"
FT                   /protein_id="AMW40874.1"
FT                   /translation="MSQPITRENFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFA
FT                   GGIAVNALGHAHPELREALNEQASKFWHTGNGYTNESVLRLAKKLIDATFADRVFFCNS
FT                   GAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPP
FT                   DIRHAAYNDINSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCDRHNALLIF
FT                   DEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECASVMTVGTHGTT
FT                   YGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNIINHRYGLFNEVRGLGLLIG
FT                   CVLNADYAGQAKQIFQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAVACEH
FT                   FVSRGSS"
FT   gene            142678..143712
FT                   /locus_tag="ARC77_00770"
FT   CDS_pept        142678..143712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00770"
FT                   /product="arginine N-succinyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00770"
FT                   /db_xref="GOA:C3T7B2"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7B2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000989455.1"
FT                   /protein_id="AMW40875.1"
FT                   /translation="MMVIRPVERSDVSALMQLASKTGGGLTSLPANEATLSARIERAIK
FT                   TWQGELPKSEQGYVFVLEDSETGTVAGICAIEVAVGLNDPWYNYRVGTLVHASKELNVY
FT                   NALPTLFLSNDHTGSSELCTLFLDPDWRKEGNGYLLSKSRFMFMAAFRDKFNDKVVAEM
FT                   RGVIDEHGYSPFWQSLGKRFFSMDFSRADFLCGTGQKAFIAELMPKHPIYTHFLSQEAQ
FT                   DVIGQVHPQTAPARAVLEKEGFRYRNYIDIFDGGPTLECDIDRVRAIRKSRLVEVAEGQ
FT                   PAQGDFPACLVANENYHHFRVVLVRTDPATERLILTAAQLDALKCHAGDRVRLVRLCAE
FT                   EKTA"
FT   gene            143709..145187
FT                   /gene="astD"
FT                   /locus_tag="ARC77_00775"
FT   CDS_pept        143709..145187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astD"
FT                   /locus_tag="ARC77_00775"
FT                   /product="N-succinylglutamate 5-semialdehyde dehydrogenase"
FT                   /note="a high throughput screen identified this enzyme as
FT                   an aldehyde dehydrogenase with broad substrate specificity;
FT                   converts succinylglutamate semialdehyde and NAD to
FT                   succinylglutamate and NADH; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00775"
FT                   /db_xref="GOA:C3T7B8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7B8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016243221.1"
FT                   /protein_id="AMW40876.1"
FT                   /translation="MTLWINGDWITGQGASRVKRNPVSGEVLWQGNDADAAQVGQACRA
FT                   ARAAFPRWARLSFAERQAVVERFAGLLERNKGELTAIIARETGKPRWEAATELTAMINK
FT                   IAISIKAYHVRTGEQRSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGN
FT                   TIIFKPSELTPWSGEAVMRLWQQAGLPPGVLNLVQGGCETGQALSALEDLDGLLFTGSA
FT                   NTGYQLHRQLSGQPEKILALEMGGNNPLIIDEVADIDAAVHLTIQSAFVTAGQRCTCAR
FT                   RVLLKSGAQGDAFLARLVAVSQRLTPGNWDDEPQPFIGGLISEQAAQQVFTAWQQLEAM
FT                   GGRTLLAPRLLQAGTSLLTPGIIEMTGVAGVPDEEVFGPLLRVWRYDSFEEAIRMANNT
FT                   RFGLSCGLVSPEREKFDQLLLEARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYA
FT                   ADYCAWPMASLESDSLTLPATLNPGLDFSDEVVR"
FT   gene            145184..146527
FT                   /locus_tag="ARC77_00780"
FT   CDS_pept        145184..146527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00780"
FT                   /product="succinylarginine dihydrolase"
FT                   /note="catalyzes the hydrolysis of 2-N-succinylarginine
FT                   into 2-N-succinylornithine, ammonia and carbon dioxide in
FT                   arginine degradation; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00780"
FT                   /db_xref="GOA:C3T7C2"
FT                   /db_xref="InterPro:IPR007079"
FT                   /db_xref="InterPro:IPR037031"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7C2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000994974.1"
FT                   /protein_id="AMW40877.1"
FT                   /translation="MNAWEVNFDGLVGLTHHYAGLSFGNKASTRHRFQVSNPRLAAKQG
FT                   LLKMKTLADAGFPQAVIPPHERPFIPVLRQLGFSGSDEQVLEKVVRQAPHWLSSVSSAS
FT                   PMWVANAATIAPSADTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHS
FT                   ALPQVALLGDEGAANHNRLGGHYGEPGMQLFVYGREEGNDTRPSRYPARQTREASEAVA
FT                   RLNQVNPQQVIFAQQNPDVIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARV
FT                   NGFMAIEVPATQVSVSDAVSTYLFNSQLLSRDDGSMMLVLPQECREHAGVWGYLNELLA
FT                   ADNPISELKVFDLRESMANGGGPACLRLRVVLTQEERRAVNPAVMMNDTLFNALNDWVD
FT                   RYYRDRLTAADLADPQLLREGREALDVLSQLLNLGSVYPFQREGGGNG"
FT   gene            146520..147488
FT                   /locus_tag="ARC77_00785"
FT   CDS_pept        146520..147488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00785"
FT                   /product="succinylglutamate desuccinylase"
FT                   /note="catalyzes the formation of succinate and glutamate
FT                   from N(2)-succinylglutamate in arginine catabolism; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00785"
FT                   /db_xref="GOA:C3T7C7"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016681"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7C7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:B7L6L8.1"
FT                   /protein_id="AMW40878.1"
FT                   /translation="MDNFLALTLTSKKPVITEREINGVRWRWLGDGVLELTPLTPPQGA
FT                   LVISAGIHGNETAPVEMLDALLGAISHGEIPLRWRLLVILGNPPALKQGKRYCHSDMNR
FT                   MFGGRWQLFAESGETCRARELEQCLEDFYDQGKESVRWHLDLHTAIRGSLHPQFGVLPQ
FT                   RDIPWDEKFLTWLGAAGLEALVFHQEPGGTFTHFSARHFGALACTLELGKALPFGQNDL
FT                   RQFAVTASAIAALLSGESVGIVRTPPLRYRVVSQITRHSPSFEMHMASDTLNFMPFKKG
FT                   TLLAQDGEERFTVTHDVEYVLFPNPLVALGLRAGLMLEKIS"
FT   gene            147818..148303
FT                   /locus_tag="ARC77_00790"
FT   CDS_pept        147818..148303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00790"
FT                   /product="ATP-independent periplasmic protein-refolding
FT                   chaperone"
FT                   /note="periplasmic protein induced by stress response via
FT                   Cpx and BaeSR system; similar to CpxP; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00790"
FT                   /db_xref="GOA:C3T7D2"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7D2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015364490.1"
FT                   /protein_id="AMW40879.1"
FT                   /translation="MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFG
FT                   PHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKAKAEAQ
FT                   IAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATAE"
FT   gene            148506..149081
FT                   /locus_tag="ARC77_00795"
FT   CDS_pept        148506..149081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00795"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00795"
FT                   /db_xref="GOA:A0A066QAE2"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR023482"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066QAE2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000455601.1"
FT                   /protein_id="AMW40880.1"
FT                   /translation="MEYFDMRKMSVNLWRNAAGETREICTFPPAKRDFYWRASIASIAA
FT                   NGEFSLFPGMERIVTLLEGGEMFLESADHFNHTLKPLQPFAFAADQVVKAKLTAGQMSM
FT                   DFNIMTRLDVCKAKVRIAERTFTTFGSRGGVVFVINGAWQLGDKLLTTDQGACWFDGRH
FT                   TLRLLQPQGKLLFSEINWLAGHSPDQVQ"
FT   gene            complement(149041..149928)
FT                   /locus_tag="ARC77_00800"
FT   CDS_pept        complement(149041..149928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00800"
FT                   /product="endonuclease"
FT                   /note="3' incision activity; acts with UvrC; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00800"
FT                   /db_xref="GOA:C3T7E2"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7E2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000252391.1"
FT                   /protein_id="AMW40881.1"
FT                   /translation="MVRRLTSPRLEFEAAAIYEYPEHLRSFLNDLPTRPGVYLFHGESD
FT                   TMPLYIGKSVNIRSRVLSHLRTPDEAAMLRQSRRISWICTAGEIGALLLEARLIKEQQP
FT                   LFNKRLRRNRQLCALQLNEKRVDVVYAKEVDFSRAPNLFGLFANRRAALQALQSIADEQ
FT                   KLCYGLLGLEPLSRGRACFRSALKRCAGACCGKESHEEHALRLRQSLERLRVVCWPWQG
FT                   AVALKEQHPEMTQYHIIQNWLWLGAVNSLEEATTLIRTPAGFDHDGYKILCKPLLSGNY
FT                   EITELDPANDQRAS"
FT   gene            149998..150147
FT                   /locus_tag="ARC77_00805"
FT   CDS_pept        149998..150147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00805"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00805"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UJ66"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014966172.1"
FT                   /protein_id="AMW40882.1"
FT                   /translation="MTKVTPSDVLRLSGLFDSCNVLNLHSFVGRIRRSRRIRREQITLF
FT                   CTIQ"
FT   gene            complement(150158..150985)
FT                   /gene="nadE"
FT                   /locus_tag="ARC77_00810"
FT   CDS_pept        complement(150158..150985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="ARC77_00810"
FT                   /product="NAD(+) synthase"
FT                   /note="catalyzes the formation of nicotinamide adenine
FT                   dinucleotide (NAD) from nicotinic acid adenine dinucleotide
FT                   (NAAD) using either ammonia or glutamine as the amide donor
FT                   and ATP; ammonia-utilizing enzymes include the ones from
FT                   Bacillus and Escherichia coli while glutamine-utilizing
FT                   enzymes include the Mycobacterial one; forms homodimers;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00810"
FT                   /db_xref="GOA:C3T7E9"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7E9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003904739.1"
FT                   /protein_id="AMW40883.1"
FT                   /translation="MTLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVL
FT                   GISGGQDSTLAGKLCQMAINELRQETGNESLQFIAVRLPYGVQADEQDCQDAIAFIQPD
FT                   RVLTVNIKGAVLASEQALREACIELSDFVRGNEKARERMKAQYSIAGMTSGVVVGTDHA
FT                   AEAITGFFTKYGDGGTDINPLYRLNKRQGKQLLAALGCPEHLYKKAPTADLEDDRPSLP
FT                   DEVALGVTYDNIDDYLEGKNVPQQVARTIENWYLKTEHKRRPPITVFDDFWKK"
FT   gene            151187..151525
FT                   /locus_tag="ARC77_00815"
FT   CDS_pept        151187..151525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00815"
FT                   /product="transcriptional regulator"
FT                   /note="osmotically-inducible lipoprotein E; activator of
FT                   ntr-like gene protein; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00815"
FT                   /db_xref="GOA:C3T7F2"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7F2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003030621.1"
FT                   /protein_id="AMW40884.1"
FT                   /translation="MNKNMAGILSAAAVLTMLAGCTAYDRTKDQFVQPVVKDVKKGMSR
FT                   AQVAQIAGKPSSEVSMIHARGTCQTYILGQRDGKAETYFVALDDTGHVINSGYQTCAEY
FT                   DTDPQAAK"
FT   gene            151825..152145
FT                   /locus_tag="ARC77_00820"
FT   CDS_pept        151825..152145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00820"
FT                   /product="PTS sugar transporter subunit IIB"
FT                   /note="catalyzes the phosphorylation of incoming sugar
FT                   substrates concomitant with their translocation across the
FT                   cell membrane; involved in N,N'-diacetylchitobiose
FT                   transport; protein IIA transfers a phosphoryl group to IIB
FT                   which then transfers the phosphoryl group to the sugar; IIC
FT                   forms the translocation channel for the sugar uptake;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00820"
FT                   /db_xref="GOA:C3T7F7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7F7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017459242.1"
FT                   /protein_id="AMW40885.1"
FT                   /translation="MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAG
FT                   EKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAA
FT                   AN"
FT   gene            152230..153588
FT                   /locus_tag="ARC77_00825"
FT   CDS_pept        152230..153588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00825"
FT                   /product="PTS N N'-diacetylchitobiose transporter subunit
FT                   IIC"
FT                   /note="catalyzes the phosphorylation of incoming sugar
FT                   substrates concomitant with their translocation across the
FT                   cell membrane; involved in N,N'-diacetylchitobiose
FT                   transport; protein IIA transfers a phosphoryl group to IIB
FT                   which then transfers the phosphoryl group to the sugar; IIC
FT                   forms the translocation channel for the sugar uptake;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00825"
FT                   /db_xref="GOA:C3T7G3"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7G3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017384664.1"
FT                   /protein_id="AMW40886.1"
FT                   /translation="MSNVIASLEKVLLPFAVKIGKQPHVNAIKNGFIRLMPLTLAGAMF
FT                   VLINNVFLSFGEGSFFYSLGIRLDASTIETLNGLKGIGGNVYNGTLGIMSLMAPFFIGM
FT                   ALAEERKVDALAAGLLSVAAFMTVTPYSVGEAYAVGANWLGGANIISGIIIGLVVAEMF
FT                   TFIVRRNWVIKLPDSVPASVSRSFSALIPGFIILSVMGIIAWALNTWGTNFHQIIMDTI
FT                   STPLASLGSVVGWAYVIFVPLLWFFGIHGALALTALDNGIMTPWALENIATYQQYGSVE
FT                   AALAAGKTFHIWAKPMLDSFIFLGGSGATLGLILAIFIASRRADYRQVAKLALPSGIFQ
FT                   INEPILFGLPIIMNPVMFIPFVLVQPILAAITLAAYYMGIIPPVTNIAPWTMPTGLGAF
FT                   FNTNGSVVALLVALFNLGIATLIYLPFVVVANKAQNAIDKEESEEDIANALKF"
FT   gene            153639..153989
FT                   /locus_tag="ARC77_00830"
FT   CDS_pept        153639..153989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00830"
FT                   /product="PTS N N'-diacetylchitobiose transporter subunit
FT                   IIA"
FT                   /note="catalyzes the phosphorylation of incoming sugar
FT                   substrates concomitant with their translocation across the
FT                   cell membrane; involved N,N'-diacetylchitobiose transport;
FT                   protein IIA transfers a phosphoryl group to IIB which then
FT                   transfers the phosphoryl group to the sugar; IIC forms the
FT                   translocation channel for the sugar uptake; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00830"
FT                   /db_xref="GOA:C3T7G7"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7G7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020231186.1"
FT                   /protein_id="AMW40887.1"
FT                   /translation="MMDLDNIPDTQTEAEELEEVVMGLIINSGQARSLAYAALKQAKQG
FT                   DFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQDHLMTSMLARELI
FT                   TELIELHEKLKA"
FT   gene            154000..154839
FT                   /locus_tag="ARC77_00835"
FT   CDS_pept        154000..154839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00835"
FT                   /product="transcriptional regulator"
FT                   /note="represses the celABCDF-ydjC operon involved in
FT                   carbon uptake; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00835"
FT                   /db_xref="GOA:W8TE34"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:W8TE34"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016156331.1"
FT                   /protein_id="AMW40888.1"
FT                   /translation="MQPVINAPEIATAREQQLFNGKNFHVFIYNKTESISGLHQHDYYE
FT                   FTLVLTGRYFQEINGKRVLLERGDFVFIPLGSHHQSFYEFGATRILNVGISKRFFEQHY
FT                   LPLLPYCFVASQVYRTNNAFLTYVETVISSLNFRETGLEEFVEMVTFYVINRLRHYREE
FT                   QVIDDVPQWLKSTVEKMHDKEQFSESALENMVTLSAKSQEYLTRATQRYYGKTPMQIIN
FT                   EIRINFAKKQLEMTNYSVTDIAFEAGYSSPSLFIKTFKKLTSFTPKSYRKKLTEFNQ"
FT   gene            154944..156296
FT                   /locus_tag="ARC77_00840"
FT   CDS_pept        154944..156296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00840"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /note="catalyzes the fromation of N-acetyl-D-glucosamine
FT                   and N-acetyl-D-glucosamine-6-phosphate from
FT                   diacetylchitobiose-6-phosphate; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00840"
FT                   /db_xref="GOA:C3T7H7"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7H7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016247271.1"
FT                   /protein_id="AMW40889.1"
FT                   /translation="MSQKLKVVTIGGGSSYTPELLEGFIKRYHELPVSELWLVDVEGGK
FT                   AKLDIIFDLCQRMIDNAGVPMKLYKTLDRREALKDADFVTTQLRVGQLPARELDERIPL
FT                   SHGYLGQETNGAGGLFKGLRTIPVIFDIVKDVEELCPNAWVINFTNPAGMVTEAVYRHT
FT                   GFKRFIGVCNIPIGMKMFIRDVLMLKDSDDLSIDLFGLNHMVFIKDVLVNGKSRFAELL
FT                   DGVASGQLKASGVKNIFDLPFSEGLIRSLNLLPCSYLLYYFKQKEMLAIEMGEYYKGGA
FT                   RAQVVQKVEKQLFELYKNPELKVKPKELEQRGGAYYSDAACEVINAIYNDKQAEHYVNI
FT                   PHHGHIDNIPADWAVEMTCTLGRDGATPHPRITHFDDKVMGLIHTIKGFEIAASNAALS
FT                   GEFNDVLLALNLSPLVHSDRDAELLAREMILAHEKWLPNFADCIAELKKAH"
FT   gene            156309..157067
FT                   /locus_tag="ARC77_00845"
FT   CDS_pept        156309..157067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00845"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00845"
FT                   /db_xref="GOA:C3T7I3"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7I3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005126961.1"
FT                   /protein_id="AMW40890.1"
FT                   /translation="MERLLIVNADDFGLSKGQNYGIIEACRNGIVTSTTALVNGQAIDH
FT                   AVQLSRDEPSLAIGMNFVLTMGKPLTAMPGLTRDGVLGKWIWQLAEEDALPLEEITQEL
FT                   ASQYLRFIELFGRKPTHLDSHHHVHMFPQIFPIVARFAAEEGIALRIDRQPLSNAGDLP
FT                   ANLRSSHGFSSAFYGEEISEALFLQVLDDSSHRGERSLEVMCHPAFVDNTIRQSAYCFP
FT                   RLTELEVLTSASLKYAIAERGYRLGSYLDV"
FT   gene            complement(157114..159375)
FT                   /gene="katE"
FT                   /locus_tag="ARC77_00850"
FT   CDS_pept        complement(157114..159375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katE"
FT                   /locus_tag="ARC77_00850"
FT                   /product="catalase HPII"
FT                   /note="Catalase HPII; monofunctional catalase that
FT                   decomposes hydrogen peroxide into water and oxygen; serves
FT                   to protect cells from the toxic effects of hydrogen
FT                   peroxide; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00850"
FT                   /db_xref="GOA:C3T7I7"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7I7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020239885.1"
FT                   /protein_id="AMW40891.1"
FT                   /translation="MSQQNEKNPHQHQSPLHDSSEAKPGMDSLAPEDGSHRPAAEPTPP
FT                   GAQPTASGSLKAPDTRNEKLNSLEDVRKGSENYALTTNQGVRIADDQNSLRAGSRGPTL
FT                   LEDFILREKITHFDHERIPERIVHARGSAAHGYFQPYKSLSDITKADFLSDPNKITPVF
FT                   VRFSTVQGGAGSADTVRDIRGFATKFYTEEGIFDLVGNNTPIFFIQDAHKFPDFVHAVK
FT                   PEPHWAIPQGQSAHDTFWDYVSLQPETLHNVMWAMSDRGIPRSYRTMEGFGIHTFRLIN
FT                   AEGKATFVRFHWKPLAGKASLVWDEAQKLTGRDPDFHRRELWEAIEAGDFPEYELGFQL
FT                   IPEEDEFKFDFDLLDPTKLIPEELVPVQRVGKMVLNRNPDNFFAENEQAAFHPGHIVPG
FT                   LDFTNDPLLQGRLFSYTDTQISRLGGPNFHEIPINRPTCPYHNFQRDGMHRMGIDTNPA
FT                   NYEPNSINDNWPRETPPGPKRGGFESYQERVEGNKVRERSPSFGEYYSHPRLFWLSQTP
FT                   FEQRHIVDGFSFELSKVVRPYIRERVVDQLAHIDLTLAQAVAKNLGIELTDDQLNITPP
FT                   PDVNGLKKDPSLSLYAIPDGDVKGRVVAILLNDEVRSADLLAILKALKAKGVHAKLLYS
FT                   RMGEVTADDGTVLPIAATFAGAPSLTVDAVIVPCGNIADIADNGDANYYLMEAYKHLKP
FT                   IALAGDARKFKATIKVADQGEEGIVEADSADGSFMDELLTLMAAHRVWSRIPKIDKIPA
FT                   "
FT   gene            159579..159821
FT                   /locus_tag="ARC77_00855"
FT   CDS_pept        159579..159821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00855"
FT                   /product="cell division modulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00855"
FT                   /db_xref="GOA:W8TE37"
FT                   /db_xref="InterPro:IPR019666"
FT                   /db_xref="InterPro:IPR038463"
FT                   /db_xref="UniProtKB/TrEMBL:W8TE37"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001295480.1"
FT                   /protein_id="AMW40892.1"
FT                   /translation="MKKPLRQQNRQIISYVPRTEPAPPEHAIKMDSFRDVWMLRGKYVA
FT                   FVLMGESFLRSPAFTVPESAQRWANQIRQEGEVTE"
FT   gene            160110..160865
FT                   /locus_tag="ARC77_00860"
FT   CDS_pept        160110..160865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00860"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00860"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7J7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001439999.1"
FT                   /protein_id="AMW40893.1"
FT                   /translation="MFSTNLIQSNYGDLNIKSLAFDSFKERLQSTMTALTFFISTGQCD
FT                   CDEIAESNFNYMIAYMSNINYDASKPGAPALSFDTYLQDNVKYRVIINNLYGSEIRIRG
FT                   INKDFIGMDVTSVFRPEKMTNLISIKNRLVIHYLRTIYYEQYYIHPVGSIFAAIQKNES
FT                   LLKFPSIISMLNINLLFNPLNLPGMGSGILEDIMSIPDSSLRKRLGYEVLSFSLQAHSL
FT                   SQECIDKLDIFSLTICLNMSQYASPRWNI"
FT   gene            complement(160916..162307)
FT                   /locus_tag="ARC77_00865"
FT   CDS_pept        complement(160916..162307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00865"
FT                   /product="L-cystine transporter tcyP"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00865"
FT                   /db_xref="GOA:C3T7K2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7K2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001702634.1"
FT                   /protein_id="AMW40894.1"
FT                   /translation="MNFPLIANIVVFVVLLFALAQTRHKQWSLAKKVLVGLVMGVVFGL
FT                   ALHTIYGSDSQVLKDSVQWFNIVGNGYVQLLQMIVMPLVFASILSAVARLHNASQLGKI
FT                   SFLTIGTLLFTTLIAALVGVLVTNLFGLTAEGLVQGGAETARLNAIESNYVGKVSDLSV
FT                   PQLVLSFIPKNPFADLTGANPTSIISVVIFAAFLGVAALKLLKDDAPKGERVLTAIDTL
FT                   QSWVMKLVRLVMQLTPYGVLALMTKVVAGSNLQDIIKLGSFVVASYLGLLIMFAVHGIL
FT                   LGINGVSPLKYFRKVWPVLTFAFTSRSSAASIPLNVEAQTRRLGVPESIASFAASFGAT
FT                   IGQNGCAGLYPAMLAVMVAPTVGINPLDPMWIATLVGIVTVSSAGVAGVGGGATFAALI
FT                   VLPAMGLPVTLVALLISVEPLIDMGRTALNVSGSMTAGTLTSQWLKQTDKAILDSEDDA
FT                   ELAHH"
FT   gene            complement(162440..163030)
FT                   /locus_tag="ARC77_00870"
FT   CDS_pept        complement(162440..163030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00870"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00870"
FT                   /db_xref="GOA:A0A037Y617"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="InterPro:IPR016956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A037Y617"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000123135.1"
FT                   /protein_id="AMW40895.1"
FT                   /translation="MTAEGHLLFSIACAVFAKNAELTPVLAQGDWWHIVPSAILTCLLP
FT                   DIDHPKSFLGQRLKWISKPIARAFGHRGFTHSLLAVFALLATFYLKVPESWFIPADALQ
FT                   GMVLGYLSHILADMLTPAGVPLLWPCRWRFRLPILVPQKGNQLERFICMALFVWSVWMP
FT                   HSLPENSAVRWSSQMINTLQIQFHRLIKHQVEY"
FT   gene            complement(163193..163861)
FT                   /locus_tag="ARC77_00875"
FT   CDS_pept        complement(163193..163861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00875"
FT                   /product="2-deoxyglucose-6-phosphatase"
FT                   /note="YniC; catalyzes the dephosphorylation of
FT                   2-deoxyglucose 6-phosphate, mannose 6-phosphate and
FT                   p-nitrophenyl phosphate; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00875"
FT                   /db_xref="GOA:C3T7L2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7L2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012132618.1"
FT                   /protein_id="AMW40896.1"
FT                   /translation="MSTPRQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNE
FT                   LPDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALC
FT                   KEQGLLVGLASASPLHMLEKVLTMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGV
FT                   DPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTELTAKDLLG
FT                   "
FT   gene            164008..164544
FT                   /locus_tag="ARC77_00880"
FT   CDS_pept        164008..164544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00880"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00880"
FT                   /db_xref="GOA:C3T7L8"
FT                   /db_xref="InterPro:IPR025229"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7L8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020453996.1"
FT                   /protein_id="AMW40897.1"
FT                   /translation="MTYQQAGRIAVLKRIMGWVIFIPALISTLISLLKFMNTRQENQEG
FT                   INAVMLDFTHVMIDMMQANTPFLNLFWYNSPTPNFNGGVNVMFWVIFILIFVGLALQDS
FT                   GTRMSRQARFLREGVEDQLILEKAKGEEGLTREQIESRIVVPHHTIFLQFFSLYILPVI
FT                   CIAAGYVFFSLLGFI"
FT   gene            complement(164585..165445)
FT                   /locus_tag="ARC77_00885"
FT   CDS_pept        complement(164585..165445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00885"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00885"
FT                   /db_xref="GOA:C3T7M2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7M2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P58065.1"
FT                   /protein_id="AMW40898.1"
FT                   /translation="MWQAISRLLSEQLGEGEIELRNELPGGEVHAAWHLRYAGHDFFVK
FT                   CDERELLPGFTAEADQLELLSRSKTVTVPKVWAVGADRDYSFLVMDYLPPRPLDAHSAF
FT                   ILGQQIARLHQWSDQPQFGLDFDNSLSTTPQPNTWQRRWSTFFAEQRIGWQLELAAEKG
FT                   IAFGNIDAIVEHIQQRLASHQPQPSLLHGDLWSGNCALGPDGPYIFDPACYWGDRECDL
FT                   AMLPLHTEQPPQIYDGYQSVSPLPADFLERQPVYQLYTLLNRARLFGGQHLVIAQQSLD
FT                   RLLAA"
FT   gene            complement(165551..165841)
FT                   /locus_tag="ARC77_00890"
FT   CDS_pept        complement(165551..165841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00890"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00890"
FT                   /db_xref="GOA:C3T7M7"
FT                   /db_xref="InterPro:IPR022597"
FT                   /db_xref="InterPro:IPR038241"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7M7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000146138.1"
FT                   /protein_id="AMW40899.1"
FT                   /translation="MASGDLVRYVITVMLHEDTLTEINELNNYLTRDGFLLTMTDDEGN
FT                   IHELGTNTFGLISTQSEEEIRELVSGLTQSATGKDPEITITTWEEWNSNRK"
FT   gene            complement(165942..166871)
FT                   /locus_tag="ARC77_00895"
FT   CDS_pept        complement(165942..166871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00895"
FT                   /product="6-phosphofructokinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00895"
FT                   /db_xref="GOA:C3T7N2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7N2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020244839.1"
FT                   /protein_id="AMW40900.1"
FT                   /translation="MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVA
FT                   RAIAHLGGSATAIFPAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQY
FT                   RFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQNQGIRC
FT                   IIDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVV
FT                   VSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVA
FT                   AGSAATLNQGTRLCSHDDTQKIYAYLSR"
FT   gene            167158..167916
FT                   /locus_tag="ARC77_00900"
FT   CDS_pept        167158..167916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00900"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00900"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7N7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015364488.1"
FT                   /protein_id="AMW40901.1"
FT                   /translation="MKLLKTVPAIVMLAGGMFASLNAAADDSVFTVMDDPASAKKPFEG
FT                   NLNAGYLAQSGNTKSSSLTADTTMTWYGQTTAWSLWGNASNTSSNDERSSEKYAAGGRS
FT                   RFNLTDYDYLFGQASWLTDRYNGYRERDVLTAGYGRQFLNGPVHSFRFEFGPGVRYDKY
FT                   TDNASETQPLGYASGAYAWQLTDNAKFTQGVSVFGAEDTTLNSESALNVAINEHFGLKV
FT                   AYNVTWNSEPPESAPEHTDRRTTLSLGYSM"
FT   gene            complement(167969..168076)
FT                   /locus_tag="ARC77_00905"
FT   CDS_pept        complement(167969..168076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00905"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00905"
FT                   /db_xref="GOA:E2QMT0"
FT                   /db_xref="UniProtKB/TrEMBL:E2QMT0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013574326.1"
FT                   /protein_id="AMW40902.1"
FT                   /translation="MPTKRFDKKHWKMVVVLLAICGAMLLLRWAAMIWG"
FT   gene            complement(168251..170149)
FT                   /locus_tag="ARC77_00910"
FT   CDS_pept        complement(168251..170149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00910"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00910"
FT                   /db_xref="InterPro:IPR012927"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDH0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000081128.1"
FT                   /protein_id="AMW40903.1"
FT                   /translation="MSQNDIIIRTHYKSPHRMHIDSDIPTPSSEPINQFAPQLITLLDT
FT                   SDLSSMLSYCVTQEFTANCRKISQNCYSTALFTINFATSPIHAENIFITLHYKKEIISL
FT                   LLETTPIKANHLRSILDYIEQEQLTAENRNHCMKLSKKIHREKTIQPTVNLNGSAFFSQ
FT                   SPSDAIFCRHLSLQYALDSLRNGKGKVNLIKHYSSVESIQQHVPLVRDAEFRALLRHPP
FT                   AGSRVIASKDFGFALDIFFCRMMANNVSHMSAILYIDNHTLSVRLRIKQSAYGQLNYVV
FT                   SVYDPNDTNVAVRGTHRTARGFLSLDKFISSGPDAQTWADRYVRNCAIAILPLLPEGVP
FT                   GAIFTGIATRMPFAPIHPSAMLLIMATGQTQQLITLFRQLPILPEKEIIEIITAQNSIG
FT                   TPALFLAMMNGHTDNVKIFMQEIQSLVDNHIIHEDNLVKLLQTKSANETPGLYISMLYG
FT                   FDEIIDIFLNALTTPIAQELLNKKLVMSILAMKIHDGEPGLYAAMENNHPLCVTRFLSK
FT                   INGIAFKYKLSKANIMDLLKGATAQGTPALYIAMSKGNEDVVLSYISTLGAFAKKHSFS
FT                   QHQLFTLLAAKNHDNMSAVHIAIHHNHYKTVETYYAAINVISQSMSFSADELKTYL"
FT   gene            170672..172600
FT                   /gene="thrS"
FT                   /locus_tag="ARC77_00915"
FT   CDS_pept        170672..172600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="ARC77_00915"
FT                   /product="threonine--tRNA ligase"
FT                   /note="catalyzes a two-step reaction, first charging a
FT                   threonine molecule by linking its carboxyl group to the
FT                   alpha-phosphate of ATP, followed by transfer of the
FT                   aminoacyl-adenylate to its tRNA; catalyzes the formation of
FT                   threonyl-tRNA(Thr) from threonine and tRNA(Thr); Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00915"
FT                   /db_xref="GOA:C3T7P2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7P2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010245687.1"
FT                   /protein_id="AMW40904.1"
FT                   /translation="MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELV
FT                   DACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYY
FT                   DVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDEN
FT                   IAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTA
FT                   WADKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFV
FT                   RSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENREYCIKPMNCPGHVQI
FT                   FNQGLKSYRDLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNG
FT                   CIRLVYDMYSTFGFEKIVVKLSTRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGE
FT                   GAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIHRAILGS
FT                   MERFIGILTEEFAGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNE
FT                   KIGFKIREHTLRRVPYMLVCGDKEVESGKIAVRTRRGKDLGSMDVNEVIEKLQQEIRSR
FT                   SLKQLEE"
FT   gene            172604..173146
FT                   /locus_tag="ARC77_00920"
FT   CDS_pept        172604..173146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00920"
FT                   /product="translation initiation factor IF-3"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00920"
FT                   /db_xref="GOA:C3T7P7"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7P7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015871208.1"
FT                   /protein_id="AMW40905.1"
FT                   /translation="MKGGKRVQTARPNRINGEIRAQEVRLTGLEGEQLGIVSLREALEK
FT                   AEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQKVIQVKEIKFRPGTDE
FT                   GDYQVKLRSLIRFLEEGDKAKITLRFRGREMAHQQIGMEVLNRVKDDLQELAVVESFPT
FT                   KIEGRQMIMVLAPKKKQ"
FT   gene            173243..173440
FT                   /locus_tag="ARC77_00925"
FT   CDS_pept        173243..173440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00925"
FT                   /product="50S ribosomal protein L35"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00925"
FT                   /db_xref="GOA:C3T7Q2"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="PDB:4V85"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7Q2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001124225.1"
FT                   /protein_id="AMW40906.1"
FT                   /translation="MPKIKTVRGAAKRFKKTGKGGFKHKHANLRHILTKKATKRKRHLR
FT                   PKAMVSKGDLGLVIACLPYA"
FT   gene            173493..173849
FT                   /gene="rplT"
FT                   /locus_tag="ARC77_00930"
FT   CDS_pept        173493..173849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="ARC77_00930"
FT                   /product="50S ribosomal protein L20"
FT                   /note="binds directly to 23S ribosomal RNA prior to in
FT                   vitro assembly of the 50S ribosomal subunit; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00930"
FT                   /db_xref="GOA:C3T7Q7"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="PDB:4V85"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7Q7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000124850.1"
FT                   /protein_id="AMW40907.1"
FT                   /translation="MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQY
FT                   AYRDRRQRKRQFRQLWIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKV
FT                   AFTALVEKAKAALA"
FT   gene            174091..174185
FT                   /pseudo
FT                   /locus_tag="ARC77_00935"
FT   CDS_pept        174091..174185
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00935"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001264823.1"
FT   gene            174299..175282
FT                   /locus_tag="ARC77_00940"
FT   CDS_pept        174299..175282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00940"
FT                   /product="phenylalanine--tRNA ligase subunit alpha"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00940"
FT                   /db_xref="GOA:C3T7R7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7R7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_004851795.1"
FT                   /protein_id="AMW40908.1"
FT                   /translation="MSHLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTL
FT                   RELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENG
FT                   GLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDAT
FT                   RLLRTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTN
FT                   LKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLR
FT                   NVGIDPEVYSGFAFGMGMERLTMLRYGVTDLRSFFENDLRFLKQFK"
FT   gene            175297..177684
FT                   /gene="pheT"
FT                   /locus_tag="ARC77_00945"
FT   CDS_pept        175297..177684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="ARC77_00945"
FT                   /product="phenylalanine--tRNA ligase subunit beta"
FT                   /note="catalyzes a two-step reaction, first charging a
FT                   phenylalanine molecule by linking its carboxyl group to the
FT                   alpha-phosphate of ATP, followed by transfer of the
FT                   aminoacyl-adenylate to its tRNA; forms a tetramer of
FT                   alpha(2)beta(2); binds two magnesium ions per tetramer;
FT                   type 2 subfamily; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00945"
FT                   /db_xref="GOA:C3T7S2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7S2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012144882.1"
FT                   /protein_id="AMW40909.1"
FT                   /translation="MKFSELWLREWVNPAIDSDALANQITMAGLEVDGVEPVAGSFHGV
FT                   VVGEVVECAQHPNADKLRVTKVNVGGDRLLDIVCGAPNCRQGLRVAVATIGAVLPGDFK
FT                   IKAAKLRGEPSEGMLCSFSELGISDDHNGIIELPADAPIGTDIREYLKLDDNTIEISVT
FT                   PNRADCLGIIGVARDVAVLNQLPLVEPEIVPVGATIDDTLPITVEAPEACPRYLGRVVK
FT                   GINVKAPTPLWMKEKLRRCGIRSIDAVVDVTNYVLLELGQPMHAFDKDRIEGGIVVRMA
FT                   KEGETLVLLDGTEAKLNADTLVIADHNKALAMGGIFGGEHSGVNDETQNVLLECAFFSP
FT                   LSITGRARRHGLHTDASHRYERGVDPALQYKAMERATRLLIDICGGEAGPVIDITNEAT
FT                   LPKRATITLRRSKLDRLIGHHIADEQVTDILRRLGCEVTEGKDEWQAVAPSWRFDMEIE
FT                   EDLVEEVARVYGYNNIPDEPVQASLIMGTHREADLSLKRVKTLLNDKGYQEVITYSFVD
FT                   PKVQQMIHPGVEALLLPSPISVEMSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRF
FT                   VPDTQAPLGIRQDLMLAGVICGNRYEEHWNLAKETVDFYDLKGDLESVLDLTGKLNEVE
FT                   FRAEANPALHPGQSAAIYLKGERIGFVGVVHPELERKLDLNGRTLVFELEWNKLADRVV
FT                   PQAREISRFPANRRDIAVVVAENVPAADILSECKKVGVNQVVGVNLFDVYRGKGVAEGY
FT                   KSLAISLILQDTSRTLEEEEIAATVAKCVEALKERFQASLRD"
FT   gene            177689..177988
FT                   /gene="ihfA"
FT                   /locus_tag="ARC77_00950"
FT   CDS_pept        177689..177988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfA"
FT                   /locus_tag="ARC77_00950"
FT                   /product="integration host factor subunit alpha"
FT                   /note="This protein is one of the two subunits of
FT                   integration host factor, a specific DNA-binding protein
FT                   that functions in genetic recombination as well as in
FT                   transcriptional and translational control; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00950"
FT                   /db_xref="GOA:Q14F23"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q14F23"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P0A1S0.1"
FT                   /protein_id="AMW40910.1"
FT                   /translation="MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVK
FT                   LSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE"
FT   gene            178089..179069
FT                   /locus_tag="ARC77_00955"
FT   CDS_pept        178089..179069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00955"
FT                   /product="vtamin B12-transporter permease"
FT                   /note="with BtuD and BtuF transports vitamin B12 into the
FT                   cell; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00955"
FT                   /db_xref="GOA:C3T7T2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR023691"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7T2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000956544.1"
FT                   /protein_id="AMW40911.1"
FT                   /translation="MLTLARQQQRQNIRWLLCLSVLMLLALLLSLCAGEQWISPGDWFS
FT                   PRGELFVWQIRLPRTLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAA
FT                   VLLGQGQLPNWALGLCAIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALMTWA
FT                   IYFSTSVDLRQLMYWMMGGFGGVDWRQSWLMLALIPMLLWICCQSRPMNMLALGEISAR
FT                   QLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRALLPGCAL
FT                   AGASALLLADIVARLALAAAELPIGVVTATLGAPVFIWLLLKAGR"
FT   gene            179132..179683
FT                   /gene="btuE"
FT                   /locus_tag="ARC77_00960"
FT   CDS_pept        179132..179683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuE"
FT                   /locus_tag="ARC77_00960"
FT                   /product="glutathione peroxidase"
FT                   /note="similar to glutathione peroxidase; member of the
FT                   btuCED operon which is required for vitamin B12 transport
FT                   across the inner membrane; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00960"
FT                   /db_xref="GOA:C3T7T7"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR033674"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7T7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012905613.1"
FT                   /protein_id="AMW40912.1"
FT                   /translation="MQDSILTTVVKDIDGEVTTLEKYAGNVLLIVNVASKCGLTPQYEQ
FT                   LENIQKAWADRGFVVLGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGR
FT                   HPLYQKLISAAPTAVAPEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGLVIQRFS
FT                   PDMTPEDPIVMESIKLALAK"
FT   gene            179683..180432
FT                   /locus_tag="ARC77_00965"
FT   CDS_pept        179683..180432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00965"
FT                   /product="vitamin B12-transporter ATPase"
FT                   /note="ATP-binding protein that acts with the transmembrane
FT                   protein BtuC and the solute binding protein BtuF to
FT                   transport vitamin B12 into the cell; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00965"
FT                   /db_xref="GOA:C3T7U2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR023693"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7U2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000029461.1"
FT                   /protein_id="AMW40913.1"
FT                   /translation="MSIVMQLQDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLAR
FT                   MAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFAMPVWHYLTLHQHDKTRT
FT                   ELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITPQANPAGQLLLLDEPMNS
FT                   LDVAQQSALDKILSALCQQGLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASGRREDVLT
FT                   PPNLAQAYGMNFRRLDIEGHRMLISTI"
FT   gene            180510..180974
FT                   /locus_tag="ARC77_00970"
FT   CDS_pept        180510..180974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00970"
FT                   /product="endopeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00970"
FT                   /db_xref="GOA:C3T7U7"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7U7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120307.1"
FT                   /protein_id="AMW40914.1"
FT                   /translation="MRFCLILITALFLAGCSHHKAPPPNARLSDSITVIAGLNDQLQSW
FT                   HGTPYRYGGMTRRGVDCSGFVVVTMRDRFDLQLPRETKEQASIGTQIDKDELLPGDLVF
FT                   FKTGSGQNGLHVGIYDTNNQFIHASTSKGVMRSSLDNVYWQKNFWQARRI"
FT   gene            181221..181934
FT                   /locus_tag="ARC77_00975"
FT   CDS_pept        181221..181934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00975"
FT                   /product="cyclic di-GMP regulator CdgR"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00975"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7V2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016242177.1"
FT                   /protein_id="AMW40915.1"
FT                   /translation="MKIFLENLYHSDCYFLPIRDNQQVLVGVELITHFSSEDGTVRIPT
FT                   SRVIAQLTEEQHWQLFSEQLELLKSCQHFFIQHKLFAWLNLTPQVATLLLERDNYAGEL
FT                   LKYPFIELLINENYPHLNEGKDNRGLLSLSQVYPLVLGNLGAGNSTMKAVFDGLFTRVM
FT                   LDKSFIQQQITHRSFEPFIRAIQAQISPCCNCIIAGGIDTPEILAQITPFDFHALQGCL
FT                   WPAVPINQITTLVQR"
FT   gene            181997..183433
FT                   /locus_tag="ARC77_00980"
FT   CDS_pept        181997..183433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00980"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00980"
FT                   /db_xref="GOA:C3T7V8"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7V8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000175710.1"
FT                   /protein_id="AMW40916.1"
FT                   /translation="MTLSFITRWRDELPETYTALSPTPLNNARLIWHNTELANTLSIPS
FT                   SLFKNGAGVWGGETLLPGMSPLAQVYSGHQFGVWAGQLGDGRGILLGEQLLADGTTMDW
FT                   HLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVTSDSPVYRETVE
FT                   PGAMLMRVAPSHLRFGHFEHFYYRREPDKVRQLADFAIRHYWSHLEDDEDKYRLWFNDV
FT                   VARTASLIAQWQTVGFAHGVMNTDNMSLLGLTLDYGPFGFLNDYEPGFICNHSDHQGRY
FT                   SFDNQPAVALWILQRLAQTLSPFVAVDALNEALDSYQQVLLTHYGQRMRQKLGFMTEQK
FT                   EDNALLNELFSLMARERSDYTRTFRMLSLTEQHSAASPLRDEFIDRAAFDDWFARYRGR
FT                   LQQDEVSDSERQQLMQSVNPALVLRNWLAQRAIEAAEKGDMTELHRLHEALRNPFSDRD
FT                   DDYVSRPPDWGKRLEVSCSS"
FT   gene            complement(183437..183628)
FT                   /locus_tag="ARC77_00985"
FT   CDS_pept        complement(183437..183628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00985"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00985"
FT                   /db_xref="InterPro:IPR019600"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7W2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P0ACY0.1"
FT                   /protein_id="AMW40917.1"
FT                   /translation="MRYTDSRKLTPETDANHKTASPQPIRRISSQTLLGPDGKLIIDHD
FT                   GQEYLLRKTQAGKLLLTK"
FT   gene            complement(183760..184806)
FT                   /locus_tag="ARC77_00990"
FT   CDS_pept        complement(183760..184806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00990"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00990"
FT                   /db_xref="GOA:C3T7W7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7W7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120291.1"
FT                   /protein_id="AMW40918.1"
FT                   /translation="MNRTDELRTARIESLVTPAELALRYPVTPGVATHVTDSRRRIEKI
FT                   LNGEDKRLLVIIGPCSIHDLTAAMEYATRLQSLRNQYQSRLEIVMRTYFEKPRTVVGWK
FT                   GLISDPDLNGSYRINHGLELARKLLLQVNELGVPTATEFLDMVTGQFIADLISWGAIGA
FT                   RTTESQIHREMASALSCPVGFKNGTDGNTRIAVDAIRAARASHMFLSPDKNGQMTIYQT
FT                   SGNPYGHIIMRGGKKPNYHADDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLEVC
FT                   EDICQQIRNGSTAIAGIMAESFLREGTQKIVGGQPLTYGQSITDPCLGWEDTERLVEKL
FT                   ASAVDTRF"
FT   gene            complement(184963..185796)
FT                   /locus_tag="ARC77_00995"
FT   CDS_pept        complement(184963..185796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_00995"
FT                   /product="phosphoenolpyruvate synthase regulatory protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_00995"
FT                   /db_xref="GOA:C3T7X2"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7X2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000370994.1"
FT                   /protein_id="AMW40919.1"
FT                   /translation="MDNAVDRHVFYISDGTAITAEVLGHAVMSQFPVTISSITLPFVEN
FT                   ESRARAVKDQIDAIYHQTGVRPLVFYSIVLPEIRAIILQSEGFCQDIVQALVAPLQQEM
FT                   KLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDGISLRNLDQAQVILLGVSRCGK
FT                   TPTSLYLAMQFGIRAANYPFIADDMDNLVLPASLKPLQHKLFGLTIDPERLAAIREERR
FT                   ENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYSVEEIATKILDIMGLSRRMY"
FT   gene            185908..186075
FT                   /locus_tag="ARC77_01000"
FT   CDS_pept        185908..186075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01000"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UJ55"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001302085.1"
FT                   /protein_id="AMW40920.1"
FT                   /translation="MKTAFHFYGFVYTDGLCGNCRKEQICATLGSVLTSKKIYLLERFT
FT                   VFFIRLNMQR"
FT   gene            186129..188507
FT                   /locus_tag="ARC77_01005"
FT   CDS_pept        186129..188507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01005"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /note="catalyzes the formation of phosphoenolpyruvate from
FT                   pyruvate; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01005"
FT                   /db_xref="GOA:C3T7X8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7X8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000069371.1"
FT                   /protein_id="AMW40921.1"
FT                   /translation="MSNNGSSPLVLWYNQLGMKDVDRVGGKNASLGEMITNLSGMGVSV
FT                   PNGFATTADAFNQFLDQSGVNQRIYELLDKTDIDDVTQLAKAGAQIRQWIIDTPFQPEL
FT                   ENAIREAYAQLSADDENASFAVRSSATAEDMPDASFAGQQETFLNVQGFDAVLVAVKHV
FT                   FASLFNDRAISYRVHQGYDHRGVALSAGVQRMVRSDLASSGVMFSIDTESGFDQVVFIT
FT                   SAWGLGEMVVQGAVNPDEFYVHKPTLAANRPAIVRRTMGSKKIRMVYAPTQEHGKQVKI
FT                   EDVPQEQRDIFSLTNEEVQELAKQAVQIEKHYGRPMDIEWAKDGHTGKLFIVQARPETV
FT                   RSRGQVMERYTLHSQGKIIAEGRAIGHRIGAGPVKVIHDISEMNRIEPGDVLVTDMTDP
FT                   DWEPIMKKASAIVTNRGGRTCHAAIIARELGIPAVVGCGDATERMKDGENVTVSCAEGD
FT                   TGYVYAELLEFSVKSSSVETMPDLPLKVMMNVGNPDRAFDFACLPNEGVGLARLEFIIN
FT                   RMIGVHPRALLEFDDQEPQLQNEIREMMKGFDSPREFYVGRLTEGIATLGAAFYPKRVI
FT                   VRLSDFKSNEYANLVGGERYEPDEENPMLGFRGAGRYVSDSFRDCFALECEAVKRVRND
FT                   MGLTNVEIMIPFVRTVDQAKAVVEELARQGLKRGENGLKIIMMCEIPSNALLAEQFLEY
FT                   FDGFSIGSNDMTQLALGLDRDSGVVSELFDERNDAVKALLSMAIRAAKKQGKYVGICGQ
FT                   GPSDHEDFAAWLMEEGIDSLSLNPDTVVQTWLSLAELKK"
FT   gene            complement(188668..190209)
FT                   /locus_tag="ARC77_01010"
FT   CDS_pept        complement(188668..190209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01010"
FT                   /product="cyclohexanecarboxylate-CoA ligase"
FT                   /note="acts in anaerobic beta-oxidation of fatty acids;
FT                   possible ligase/synthase involved in anaerobic growth on
FT                   fatty acids; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01010"
FT                   /db_xref="GOA:A0A143E8S0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143E8S0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001453021.1"
FT                   /protein_id="AMW45895.1"
FT                   /translation="MKVTLTFNEQRRAAYRQQGLWGDASLADYWQQTARAMPDKIAVVD
FT                   NHGASYTYSALDHAASCLANWMLAKGIESGDRIAFQLPGWCEFTVIYLACLKIGAVSVP
FT                   LLPSWREAELVWVLNKCQAKMFFTPTLFKQTRPVDLILPLQNQLPQLQQIVGVDKLAPA
FT                   TSSLSLSQIIADNTPLTTAITTHGDELAAVLFTSGTEGLPKGVMLTHNNILASERAYCA
FT                   RLNLTWQDVFMMPAPLGHATGFLHGVTAPFLIGARSVLLDIFTPDACLALLEQQRCSCM
FT                   LGATPFVYDLLNLLEKQPADLSALRFFLCGGTTIPKKVARECQQRGIKLLSVYGSTESS
FT                   PHAVVNLDDPLSRFMHTDGYAAAGVEIKVVDDARKTLPPGCEGEEASRGPNVFMGYFDE
FT                   PELTARALDEEGWYYSGDLCRMDEAGYIKITGRKKDIIVRGGENISSREVEDILLQHPK
FT                   IHDACVVAMPDERLGERSCAYVVLKAPHHSLSLEEVVAFLAVNGSQNINILNISW"
FT   gene            complement(190266..190559)
FT                   /locus_tag="ARC77_01015"
FT   CDS_pept        complement(190266..190559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01015"
FT                   /product="ferredoxin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01015"
FT                   /db_xref="GOA:C3T7Y2"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7Y2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000081064.1"
FT                   /protein_id="AMW40922.1"
FT                   /translation="MSQNATVNVDIKLGVNKFHVDEGHPHIILAANPDINEFRKLMKAC
FT                   PAGLYKQDDAGNIHFDSAGCLECGTCRVLCGNTILEQWQYPAGTFGIDFRYG"
FT   gene            complement(190556..191845)
FT                   /locus_tag="ARC77_01020"
FT   CDS_pept        complement(190556..191845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01020"
FT                   /product="oxidoreductase"
FT                   /note="FAD/NAD(P)-binding domain; possibly part of an
FT                   electron transfer system required for anaerobic carnitine
FT                   reduction; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01020"
FT                   /db_xref="GOA:C3T7Y7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7Y7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120278.1"
FT                   /protein_id="AMW40923.1"
FT                   /translation="MSDDKFDAIVVGAGVAGSVAALVMARAGLDILVIERGDSAGCKNM
FT                   TGGRLYAHTLEAIIPGFAASAPVERKVTREKISFLTEESAVTLDFHREQPDVPQHASYT
FT                   VLRNRLDPWLMEQAEQAGAQFIPGVRVDALVREGNKVTGVQAGDDILEANVVILADGVN
FT                   SMLGRSLGMVPASDPHHYAVGVKEVIGLTPEQINDRFNITGEEGAAWLFAGSPSDGLMG
FT                   GGFLYTNKDSISLGLVCGLADIAHAQKSVPQMLEDFKQHPAIRPLISGGKLLEYSAHMV
FT                   PEGGLAMVPQLVNDGVMIVGDAAGFCLNLGFTVRGMDLAIASAQAAATTVIAAKERADF
FT                   SASSLAQYKRELEQSCVMRDMQHFRKIPALMENPRLFSQYPRMVADIMNEMFTIDGKPN
FT                   QPVRKMIMGHAKKIGLINLLKDGIKGATAL"
FT   gene            complement(191901..192839)
FT                   /gene="fixB"
FT                   /locus_tag="ARC77_01025"
FT   CDS_pept        complement(191901..192839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="ARC77_01025"
FT                   /product="electron transfer flavoprotein"
FT                   /note="involved in electron transfer during carnitine
FT                   metabolism; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01025"
FT                   /db_xref="GOA:C3T7Z3"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7Z3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020233096.1"
FT                   /protein_id="AMW40924.1"
FT                   /translation="MSQLNSVWVFSDNPERYAELFGGAQQWGQQVYAIVQNTDQAQAVM
FT                   PYGPKCIYVLEQNDALQRTENYAESIAALLKDKHPAMLLLAATKRGKALAARLSVQLNA
FT                   ALVNDATAVDIVDGHICAEHRMYGGLAFAQEKINSSLAIITLAPGVQEPCTSDTSHQCP
FT                   TETVPYVAPRHEILCRERRAKAASSVDLSKAKRVVGVGRGLAAQDDLKMVHELAAVLNA
FT                   EVGCSRPIAEGENWMERERYIGVSGVLLKSDLYLTLGISGQIQHMVGGNGAKVIVAINK
FT                   DKNAPIFNYADYGLVGDIYKVVPALISQLSR"
FT   gene            complement(192859..193623)
FT                   /locus_tag="ARC77_01030"
FT   CDS_pept        complement(192859..193623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01030"
FT                   /product="electron transfer flavoprotein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01030"
FT                   /db_xref="GOA:C3T7Z7"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:C3T7Z7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016158174.1"
FT                   /protein_id="AMW40925.1"
FT                   /translation="MKIITCFKLVPEEQDIVVTPEYTLNFDNADAKISQFDLNAIEAAS
FT                   QLATDDDEIAALTVGGSLLQNSKVRKDVLSRGPHSLYMVQDAQLEHALPLDTAKALAAA
FT                   VEKIGFDLLIFGKGSGDLYAQQVGLLVGEILQLPVINAVSAIQRQGNTLVIERTLEDDV
FT                   EVIELSVPAVLCVTSDINVPRIPSMKAILGAGKKPVNQWQASDIGWSQSAPLAELTGIR
FT                   VPPQTERKHIILDNDSPEAIAELAEHLKKALN"
FT   gene            193660..193836
FT                   /locus_tag="ARC77_01035"
FT   CDS_pept        193660..193836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01035"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A094VR45"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000398611.1"
FT                   /protein_id="AMW40926.1"
FT                   /translation="MEGKNGLKIVCDSGAGFSTEQAVFLANNLAKKMRSLKQKCNLRQY
FT                   SYSMTVQSCIQCK"
FT   gene            193939..194850
FT                   /locus_tag="ARC77_01040"
FT   CDS_pept        193939..194850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01040"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01040"
FT                   /db_xref="GOA:C3T802"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C3T802"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001382980.1"
FT                   /protein_id="AMW40927.1"
FT                   /translation="MYQRCFDNASETLFVAGKTPRLSRFAFSDDPKWESGHHVHDNETE
FT                   LIYVKKGVARFTIDSSLYVAHADDIVVIERGRLHAVASDVNDPATTCTCALYGFQFQGA
FT                   EENHLLQPHSCPVIAAGQGKEVIKTLFNELSVILPQSKNSQTSSLWDAFAYTLAILYYE
FT                   NFKNAYRSEQGYIKKDVLIKDILFYLNNNYREKITLEQLSKKFRASVSYICHEFTKEYR
FT                   ISPINYVIQRRMTEAKWSLTNTELSQAEISWRVGYENVDHFAKLFLRHVGCSPSDYRRQ
FT                   FKNCFAEQEILSEFPQPVSLAG"
FT   gene            complement(194893..196044)
FT                   /locus_tag="ARC77_01045"
FT   CDS_pept        complement(194893..196044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01045"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="may play a role in electron transport between the
FT                   anaerobic fatty acid oxidation pathway and the respiratory
FT                   chain; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01045"
FT                   /db_xref="GOA:E2QMQ6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E2QMQ6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001750101.1"
FT                   /protein_id="AMW40928.1"
FT                   /translation="MDFSLTEEQELLLASIRELITTNFPEEYFRTCDQNGTYPREFMRA
FT                   LADNGISMLGVPEEFGGIPADYVTQMLALMEVSKCGAPAFLITNGQCIHSMRRFGSAEQ
FT                   LRKTAESTLETGDPAYALALTEPGAGSDNNSATTTYTRKNGKVYINGQKTFITGAKEYP
FT                   YMLVLARDPQPKDPKKAFTLWWVDSSKPGIKINPLHKIGWHMLSTCEVYLDNVEVEESD
FT                   MVGEEGMGFLNVMYNFEMERLINAARSTGFAECAFEDAARYANQRIAFGKPIGHNQMIQ
FT                   EKLALMAIKIDNMRNMVLKVAWQADQHQSLRTSAALAKLYCARTAMEVIDDAIQIMGGL
FT                   GYTDEARVSRFWRDVRCERIGGGTDEIMIYVAGRQILKDYQNK"
FT   gene            complement(196058..197653)
FT                   /locus_tag="ARC77_01050"
FT   CDS_pept        complement(196058..197653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01050"
FT                   /product="acetate CoA-transferase YdiF"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01050"
FT                   /db_xref="GOA:C3T812"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C3T812"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P37766.3"
FT                   /protein_id="AMW40929.1"
FT                   /translation="MKPVKPPRINGRVPVLSAQEAVNYIPDEATLCVLGAGGGILEATT
FT                   LITALADKYKQTQTPRNLSIISPTGLGDRADRGISPLAQEGLVKWALCGHWGQSPRISD
FT                   LAEQNKIIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLI
FT                   KLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIV
FT                   MMQVQKMVKKATLHPKSVRIPGYLVDIVVVDPDQSQLYGGAPVNRFISGDFTLDDSTKL
FT                   SLPLNQRKLVARRALFEMRKGAVGNVGVGIADGIGLVAREEGCADDFILTVETGPIGGI
FT                   TSQGIAFGANVNTRAILDMTSQFDFYHGGGLDVCYLSFAEVDQHGNVGVHKFNGKIMGT
FT                   GGFIDISATSKKIIFCGTLTAGSLKTEIADGKLNIVQEGRVKKFIRELPEITFSGKIAL
FT                   ERGLDVRYITERAVFTLKEDGLHLIEIAPGVDLQKDILDKMDFTPVISPELKLMDERLF
FT                   IDAAMGFVLPEAAH"
FT   gene            complement(197798..198556)
FT                   /locus_tag="ARC77_01055"
FT   CDS_pept        complement(197798..198556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01055"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01055"
FT                   /db_xref="GOA:C3T817"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="UniProtKB/TrEMBL:C3T817"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000860190.1"
FT                   /protein_id="AMW40930.1"
FT                   /translation="MKTVTVKDLVIGTGAPKIIVSLMAKDIARVKSEALAYREADFDIL
FT                   EWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAA
FT                   IDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQS
FT                   FDADIPKIALMPQSTSDVLALLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSA
FT                   ATFGAVKKASAPGQISVNDLRTVLTILHQA"
FT   gene            complement(198587..199453)
FT                   /locus_tag="ARC77_01060"
FT   CDS_pept        complement(198587..199453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01060"
FT                   /product="quinate/shikimate dehydrogenase"
FT                   /note="YdiB; quinate/shikimate dehydrogenase from
FT                   Escherichia coli uses both NAD and NAD(P) to convert
FT                   quinate and shikimate to 3-dehydroquinate and
FT                   3-dehydroshikimate; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01060"
FT                   /db_xref="GOA:C3T823"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022872"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:C3T823"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:B7NTU4.1"
FT                   /protein_id="AMW40931.1"
FT                   /translation="MDVTAKYELIGLMAYPIRHSLSPEMQNKALEKAGLPFTYMAFEVD
FT                   NDSFPGAIEGLKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIVNDDGYLRGY
FT                   NTDGTGHIRAIKESGFDIKGKTMVLLGAGGASTAIGAQGAIEGLKEIKLFNRRDKFFDK
FT                   ALAFAQRVNENTDCVVTVTDLADQQAFAEALASADILTNGTKVGMKPLENKSLVNDISL
FT                   LHPGLLVTECVYNPHMTKLLQQAQQAGCKTIDGYGMLLWQGAEQFTLWTGKDFPLEYVK
FT                   QVMGFGA"
FT   gene            complement(199465..200730)
FT                   /locus_tag="ARC77_01065"
FT   CDS_pept        complement(199465..200730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01065"
FT                   /product="transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01065"
FT                   /db_xref="GOA:W8SYJ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:W8SYJ6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001405269.1"
FT                   /protein_id="AMW40932.1"
FT                   /translation="MSQNKAFSTPFILAVLCIYFSYFLHGISVITLAQNMSSLAEKFST
FT                   DNAGIAYLISGIGLGRLISILFFGVISDKFGRRAVILMAVIMYLLFFFGIPACPNLTLA
FT                   YGLAVCVGIANSALDTGGYPALMECFPKASGSAVILVKAMVSFGQMFYPMLVSYMLLNN
FT                   IWYGYGLIIPGILFVLITLMLLKSKFPSQLVDASVANELPQMNSKPLVWLEGVSSVLFG
FT                   VAAFSTFYVIVVWMPKYAMAFAGMSEAEALKTISYYSMGSLVCVFIFAALLKKMVRPIW
FT                   ANVFNSALATITAAIIYLYPSPLVCNAGAFVIGFSAAGGILQLGVSVMSEFFPKSKAKV
FT                   TSIYMMMGGLANFVIPLITGYLSNIGLQYIIVLDFTFALLALITAIIVFIRYYRVFIIP
FT                   ENDVRFGERKFSTRLNTIKHRG"
FT   gene            complement(200957..202171)
FT                   /locus_tag="ARC77_01070"
FT   CDS_pept        complement(200957..202171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01070"
FT                   /product="transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01070"
FT                   /db_xref="GOA:C3SDH6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDH6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_004016191.1"
FT                   /protein_id="AMW40933.1"
FT                   /translation="MKNPYYPTALGLYFNYLVHGMGVILMSLNMASLETLWQSNAAGVS
FT                   IVISSLGIGRLSVLLFAGLLSDRFGRRPFIMLGMCCYMAFFFGILQTNNIIIAYVFGFL
FT                   AGMANSFLDAGTYPSLMEAFPRSPGTANILIKAFVSSGQFLLPLIISLLVWAELWFGWS
FT                   FMIAAGIMFINALFLYRCTFPPHPGRRLPVIKKTTSSTEHRCSIIDLASYTLYGYISMA
FT                   TFYLVSQWLAQYGQFVAGMSYTMSIKLLSIYTVGSLLCVFITAPLIRNTVRPTTLLMLY
FT                   TFISFIALFTVCLHPTFYVVIIFSFVIGFTSAGGVVQIGLTLMAERFPYAKGKATGIYY
FT                   SAGSIATFTIPLITAHLSQRSIADIMWFDTAIAAIGFLLALFIGLRSRKKTRHHSLKEN
FT                   VAPGG"
FT   gene            complement(202271..202627)
FT                   /locus_tag="ARC77_01075"
FT   CDS_pept        complement(202271..202627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01075"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01075"
FT                   /db_xref="GOA:A0A152UJ70"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015060"
FT                   /db_xref="InterPro:IPR027910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UJ70"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016158180.1"
FT                   /protein_id="AMW40934.1"
FT                   /translation="MNAYELQALRHIFAMTIDECATWIAQTGDSESWRQWENGRCAIPD
FT                   CVVEQLLAMRQQRKKHLHAIIEKINNRIGNNTMRFFPDLTAFQQVYPDGNFIDWKIYQS
FT                   VAAELYAHDLERLC"
FT   gene            complement(202763..202870)
FT                   /gene="rprA"
FT                   /locus_tag="ARC77_01080"
FT   ncRNA           complement(202763..202870)
FT                   /gene="rprA"
FT                   /locus_tag="ARC77_01080"
FT                   /product="antisense sRNA RprA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: cmsearch."
FT                   /inference="COORDINATES:nucleotide motif:Rfam:12.0:RF00034"
FT                   /inference="COORDINATES:profile:INFERNAL:1.1.1"
FT                   /ncRNA_class="antisense_RNA"
FT   gene            complement(203056..204168)
FT                   /locus_tag="ARC77_01085"
FT   CDS_pept        complement(203056..204168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01085"
FT                   /product="hypothetical protein"
FT                   /note="YdiK; inner membrane protein; ydiK promoter presents
FT                   a PurR sequence, suggesting that its expression is
FT                   purine-regulated; unknown function; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01085"
FT                   /db_xref="GOA:C3T832"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C3T832"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020239880.1"
FT                   /protein_id="AMW40935.1"
FT                   /translation="MVNVRQPRDVAQILLSVLFLAIMIVACLWIVQPFILGFAWAGTVV
FT                   IATWPVLLRLQKIMFGRRSLAVLVMTLLLVMVFIIPIALLVNSIVDGSGPLIKAISSGD
FT                   MTLPDLAWLNTIPVIGAKLYAGWHNLLDMGGTAIMAKVRPYIGTTTTWFVGQAAHIGRF
FT                   MVHCALMLLFSALLYWRGEQVAQGIRHFATRLAGVRGDAAVLLAAQAIRAVALGVVVTA
FT                   LVQAVLGGIGLAVSGVPYATLLTVLMILSCLVQLGPLPVLIPAIIWLYWTGDTTWGTVL
FT                   LVWSGVVGTLDNVIRPMLIRMGADLPLILILSGVIGGLIAFGMIGLFIGPVLLAVSWRL
FT                   FAAWVEEVPPPTDQPEEILEELGEIQKPNK"
FT   gene            204557..207613
FT                   /locus_tag="ARC77_01090"
FT   CDS_pept        204557..207613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01090"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01090"
FT                   /db_xref="GOA:C3T838"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3T838"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000612887.1"
FT                   /protein_id="AMW40936.1"
FT                   /translation="MIPQISQAPGVVQLVLNFLQELEQQGFTGDTATSYADRLTMSTDN
FT                   SIYQLLPDAVVFPRSTADVALIARLAAQERYSSLIFTPRGGGTGTNGQALNQGIIVDMS
FT                   RHMNRIIEINPEEGWVRVEAGVIKDQLNQYLKPFGYFFAPELSTSNRATLGGMINTDAS
FT                   GQGSLVYGKTSDHVLGLRAVLLGGDILDTQPLPVELAETLGKSNTTIGRIYNTVYQRCR
FT                   QQRQLIIDNFPKLNRFLTGYDLRHVFNDEMTEFDLTRILTGSEGTLAFITEARLDITRL
FT                   PKVRRLVNVKYDSFDSALRNAPFMVEARALSVETVDSKVLNLAREDIVWHSVSELITDV
FT                   PDKEMLGLNIVEFAGDDEALIDERVNALCARLDELIASHQAGVIGWQMCRELAGVERIY
FT                   AMRKKAVGLLGNAKGAAKPIPFAEDTCVPPEHLADYIAEFRALLDSHGLSYGMFGHVDA
FT                   GVLHVRPALDMCDPQQEILMKQISDDVVALTAKYGGLLWGEHGKGFRAEYSPAFFGEEL
FT                   FAELRKVKAAFDPHNRLNPGKICPPEGLDAPMMKVDAVKRGTFDRQIPIAVRQQWRGAM
FT                   ECNGNGLCFNFDARSPMCPSMKITQNRIHSPKGRATLVREWLRLLADRGVDPLKLEQEL
FT                   PESGVSLRTLIARTRNSWHANKGEYDFSHEVKEAMSGCLACKACSTQCPIKIDVPEFRS
FT                   RFLQLYHTRYLRPLRDHLVATVESYAPLMARAPKTFNFFINQPLVRKLSEKHIGMVDLP
FT                   LLSVPSLQQQMVGHRSANMTLEQLESLNAEQKARTVLVVQDPFTSYYDAQVVADFVRLV
FT                   EKLGFQPVLLPFSPNGKAQHIKGFLNRFAKTAKKTADFLNRMAKLGMPMVGVDPALVLC
FT                   YRDEYKLALGEERGEFNVLLANEWLASALESQPVATVSGESWYFFGHCTEVTALPGAPA
FT                   QWAAIFARFGAKLENVSVGCCGMAGTYGHEAKNHKNSLGIYELSWHQAMQRLPRNRCLA
FT                   TGYSCRSQVKRVEGTGVRHPVQALLEIIK"
FT   gene            207610..208020
FT                   /locus_tag="ARC77_01095"
FT   CDS_pept        207610..208020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01095"
FT                   /product="thioesterase"
FT                   /note="required for efficient enterobactin production;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01095"
FT                   /db_xref="GOA:C3T842"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR030863"
FT                   /db_xref="UniProtKB/TrEMBL:C3T842"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000637981.1"
FT                   /protein_id="AMW40937.1"
FT                   /translation="MIWKRKIPLEALNAMGEGNMVGLLDIRFEHIGDDTLEATMPVDSR
FT                   TKQPFGLLHGGASVVLAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKP
FT                   LHLGSRHQVWQIEISDEKGRLCCSSRLTTAIL"
FT   gene            208120..208308
FT                   /locus_tag="ARC77_01100"
FT   CDS_pept        208120..208308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01100"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01100"
FT                   /db_xref="InterPro:IPR031830"
FT                   /db_xref="UniProtKB/TrEMBL:W8T121"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005120249.1"
FT                   /protein_id="AMW45896.1"
FT                   /translation="MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLS
FT                   SAELKEEIYFAWRLGVH"
FT   gene            208857..209225
FT                   /gene="sufA"
FT                   /locus_tag="ARC77_01105"
FT   CDS_pept        208857..209225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufA"
FT                   /locus_tag="ARC77_01105"
FT                   /product="Fe-S cluster assembly scaffold SufA"
FT                   /note="functions as a scaffold on which iron-sulfur
FT                   clusters ([2Fe-2S]; [4Fe-4S]) are assembled; forms a
FT                   homodimer; similar to IscA protein; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01105"
FT                   /db_xref="GOA:C3T852"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011298"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C3T852"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000418976.1"
FT                   /protein_id="AMW40938.1"
FT                   /translation="MDMHSGTFNPQDFAWQGLTLTPAAAVHIRELVAKQPGMVGVRLGV
FT                   KQTGCAGFGYVLDSVSEPDKDDLLFEHDGAKLFVPLQAMPFIDGTEVDFVREGLNQIFK
FT                   FHNPKAQNECGCGESFGV"
FT   gene            209234..210721
FT                   /locus_tag="ARC77_01110"
FT   CDS_pept        209234..210721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01110"
FT                   /product="Fe-S cluster assembly protein SufB"
FT                   /note="with SufCD activates cysteine desulfurase SufS;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01110"
FT                   /db_xref="GOA:A0A143EA42"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143EA42"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015584111.1"
FT                   /protein_id="AMW40939.1"
FT                   /translation="MSRNTEATDDVKTWTGGPLNYKEGFFTQLATDELAKGINEEVVRA
FT                   ISAKRNEPEWMLEFRLNAYRAWLEMEEPHWLKAHYDKLNYQDYSYYSAPSCGNCDDTCA
FT                   SEPGAVQQTGANAFLSKEVEAAFEQLGVPVREGKEVAVDAIFDSVSVATTYREKLAEQG
FT                   IIFCSFGEAIHDHPELVRKYLGTVVPGNDNFFAALNAAVVSDGTFIYVPKGVRCPMELS
FT                   TYFRINAEKTGQFERTILVADEDSYVSYIEGCSAPVRDSYQLHAAVVEVIIHKNAEVKY
FT                   STVQNWFPGDNNTGGILNFVTKRALCEGENSKMSWTQSETGSAITWKYPSCILRGDNSI
FT                   GEFYSVALTSGHQQADTGTKMIHIGKNTKSTIISKGISAGHSQNSYRGLVKIMPTATNA
FT                   RNFTQCDSMLIGANCGAHTFPYVECRNNSAQLEHEATTSRIGEDQLFYCLQRGISEEDA
FT                   ISMIVNGFCKDVFSELPLEFAVEAQKLLAISLEHSVG"
FT   gene            210731..211477
FT                   /gene="sufC"
FT                   /locus_tag="ARC77_01115"
FT   CDS_pept        210731..211477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="ARC77_01115"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="part of SUF system involved in inserting iron-sulfur
FT                   clusters into proteins; in Escherichia coli this protein
FT                   forms a complex with SufBD; the SufBCD complex stimulates
FT                   the cysteine desulfurase SufS in conjunction with SufE;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01115"
FT                   /db_xref="GOA:C3T862"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3T862"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008500629.1"
FT                   /protein_id="AMW40940.1"
FT                   /translation="MLSIKDLHVSVEDKAILRGLSLDVRPGEVHAIMGPNGSGKSTLSA
FT                   TLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALN
FT                   AVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLE
FT                   PELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQG
FT                   RIVKSGDFTLVKQLEEQGYGWLTEQQ"
FT   gene            211452..212723
FT                   /locus_tag="ARC77_01120"
FT   CDS_pept        211452..212723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01120"
FT                   /product="FeS cluster assembly protein SufD"
FT                   /note="with SufBC activates cysteine desulfurase SufS;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01120"
FT                   /db_xref="GOA:C3T867"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:C3T867"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000907973.1"
FT                   /protein_id="AMW40941.1"
FT                   /translation="MAGLPNSSNALQQWHHLFEAEGTKRSPQAQQHLQQLLRTGLPTRK
FT                   HENWKYTPLEGLTNSQFVSIAGEISPQQRDALALTLDAVRLVFVDGRYVPALSDATEGS
FT                   GYEVSINDDRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRGQRPAKPLLLMHITQGVAG
FT                   EEVNTAHYRHHLELAEGAEATVIEHFVSLNDARHFTGARFSINVAANAHLQHIKLAFEN
FT                   PLSHHFAHNDLLLADDATAFSHSFLLGGAVLRHNTSTQLNGENCTLRINSLAMPVKNEV
FT                   CDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLLMGKL
FT                   AEVDTKPQLEIYADDVKCSHGATVGRIDDEQMFYLRSRGINQQDAQQMIIYAFAAELTE
FT                   ALRDEGLKQQVLTRIGQRLPGGAR"
FT   gene            212720..213940
FT                   /locus_tag="ARC77_01125"
FT   CDS_pept        212720..213940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01125"
FT                   /product="cysteine sulfinate desulfinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01125"
FT                   /db_xref="GOA:C3T872"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C3T872"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001730075.1"
FT                   /protein_id="AMW40942.1"
FT                   /translation="MTFSVDKVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAE
FT                   FYRHGYAAVHRGIHTLSAQATEKMENVRKRASLFINARSAEELVFVRGTTEGINLVANS
FT                   WGNSNVRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPTLFDE
FT                   KTRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVF
FT                   SGHKLYGPTGIGILYVKEALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNT
FT                   GGIIGLGAALEYVSAQGLNNIAEYEQNLMHYALSQLESVPDLTLYGPQNRLGVIAFNLG
FT                   KHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQ
FT                   RIHRLLG"
FT   gene            213953..214369
FT                   /locus_tag="ARC77_01130"
FT   CDS_pept        213953..214369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01130"
FT                   /product="cysteine desufuration protein SufE"
FT                   /note="Acts with SufS to catalyze the formation of
FT                   L-alanine from L-cysteine; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01130"
FT                   /db_xref="GOA:C3T877"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="InterPro:IPR023939"
FT                   /db_xref="UniProtKB/TrEMBL:C3T877"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020233099.1"
FT                   /protein_id="AMW40943.1"
FT                   /translation="MALLPDKEKLLRNFLRCANWEEKYLYIIELGQRLPELRDEDRSPQ
FT                   NSIQGCQSQVWIVMRQNAQGIIELQGDSDAAIVKGLIAVVFILYDQMTPQDVVNFDVRP
FT                   WFEKMALTQHLTPSRSQGLEAMIRAIRAKAAALS"
FT   gene            214518..215522
FT                   /locus_tag="ARC77_01135"
FT   CDS_pept        214518..215522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01135"
FT                   /product="murein L,D-transpeptidase"
FT                   /note="catalyzes the formation of a meso-diaminopimelyl-3-a
FT                   meso-diaminopimelyl-3 cross-link in peptidoglycan
FT                   synthesis; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01135"
FT                   /db_xref="GOA:C3T882"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041597"
FT                   /db_xref="UniProtKB/TrEMBL:C3T882"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000817090.1"
FT                   /protein_id="AMW40944.1"
FT                   /translation="MKRASLLTLTLIGAFSAIQAAWAVDYPLPPTGSRLVGQNQTYTVQ
FT                   EGDKNLQAIARRFDTAAMLILEANNTIAPVPKPGTTITIPSQLLLPDAPRQGIIVNLAE
FT                   LRLYYYPPGENIVQVYPIGIGLQGLETPVMETRVGQKIPNPTWTPTAGIRQRSLERGIK
FT                   LPPVVPAGPNNPLGRYALRLAHGNGEYLIHGTSAPDSVGLRVSSGCIRMNAPDIKALFS
FT                   SVRTGTPVKVINEPVKYSVEPNGMRYVEVHRPLSAEEQQNVQTMPYTLPAGFTQFKDNK
FT                   AVDQKLVDKALYRRAGYPVAVSSGATPTASNAPSVESAQNGEPEQGNMLRATQ"
FT   gene            complement(215585..215821)
FT                   /locus_tag="ARC77_01140"
FT   CDS_pept        complement(215585..215821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01140"
FT                   /product="murein lipoprotein"
FT                   /note="major outer membrane lipoprotein; interacts with
FT                   peptidoglycan to maintain the integrity of the cell
FT                   envelope; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01140"
FT                   /db_xref="GOA:C3T887"
FT                   /db_xref="InterPro:IPR006817"
FT                   /db_xref="InterPro:IPR016367"
FT                   /db_xref="UniProtKB/TrEMBL:C3T887"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006675846.1"
FT                   /protein_id="AMW40945.1"
FT                   /translation="MKATKLVLGAVILGSTLLAGCSSNAKIDQLSSDVQTLNAKVDQLS
FT                   NDVNAMRSDVQAAKDDAARANQRLDNMATKYRK"
FT   gene            complement(216132..217544)
FT                   /locus_tag="ARC77_01145"
FT   CDS_pept        complement(216132..217544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01145"
FT                   /product="pyruvate kinase"
FT                   /note="catalyzes the formation of phosphoenolpyruvate from
FT                   pyruvate; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01145"
FT                   /db_xref="GOA:Q2TL68"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TL68"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010346010.1"
FT                   /protein_id="AMW40946.1"
FT                   /translation="MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQ
FT                   RIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSE
FT                   MVAVTYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGV
FT                   SIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIE
FT                   NQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQML
FT                   DSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMN
FT                   SRLEFNNDNRKLRITEAVCRGAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILAL
FT                   TTNEKTAHQLVLSKGVVPQLVKEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVP
FT                   SGTTNTASVHVL"
FT   gene            218101..218310
FT                   /locus_tag="ARC77_01150"
FT   CDS_pept        218101..218310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01150"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01150"
FT                   /db_xref="GOA:C3T897"
FT                   /db_xref="InterPro:IPR024493"
FT                   /db_xref="UniProtKB/TrEMBL:C3T897"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000164230.1"
FT                   /protein_id="AMW40947.1"
FT                   /translation="MGNRTKEDELYREMCRVVGKVVLEMRDLGQEPKHIVIAGVLRTAL
FT                   ANKRIQRSELEKQAMETVINALVK"
FT   gene            218766..219392
FT                   /locus_tag="ARC77_01155"
FT   CDS_pept        218766..219392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01155"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01155"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8A2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005122832.1"
FT                   /protein_id="AMW40948.1"
FT                   /translation="MNPVDRPLLDIGLTRLEFLRISGKGLAGLTIAPALLSLLGCKQED
FT                   IDSGTVGLINTPKGVLVTQRARCTGCHRCEISCTNFNDGSVGTFFSRIKIHRNYFFGDN
FT                   GVGSGGGLYGDLNYTADTCRQCKEPQCMNVCPIGAITWQQKEGCITVDHKRCIGCSACT
FT                   TACPWMMATVNTESKKSSKCVLCGECANACPTGALKIIEWKDITV"
FT   gene            219413..221515
FT                   /locus_tag="ARC77_01160"
FT   CDS_pept        219413..221515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01160"
FT                   /product="oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01160"
FT                   /db_xref="GOA:C3SDH9"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDH9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016235681.1"
FT                   /protein_id="AMW40949.1"
FT                   /translation="MTNGWTGNILRVNLTTGNITLEDSSKFKSFVGGMGFGYKIMYDEV
FT                   PPGTKPFDEANKLVFATGPLTGSGAPCSSRVNITSLSTFTKGNLVVDAHMGGFFAAQMK
FT                   FAGYDVIIIEGKAKSPVWLKIKDDKVSLEKADFLWGKGTRATTEEICRLTSPETCVAAI
FT                   GQAGENLVPLSGMLNSRNHSGGAGTGAIMGSKNLKAIAVEGTKGVNIADRQEMKRLNDY
FT                   MMTELIGANNNHVVPSTPQSWAEYSDPKSRWTARKGLFWGAAEGGPIETGEIPPGNQNT
FT                   VGFRTYKSVFDLGPAAEKYTVKMSGCHSCPIRCMTQMNIPRVKEFGVPSTGGNTCVANF
FT                   VHTTIFPNGPKDFEDKDDGRVIGNLVGLNLFDDYGLWCNYGQLHRDFTYCYSKGVFKRV
FT                   LPAEEYAEIRWDQLEAGDVNFIKDFYYRLAHRVGELSHLADGSYAIAECWNLGEEYWGY
FT                   AKNKLWSPFGYPVHHANEASAQVGSIVNCMFNRDCMTHTHINFIGSGLPLKLQREVAKE
FT                   LFGSEDAYDETKNYTPINDAKIKYAKWSLLRVCLHNAVTLCNWVWPMTVSPLKSRNYRG
FT                   DLALEAKFFKAITGEEMTQEKLDLAAERIFTLHRAYTVKLMQTKDMRNEHDLICSWVFD
FT                   KDPQIPVFTEGTDKMDRDDMHASLTMFYKEMGWDPQLGCPTRETLQRLGLEDIAADLAA
FT                   HNLLPA"
FT   gene            221528..222166
FT                   /locus_tag="ARC77_01165"
FT   CDS_pept        221528..222166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01165"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K4FWT8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001599958.1"
FT                   /protein_id="AMW40950.1"
FT                   /translation="MNHQDELPLAKVSEVDEAKRQWLQGMRHPVDTVTEPEPAEILAEF
FT                   IRQHSVAGQLVARAVFLSPPYSVAEEELSVLLENIKQNGDYADIACMTGSQDDYYYSTQ
FT                   AMSENYAAMSLQVVEQDICRAIAHAVRFECQTYPRPYKVAMLMQAPYYFQEAQIEAAIA
FT                   AMDVAPEYADIRQVESSTAVLYLFSERFMTYGKAYGLCEWFEVEQFQNP"
FT   gene            222230..222898
FT                   /locus_tag="ARC77_01170"
FT   CDS_pept        222230..222898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01170"
FT                   /product="ferredoxin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01170"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143E897"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003029332.1"
FT                   /protein_id="AMW45897.1"
FT                   /translation="MSFTRRKFVLGMGTVIFFTGSASSLLANTRQEKEVRYAMIHDESR
FT                   CNGCNICACACRKTNHAPAQGSRLSIAHIPVTDNDNETQYHFFRQSCQHCEDAPCIDVC
FT                   PTGASWRDEQGIVRVEKSQCIGCSYCIGACPYQVRYLNPVTKVADKCDFCAESRLAKGF
FT                   PPICVSACPEHALIFGREDSPEIQAWLQDNKYYQYQLPGAGKPHLYRRFGQHLIKKENV
FT                   "
FT   gene            222895..223680
FT                   /locus_tag="ARC77_01175"
FT   CDS_pept        222895..223680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01175"
FT                   /product="thiosulfate reductase cytochrome B subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01175"
FT                   /db_xref="GOA:C3T8B7"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8B7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001069994.1"
FT                   /protein_id="AMW40951.1"
FT                   /translation="MNPSQHAEQFQSQLANYVPQFTPEFWPVWLIIAGVLLVGMWLVLG
FT                   LHALLRARGVKKSATDHGERIYLYSKAVRLWHWSNALLFVLLLASGLINHFALVGATAV
FT                   KSLVAVHEVCGFLLLACWLGFVLINGVGGNGHHYRIRRQGWLERAAKQTRFYLFGIMQG
FT                   EEHPFPATTQSKFNPLQQVAYVGVMYGLLPLLLLTGLLCLYPQAVGDVFPGVRYWLLQA
FT                   HFALAFISLFFIFGHLYLCTTGRTPHETFKSMVDGYHRH"
FT   gene            223684..224496
FT                   /locus_tag="ARC77_01180"
FT   CDS_pept        223684..224496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01180"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01180"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8C2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000587591.1"
FT                   /protein_id="AMW40952.1"
FT                   /translation="MIITRADLREWRIGAVMYRWFLRHFPRGGSYADIHHALIEEGYTD
FT                   WAESLVEYAWKKWLADENFAHQEVSSMQKLATDPGERAFCSQFARSDDHARIGCCEDNA
FT                   RIATAGYAAQIASMGYSVRIGSVGFNSHIGSSGERARVAVTGNSSRISSAGDSSRIANT
FT                   GMRVRVCTLGKRCHVASNGDLVQIASFGANARIANSGDNVHIIASGENSTVVSTGVVDS
FT                   IILGPGGSAALAYHDGERVRFAVAIEGENNIRAGVRYRLNEQHQFVEC"
FT   gene            complement(224508..226112)
FT                   /locus_tag="ARC77_01185"
FT   CDS_pept        complement(224508..226112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01185"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01185"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8C7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P77148.1"
FT                   /protein_id="AMW40953.1"
FT                   /translation="MKKIAIVGAGPTGIYTLFSLLQQQTPLSISIFEQADEAGVGMPYS
FT                   DEENSKMMLANIASIEIPPIYCTYLEWLQKQEASHLQRYGVKKETLHDRQFLPRILLGE
FT                   YFRDQFLRLVDQARKQKFAVAVYESCQVTDLQITNAGVMLATNQDLPSETFDLAVIATG
FT                   HVWPDEEEATRTYFPSPWSGLMEAKVDACNVGIMGTSLSGLDAAMAVAIQHGSFIEDDK
FT                   QHVVFHRDNASEKLNITLMSRTGILPEADFYCPIPYEPLHIVTDQALNAEIQKGEYGLL
FT                   DRVFRLIVEEIKFADPDWSQRIALESLNVDSFAQAWFAERKQRDQFDWAEKNLQEVERN
FT                   KREKHTVPWRYVILRLHEAVQEIVPHLNEHDHKRFSKGLARVFIDNYAAIPSESIRRLL
FT                   ALREAGIIHILALGEDYKMEINESRTVLKTEDNSYSFDVFIDARGQRPLKVKDIPFPGL
FT                   REQLQKTGDEIPDVGEDYTLQQPEDIRGRVAFGALPWLMHDQPFVQGLTACAEIGEAMA
FT                   RAVVKPASRARRRLSFD"
FT   gene            complement(226238..226543)
FT                   /locus_tag="ARC77_01190"
FT   CDS_pept        complement(226238..226543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01190"
FT                   /product="monooxygenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01190"
FT                   /db_xref="GOA:C3T8D3"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR014910"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8D3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000212656.1"
FT                   /protein_id="AMW40954.1"
FT                   /translation="MATLLQLHFAFNGPFGDAMAEQLKPLAESINQEPGFLWKVWTESE
FT                   KNHEAGGIYLFTDEKSALAYLEKHTAQLKKLGVEEVVAKVFDVNEPLSQINQAKLA"
FT   gene            complement(226651..226727)
FT                   /locus_tag="ARC77_01195"
FT   tRNA            complement(226651..226727)
FT                   /locus_tag="ARC77_01195"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:226691..226693,aa:Val,seq:gac)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(226732..226808)
FT                   /locus_tag="ARC77_01200"
FT   tRNA            complement(226732..226808)
FT                   /locus_tag="ARC77_01200"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:226772..226774,aa:Val,seq:gac)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            227116..228372
FT                   /locus_tag="ARC77_01205"
FT   CDS_pept        227116..228372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01205"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01205"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR030930"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8D9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000534301.1"
FT                   /protein_id="AMW40955.1"
FT                   /translation="MGSDAKNLMSDGNVQIVKTGEVIGATQLTEGELIVEAGGRAENTV
FT                   VTGAGWLKVATGGIAKCTQYGNNGTLSVSDGAIATDIVQSEGGAISLSTLATVNGRHPE
FT                   GEFSVDQGYACGLLLENGGNLRVLEGHRAEKIILDQEGGLLVNGTTSAVVVDEGGELLV
FT                   YPGGEASNCEINQGGVFMLAGKANDTLLADGTMNNLGGEDSDTIVENGAIYRLGTDGLQ
FT                   LYSSGKTQNLSVNVGGRAEVHAGTLENAVIQGGTVILLSPTSADENFVVEEDRAPVELT
FT                   GSVALLDGASMIIGYGADLQQSTLTVQQGGVLILDGSTVKGDSVTFSIGNINLNGGKLW
FT                   LITGAATHVQLKVKRLRGEGAICLQTSAKEISPDFINVKGEVNGDIRVQITDASRQTLC
FT                   NALKLQPDEDGIGATLQPA"
FT   gene            complement(228413..229786)
FT                   /locus_tag="ARC77_01210"
FT   CDS_pept        complement(228413..229786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01210"
FT                   /product="MATE family efflux transporter"
FT                   /note="NorM; MdtK; functions as a Na(+)/drug antiporter;
FT                   inactivation in Vibrio cholerae results in susceptibility
FT                   to fluoroquinolones; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01210"
FT                   /db_xref="GOA:C3T8E3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="InterPro:IPR022913"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8E3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003857645.1"
FT                   /protein_id="AMW40956.1"
FT                   /translation="MQKYISEARLLLALAIPVILAQIAQTAMGFVDTVMAGGYSATDMA
FT                   AVAIGTSIWLPAILFGHGLLLALTPVIAQLNGSGRRERIAHQVRQGFWLAGFVSVLIML
FT                   VLWNAGYIIRSMENIDPALADKAVGYLRALLWGAPGYLFFQVARNQCEGLAKTKPGMVM
FT                   GFIGLLVNIPVNYIFIYGHFGMPELGGVGCGVATAAVYWVMFLAMVSYIKRARSMRDIR
FT                   NEKGTAKPDPAVMKRLIQLGLPIALALFFEVTLFAVVALLVSPLGIVDVAGHQIALNFS
FT                   SLMFVLPMSLAAAVTIRVGYRLGQGSTLDAQTAARTGLMVGVCMATLTAIFTVSLREQI
FT                   ALLYNDNPEVVTLAAHLMLLAAVYQISDSIQVIGSGILRGYKDTRSIFYITFTAYWVLG
FT                   LPSGYILALTDLVVEPMGPAGFWIGFIIGLTSAAIMMMLRMRYLQRLPSAIILQRASR"
FT   gene            230001..230642
FT                   /locus_tag="ARC77_01215"
FT   CDS_pept        230001..230642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01215"
FT                   /product="riboflavin synthase subunit alpha"
FT                   /note="catalyzes the formation of riboflavin from
FT                   6,7-dimethyl-8-(1-D-ribityl)lumazine; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01215"
FT                   /db_xref="GOA:C3T8E8"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8E8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000493941.1"
FT                   /protein_id="AMW40957.1"
FT                   /translation="MFTGIVQGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHN
FT                   GCCLTVTEINGNHVSFDLMKETLRITNLGDLKVGDWVNVERAAKFSDEIGGHLMSGHIM
FT                   TTAEVAKILTSENNRQIWFKVQDSQLMKYILYKGFIGIDGISLTVGEVTPTRFCVHLIP
FT                   ETLERTTLGKKKLGARVNIEIDPQTQAVVDTVERVLAARENAMNQSGTEA"
FT   gene            complement(230682..231830)
FT                   /locus_tag="ARC77_01220"
FT   CDS_pept        complement(230682..231830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01220"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /note="catalyzes the transfer of a methylene group from
FT                   S-adenosyl-L-methionine to the cis double bond of an
FT                   unsaturated fatty acid chain resulting in the replacement
FT                   of the double bond with a methylene bridge; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01220"
FT                   /db_xref="GOA:C3T8F2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8F2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020236338.1"
FT                   /protein_id="AMW40958.1"
FT                   /translation="MSSSCIEEVSVPDDNWYRIANELLSRAGIAINGSAPADIRVKNPD
FT                   FFKRVLQEGSLGLGESYMDGWWECDRLDMFFSKVLRAGLENQLPHHFKDTLRIAGARLF
FT                   NLQSKKRAWIVGKEHYDLGNDLFSRMLDPFMQYSCAYWKDADNLESAQQAKLKMICEKL
FT                   QLKPGMRVLDIGCGWGGLAHYMASNYDVSVVGVTISAEQQKMAQERCEGLDVTILLQDY
FT                   RDLNDQFDRIVSVGMFEHVGPKNYDTYFTVVDRNLKPEGIFLLHTIGSKKTDLNVDPWI
FT                   NKYIFPNGCLPSVRQIAQSSEPHFVMEDWHNFGADYDTTLMAWYERFVAAWPEIADNYS
FT                   ERFKRMFTYYLNACAGAFRARDIQLWQVVFSRGVENGLRVAR"
FT   gene            complement(232121..233332)
FT                   /locus_tag="ARC77_01225"
FT   CDS_pept        complement(232121..233332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01225"
FT                   /product="Bcr/CflA family multidrug efflux transporter"
FT                   /note="uncharacterized member of the major facilitator
FT                   superfamily (MFS); Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01225"
FT                   /db_xref="GOA:C3T8F7"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8F7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005127192.1"
FT                   /protein_id="AMW40959.1"
FT                   /translation="MQPGKRFLVWLAGLSVLGFLATDMYLPAFAAIQADLQTPASAVSA
FT                   SLSLFLAGFAAAQLLWGPLSDRYGRKPVLLIGLTIFALGSLGMLWVENAAMLLVLRFVQ
FT                   AVGVCAAAVIWQALVTDYYPSQKVNRIFATIMPLVGLSPALAPLLGSWLLVHFSWQAIF
FT                   ATLFAITVVLILPIFWLKPTTKARNNSQDGLTFTDLLRSKTYRGNVLIYAACSASFFAW
FT                   LTGSPFILSEMGYSPAVIGLSYVPQTIAFLIGGYGCRAALQKWQGKQLLPWLLVLFAVS
FT                   VIATWAAGFISHVSLVEILIPFCVMAIANGAIYPIVVAQALRPFPHATGRAAALQNTLQ
FT                   LGLCFLASLVVSWLISISTPLLTTTSVMLSTVVLVALGYMMQRCEEVGCQNHGNAEVAH
FT                   SESH"
FT   gene            233445..234377
FT                   /locus_tag="ARC77_01230"
FT   CDS_pept        233445..234377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01230"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01230"
FT                   /db_xref="GOA:C3T8G2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8G2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001538795.1"
FT                   /protein_id="AMW40960.1"
FT                   /translation="MWSEYSLEVVDAVARNGSFSAAAQELHRVPSAVSYTVRQLEEWLA
FT                   VPLFERRHRDVELTAAGAWFLKEGRSVVKKMQITRQQCQQIANGWRGQLAIAVDNIVRP
FT                   ERTRQMIVDFYRHFDDVELLVFQEVFNGVWDALSDGRVELAIGATRAIPVGGRYAFRDM
FT                   GMLSWSCVVASHHPLALMDGPFSDDTLRNWPSLVREDTSRTLPKRITWLLDNQKRVVVP
FT                   DWESSATCISAGLCIGMVPTHFAKPWLNEGKWVALELENPFPDSACCLTWQQNDMSPAL
FT                   TWLLEYLGDSETLNKEWLREPEETPATGD"
FT   gene            complement(234374..235399)
FT                   /locus_tag="ARC77_01235"
FT   CDS_pept        complement(234374..235399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01235"
FT                   /product="transcriptional regulator"
FT                   /note="binds to the purF operator and coregulates other
FT                   genes for de novo purine nucleotide synthesis; is involved
FT                   in regulation of purB, purC, purEK, purHD, purL, purMN and
FT                   guaBA expression; binds hypoxanthine and guanine as
FT                   inducers; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01235"
FT                   /db_xref="GOA:C3T8G7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR023588"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8G7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005127190.1"
FT                   /protein_id="AMW40961.1"
FT                   /translation="MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHY
FT                   SPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQ
FT                   RAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAF
FT                   EGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFE
FT                   PESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNAR
FT                   YFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
FT                   R"
FT   gene            235698..235787
FT                   /locus_tag="ARC77_01240"
FT   CDS_pept        235698..235787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01240"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01240"
FT                   /db_xref="GOA:A0A024L1M7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024L1M7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000102278.1"
FT                   /protein_id="AMW40962.1"
FT                   /translation="MSTDLKFSLVTTIIVLGLIVAVGLTAALH"
FT   gene            235953..237122
FT                   /locus_tag="ARC77_01245"
FT   CDS_pept        235953..237122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01245"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01245"
FT                   /db_xref="GOA:C3T8H3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8H3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001634435.1"
FT                   /protein_id="AMW40963.1"
FT                   /translation="MKINYPLLALAIGAFGIGTTEFSPMGLLPVIARGVDVSIPAAGML
FT                   ISAYAVGVMVGAPLMTLLLSHRARRSALIFLMAIFTLGNVLSAIAPDYMTLMLSRILTS
FT                   LNHGAFFGLGSVVAASVVPKHKQASAVATMFMGLTLANIGGVPAATWLGETIGWRMSFL
FT                   ATAGLGVISMVSLFFSLPKGGAGARPEVKKELAVLMRPQVLSALLTTVLGAGAMFTLYT
FT                   YISPVLQSITHATPVFVTAMLVLIGVGFSIGNYLGGKLADRSVNGTLKGFLLLLMVIML
FT                   AIPFLARNKFGAAISMAVWGAATFAVVPPLQMRVMRVASEAPGLSSSVNIGAFNLGNAL
FT                   GAAAGGAVISAGLGYSFVPVMGAIVAGLALLLVFMSARKQPETVCVANS"
FT   gene            complement(237268..237849)
FT                   /locus_tag="ARC77_01250"
FT   CDS_pept        complement(237268..237849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01250"
FT                   /product="superoxide dismutase"
FT                   /note="SodB; iron binding; present under aerobic and
FT                   anaerobic conditions; destroys free radicals; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01250"
FT                   /db_xref="GOA:C3T8H7"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8H7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020079002.1"
FT                   /protein_id="AMW40964.1"
FT                   /translation="MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKG
FT                   TAFEGKSLEEIIRSSEGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSF
FT                   ADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAY
FT                   YIDYRNARPGYLEHFWALVNWEFVAKNLAA"
FT   gene            complement(237977..238792)
FT                   /locus_tag="ARC77_01255"
FT   CDS_pept        complement(237977..238792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01255"
FT                   /product="endopeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01255"
FT                   /db_xref="GOA:C3T8I2"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8I2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005127187.1"
FT                   /protein_id="AMW40965.1"
FT                   /translation="MARINRISITLCALLFTTLPLTPMAHASKQARESSATTHITKKAD
FT                   KKKSTATTKKTQKTAKKAASKSTTKSKTASSVKKSSITASKNAKTRSKHTVNKTASASF
FT                   TEKCTKRKGYKSHCVKVKNAASGTLADAHKAKVQKATKVAMNKLMQQIGKPYRWGGSSP
FT                   RTGFDCSGLVYYAYKDLVKIRIPRTANEMYHLRDAAPIERSELKNGDLVFFRTQGRGTA
FT                   DHVGVYVGNGKFIQSPRTGQEIQITSLSEDYWQRHYVGARRVMTPKTLR"
FT   gene            239127..239474
FT                   /locus_tag="ARC77_01260"
FT   CDS_pept        239127..239474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01260"
FT                   /product="glutaredoxin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01260"
FT                   /db_xref="GOA:C3T8I7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8I7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_004385024.1"
FT                   /protein_id="AMW40966.1"
FT                   /translation="MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGE
FT                   RFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETA
FT                   AKYKSEEPDAE"
FT   gene            complement(239525..244141)
FT                   /locus_tag="ARC77_01265"
FT   CDS_pept        complement(239525..244141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01265"
FT                   /product="ATP-dependent helicase"
FT                   /note="similar to the DNA and RNA helicase superfamily II
FT                   and eukaryotic DEAD family of helicases; longest known
FT                   protein in E. coli; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01265"
FT                   /db_xref="GOA:C3T8J2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8J2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001302074.1"
FT                   /protein_id="AMW40967.1"
FT                   /translation="MADNPNPSSPLPDVFSPATRDWFLRAFKQPTAVQSQTWHVAARGE
FT                   HALVIAPTGSGKTLAAFLYALDRLFREGGEDTREAHKRKTSRILYISPIKALGTDVQRN
FT                   LQIPLKGIADERRRRGETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLT
FT                   SRARETLRGVETVIIDEVHAVAGSKRGAHLALSLERLDALLHTSAQRIGLSATVRSASD
FT                   VAAFLGGDRPVTVVNPPAMRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPYI
FT                   ETGILDEVLRHRSTIVFTNSRGLAEKLTARLNELYAARLQRSPSIAADAAHFESTSGAT
FT                   SNRVQSSDVFIARSHHGSVSKEQRAITEQALKSGELRCVVATSSLELGIDMGAVELVIQ
FT                   VATPLSVASGLQRIGRAGHQIGGISKGLFFPRTRRDLVDSAVIVECMFAGRLENLTPPH
FT                   NPLDVLAQHTVAAAAMDALQVDEWYSRVRRAAPWKDLPRRVFDATLDMLSGRYPSGDFS
FT                   AFRPKLVWNRETGILTARPGAQLLAVTSGGTIPDRGMYSVLLPEGEEQAGSRRVGELDE
FT                   EMVYESRVNDIITLGATSWRIQQITRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMI
FT                   GDFLHLLADGAFFSGTIPPWLAEENTIANIQGLIDEQRNATGIVPGSRHLVLERCRDEI
FT                   GDWRIILHSPYGRRVHEPWALAIAGRIHALWGADASVVASDDGIVARIPDTDGKLPDAA
FT                   IFLFEPEKLLQIVREAVGSSALFAARFRECAARALLMPGRTPGHRTPLWQQRLRASQLL
FT                   EIAQGYPDFPAILETLRECLQDVYDLPALERLMRRLNGGEIQISDVTTTTPSPFATSLL
FT                   FGYVAEFMYQSDAPLAERRASVLSLDSELLRNLLGQVDPGELLDPQVIRQVEEELQRLA
FT                   PGRRAKGEEGLFDLLRELGPMTVEDLAQRHTGSSEEIASYLENLLTVKRIFPTMISGQE
FT                   RLACMDDAARLRDALGVRLPESLPEIYLHRVSYPLRDLFLRYLRAHALVTAEQLAHEFS
FT                   LGIAIVEEQLQQLREQGLVMNLQQDIWVSDEVFRRLRLRSLQAAREATRPVAATTYARL
FT                   LLERQGVLPATDGSPALFASTSPGVYEGVDGVMRVIEQLAGVGLPASLWESQILPARVH
FT                   DYSPEVLDELLATGAVIWSGQKKLGEDDGLVALHLQEYAAESFTPAEADQANRSALQQA
FT                   IVAVLADGGAWFAQQISQRIRDKIGESVDPSALQEALWALVWQGVITSDIWAPLRALTR
FT                   SSSNARTSTRRSHRARRGRPVYAQPVSPRVSYNTPNLAGRWSLLQVEPLNDTERMLALA
FT                   ENMLDRYGIISRQAVIAENIPGGFPSMQTLCRSMEDSGRIMRGRFVEGLGGAQFAERLT
FT                   IDRLRDLATQAAQTRHYTPVALSANDPANVWGNLLPWPAHPATLVPTRRAGALVVVSGG
FT                   KLLLYLAQGGKKMLVWQEKEELLAPEVFHALTTALRREPRLRFTLTEVNDLPVWQTPMF
FT                   TLLREAGFSSSPQGLDWG"
FT   gene            complement(244234..244881)
FT                   /locus_tag="ARC77_01270"
FT   CDS_pept        complement(244234..244881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01270"
FT                   /product="ribonuclease T"
FT                   /note="Responsible for the end-turnover of tRNA:
FT                   specifically removes the terminal AMP residue from
FT                   uncharged tRNA (tRNA-C-C-A); Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01270"
FT                   /db_xref="GOA:C3T8J7"
FT                   /db_xref="InterPro:IPR005987"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8J7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001735302.1"
FT                   /protein_id="AMW40968.1"
FT                   /translation="MSDNAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLK
FT                   MDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVR
FT                   KGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTV
FT                   LSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLPAAEEV"
FT   gene            complement(244984..245391)
FT                   /locus_tag="ARC77_01275"
FT   CDS_pept        complement(244984..245391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01275"
FT                   /product="lactoylglutathione lyase"
FT                   /note="Ni-dependent; catalyzes the formation of
FT                   S-lactoylglutathione from methylglyoxal and glutathione;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01275"
FT                   /db_xref="GOA:C3T8K2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8K2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008500591.1"
FT                   /protein_id="AMW40969.1"
FT                   /translation="MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVG
FT                   YGPETEEAVIELTYNWGVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVK
FT                   GGTTVIAFVEDPDGYKIELIEEKDAGRGLGN"
FT   gene            complement(245472..246569)
FT                   /locus_tag="ARC77_01280"
FT   CDS_pept        complement(245472..246569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01280"
FT                   /product="alkene reductase"
FT                   /note="FMN-linked; catalyzes the formation of
FT                   N-ethylsuccinimide from N-ethylmaleimide; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01280"
FT                   /db_xref="GOA:C3T8K7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8K7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015964258.1"
FT                   /protein_id="AMW40970.1"
FT                   /translation="MSSEKLYSPLKVGAITAANRIFMAPLTRLRSIEPGDIPTPLMAEY
FT                   YRQRASAGLIISEATQISAQAKGYAGAPGIHSPEQIAAWKKITAGVHAENGHMAVQLWH
FT                   TGRISHASLQPGGQAPVAPSALSAGTRTSLRDENGQAIRVETSMPRALELEEIPSIVND
FT                   FRQAIANAREAGFDLVELHSAHGYLLHQFLSPSSNHRTDQYGGSVENRARLVLEVVDAG
FT                   IEEWGADRIGIRVSPIGTFQNTDNGPNEEADALYLIEQLGKRGIAYLHMSEPDWAGGEP
FT                   YTDAFREKVRARFHGPIIGAGAYTVEKAETLIGKGLIDAVAFGRDWIANPDLVARLQRK
FT                   AELNPQRAESFYGGGAEGYTDYPTL"
FT   gene            complement(246606..247205)
FT                   /locus_tag="ARC77_01285"
FT   CDS_pept        complement(246606..247205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01285"
FT                   /product="transcriptional repressor NemR"
FT                   /note="represses nemA which is involved in degradation of
FT                   N-ethylmaleimide; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01285"
FT                   /db_xref="GOA:C3T8L9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8L9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008784668.1"
FT                   /protein_id="AMW40971.1"
FT                   /translation="MNKHTEHDTREHLLATGEQLCLQRGFTGMGLSELLKTAEVPKGSF
FT                   YHYFRSKEAFGVAMLERHYATYHQRLTELLQSGEGNYRDRILAYYQQTLNQFCQHGTIS
FT                   GCLTVKLSAEVCDLSEDMRSAMDKGARGVIALLSQALENGRDSHCLTFCGEPLQQAQVL
FT                   YALWLGANLQAKISRNYEPLENALAHVKTIIATPAV"
FT   gene            247308..247547
FT                   /locus_tag="ARC77_01290"
FT   CDS_pept        247308..247547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01290"
FT                   /product="oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01290"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:W8U0J4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000840481.1"
FT                   /protein_id="AMW40972.1"
FT                   /translation="MAEQLEFFPVQSPCRGICQSDERGFCRGCFRSRDERFNWNKMSDG
FT                   EKQEVLRLCRQRLMRKLRANKPASSDEPEQPSLF"
FT   gene            247596..248384
FT                   /locus_tag="ARC77_01295"
FT   CDS_pept        247596..248384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01295"
FT                   /product="oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01295"
FT                   /db_xref="GOA:C3SDI2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDI2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000250655.1"
FT                   /protein_id="AMW40973.1"
FT                   /translation="MVQRITIAPQGPEFSRFVMGYWRLMDWNMSARQLVSFIEEHLDLG
FT                   VTTVDHADIYGGYQCEAAFGEALKLAPHLRERMEIVSKCGIATTAREENVIGHYITDRD
FT                   HIIKSAEQSLINLATDHLDLLLIHRPDPLMDADEVADAFKHLHQSGKVRHFGVSNFTPA
FT                   QFALLQSRLPFTLATNQVEISPVHQPLLLDGTLDQLQQLRVRPMAWSCLGGGRLFNDDY
FT                   FQPLRDELAVVAEELNAGSIEQVVYAWVLRLPSQPLPIIG"
FT   gene            248573..249094
FT                   /locus_tag="ARC77_01300"
FT   CDS_pept        248573..249094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01300"
FT                   /product="superoxide dismutase"
FT                   /note="SodC; copper and zinc binding; converts superoxide
FT                   radicals to hydrogen peroxide and water; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01300"
FT                   /db_xref="GOA:B1AEH3"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:B1AEH3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016238049.1"
FT                   /protein_id="AMW45898.1"
FT                   /translation="MKRFSLAILALVVATGAQAASEKVEMNLVTSQGVGQSIGSVTITE
FT                   TDKGLEFSPDLKALPPGEHGFHIHAKGSCQPATKDGKASAAESAGGHLDPQNTGKHEGP
FT                   EGAGHLGDLPALVVNNDGKATDAVIAPRLKSLDEIKDKALMVHVGGDNMSDQPKPLGGG
FT                   GERYACGVIK"
FT   gene            complement(249095..251107)
FT                   /locus_tag="ARC77_01305"
FT   CDS_pept        complement(249095..251107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01305"
FT                   /product="fusaric acid resistance protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01305"
FT                   /db_xref="GOA:C3T8M8"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8M8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020233107.1"
FT                   /protein_id="AMW40974.1"
FT                   /translation="MNASSWSLRNLPWFRATLAQWRYALRNTIAMCLALTVAYYLNLDE
FT                   PYWAMTSAAVVSFPTVGGVISKSLGRIAGSLLGAIAALLLAGHTLNEPWFFLLSMSAWL
FT                   GFCTWACAHFTNNVAYAFQLAGYTAAIIAFPMVNITEASQLWDIAQARVCEVIVGILCG
FT                   GMMMMILPSSSDATALLTALKNMHARLLEHASLLWQPETTDAIRAAHEGVIGQILTMNL
FT                   LRIQAFWSHYRFRQQNARLNALLHQQLRMTSVISSLRRMLLNWPSPPGATREILEQLLT
FT                   ALASSQTDVYTVARIIAPLRPTNVADYRHVAFWQRLRYFCRLYLQSSQELHRLQSDVDD
FT                   HARLPRTSGLARHTDNAEAMWSGLRTFCTLMMIGAWSIASQWDAGANALTLAAISCVLY
FT                   SAVAAPFKSLSLLMRTLVLLSLFSFVVKFGLMVQISDLWQFLLFLFPLLATMQLLKLQM
FT                   PKFAALWGQLIVFMGSFIAVTNPPVYNFADFLNDNLAKIVGVALAWLAFAILRPGSDAR
FT                   KSRRHIRALRRDFVDQLSRHPTLSESEFESLTYHHVSQLSNSQDALARRWLLRWGIVLL
FT                   NCSHVVWQLRDWESRSDPLSRVRDNCISLLRGVMSERGVQQKSLAATLEELQRICDSLA
FT                   RHHQPAARELAAIVWRLYCSLSQLEQAPPQGTLAS"
FT   gene            complement(251107..251964)
FT                   /locus_tag="ARC77_01310"
FT   CDS_pept        complement(251107..251964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01310"
FT                   /product="efflux transporter periplasmic adaptor subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01310"
FT                   /db_xref="GOA:A0A0K3GEY0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3GEY0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005055619.1"
FT                   /protein_id="AMW40975.1"
FT                   /translation="MSIKTIKYFSTIIVAVVAVLAGWWLWNYYMQSPWTRDGKIRAEQV
FT                   SITPQVSGRIVELNIKDNQLVNAGDLLLTIDKTPFQIAELNAQAQLAKAQSDLAKANNE
FT                   ANRRRHLSQNFISAEELDTANLNVKAMQASVDAAQATLKQTQWQLAQTEIRAPVSGWVT
FT                   NLTTRIGDYADTGKPLFALVDSHSFYVIGYFEETKLRHIREGAPAQITLYSDNKTLQGH
FT                   VSSIGRAIYDQSVESDSSLIPDVKPNVPWVRLAQRVPVRFALDKVPGDVTLVSGTTCSI
FT                   AVGQ"
FT   gene            complement(251967..252203)
FT                   /locus_tag="ARC77_01315"
FT   CDS_pept        complement(251967..252203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01315"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01315"
FT                   /db_xref="GOA:C3T8N7"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8N7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000670995.1"
FT                   /protein_id="AMW40976.1"
FT                   /translation="MKFMLNATGLPLQDLVFGASVYFPPFFKAFAFGFVIWLVVHRLLR
FT                   GWIYAGDIWHPLLMDLSLFAICVCLALAILIAW"
FT   gene            252404..252838
FT                   /locus_tag="ARC77_01320"
FT   CDS_pept        252404..252838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01320"
FT                   /product="transcriptional regulator SlyA"
FT                   /note="Transcription regulator that can both activate or
FT                   repress expression; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01320"
FT                   /db_xref="GOA:W8TEC6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023071"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:W8TEC6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000445640.1"
FT                   /protein_id="AMW45899.1"
FT                   /translation="MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPP
FT                   DQSQIQLAKAIGIEQPSLVRTLDQLEEKGLISRQTCASDRRAKRIKLTEKAEPLISEME
FT                   AVINKTRAEILHGISAEELEQLITLIAKLEHNIIELQAKG"
FT   gene            complement(252885..253352)
FT                   /locus_tag="ARC77_01325"
FT   CDS_pept        complement(252885..253352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01325"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01325"
FT                   /db_xref="GOA:C3T8P7"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8P7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014169789.1"
FT                   /protein_id="AMW40977.1"
FT                   /translation="MIKRVLVVSMVGLSLVGCVNNDTLSGDVYTASEAKQVQNVSYGTI
FT                   VNVRPVQIQGGDDSNVIGAIGGAVLGGFLGNTVGGGTGRSLATAAGAVAGGVAGQGVQS
FT                   AMNKTQGVELEIRKDDGNTIMVVQKQGNTRFSPGQRVVLASNGSQVTVSPR"
FT   gene            253625..254734
FT                   /gene="anmK"
FT                   /locus_tag="ARC77_01330"
FT   CDS_pept        253625..254734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="anmK"
FT                   /locus_tag="ARC77_01330"
FT                   /product="anhydro-N-acetylmuramic acid kinase"
FT                   /note="catalyzes hydrolysis of 1,6-anhydro bond of
FT                   anyhydro-N-acetylmuramic acid (anhMurNAc) and
FT                   phosphorylates anhMurNAc to produce
FT                   N-acetyl-muramate-6-phosphate; involved in murein
FT                   recycling; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01330"
FT                   /db_xref="GOA:C3T8Q3"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8Q3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005127175.1"
FT                   /protein_id="AMW40978.1"
FT                   /translation="MKSGRFIGVMSGTSLDGVDVVLATIDEHRVAQLASLSWPIPVSLK
FT                   QAVLDICQGQQLTLSQFGQLDTQLGRLFADAVKALLKEQNLQARDIVAIGCHGQTVWHE
FT                   PTGVAPHTLQIGDNNQIVARTGITVVGDFRRRDIALGGQGAPLVPAFHHALLAHPTERR
FT                   MVLNIGGIANLSLLIPGQPVGGYDTGPGNMLMDAWIWRQAGKPYDKDAEWARAGKVILP
FT                   LLQNMLSDPYFSQPAPKSTGREYFNYGWLERHLRHFPGVDPRDVQATLAELTAVTISEQ
FT                   VLLSGGCERLMVCGGGSRNPLLMARLAALLPGTEVTTTDAVGISGDDMEALAFAWLAWR
FT                   TLAGLPGNLPSVTGASQETVLGAIFPANS"
FT   gene            254832..255161
FT                   /locus_tag="ARC77_01335"
FT   CDS_pept        254832..255161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01335"
FT                   /product="lysozyme inhibitor"
FT                   /note="MliC; membrane-bound lysozyme inhibitor of c-type
FT                   lysozyme; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01335"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTH7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P28224.2"
FT                   /protein_id="AMW40979.1"
FT                   /translation="MTMKKLLIIILPVLLSGCSAFNQLVERMQTDTLEYQCDEKPLTVK
FT                   LNNPRQEVSFVYDNQLLHLKQGLSASGARYSDGIYVFWSKGEEATVYKRDRIVLNNCQL
FT                   QNPQR"
FT   gene            255220..255876
FT                   /locus_tag="ARC77_01340"
FT   CDS_pept        255220..255876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01340"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /note="catalyzes the formation of pyridoxal 5'-phosphate
FT                   from pyridoxamine 5'-phosphate; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01340"
FT                   /db_xref="GOA:C3T8R2"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8R2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005127173.1"
FT                   /protein_id="AMW40980.1"
FT                   /translation="MSDNDELQQIAHLRREYTKGGLRRRDLPADPLTLFERWLSQACEA
FT                   KLADPTAMVVATVDEHGQPYQRIVLLKHYDEKGMVFYTNLGSRKAHQIENNPRVSLLFP
FT                   WHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGSWVSKQSSRISARGILESKFLEL
FT                   KQKFQQGEVPLPSFWGGFRVSLEQIEFWQGGEHRLHDRFLYQRENDAWKIDRLAP"
FT   gene            256005..257279
FT                   /locus_tag="ARC77_01345"
FT   CDS_pept        256005..257279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01345"
FT                   /product="tyrosine--tRNA ligase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01345"
FT                   /db_xref="GOA:J7R1G7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:J7R1G7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005127172.1"
FT                   /protein_id="AMW40981.1"
FT                   /translation="MASSNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTAD
FT                   SLHLGHLVPLLCLKRFQQAGHKPVALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKI
FT                   RKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTFLRDIGKHFSVNQMINKEAVKQRLNR
FT                   EDQGISFTEFSYNLLQGYDFACLNKQYGVVLQIGGSDQWGNITSGIDLTRRLHQNQVFG
FT                   LTVPLITKADGTKFGKTEGGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSIE
FT                   EINALEEEDKNSGKAPRAQYVLAEQVTRLVHGEEGLQAAKRITECLFSGSLSALSEADF
FT                   EQLAQDGVPMVEMEKGADLMQALVDSELQPSRGQARKTIASNAITINGEKQSDPEYFFK
FT                   EEDRLFGRFTLLRRGKKNYCLICWK"
FT   gene            257341..258201
FT                   /locus_tag="ARC77_01350"
FT   CDS_pept        257341..258201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01350"
FT                   /product="pyridoxal kinase"
FT                   /note="catalyzes the formation of pyridoxal 5'-phosphate
FT                   from pyridoxal; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01350"
FT                   /db_xref="GOA:A0A074Q957"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR023685"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A074Q957"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002907739.1"
FT                   /protein_id="AMW40982.1"
FT                   /translation="MKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQ
FT                   YGKWTGCVMPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANP
FT                   QAKYFCDPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCEHPVNNVEEA
FT                   VLAARELIAQGPQIVLVKHLARAGYSRDRFEMLLVTADEAWHISRPLVDFGMRQPVGVG
FT                   DVTSGLLLVKLLQGATLQEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIAKPEHYF
FT                   SATKL"
FT   gene            complement(258245..258850)
FT                   /locus_tag="ARC77_01355"
FT   CDS_pept        complement(258245..258850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01355"
FT                   /product="glutathione S-transferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01355"
FT                   /db_xref="GOA:C3T8S7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8S7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016247254.1"
FT                   /protein_id="AMW40983.1"
FT                   /translation="MKLFYKPGACSLASHITLRESGKDFTLVSVDLMKKRLENGDDYFA
FT                   VNPKGQVPALLLDDGTLLTEGVAIMQYLADSVPDRQLLAPVNSISRYKTIEWLNYIATE
FT                   LHKGFTPLFRPDTPEEYKPTVRAQLEKKLQYVNEALKDEHWICGQRFTIADAYLFTVLR
FT                   WAYAVKLNLEGLEHIAAFMQRMAERPEVQDALSAEGLK"
FT   gene            complement(258956..260458)
FT                   /gene="tppB"
FT                   /locus_tag="ARC77_01360"
FT   CDS_pept        complement(258956..260458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tppB"
FT                   /locus_tag="ARC77_01360"
FT                   /product="peptide ABC transporter permease"
FT                   /note="mutations in this gene confer resistance to the
FT                   toxic peptide alafosfalin in Salmonella typhimurium; member
FT                   of proton-dependent oligopeptide transport (POT) system
FT                   family; in Escherichia coli this gene is regulated by OmpR
FT                   although not via osmoregulation; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01360"
FT                   /db_xref="GOA:C3T8T4"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023517"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8T4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003843542.1"
FT                   /protein_id="AMW40984.1"
FT                   /translation="MSTANQKPTESVSLNAFKQPKAFYLIFSIELWERFGYYGLQGIMA
FT                   VYLVKQLGMSEADSITLFSSFSALVYGLVAIGGWLGDKVLGTKRVIMLGAIVLAIGYAL
FT                   VAWSGHDAGIVYMGMAAIAVGNGLFKANPSSLLSTCYEKNDPRLDGAFTMYYMSVNIGS
FT                   FFSMIATPWLAAKYGWSVAFALSVVGLLITIVNFAFCQRWVKQNGSKPDFEPINYRNLL
FT                   LTIIGVVALIAIATWLLHNQEVARMALGVVAFGIVVIFGKEAFAMKGAARRKMIVAFIL
FT                   MLEAIIFFVLYSQMPTSLNFFAIRNVEHTILGLAVEPEQYQALNPFWIIIGSPILAAIY
FT                   NKMGDTLPMPTKFAIGMVMCSGAFLILPLGAKFASDAGIVSVSWLVASYGLQSIGELMI
FT                   SGLGLAMVAQLVPQRLMGFIMGSWFLTTAGANLIGGYVAGMMAVPDNVTDPLMSLEVYG
FT                   RVFLQIGVATAVIAVLMLLTAPKLHRMTQDDAADKAAKAAVA"
FT   gene            complement(260741..260941)
FT                   /locus_tag="ARC77_01365"
FT   CDS_pept        complement(260741..260941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01365"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UJB6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001197983.1"
FT                   /protein_id="AMW40985.1"
FT                   /translation="MQVNCFFNSEIFYSLVIKITMLWQCKNIARIRLKSFKFTHATNID
FT                   LQNITLAIFKKLDYLTRKNAK"
FT   gene            complement(261069..261704)
FT                   /locus_tag="ARC77_01370"
FT   CDS_pept        complement(261069..261704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01370"
FT                   /product="endonuclease III"
FT                   /note="DNA-(apurinic or apyrimidinic site) lyase; has
FT                   apurinic or apyrimidinic endonuclease activity and DNA
FT                   N-glycosylase activity; removed damaged DNA at cytosines,
FT                   thymines and guanines; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01370"
FT                   /db_xref="GOA:C3T8T8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8T8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019076735.1"
FT                   /protein_id="AMW40986.1"
FT                   /translation="MNKAKRLEILTRLRENNPHPTTELNFSSPFELLIAVLLSAQATDV
FT                   SVNKATAKLYPVANTPAAMLELGVEGVKTYIKTIGLYNSKAENIIKTCRILLEQHNSEV
FT                   PEDRAALEALPGVGRKTANVVLNTAFGWPTIAVDTHIFRVCNRTQFAPGKNVEQVEEKL
FT                   LKVVPAEFKVDCHHWLILHGRYTCIARKPRCGSCIIEDLCEYKEKVDI"
FT   gene            complement(261704..262399)
FT                   /locus_tag="ARC77_01375"
FT   CDS_pept        complement(261704..262399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01375"
FT                   /product="electron transport complex subunit RsxE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01375"
FT                   /db_xref="GOA:C3T8U2"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8U2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001405247.1"
FT                   /protein_id="AMW40987.1"
FT                   /translation="MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLAT
FT                   TLVLTLTNLTISTLRHWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPL
FT                   IVTNCIVVGRAEAFAAKKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADA
FT                   LLGSWAKVLRVEIFHTDSPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRTEAAAERA
FT                   LPNGETGNV"
FT   gene            complement(262403..263023)
FT                   /locus_tag="ARC77_01380"
FT   CDS_pept        complement(262403..263023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01380"
FT                   /product="electron transport complex subunit RsxG"
FT                   /note="part of membrane-bound complex hought to be involved
FT                   in electron transport to nitrogen; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01380"
FT                   /db_xref="GOA:C3T8U7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8U7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005121203.1"
FT                   /protein_id="AMW40988.1"
FT                   /translation="MLKTIRKHGITLALFAAGSTGLTAAINQMTKTTIAEQASLQQKAL
FT                   FDQVLPAERYNNALAQSCYLVTAPELGKGEHRVYIAKQDDKPVAAVLEATAPDGYSGAI
FT                   QLLVGADFNGTVLGTRVTEHHETPGLGDKIELRLSDWITHFAGKKISGADDAHWAVKKD
FT                   GGNFDQFTGATITPRAVVNAVKRAGLYAQTLPEQLSQLPACGE"
FT   gene            complement(263027..264085)
FT                   /gene="rnfD"
FT                   /locus_tag="ARC77_01385"
FT   CDS_pept        complement(263027..264085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfD"
FT                   /locus_tag="ARC77_01385"
FT                   /product="electron transport complex subunit RsxD"
FT                   /note="RnfD; RsxD; required for nitrogen fixation in
FT                   Rhodobacter capsulatus; part of a membrane-bound complex
FT                   thought to be involved in electron transport to
FT                   nitrogenase; in Escherichia coli this gene is part of a
FT                   cluster controlling SoxR-mediated induction of the SoxS
FT                   transcription factor in the absence of oxidizing agents;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01385"
FT                   /db_xref="GOA:C3T8V2"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8V2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:B7M0I7.1"
FT                   /protein_id="AMW40989.1"
FT                   /translation="MVFRIASSPYTHNQRQTSRIMLLVLLAAVPGIAAQLWFFGWGTLV
FT                   QILLASVSALLAEALVLKLRKQSVAATLKDNSALLTGLLLAVSIPPLAPWWMVVLGTVF
FT                   AVIIAKQLYGGLGQNPFNPAMIGYVVLLISFPVQMTSWLPPHEIAVNIPGFIDAIQVIF
FT                   SGHTASGGDMNTLRLGIDGISQATPLDTFKTSVRAGHSVEQIMQYPIYSGILAGAGWQW
FT                   VNLAWLAGGVWLLWQKAIRWHIPLSFLVTLALCATLGWLFSPETLAAPQIHLLSGATML
FT                   GAFFILTDPVTASTTNRGRLIFGALAGLLVWLIRSFGGYPDGVAFAVLLANITVPLIDY
FT                   YTRPRVYGHRKG"
FT   gene            complement(264086..266404)
FT                   /locus_tag="ARC77_01390"
FT   CDS_pept        complement(264086..266404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01390"
FT                   /product="electron transport complex subunit RsxC"
FT                   /note="part of membrane-bound complex thought to be
FT                   involved in electron transport to nitrogen; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01390"
FT                   /db_xref="GOA:A0A143DWB8"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWB8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000915802.1"
FT                   /protein_id="AMW40990.1"
FT                   /translation="MLKLFSAFRKNKIWDFNGGIHPPEMKTQSNGTPLRQVPLAQRFVI
FT                   PLKQHIGAEGELCVSVGDKVLRGQPLTRGRGKMLPVHAPTSGTVTAIAPHSTAHPSALA
FT                   ELSVIIDADGEDCWIPRDGWADYRSRRREELIERIHQFGVAGLGGAGFPTGVKLQGGGD
FT                   KIETLIINAAECEPYITADDRLMQDCAAQVVEGIRILAHILQPREILIGIEDNKPQAIS
FT                   MLRAVLADSHDISMRVIPTKYPSGGAKQLTYILTGKQVPHGGRSSDIGVLMQNVGTAYA
FT                   VKRAVIDGEPITERVVTLTGEAIARPGNVWARLGTPVRHLLNDAGFCPSADQMVIMGGP
FT                   LMGFTLPWLDVPVVKITNCLLAPSANELGEPQEEQSCIRCSACADACPADLLPQQLYWF
FT                   SKGQQHDKATTHNIADCIECGACAWVCPSNIPLVQYFRQEKAEIAAIRQEEKRAAEAKA
FT                   RFEARQARLEREKAARLERHKSAAVQPAAKDKDAIAAALARVKEKQAQATQPIVIKAGE
FT                   RPDNSAIIAAREARKAQARAKQAELQQTNDAATVTDPRKTAVEAAIARAKARKLEQQQA
FT                   NAEPEQQVDPRKAAVEAAIARAKARKLEQQQANAEPEQQVDPRKAAVEAAIARAKARKL
FT                   EQQQANAEPEEPVDPRKAAVEAAIARAKARKLEQQQANAEPEEPVDPRKAAVEAAITRA
FT                   KARKLEQQQANAEPEEQVDPRKAAVAAAIARAKARKLEQQQANAEPEEQVDPRKAAVAA
FT                   AIARVQAKKAVQQKVVNED"
FT   gene            complement(266397..266975)
FT                   /locus_tag="ARC77_01395"
FT   CDS_pept        complement(266397..266975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01395"
FT                   /product="electron transport complex subunit RsxB"
FT                   /note="part of membrane-bound complex thought to be
FT                   involved in electron transport to nitrogen; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01395"
FT                   /db_xref="GOA:C3T8V7"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR016463"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8V7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016240810.1"
FT                   /protein_id="AMW40991.1"
FT                   /translation="MNAIWIAVAAVSLLGLAFGAILGYASRRFAVEDDPVVEKIDEILP
FT                   QSQCGQCGYPGCRPYAEAISCNGEKINRCAPGGEAVMLKIAELLNVEPQPLDGEAQELT
FT                   PARMVAVIDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCIS
FT                   LQPVAETPDSWKWDLNTIPVRIIPVEHHA"
FT   gene            complement(266975..267556)
FT                   /locus_tag="ARC77_01400"
FT   CDS_pept        complement(266975..267556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01400"
FT                   /product="electron transport complex subunit RsxA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01400"
FT                   /db_xref="GOA:C3T8W2"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8W2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017456621.1"
FT                   /protein_id="AMW40992.1"
FT                   /translation="MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLAT
FT                   TFVMTLASICAWLIDTWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLG
FT                   IFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADV
FT                   PAPFRGNAIALITAGLMSLAFMGFSGLVKL"
FT   gene            complement(267633..268073)
FT                   /locus_tag="ARC77_01405"
FT   CDS_pept        complement(267633..268073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01405"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01405"
FT                   /db_xref="GOA:A0A066R2N7"
FT                   /db_xref="InterPro:IPR019690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066R2N7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000214176.1"
FT                   /protein_id="AMW40993.1"
FT                   /translation="MTTTTPQRIGGWLLGPLAWLLVALLSTTLALLLYTAALSSPQTFQ
FT                   TLGAQALTTQILWGVSFITAIAMWYYTLWLTIAFFKRRRCVPKHYIIWLLISVLLAVKA
FT                   FAFSPVEDGIAVRQLLFTLLATALIVPYFKRSSRVKATFVNP"
FT   gene            complement(268159..268374)
FT                   /locus_tag="ARC77_01410"
FT   CDS_pept        complement(268159..268374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01410"
FT                   /product="oriC-binding nucleoid-associated protein"
FT                   /note="YdgT; in E. coli, when complexed with H-NS or StpA
FT                   binds a 26 base-pair DNA sequence of oriC; seems to play a
FT                   role in optimizing the activity of oriC; non-essential; Hha
FT                   protein paralog; in an hha mutant background, cnu is
FT                   overexpressed and can compensate hha-induced phenotypes;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01410"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8X2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012905703.1"
FT                   /protein_id="AMW40994.1"
FT                   /translation="MTVQDYLLKFRKISSLESLEKLYDHLNYTLTDDQELINMYRAADH
FT                   RRAELVSGGRLFDLGQVPKSVWHYVQ"
FT   gene            complement(268647..268772)
FT                   /locus_tag="ARC77_01415"
FT   CDS_pept        complement(268647..268772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01415"
FT                   /product="beta-lactam resistance protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01415"
FT                   /db_xref="GOA:C3T8X7"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8X7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001708800.1"
FT                   /protein_id="AMW40995.1"
FT                   /translation="MNRLIELTGWIVLVVSVILLGVASHIDNYQPPEQSTTVQHK"
FT   gene            269015..270055
FT                   /locus_tag="ARC77_01420"
FT   CDS_pept        269015..270055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01420"
FT                   /product="oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01420"
FT                   /db_xref="GOA:A0A143DTW5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTW5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001282547.1"
FT                   /protein_id="AMW40996.1"
FT                   /translation="MSDNIRVGLIGYGYASKTFHAPLIAGTPGLELAVISSSDETKVKA
FT                   DWPTVTVVSEPKHLFNDPNIDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPFTVTLSQA
FT                   RELDALAKSLGRVLSVFHNRRWDSDFLTLKGLLAEGVLGEVAYFESHFDRFRPQVRDRW
FT                   REQGGPGSGIWYDLAPHLLDQAIMLFGLPVSMTVDLAQLRPGAQSTDYFHAILSYPQRR
FT                   VILHGTMLAAAESARYIVHGSRGSYVKYGLDPQEERLKNGERLPQEDWGYDMRDGVLTR
FT                   VEGEERVEETLLTVPGNYPAYYAAIRDALNGDGENPVPASQAIQVMELIELGIESAKHR
FT                   ATLCLA"
FT   gene            complement(270091..271092)
FT                   /locus_tag="ARC77_01425"
FT   CDS_pept        complement(270091..271092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01425"
FT                   /product="adenosine deaminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01425"
FT                   /db_xref="GOA:C3T8Y7"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8Y7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000567480.1"
FT                   /protein_id="AMW40997.1"
FT                   /translation="MIDTTLPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIP
FT                   HVQVIANEPDLVSFLTKLDWGVKVLASLDACRRVAFENIEDAARNGLHYVELRFSPGYM
FT                   AMAHQLPVAGVVEAVIDGVREGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQI
FT                   TALDLAGDELGFPGSLFLSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHG
FT                   VKAIEDRALMDFLAEQQIGIESCLTSNIQTSTVAELAAHPLKTFLEHGIRASINTDDPG
FT                   VQGVDIIHEYTVAAPAAGLSREQIRQAQINGLEMAFLNAEEKRALREKVAAK"
FT   gene            complement(271196..272368)
FT                   /locus_tag="ARC77_01430"
FT   CDS_pept        complement(271196..272368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01430"
FT                   /product="transcriptional regulator"
FT                   /note="catalyzes the formation of homocysteine and pyruvate
FT                   from cystathionine; also acts a a negative regulator for
FT                   the mal regulon but interacting with the transcriptional
FT                   activator MalT; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01430"
FT                   /db_xref="GOA:C3T8Z2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:C3T8Z2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000459371.1"
FT                   /protein_id="AMW40998.1"
FT                   /translation="MFDFSKVVDRHGTWCTQWDYVADRFGTADLLPFTISDMDFATAPC
FT                   IIEALNQRLMHGVFGYSRWKNDEFLAAIAHWFSTQHYTAIDPQSVVYGPSVIYMVSELI
FT                   RQWSETGEGVVIHTPAYDAFYKAIEGNQRTVMPVALEKQADGWFCDMGKLEAVLAKPEC
FT                   KIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHIPWSNVAR
FT                   GDWALLTSGSKSFNIPALTGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALTAHIAAY
FT                   QQGAPWLDALRVYLKDNLTYIADKMNAAFPELNWQIPQSTYLAWLDLRPLNIDDNALQK
FT                   ALIEQEKVAIMPGYTYGEEGRGFVRLNAGCPRSKLEKGVAGLINAIRAVR"
FT   gene            complement(272378..273970)
FT                   /locus_tag="ARC77_01435"
FT   CDS_pept        complement(272378..273970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01435"
FT                   /product="PTS sugar transporter subunit IIBC"
FT                   /note="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system (PTS); catalyzes the
FT                   phosphorylation of maltose and glucose concomitant with
FT                   their translocation across the cell membrane; component IIB
FT                   catalyzes the phosphorylation of the sugar molecule; IIC
FT                   forms the translocation channel and contains the substrate
FT                   specific binding site; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01435"
FT                   /db_xref="GOA:A0A143DTJ9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004719"
FT                   /db_xref="InterPro:IPR011301"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTJ9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001532804.1"
FT                   /protein_id="AMW40999.1"
FT                   /translation="MTAKTAPKVTLWEFFQQLGKTFMLPVALLSFCGIMLGIGSSLSSH
FT                   DVITLLPVLGNPVLQAIFTWMSKIGSFAFSFLPVMFCIAIPLGLARENKGVAAFAGFVG
FT                   YAVMNLAVNFWLTNKGILPTTDAAVLKANNIQSILGIQSIDTGILGAVIAGIIVWMLHE
FT                   RFHNIRLPDALAFFGGTRFVPIISSLVMGLVGLVIPLVWPIFAMGISGLGHMINSAGDF
FT                   GPMLFGTGERLLLPFGLHHILVALIRFTDAGGTQEVCGQTVSGALTIFQAQLSCPTTHG
FT                   FSESATRFLSQGKMPAFLGGLPGAALAMYHCARPENRHKIKGLLISGLIACVVGGTTEP
FT                   LEFLFLFVAPVLYVIHALLTGLGFTVMSVLGITIGNTDGNIIDFVVFGILHGLSTKWYM
FT                   VPVVVAIWFVVYYVIFRFAITRFNLKTPGRDSEVASSIEKAVAGAPGKSGYNVPAILEA
FT                   LGGADNIVSLDNCITRLRLSVKDMSLVNVQALKDNRAIGVVQLNQHNLQVVIGPQVQSV
FT                   KDEMAGLMHTVQA"
FT   gene            274145..275173
FT                   /locus_tag="ARC77_01440"
FT   CDS_pept        274145..275173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01440"
FT                   /product="transcriptional regulator"
FT                   /note="regulates malXY which are involved in
FT                   maltose-glucose transport; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01440"
FT                   /db_xref="GOA:C3T904"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3T904"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000179489.1"
FT                   /protein_id="AMW41000.1"
FT                   /translation="MATAKKITIHDVALAAGVSVSTVSLVLSGKGRISTATGERVNAAI
FT                   EELGFVRNRQASALRGGQSGVIGLIVRDLSAPFYAELTAGLTEALEAQGRMVFLVHGGK
FT                   DGEQLAQRFSLLLNQGVDGVVIAGAAGSSDDLRRMAEEKAIPVIFASRASYLDDVDTVR
FT                   PDNMQAAQLLTEHLIRNGHQRIAWLGGQSSSLTRAERVGGYCATLLKFGLPFHSDWVLE
FT                   CTSSQKQAAEAITALLRHNPTISAVVCYNETIAMGAWFGLLKAGRQSGESGVDRYFEQQ
FT                   VSLAAFTDATPTTLDDIPVTWASTPARELGTTLADRMMQKITHEETHSRNLIIPARLIA
FT                   AK"
FT   gene            275285..276052
FT                   /locus_tag="ARC77_01445"
FT   CDS_pept        275285..276052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01445"
FT                   /product="7-alpha-hydroxysteroid dehydrogenase"
FT                   /note="Acts on the hydroxyl group at position 7 of the
FT                   steroid frame; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01445"
FT                   /db_xref="GOA:C3T907"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3T907"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000483370.1"
FT                   /protein_id="AMW41001.1"
FT                   /translation="MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINA
FT                   DAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF
FT                   DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSK
FT                   AAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQ
FT                   DIANAALFLCSPAASWVSGQILTVSGGGVQELN"
FT   gene            276281..276871
FT                   /locus_tag="ARC77_01450"
FT   CDS_pept        276281..276871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01450"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01450"
FT                   /db_xref="GOA:C3T912"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C3T912"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000969092.1"
FT                   /protein_id="AMW41002.1"
FT                   /translation="MMDNMQTEAQPTRTRILNAAREIFSENGFHSASMKAICKSCAISP
FT                   GTLYHHFISKEALIQAIILQDQERALARFREPIEGIHFVDYMVESIVSLTHEAFGQRAL
FT                   VVEIMAEGMRNPQVAAMLKNKHMTITEFVAQRMRDAQQKGEISPDINTAMTSRLLLDLT
FT                   YGVLADIEAEDLAREASFAQGLRAMIGGILTAS"
FT   gene            277262..279075
FT                   /pseudo
FT                   /locus_tag="ARC77_01455"
FT   CDS_pept        277262..279075
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01455"
FT                   /product="beta-glucuronidase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000945881.1"
FT   gene            279072..280445
FT                   /locus_tag="ARC77_01460"
FT   CDS_pept        279072..280445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01460"
FT                   /product="glucuronide transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01460"
FT                   /db_xref="GOA:C3T917"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR018043"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:C3T917"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016236686.1"
FT                   /protein_id="AMW41003.1"
FT                   /translation="MNQQLSWRTIVGYSLGDIANNFAFAMGALFLLSYYTDVAGVGAAA
FT                   AGTMLLLVRVFDAFADVFAGRVVDSVNTRWGKFRPFLLFGTAPLMIFSVLVFWVPTDWS
FT                   HGSKVVYAYLTYMGLGLCYSLVNIPYGSLATAMTQQPQSRARLGAARGIAASLTFVCLA
FT                   FLIGPSIKNSSPEEMVSVYHFWTIVLAIAGMVLYFICFKSTRENVVRIVAQPSLKISLQ
FT                   TLKRNRPLFMLCIGALCVLISTFAVSASSLFYVRYVLNDTGLFTVLVLVQNLVGTVASA
FT                   PLVPGMVARIGKKNTFLIGALLGTCGYLLFFWVSVWSLPVALVALAIASIGQGVTMTVM
FT                   WALEADTVEYGEYLTGVRIEGLTYSLFSFTRKCGQAIGGSIPAFILGLSGYIANQVQTP
FT                   EVIMGIRTSIALVPCGFMLLAFVIIWFYPLTDKKFKEIVVEIDNRKKVQQQLISDITN"
FT   gene            280484..281748
FT                   /pseudo
FT                   /locus_tag="ARC77_01465"
FT   CDS_pept        280484..281748
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01465"
FT                   /product="glucuronide uptake porin UidC"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001226994.1"
FT   gene            complement(281793..283301)
FT                   /locus_tag="ARC77_01470"
FT   CDS_pept        complement(281793..283301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01470"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01470"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:C3T934"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P77804.1"
FT                   /protein_id="AMW41004.1"
FT                   /translation="MNKSLVAVGVIVALGVVWTGGAWYTGKKIETHLEDMVAQANAQLK
FT                   LTAPESNLEVSYQNYHRGVFSSQLQLLVKPIAGKENPWIKSGQSVIFNESVDHGPFPLA
FT                   QLKKLNLIPSMASIQTTLVNNEVSKPLFDMAKGETPFEINSRIGYSGDSSSDISLKPLN
FT                   YEQKDEKVAFSGGEFQLNADRDGKAISLSGEAQSGRIDAVNEYNQKVQLTFNNLKTDGS
FT                   STLASFGERVGNQKLSLVKMTISVEGKELALLEGMEISGKSDLVNDGKTINSQLDYSLN
FT                   SLKVQNQDLGSGKLTLKVGQIDGEAWHQFSQQYNAQTQALLAQPEIANNPELYQEKVTE
FT                   AFFSALPLMLKGDPVITIAPLSWKNSQGESALNLSLFLKDPATTKEAPQTLAQEVDRSV
FT                   KSLDAKLTIPVDMATELMTQVAKLEGYQEDQAKKLAKQQVEGASAMGQMFRLTTLQDNT
FT                   ITTSLQYTNGQITLNGQKMPLEDFVGMFAMPALNVPVVPAIPQQ"
FT   gene            complement(283402..284577)
FT                   /locus_tag="ARC77_01475"
FT   CDS_pept        complement(283402..284577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01475"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /note="catalyzes the formation of of fructose 6-phosphate
FT                   from mannose 6-phosphate; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01475"
FT                   /db_xref="GOA:C3T938"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="InterPro:IPR018050"
FT                   /db_xref="UniProtKB/TrEMBL:C3T938"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001170689.1"
FT                   /protein_id="AMW41005.1"
FT                   /translation="MQKLINSVQNYAWGSKTALTELYGMENPSSQPMAELWMGAHPKSS
FT                   SRVQNAAGDIVSLRDVIESDKSTLLGEAVAKRFGELPFLFKVLCAAQPLSIQVHPNKHK
FT                   SEIGFAKENAAGIPMDAAERNYKDPNHKPELVFALTPFLAMNAFREFSEIVSLLQPVAG
FT                   AHPAIAHFLQQPDAERLSELFASLLNMQGEEKSRALAILKSALDSQQGEPWQTIRLISE
FT                   FYPDDSGLFSPLLLNVVKLNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKY
FT                   IDIPELVANVKFEAKPANQLLTQPVKQGAELDFPIPVDDFAFSLHDLSDKETTISQQSA
FT                   AILFCVEGDATLWKGSQQLQLKPGESAFIAANESPVTVKGHGRLARVYNKL"
FT   gene            284776..286422
FT                   /locus_tag="ARC77_01480"
FT   CDS_pept        284776..286422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01480"
FT                   /product="fumarate hydratase"
FT                   /note="catalyzes the formation of malate from fumerate;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01480"
FT                   /db_xref="GOA:A0A143DTX5"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTX5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000066594.1"
FT                   /protein_id="AMW41006.1"
FT                   /translation="MSNKPFHYQAPFPLKKDDTEYYLLTSEHVSLSEFEGQEILKVAPE
FT                   ALTLLARQAFHDASFMLRPAHQQQVADILRDPEASENDKYVALQFLRNSDIAAKGVLPT
FT                   CQDTGTAIIVGKKGQRVWTGGGDEAALACGVYNTYIEDNLRYSQNAPLDMYKEVNTGTN
FT                   LPAQIDLYAVDGDEYKFLCIAKGGGSANKTYLYQETKALLTPGKLKNYLVEKMRTLGTA
FT                   ACPPYHIAFVIGGTSAETNLKTVKLASAKYYDELPTEGNEHGQAFRDVELEKELLIEAQ
FT                   NLGLGAQFGGKYFAHDIRVIRLPRHGASCPVGMGVSCSADRNIKAKINRQGIWIEKLEH
FT                   NPGKYIPEELRKAGEGEAVRVDLNRPMKEILAQLSQYPVSTRLSLNGTIIVGRDIAHAK
FT                   LKERMDNGEGLPQYIKDHPIYYAGPAKTPEGYASGSLGPTTAGRMDSYVDQLQALGGSM
FT                   IMLAKGNRSQQVTDACKKHGGFYLGSIGGPAAVLAQGSIKSLECVEYPELGMEAIWKIE
FT                   VEDFPAFILVDDKGNDFFQQIQLTQCTRCVK"
FT   gene            286565..287968
FT                   /gene="fumC"
FT                   /locus_tag="ARC77_01485"
FT   CDS_pept        286565..287968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="ARC77_01485"
FT                   /product="class II fumarate hydratase"
FT                   /note="class II family (does not require metal); tetrameric
FT                   enzyme; fumarase C; reversibly converts (S)-malate to
FT                   fumarate and water; functions in the TCA cycle; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01485"
FT                   /db_xref="GOA:C3T947"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C3T947"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001099106.1"
FT                   /protein_id="AMW41007.1"
FT                   /translation="MNTVRSEKDSMGAIDVPADKLWGAQTQRSLEHFRISTEKMPTSLI
FT                   HALALTKRAAAKVNEDLGLLSEEKASAIRQAADEVLAGQHDDEFPLAIWQTGSGTQSNM
FT                   NMNEVLANRASELLGGVRGMERKVHPNDDVNKSQSSNDVFPTAMHVAALLALRKQLIPQ
FT                   LKTLTQTLSEKSRAFADIVKIGRTHLQDATPLTLGQEISGWVAMLEHNLKHIEYSLPHV
FT                   AELALGGTAVGTGLNTHPEYARRVADELAVITCAPFVTAPNKFEALATCDALVQAHGAL
FT                   KGLAASLMKIANDVRWLASGPRCGIGEISIPENEPGSSIMPGKVNPTQCEALTMLCCQV
FT                   MGNDVAINMGGASGNFELNVFRPMVIHNFLQSVRLLADGMESFNKHCAVGIEPNRERIN
FT                   QLLNESLMLVTALNTHIGYDKAAEIAKKAHKEGLTLKAAALALGYLSEAEFDSWVRPEQ
FT                   MVGSMKAGR"
FT   gene            complement(287965..288894)
FT                   /locus_tag="ARC77_01490"
FT   CDS_pept        complement(287965..288894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01490"
FT                   /product="DNA replication terminus site-binding protein"
FT                   /note="binds to DNA replication terminator sequences to
FT                   prevent passage of replication forks; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01490"
FT                   /db_xref="GOA:C3T952"
FT                   /db_xref="InterPro:IPR008865"
FT                   /db_xref="InterPro:IPR036381"
FT                   /db_xref="InterPro:IPR036384"
FT                   /db_xref="UniProtKB/TrEMBL:C3T952"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020233464.1"
FT                   /protein_id="AMW41008.1"
FT                   /translation="MARYDLVDRLNTTFRQMEQELAAFAAHLEQHKLLVARVFSLPEVK
FT                   KEDEHNPLNRIEVKQHLGNDAQSQALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDN
FT                   LSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLH
FT                   DPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAAL
FT                   PQNAKLKIKRPVKVQPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYD
FT                   ADNVQHRYKPQAQPLRLIIPRLHLYVAD"
FT   gene            complement(288970..290271)
FT                   /locus_tag="ARC77_01495"
FT   CDS_pept        complement(288970..290271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01495"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01495"
FT                   /db_xref="GOA:C3T957"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3T957"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001733030.1"
FT                   /protein_id="AMW41009.1"
FT                   /translation="MKKLFIQFYLLLFVCFLVMSLLVGLVYKFTAERAGKQSLDDLMNS
FT                   SLYLMRSELREIPPHDWGKTLKEMDLNLSFDLRVEPLSKYHLDDISMHRLRGGEIVALD
FT                   DQYTFLQRIPRSHYVLAVGPVPYLYYLHQMRLLDIALIAFIAISLAFPVFIWMRPHWQD
FT                   MLKLEAAAQRFGDGHLNERIHFDEGSSFERLGIAFNQMADNINALIASKKQLIDGIAHE
FT                   LRTPLVRLRYRLEMSDNLSAAESQALNRDISQLEALIEELLTYARLDRPQNELHLSEPD
FT                   LPLWLSTHLADIQAVTPDKTVRIKTLMQGHYAALDMRLMERVLDNLLNNALRYCHSTVE
FT                   TSLLLSGNRATLIVEDDGPGIAPENREHIFEPFVRLDPSRDRSTGGCGLGLAIVHSIAL
FT                   AMGGTVNCDTSELGGARFSFSWPLWHNIPQFTSA"
FT   gene            complement(290275..290994)
FT                   /locus_tag="ARC77_01500"
FT   CDS_pept        complement(290275..290994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01500"
FT                   /product="two-component system response regulator RstA"
FT                   /note="response regulator in two-component regulatory
FT                   system with RstB; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01500"
FT                   /db_xref="GOA:A0A152UJI2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UJI2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001092493.1"
FT                   /protein_id="AMW41010.1"
FT                   /translation="MNTIVFVEDDAEVGSLIAAYLAKHDIQVTVEPRGDQAEETILREN
FT                   PDLVLLDIMLPGKDGMTICRDLRAKWSGPIVLLTSLDSDMNHILALEMGACDYILKTTP
FT                   PAVLLARLRLHLRQNEQATLTKGLQETSLTPYKALHFGTLTIDPINRVVTLANTEISLS
FT                   TADFELLWELATHAGQIMDRDALLKNLRGVSYDGLDRSVDVAISRLRKKLLDNAAEPYR
FT                   IKTVRNKGYLFAPHAWE"
FT   gene            291123..291458
FT                   /locus_tag="ARC77_01505"
FT   CDS_pept        291123..291458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01505"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01505"
FT                   /db_xref="GOA:C3T967"
FT                   /db_xref="InterPro:IPR009707"
FT                   /db_xref="UniProtKB/TrEMBL:C3T967"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000524814.1"
FT                   /protein_id="AMW41011.1"
FT                   /translation="MGLVIKAALGALVVLLIGVLAKTKNYYIAGLIPLFPTFALIAHYI
FT                   VASERGIEALRATIIFSMWSIIPYFVYLVSLWYFTGMMRLPAAFVGSVACWGISAWVLI
FT                   ICWIKLH"
FT   gene            complement(291455..292177)
FT                   /locus_tag="ARC77_01510"
FT   CDS_pept        complement(291455..292177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01510"
FT                   /product="dihydromonapterin reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01510"
FT                   /db_xref="GOA:C3T972"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3T972"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000521193.1"
FT                   /protein_id="AMW41012.1"
FT                   /translation="MGKTQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAID
FT                   GLINAGAQCIQADFSTNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLADVLAC
FT                   MMQIHVNTPYLLNHALERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMT
FT                   RSFARKLAPEVKVNSIAPSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLT
FT                   SCFVTGRSFPLDGGRHLR"
FT   gene            complement(292214..293596)
FT                   /locus_tag="ARC77_01515"
FT   CDS_pept        complement(292214..293596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01515"
FT                   /product="arginine:ornithine antiporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01515"
FT                   /db_xref="GOA:C3T977"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:C3T977"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000412388.1"
FT                   /protein_id="AMW41013.1"
FT                   /translation="MEKKLGLSALTALVLSSMLGAGVFSLPQNMAAVASPAALLIGWGI
FT                   TGAGILLLAFAMLILTRIRPELDGGIFTYAREGFGELIGFCSAWGYWLCAVIANVSYLV
FT                   IVFSALSFFTDTPELRLFGDGNTWQSIVGASALLWIVHFLILRGVQTAASINLVATLAK
FT                   LLPLGLFVVLAMMMFKLDIFKLDFTGLALGVPVWEQVKNTMLITLWVFIGVEGAVVVSA
FT                   RARNKRDVGKATLLAVLSALGVYLLVTLLSLGVVARPELAEIRNPSMAGLMVEMMGPWG
FT                   EIIIAAGLIVSVCGAYLSWTIMAAEVPFLAATHKAFPRIFARQNAQAAPSASLWLTNIC
FT                   VQICLVLIWLTGSDYNTLLTIASEMILVPYFLVGAFLLKIATRPLHKAVGVGACIYGLW
FT                   LLYASGPMHLLLSVVLYAPGLLVFLYARKTHTHDNVLNRQEMVLIGMLLIASVPATWML
FT                   VG"
FT   gene            complement(293782..294726)
FT                   /locus_tag="ARC77_01520"
FT   CDS_pept        complement(293782..294726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01520"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01520"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025539"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C3T982"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000769320.1"
FT                   /protein_id="AMW41014.1"
FT                   /translation="MKLKNTLLASALLSATAFSVNAATELTPEQAAAVKPFDRVVVTGR
FT                   FNAIGEAVKAVSRRADKEGAASFYVVDTSDFGNSGNWRVVADLYKADAEKAEETSNRVI
FT                   NGVVELPKDQAVLIEPFDTVTVQGFYRSQPEVNDAITKAAKAKGAYSFYIVRQIDANQG
FT                   GNQRITAFIYKKDAKKRIVQSPDVIPADSEAGRAALAAGGEAAKKVEIPGVATTASPSS
FT                   EVGRFFETQSSKGGRYTVTLPDGTKVEELNKATAAMMVPFDSIKFSGNYGNMTEVSYQV
FT                   AKRAAKKGAKYYHITRQWQERGNNLTVSADLYK"
FT   gene            295250..296782
FT                   /gene="pntA"
FT                   /locus_tag="ARC77_01525"
FT   CDS_pept        295250..296782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntA"
FT                   /locus_tag="ARC77_01525"
FT                   /product="NAD(P) transhydrogenase subunit alpha"
FT                   /note="forms a tetramer composed of 2 alpha subunits and 2
FT                   beta subunits in the inner membrane; involved in catalyzing
FT                   transfer of hydride ion equivalents between NAD and NADP;
FT                   stereospecific (AB-specific); functions as a proton pump by
FT                   translocating protons from cytoplasm to periplasm; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01525"
FT                   /db_xref="GOA:C3T988"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3T988"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016150210.1"
FT                   /protein_id="AMW41015.1"
FT                   /translation="MRIGIPRERLTNEPRVAATPKTVEQLLKLGFTVAVESGAGQLASF
FT                   DDKAFVQAGAEIVEGNSVWQSEIILKVNAPLDDEIALLNPGTTLVSFIWPAQNPELMQK
FT                   LAERNVTVMAMDSVPRISRAQSLDALSSMANIAGYRAIVEAAHEFGCFFTGQITAAGKV
FT                   PPAKVMVIGAGVAGLAAIGAANSLGAIVRAFDTRPEVKEQVQSMGAEFLELDFKEEAGS
FT                   GDGYAKVMSDAFIKAEMELFAAQAKEVDIIVTTALIPGKPAPKLITREMVDSMKAGSVI
FT                   VDLAAQNGGNCEYTVPGEIFTTENGVKVIGYTDLPGRLPTQSSQLYGTNLVNLLKLLCK
FT                   EKNGNITVDFDDVVIRGVTVIRAGEITWPAPPIQVSAQPQVAQKAAPEVKTEEKCACSP
FT                   WRKYALMALAIILFGWLASVAPKEFLGHFTVFALACVVGYYVVWNVSHALHTPLMSVTN
FT                   AISGIIVVGALLQIGQGGWVSFLSFIAVLIASINIFGGFTVTQRMLKMFRKN"
FT   gene            296793..298181
FT                   /gene="pntB"
FT                   /locus_tag="ARC77_01530"
FT   CDS_pept        296793..298181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="ARC77_01530"
FT                   /product="NAD(P) transhydrogenase subunit beta"
FT                   /note="catalyzes reversible transfer of hydride ion
FT                   equivalent between NAD and NADP; membrane-bound proton pump
FT                   that translocates protons from cytosolic to periplasmic
FT                   side of the inner membrane; forms a tetramer composed of
FT                   two alpha and 2 beta subunits; AB-stereospecific enzyme;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01530"
FT                   /db_xref="GOA:C3T992"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:C3T992"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000014033.1"
FT                   /protein_id="AMW41016.1"
FT                   /translation="MSGGLVTAAYIVAAILFIFSLAGLSKHETSRQGNNFGIAGMAIAL
FT                   IATIFGPDTGNVGWILLAMVIGGAIGIRLAKKVEMTEMPELVAILHSFVGLAAVLVGFN
FT                   SYLHHDAGMAPILVNIHLTEVFLGIFIGAVTFTGSVVAFGKLCGKISSKPLMLPNRHKM
FT                   NLAALVVSFLLLIVFVRTDSVGLQVLALLIMTAIALVFGWHLVASIGGADMPVVVSMLN
FT                   SYSGWAAAAAGFMLSNDLLIVTGALVGSSGAILSYIMCKAMNRSFISVIAGGFGTDGSS
FT                   TGDDQEVGEHREITAEETAELLKNSHSVIITPGYGMAVAQAQYPVAEITEKLRARGINV
FT                   RFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDTVLVIGANDTVNPAAQ
FT                   DDPKSPIAGMPVLEVWKAQNVIVFKRSMNTGYAGVQNPLFFKENTHMLFGDAKASVDAI
FT                   LKAL"
FT   gene            complement(298206..299240)
FT                   /gene="tqsA"
FT                   /locus_tag="ARC77_01535"
FT   CDS_pept        complement(298206..299240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tqsA"
FT                   /locus_tag="ARC77_01535"
FT                   /product="pheromone autoinducer 2 transporter"
FT                   /note="transport of quorum-sensing signal; mutations in
FT                   this gene alters the transport of the quorum-sensing signal
FT                   autoinducer 2 (AI-2) which affects expression of a large
FT                   number of genes; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01535"
FT                   /db_xref="GOA:C3T998"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C3T998"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001357322.1"
FT                   /protein_id="AMW41017.1"
FT                   /translation="MAKPLITLNGLKIVIMLGMLVIILCGIRFAAEIIVPFILALFIAV
FT                   ILNPLVQHMVRWRVPRVLAVSILMTIIVMAMVLLLAYLGSTLNELTRTLPQYRNSIMTP
FT                   LQALEPLLQRVGIDVSVDQLAHYIDPNAAMTLLTNLLTQLSNAMSSIFLLLLTVLFMLL
FT                   EVPQLPGKFKQMMARPVEGMAAIQRAIDSVSHYLVLKTAISIITGLVAWAMLAALDVRF
FT                   AFVWGLLAFALNYIPNIGSVLAAIPPIAQVLVFNGFYEALLVLAGYLLINLVFGNILEP
FT                   RIMGRGLGLSTLVVFLSLIFWGWLLGPVGMLLSVPLTIIVKIALEQTAGGQSIAVLLSD
FT                   LNKE"
FT   gene            299652..300017
FT                   /locus_tag="ARC77_01540"
FT   CDS_pept        299652..300017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01540"
FT                   /product="multidrug transporter"
FT                   /note="with MdtI is involved in resistance to deoxycholate,
FT                   nalidixic acid, fosfomycin, and SDS; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01540"
FT                   /db_xref="GOA:C3T9A2"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR023740"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9A2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000276141.1"
FT                   /protein_id="AMW41018.1"
FT                   /translation="MYIYWILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSY
FT                   IFLSFAVKKIALGVAYALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKS
FT                   GTRKARKPELEVNHGAV"
FT   gene            300004..300333
FT                   /locus_tag="ARC77_01545"
FT   CDS_pept        300004..300333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01545"
FT                   /product="multidrug transporter"
FT                   /note="with MdtJ is involved in resistance to deoxycholate,
FT                   nalidixic acid, fosfomycin, and SDS; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01545"
FT                   /db_xref="GOA:C3T9A7"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR023737"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9A7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020801673.1"
FT                   /protein_id="AMW41019.1"
FT                   /translation="MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAV
FT                   LAAFSALSQAVKGIDLSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMI
FT                   MVKLA"
FT   gene            complement(300372..301193)
FT                   /locus_tag="ARC77_01550"
FT   CDS_pept        complement(300372..301193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01550"
FT                   /product="serine protease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01550"
FT                   /db_xref="GOA:A0A024L2F3"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024L2F3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001692781.1"
FT                   /protein_id="AMW41020.1"
FT                   /translation="MRTTIAVVLGAISLTSAFVFADKPDVAKSANDEVSTLFFGHDDRV
FT                   PVNDTTQSPWDAVGQLETASGNLCTATLIAPNLALTAGHCLLTPPKGKADKAVALRFVS
FT                   NKGLWRYDIHDIEGRVDPTLGKRLKADGDGWIVPPAAAPWDFGLIVLRNPPSGITPLPL
FT                   FEGDKAALTAALKAAGRKVTQAGYPEDHLDTLYSHQNCEVTGWAQTSVMSHQCDTLPGD
FT                   SGSPLMLHTDDGWQLIGVQSSAPAAKDRWRADNRAISVTGFRDKLDQLSQK"
FT   gene            complement(301293..301376)
FT                   /locus_tag="ARC77_01555"
FT   CDS_pept        complement(301293..301376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01555"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01555"
FT                   /db_xref="GOA:A0A024L397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024L397"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000233090.1"
FT                   /protein_id="AMW41021.1"
FT                   /translation="MVGRYRFEFILIILILCALIAARFYLS"
FT   gene            complement(301469..301804)
FT                   /locus_tag="ARC77_01560"
FT   CDS_pept        complement(301469..301804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01560"
FT                   /product="acid-shock protein"
FT                   /note="required for growth and survival under moderately
FT                   acid conditions; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01560"
FT                   /db_xref="GOA:C3T9B2"
FT                   /db_xref="InterPro:IPR023497"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9B2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000743943.1"
FT                   /protein_id="AMW41022.1"
FT                   /translation="MKKQIEGMTMKKVLALVVAAAMGLSSAAFAAETATTPAPTATTTK
FT                   AAPAKTTHHKKQHKAAPAQKAQAAKKHHKNTKAEQKAPEQKAQAAKKHAKKHSHQQPAK
FT                   PAAQPAA"
FT   gene            complement(302201..303454)
FT                   /locus_tag="ARC77_01565"
FT   CDS_pept        complement(302201..303454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01565"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01565"
FT                   /db_xref="GOA:C3T9B7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9B7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005121165.1"
FT                   /protein_id="AMW41023.1"
FT                   /translation="MSRTTTVDGAPASDTDKQSISQPNQFIKRGTPQFMRVTLALFSAG
FT                   LATFALLYCVQPILPVLSQEFGLTPANSSISLSISTAMLAIGLLFTGPLSDAIGRKPVM
FT                   VTALLLASICTLLSTMMTSWHGILIMRALIGLSLSGVAAVGMTYLSEEIHPSFVAFSMG
FT                   LYISGNSIGGMSGRLISGVFTDFFNWRIALAAIGCFALASALMFWKILPESRHFRPTSL
FT                   RPKSLFINFRLHWRDRGLPLLFAEGFLLMGSFVTLFNYIGYRLMLSPWHVSQAVVGLLS
FT                   LAYLTGTWSSPKAGTMTTRYGRGPVMLFSTGVMLFGLLMTLFSSLWLIFAGMLLFSAGF
FT                   FAAHSVASSWIGPRAKRAKGQASSLYLFSYYLGSSIAGTLGGVFWHNYGWNGVGAFIAL
FT                   MLVIALLVGTRLHRRLHA"
FT   gene            303561..304454
FT                   /locus_tag="ARC77_01570"
FT   CDS_pept        303561..304454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01570"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01570"
FT                   /db_xref="GOA:C3T9C2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9C2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001019532.1"
FT                   /protein_id="AMW41024.1"
FT                   /translation="MNIELRHLRYFVAVAEELHFGRAAARLNISQPPLSQQIQALEQQI
FT                   GARLLARTNRSVLLTAAGKQFLADSRQILSMVDDAAARAERLHQGEAGELRIGFTSSAP
FT                   FIRAVSDTLSLFRRDYPDVHLQTREMNTREQIAPLIEGTLDMGLLRNTALPETLEHAVI
FT                   VHEPLMAMIPHDHPLANNPNVTLAELAKEPFVFFDPHVGTGLYDDILGLMRRYHLTPVI
FT                   TQEVGEAMTIIGLVSAGLGVSILPASFKRVQLNEMRWVPIAEEDAVSEMWLVWPKHHEQ
FT                   SPAARNFRIHLLNALR"
FT   gene            304589..305809
FT                   /locus_tag="ARC77_01575"
FT   CDS_pept        304589..305809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01575"
FT                   /product="transcriptional regulator"
FT                   /note="mlc, controls the expression of genes involved in
FT                   the phosphotransferase and phosphoenolpyruvate systems,
FT                   regulates genes involved in the uptake of sugars; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01575"
FT                   /db_xref="GOA:C3T9C7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9C7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P50456.2"
FT                   /protein_id="AMW41025.1"
FT                   /translation="MVAENQPGHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPA
FT                   SITKIVREMLEAHLVQELEIKEAGNRGRPAVGLVVETEAWHYLSLRISRGEIFLALRDL
FT                   SSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGI
FT                   VHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDH
FT                   NVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLR
FT                   LNQSMSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILI
FT                   GSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSL
FT                   LIRLLQG"
FT   gene            305934..306629
FT                   /locus_tag="ARC77_01580"
FT   CDS_pept        305934..306629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01580"
FT                   /product="dethiobiotin synthase"
FT                   /note="DTB synthetase; dethiobiotin synthase; involved in
FT                   production of dethiobiotin from ATP and
FT                   7,8-diaminononanoate and carbon dioxide; contains
FT                   magnesium; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01580"
FT                   /db_xref="GOA:W8T1C3"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:W8T1C3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000919213.1"
FT                   /protein_id="AMW41026.1"
FT                   /translation="MLKRFFITGTDTSVGKTVVSRALLQALASQGKTVAGYKPVAKGSK
FT                   ETPEGLRNKDALVLQSVSTIELPYEAVNPIALSEEESSVAHSCPINYTLISNGLANLTE
FT                   KVDHVVVEGTGGWRSLMNDLRPLSEWVVQEQLPVLMVVGIQEGCINHALLTAQAIANDG
FT                   LPLIGWVANRINPGLAHYAEIIDVLGKKLPAPLIGELPYLPRAEQRELGQYIRLAMLRS
FT                   VLAVDRVTV"
FT   gene            complement(306582..307838)
FT                   /locus_tag="ARC77_01585"
FT   CDS_pept        complement(306582..307838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01585"
FT                   /product="voltage-gated ClC-type chloride channel ClcB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01585"
FT                   /db_xref="GOA:A0A0C2E802"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023790"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0C2E802"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001678882.1"
FT                   /protein_id="AMW41027.1"
FT                   /translation="MFRRLLIATVVGILAAFAVAGFRHAMLLLEWLFLNNDSGSLVNAA
FT                   TNLSPWRRLLTPALGGLAAGLLLMGWQKFTQQRPHAPTDYMEALQTDGQFDYAASLVKS
FT                   LASLLVVTSGSAIGREGAMILLAALAASCFAQRFTPRQEWKLWIACGAAAGMAAAYRAP
FT                   LAGSLFIAEVLFGTMMLASLGPVIISAVVALLVSNLINHSDALLYSVQLSVTVQARDYA
FT                   LIISTGVLAGLCGPLLLTLMNACHRGFVSLKLAPPWQLALGGLIVGLLSLFTPAVWGNG
FT                   YSTVQSFLTAPPLLMIIAGIFLCKLCAVLASSGSGAPGGVFTPTLFIGLAIGMLYGRSL
FT                   GLWFPDGEEITLLLGLTGMATLLAATTHAPIMSTLMICEMTGEYQLLPGLLIACVIASV
FT                   ISRTLHRDSIYRQHTAQHS"
FT   gene            complement(308032..308646)
FT                   /locus_tag="ARC77_01590"
FT   CDS_pept        complement(308032..308646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01590"
FT                   /product="twin-argninine leader-binding protein DmsD"
FT                   /note="binds to the twin-arginine signal peptides of
FT                   certain proteins, including dimethylsulfoxide reductase and
FT                   trimethylamine N-oxide reductase that are translocated to
FT                   the cytoplasmic membrane; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01590"
FT                   /db_xref="GOA:W8TEJ5"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR026269"
FT                   /db_xref="InterPro:IPR028611"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:W8TEJ5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005121159.1"
FT                   /protein_id="AMW41028.1"
FT                   /translation="MTHFSQQDNFSVAARVLGALFYYAPESAEAAPLVAVLTSDGWETQ
FT                   WPLPEASLAPLVTAFQTQCEETHAQAWQRLFVGPWALPSPPWGSVWLDRESVLFGDSTL
FT                   ALRQWMREKGIQFEMKQNEPEDHFGSLLLMAAWLAENGRQTECEELLAWHLFPWSTRFL
FT                   DVFIEKAEHPFYRALGELARLTLAQWQSQLLIPVAVKPLFR"
FT   gene            complement(308689..309543)
FT                   /locus_tag="ARC77_01595"
FT   CDS_pept        complement(308689..309543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01595"
FT                   /product="dimethylsulfoxide reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01595"
FT                   /db_xref="GOA:C3T9E7"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9E7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016245348.1"
FT                   /protein_id="AMW41029.1"
FT                   /translation="MGNGWHEWPLVIFTVLGQCVVGALIVSGIGWFAAKTDADRQHIVR
FT                   GMFFLWLLMGIGFIASVMHLGSPLRAFNSLNRIGASGLSNEIAAGSIFFAVGGLWWLVA
FT                   VIGKMPQALGKLWLLVSMALGVIFVWMMTCVYQIDTVPTWHNGYTTLAFFVTVLLSGPI
FT                   LAAAILRAARVTFNTTPFAIISVLALIACAGVIVLQGLSLSSIHSSVQQASALVPDYAS
FT                   LQVWRVVLLCAGLGCWLCPLIRRREPHVAGLILGLILILGGEMIGRVLFYGLHMTVGMA
FT                   IAG"
FT   gene            complement(309545..310162)
FT                   /locus_tag="ARC77_01600"
FT   CDS_pept        complement(309545..310162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01600"
FT                   /product="dimethyl sulfoxide reductase subunit B"
FT                   /note="oxidoreductase, Fe-S subunit; terminal electron
FT                   transfer protein for the reduction of DMSO; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01600"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9F2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000213046.1"
FT                   /protein_id="AMW41030.1"
FT                   /translation="MTTQYGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGG
FT                   DWQEDNGVWHQNVFAYYLSISCNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRY
FT                   CHMACPYGAPQYNAEKGHMTKCDGCYSRVAEGKQPICVESCPLRALEFGPIEELRQKHG
FT                   TLAAVAPLPRAHFTKPNIVIKPNANSRPTGDTTGYLANPEEV"
FT   gene            complement(310173..312569)
FT                   /locus_tag="ARC77_01605"
FT   CDS_pept        complement(310173..312569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01605"
FT                   /product="dimethyl sulfoxide reductase subunit A"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01605"
FT                   /db_xref="GOA:A0A152UJL1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UJL1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001672876.1"
FT                   /protein_id="AMW45900.1"
FT                   /translation="MKAEISRRSLMKTSALGSLALASSAFTLPFSQMVRAAEAPVEEKA
FT                   VWSSCTVNCGSRCLLRLHVKDDTVYWVESDTTGDDVYGNHQVRACLRGRSIRRRMNHPD
FT                   RLKYPMKRVGKRGEGKFERISWDEALDTISDNLRRILKDYGNEAVHVLYGTGVDGGNIT
FT                   NSNVPYRLMNSCGGFLSRYGSYSTAQISAAMSYMFGANDGNSPDDIANTKLVVMFGNNP
FT                   AETRMSGGGVTYYVEQARERSNARMIVIDPRYNDTAAGREDEWLPIRPGTDGALACAIA
FT                   WVLISENMVDQPFLDKYCVGYDEKTLPANAPRNAHYKAYILGEGPDGIAKTPEWAAKIT
FT                   SIPAEKIIQLAREIGSAKPAYICQGWGPQRHSNGEQTSRAIAMLSVLTGNVGINGGNSG
FT                   VREGSWDLGVEWFPMLENPVKTQISVFTWTDAIDHGTEMTATRDGVRGKEKLDVPIKFL
FT                   WCYASNTLINQHGDINHTNEVLQDDSKCEMIVGIDHFMTASAKYCDILLPDLMPTEQED
FT                   LISHESAGNMGYVILAQPATSAKFERKPIYWMLSEVAKRLGPDVYQTFTEGRSQHEWIK
FT                   YLHAKTKERNPEMPDYEEMKTTGIFKKKCPEEHYVAFRAFREDPQANPLKTPSGKIEIY
FT                   SERLAKIADTWELKKDEIIHPLPAYTPGFDGWDDPLRKTYPLQLTGFHYKARTHSSYGN
FT                   IDVLQQACPQEVWINPIDAQARGIRHGDTVRVFNNNGEMLIAAKVTPRILPGVTAIGQG
FT                   AWLKADMFGDRVDHGGSINILTSHRPSPLAKGNPSHSNLVQIEKV"
FT   gene            complement(312657..315083)
FT                   /locus_tag="ARC77_01610"
FT   CDS_pept        complement(312657..315083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01610"
FT                   /product="dimethyl sulfoxide reductase subunit A"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01610"
FT                   /db_xref="GOA:C3T9F8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9F8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000041546.1"
FT                   /protein_id="AMW41031.1"
FT                   /translation="MSKNERMVGISRRTLVKSTAIGSLALAAGGFSLPFTLRSAAAAVQ
FT                   QASEQVVWGACSVNCGSRCALRLHVKDNEVAWVETDNTGSDEYGNHQVRACLRGRSIRR
FT                   RINHPDRLNYPMKRVGKRGEGKFERISWDEALDTIASSLKKTVEQYGNEAVYIQYSSGI
FT                   VGGNITRSSPSASAVKRLMNCYGGSLNQYGSYSTAQISCAMPYTYGSNDGNSTTDIENS
FT                   KLVVMFGNNPAETRMSGGGITYLLEKSREKSNAKMIVIDPRYTDTAAGREDEWLPIRPG
FT                   TDAALVAGIAWVLINENLVDQPFLDKYCVGYDEKTLPADAPKNGHYKAYILGEGDDKTA
FT                   KTPQWASQITGIPVDRIIKLAREIGTAKPAYICQGWGPQRQANGELTARAIAMLPILTG
FT                   NVGISGGNSGARESTYTITIERLPVLDNPVKTSISCFSWTDAIDHGPQMTAIRDGVRGK
FT                   DKLDVPIKFIWNYAGNTLVNQHSDINKTHEILQDESKCEMIVVIENFMTSSAKYADILL
FT                   PDLMTVEQEDIIPNDYAGNMGYLIFLQPVTSEKFERKPIYWILSEVAKRLGPDVYQKFT
FT                   EGRTQEQWLQHLYAKMLAKDPALPSYDELKKMGIYKRKDPNGHFVAYKAFRDDPEANPL
FT                   KTPSGKIEIYSSKLAEIARTWELEKDEVISPLPVYASTFEGWDSPERSTFPLQLFGFHY
FT                   KSRTHSTYGNIDVLKAACRQEVWINPIDAQKRGIANGDMVRVYNHRGEVRLPAKVTPRI
FT                   LPGVSAMGQGAWHEANMSGDKIDHGGCVNTLTTLRPSPLAKGNPQHTNLVEIEKI"
FT   gene            complement(315282..315587)
FT                   /locus_tag="ARC77_01615"
FT   CDS_pept        complement(315282..315587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01615"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01615"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K6CDM9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000778146.1"
FT                   /protein_id="AMW45901.1"
FT                   /translation="MKLSTCYAALLLALASPAVLAAPGSCERIQSDISQRIINNGVPES
FT                   SFTLSIVPNDQVDQPDSQVVGHCANDTHKILYTRTTSGNVSAPAQSTQDGAPAEPQ"
FT   gene            315659..316405
FT                   /locus_tag="ARC77_01620"
FT   CDS_pept        315659..316405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01620"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01620"
FT                   /db_xref="GOA:C3T9G7"
FT                   /db_xref="InterPro:IPR010646"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9G7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003832899.1"
FT                   /protein_id="AMW41032.1"
FT                   /translation="MIENHLYSLVTDVKYKLLPCLLAILLTGCDRTEVTLSFTPEMASF
FT                   SNEFDFDPLRGPVKDFTQTLMDEQGEVTKRVSGTLSEEGCFDSLELLDLENNTVVALVL
FT                   DANYYRDAETLEKRVRLQGKCQLAELPSAGVSWETDDNGFVIKASSKQMQMEYRYDDQG
FT                   YPLGKTTKSNDKTLSVSATPSTDPIKKLDYTAVTLLNNQRVGNVKQSCEYDSHANPVGC
FT                   QLIIVDEGVKPAVERVYTIKNTIDYY"
FT   gene            complement(316408..316968)
FT                   /locus_tag="ARC77_01625"
FT   CDS_pept        complement(316408..316968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01625"
FT                   /product="spermidine acetyltransferase"
FT                   /note="catalyzes the formation of N(1)- and
FT                   N(8)-acetylspermidine from spermidine; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01625"
FT                   /db_xref="GOA:C3T9H2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9H2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000199500.1"
FT                   /protein_id="AMW41033.1"
FT                   /translation="MPSAHSVKLRPLEREDLRYVHQLDNNASVMRYWFEEPYEAFVELS
FT                   DLYDKHIHDQSERRFVVECDGEKAGLVELVEINHVHRRAEFQIIISPEYQGKGLATRAA
FT                   KLAMDYGFTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAIRMC
FT                   IFQHQYLAEHKTPGQTLLKPTAQ"
FT   gene            complement(317003..317344)
FT                   /locus_tag="ARC77_01630"
FT   CDS_pept        complement(317003..317344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01630"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01630"
FT                   /db_xref="InterPro:IPR009700"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9H7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000705189.1"
FT                   /protein_id="AMW41034.1"
FT                   /translation="MKITLSKRIDLLAFLLPCALALSTTVHAETNKLVIESGDSAQSRQ
FT                   HAAMEKEQWNDTGNLRQKVNKRTEKEWDKADAAFDNRDKCEQSANINAYWEPNTLRCLD
FT                   RRTGRVITP"
FT   gene            317479..317805
FT                   /locus_tag="ARC77_01635"
FT   CDS_pept        317479..317805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01635"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01635"
FT                   /db_xref="GOA:C3T9I3"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9I3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A4WA77.1"
FT                   /protein_id="AMW41035.1"
FT                   /translation="MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALF
FT                   VWLLTLHPAASGRVYAAYGGVYVCTALMWLRVVDGVKLTLYDWTGPLIALCGMLIIVVG
FT                   WGRT"
FT   gene            complement(318077..318759)
FT                   /pseudo
FT                   /locus_tag="ARC77_01640"
FT   CDS_pept        complement(318077..318759)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01640"
FT                   /product="integrase"
FT                   /note="frameshifted; incomplete; partial on complete
FT                   genome; missing stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000876982.1"
FT   gene            complement(318794..319045)
FT                   /locus_tag="ARC77_01645"
FT   CDS_pept        complement(318794..319045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01645"
FT                   /product="DNA-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01645"
FT                   /db_xref="GOA:E2QME2"
FT                   /db_xref="InterPro:IPR009634"
FT                   /db_xref="InterPro:IPR038146"
FT                   /db_xref="UniProtKB/TrEMBL:E2QME2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000005552.1"
FT                   /protein_id="AMW41036.1"
FT                   /translation="MSEVIMIVSPGKWVSEEQLIALKGIKKGTLKKAREKSFMEGREYK
FT                   HVAHDGMPWDNSPCFYNLEEIDRWIERQASARPRRHLT"
FT   gene            complement(319118..321589)
FT                   /locus_tag="ARC77_01650"
FT   CDS_pept        complement(319118..321589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01650"
FT                   /product="exonuclease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01650"
FT                   /db_xref="GOA:A0A143DU72"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR033390"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DU72"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000048512.1"
FT                   /protein_id="AMW41037.1"
FT                   /translation="MSKVFICAAIPDEQAIKEEGAVAVATAIEAGDERRARAKFHWQFL
FT                   EHYPAAQDCAYKFLVCEDKPGIPRPALDSWDAEYMQENRWDEASASFVPVETESDPMNV
FT                   TFDNLAPEVQNAVMVKFDTCENITVDMVISAQELLQEDMATFDGHIVEALMKMPEVNAM
FT                   YPELKLHAIGWVKHKCKPGAKWPEIQAEMRIWKKRREGERKEAGKYTSVVDLARARANQ
FT                   QHTENSTGKINPVIAAIHREYKQTWKTLDDELAYALWPGDVDAGNIDGSIHRWAKNEVI
FT                   DNGREDWKRISASMRKQPDALRYDRQTIFGLVRERPIDIHKDPVALNKYITEYLTTKGV
FT                   FEDEGTNQSATDTLSSPVPETDAVETAIPDNEKTECKVEVEPSVEREGPFYFLFTDKDG
FT                   EKYGRANKLSGLDKALAAGATEITKEEYFARKNGTYTGLPQNANTAQNSEQPEPVKVTA
FT                   DEVKKIMQAANISQPDAEELLAVSRGEFVEGISDPNDPKWVKGIQTRDSVNQNQQETEQ
FT                   NDQKAEQNSPNTQQNEPETKQPEPVVQQEPEKICTACGQSGGGNCPDCGAVMGDATYQE
FT                   IFDGENQPEVQENDPEEMEGTAHQHKENTGGNQHHASDSETGEASDPLIKANGHHNLTS
FT                   TSRAGIHLMIDLETMGKNPDAPIISIGAIFFDPQTGDMGPEFSKTIDLDTAGGVIDRDT
FT                   MKWWLKQSREAQSAIMTDEIPLDDALLQLREFIDENSGEFFVHVWGNGANFDNTILRRS
FT                   YERQGSPCPWRYYNDRDVRTIVELGKAIDFDARTAIPFEGERHNALDDARYQAKYVSAI
FT                   WQKLIPSQADS"
FT   gene            complement(321682..321873)
FT                   /locus_tag="ARC77_01655"
FT   CDS_pept        complement(321682..321873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01655"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01655"
FT                   /db_xref="InterPro:IPR009954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066R639"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001083277.1"
FT                   /protein_id="AMW41038.1"
FT                   /translation="MNTAFALVLTVFLVSGEPVDIAVSVHRTMQECVTAATEQKIPGNC
FT                   YPVDKVIHQDNNEIPAGL"
FT   gene            complement(321870..322058)
FT                   /locus_tag="ARC77_01660"
FT   CDS_pept        complement(321870..322058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01660"
FT                   /product="cell division inhibition protein DicB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01660"
FT                   /db_xref="GOA:A0A066R2I6"
FT                   /db_xref="InterPro:IPR008022"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066R2I6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000449192.1"
FT                   /protein_id="AMW41039.1"
FT                   /translation="METLLPNVNTSEGCFEIGVTISNPVFTEDAINKRKHERELLNKIC
FT                   ILSMLARLRPIQKGCWQ"
FT   gene            complement(322627..322845)
FT                   /locus_tag="ARC77_01665"
FT   CDS_pept        complement(322627..322845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01665"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01665"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H0MYP8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P21418.1"
FT                   /protein_id="AMW41040.1"
FT                   /translation="MQKREPVIIAPDYTDDELYEWMHQKINAAQDLKWANEARAKQAEN
FT                   LSALEQDITNLEKAAALSIARMITYPR"
FT   gene            complement(322917..323216)
FT                   /locus_tag="ARC77_01670"
FT   CDS_pept        complement(322917..323216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01670"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DV84"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001240336.1"
FT                   /protein_id="AMW41041.1"
FT                   /translation="MALYIDISAIAGQVRVIRAVTKRYAPLLQKVSGECTEDIVNDFVI
FT                   ELRGLIFSYKVTTIFADGSRETVRALRLKGCVKDFATTFWARKLDCIHNQFPLE"
FT   gene            complement(323200..323364)
FT                   /locus_tag="ARC77_01675"
FT   CDS_pept        complement(323200..323364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01675"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DW84"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303512.1"
FT                   /protein_id="AMW41042.1"
FT                   /translation="MNMTAGFNFNNYAAVFCSATPALRGNRGFLSGRSQTSEWKASRDR
FT                   QRSSNGALY"
FT   gene            complement(323568..323846)
FT                   /locus_tag="ARC77_01680"
FT   CDS_pept        complement(323568..323846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01680"
FT                   /product="plasmid stabilization protein ParE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01680"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="PDB:5CZE"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7C2L1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303511.1"
FT                   /protein_id="AMW41043.1"
FT                   /translation="MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSE
FT                   HPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVEVVNVIHARRQFP"
FT   gene            complement(323848..324039)
FT                   /locus_tag="ARC77_01685"
FT   CDS_pept        complement(323848..324039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01685"
FT                   /product="stability determinant"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B0Z142"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001463348.1"
FT                   /protein_id="AMW45902.1"
FT                   /translation="MNRALSPMVSEFETIEQENSYNEWLRAKVATSLADPRPAIPHDEV
FT                   ERRMAERFAKMRKERSKQ"
FT   gene            complement(324060..324278)
FT                   /locus_tag="ARC77_01690"
FT   CDS_pept        complement(324060..324278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01690"
FT                   /product="repressor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A153E712"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001383282.1"
FT                   /protein_id="AMW45903.1"
FT                   /translation="MPEGYLDAEYAEQPGGSPPHAGLTSNQLELLQIFSAFPEDEQRQI
FT                   ISELKQKKESMEDLIARWIAAQKCRRA"
FT   gene            324529..324831
FT                   /locus_tag="ARC77_01695"
FT   CDS_pept        324529..324831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01695"
FT                   /product="XRE family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01695"
FT                   /db_xref="GOA:A0A0D7C0Q9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR031856"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7C0Q9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000172738.1"
FT                   /protein_id="AMW41044.1"
FT                   /translation="MTLKEFIKSLRVGDAKKFAARLGVSPSYLSQMASGRTAISPTRAL
FT                   MIESATEGQVSRAELRPHDWELIWPEYASGIRLGQTHVVHAEGDCSACLSDGVDS"
FT   gene            324828..325253
FT                   /locus_tag="ARC77_01700"
FT   CDS_pept        324828..325253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01700"
FT                   /product="Rha family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01700"
FT                   /db_xref="InterPro:IPR009364"
FT                   /db_xref="InterPro:IPR037042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZWM6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000693843.1"
FT                   /protein_id="AMW41045.1"
FT                   /translation="MKIKHEHIRMAMNVWAHPDGEKVPAAKITKAYFELGMTFPELYDD
FT                   SHPEALARNTQKIFRWLDKDTPDAVEKMQALLPAIEKAMPPLLVARMRSHSSEYYREIV
FT                   ERRDRLVKDVDDFVASAVVLYDQMNRGGPAGNAVVMH"
FT   gene            325351..326238
FT                   /locus_tag="ARC77_01705"
FT   CDS_pept        325351..326238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01705"
FT                   /product="DNA-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01705"
FT                   /db_xref="GOA:A0A143DU29"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DU29"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000113054.1"
FT                   /protein_id="AMW41046.1"
FT                   /translation="MARLADYSNDEGVSWPAIETIRRQIGARSESTVKSAIAELAKEGW
FT                   LTKEERKVGGRNVSNIYRLNVEKLEAAAAAARESYKPKRKISPAKNDPLTVDPSNIAPS
FT                   TVDPSNFDGSTVDNKLPIRGAMIDPDPSVLKPDPSDKRSSCPDASQPDPQTAEQNFLTR
FT                   HPDAVVFSAKKRQWGSQEDLVCAQWIWGRIVSLYEQAASDDGEITRPKEPNWTAWANDV
FT                   RTMRMLDGRTHRQICEMFGRLQRDSFWVKNIMSPAKLREKWDELVIRLGRSPAQRCVNH
FT                   ISEPDTEIPPGFRG"
FT   gene            326245..326985
FT                   /locus_tag="ARC77_01710"
FT   CDS_pept        326245..326985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01710"
FT                   /product="DNA replication protein DnaC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01710"
FT                   /db_xref="GOA:A0A0D6ZUQ6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZUQ6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000789012.1"
FT                   /protein_id="AMW41047.1"
FT                   /translation="MKNIAAVGVLERIRRLAPQGAVPPYRTVEEWREWQLAEGRKRSEE
FT                   INRLNHQVRVEKILNRAGIQPLHRKCSFGNYRVQNDGQRHALSQAKSIADELMTGCTNF
FT                   VFSGKPGTGKNHLAAAIGNRLMAKGRSVIIVTVSDVMSVLHDGYDNGQSGEKFLQELCG
FT                   VDLLVLDEIGMQRDTRNEQVTLNQIVDRRTASMRSVGMLTNLNHAAMSTLLGDRVMDRM
FT                   TMNGGRWVNFNWESWRSNVGRQGM"
FT   gene            327011..327190
FT                   /locus_tag="ARC77_01715"
FT   CDS_pept        327011..327190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01715"
FT                   /product="DNA-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01715"
FT                   /db_xref="GOA:A0A152VQF4"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152VQF4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001304151.1"
FT                   /protein_id="AMW45904.1"
FT                   /translation="METVLHALKAMGKANSVELAARLDISREEVLNELWELKKMALLIK
FT                   RVTPGFWLSKVKPG"
FT   gene            327112..327780
FT                   /locus_tag="ARC77_01720"
FT   CDS_pept        327112..327780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01720"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01720"
FT                   /db_xref="InterPro:IPR012432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTP9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001366933.1"
FT                   /protein_id="AMW41048.1"
FT                   /translation="MGTQKNGVVDKTGHTWFLAVEGEAGVTEGQALQPEAPDVVTEEVA
FT                   PKVTADMMVEFIGQDGAKTCEELAGKFGVSTRKVASTLAVVTATGRLARVNQNGKFRYC
FT                   MSGGNLPADPKAAPVTKNDGKAFPQPAGAALPVREAATQEEIKTETVADIVQPLPSFTE
FT                   TQADELIFPSLRRANLALRRAKSDVQKWERVCAALRELNKHRDIVRQITDSSRRVVSEK
FT                   "
FT   gene            327796..328155
FT                   /locus_tag="ARC77_01725"
FT   CDS_pept        327796..328155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01725"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01725"
FT                   /db_xref="InterPro:IPR010382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTR5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001118159.1"
FT                   /protein_id="AMW41049.1"
FT                   /translation="MAKPFTHEQREELKARIIGLVRKNERMTISQLERATGAGWHSVRR
FT                   CLVDVLACGDLYMPGKYGVFTSEQVYRVWRKAAEKATDQTLIRKLPDGEIRRYDRQQNI
FT                   ICGEPPRFSWRVFYL"
FT   gene            complement(328158..329045)
FT                   /locus_tag="ARC77_01730"
FT   CDS_pept        complement(328158..329045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01730"
FT                   /product="transposase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01730"
FT                   /db_xref="GOA:A0A143E886"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143E886"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001302073.1"
FT                   /protein_id="AMW41050.1"
FT                   /translation="MPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   RDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTVSRKAVSAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFSGCIVGWR
FT                   VSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTERLKEAKLLASTGSTGD
FT                   SYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHIPPAEAE
FT                   KAYYASIRNDDLAA"
FT   gene            complement(329045..329371)
FT                   /locus_tag="ARC77_01735"
FT   CDS_pept        complement(329045..329371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01735"
FT                   /product="transposase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01735"
FT                   /db_xref="GOA:C1J8U1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1J8U1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P0A1V2.1"
FT                   /protein_id="AMW41051.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   gene            329562..330146
FT                   /locus_tag="ARC77_01740"
FT   CDS_pept        329562..330146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01740"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01740"
FT                   /db_xref="InterPro:IPR007539"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DW90"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000206792.1"
FT                   /protein_id="AMW41052.1"
FT                   /translation="MTTFTKEQLISHVSENVKAMKFAVKQTAFKNSLEAIELDLALALV
FT                   AQASLEAEPVLYMNRFTGKTFSLEEQPGADKEPEIYVPLYAAPPDSAAMLQAGNFREKK
FT                   GSSTNNFREISETSTNYPVTLDDWISCSERMPDDGQHVIILCDGAFVLYAQYRDGEFFD
FT                   VVRNGDEFFETQSRNVTDWMPLPEPPQEVRQ"
FT   gene            complement(330355..330510)
FT                   /locus_tag="ARC77_01745"
FT   CDS_pept        complement(330355..330510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01745"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01745"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZUQ2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303916.1"
FT                   /protein_id="AMW41053.1"
FT                   /translation="MLTGAFLCLPYGGMPEADSLKHPQQFYLTLALPQTVFTRYGNSHI
FT                   VMNSVP"
FT   gene            330555..330767
FT                   /locus_tag="ARC77_01750"
FT   CDS_pept        330555..330767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01750"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01750"
FT                   /db_xref="GOA:A0A143E905"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143E905"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000882662.1"
FT                   /protein_id="AMW41054.1"
FT                   /translation="MLDTCRLASYAPKGKEKQAMKQQKAMLIALIVICITVIVTALVTR
FT                   KDLCEVRIRTGQTEVAVFTAYEPEE"
FT   gene            complement(330953..331132)
FT                   /locus_tag="ARC77_01755"
FT   CDS_pept        complement(330953..331132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01755"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01755"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3V293"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000219243.1"
FT                   /protein_id="AMW41055.1"
FT                   /translation="MTVVEAKGFFNLASAPAVTLNEPFGLFFSAWGMLVPVRFECVKTP
FT                   SAPAGKDGRIIRIV"
FT   gene            331215..332264
FT                   /locus_tag="ARC77_01760"
FT   CDS_pept        331215..332264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01760"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01760"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR010373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DU43"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016241288.1"
FT                   /protein_id="AMW41056.1"
FT                   /translation="MRVLLRPVLVPELGLVIVKPGRESMSAFHNGRILVEPEPKSMRAL
FT                   PSGVVPAVHQPLAEDKSLLPFFSDERVIRAAGGAGALSDWLLRHVKSCQWLHGDYHHSE
FT                   TVIHRYGTGAMVLCWHCDNQLREQTSDSLDQLAQQNLAAWMIDIIRHAMNGAQERELSL
FT                   AELSWWAVRNQVADALPEAVLRRSLGLRAEKIRSVYRESDIIPGEQTATSILKQRTKNI
FT                   ALPPHTHQQQNPPQEKTVVSIAVDPESPKSFMKRPKRRRWVNEKYTRWVKTQPCACCGK
FT                   PADDPHHLIGHGQGGMGTKSHDIFTLPLCREHHNELHADPLAFEEKHGSQVDLIFRFLD
FT                   HAFATGVLG"
FT   gene            332277..332636
FT                   /locus_tag="ARC77_01765"
FT   CDS_pept        332277..332636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01765"
FT                   /product="endodeoxyribonuclease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01765"
FT                   /db_xref="GOA:A0A143DU91"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR016281"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DU91"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001686798.1"
FT                   /protein_id="AMW41057.1"
FT                   /translation="MRIEFVLPYPPTVNTYWRRRGSTYFVSKAGERYRRDVALIVRQQR
FT                   LKLNLSGRLVIKIIAEPPDKRRRDLDNILKAPLDVLTHAGLLIDDEQFDEINIVRGQLV
FT                   PGERLGIKITELECA"
FT   gene            332633..333322
FT                   /locus_tag="ARC77_01770"
FT   CDS_pept        332633..333322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01770"
FT                   /product="antiterminator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01770"
FT                   /db_xref="InterPro:IPR010455"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTQ8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001064894.1"
FT                   /protein_id="AMW41058.1"
FT                   /translation="MNNHYLQFVREQLIIATADLSGATKGQLEAWQENAMFDTGRYRRK
FT                   KIRYRDEVTGKMITRDNPPIPGKQSLAKVTSIPLVSPVEFSTSSWRRAVLSLEEHHKAW
FT                   LLWCYSGSICWEYQIAITQWAWNEFNTQSGTRKIAGKTQERLKKLIWLAAQAVKAELFG
FT                   GEGYEYKELALLVGVTTKNWSKTFTRHWVAMKHIFHRLDSEALLFVMRTRSKQKAAFSK
FT                   QSVAKVD"
FT   gene            333533..333608
FT                   /locus_tag="ARC77_01775"
FT   tRNA            333533..333608
FT                   /locus_tag="ARC77_01775"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:333566..333568,aa:Met,seq:cat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            333616..333692
FT                   /locus_tag="ARC77_01780"
FT   tRNA            333616..333692
FT                   /locus_tag="ARC77_01780"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:333650..333652,aa:Arg,seq:tcg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            333706..333782
FT                   /locus_tag="ARC77_01785"
FT   tRNA            333706..333782
FT                   /locus_tag="ARC77_01785"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:333740..333742,aa:Arg,seq:tct)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            333959..334387
FT                   /locus_tag="ARC77_01790"
FT   CDS_pept        333959..334387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01790"
FT                   /product="tellurite resistance protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01790"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTS6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303509.1"
FT                   /protein_id="AMW41059.1"
FT                   /translation="MVFLVKKARRAATEIKKFEKRDLAQVVINAAYLVACADGECEASE
FT                   KAKIEQVLRNQPALSAFTSEINAISATIIGQLDTNFKTGRRAALREIEDVKHDTREAED
FT                   VLDVAVAIAEADGEIEPEERKVLEEIAGVLGLRLENHL"
FT   gene            334384..334551
FT                   /locus_tag="ARC77_01795"
FT   CDS_pept        334384..334551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01795"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01795"
FT                   /db_xref="GOA:A0A0K5UN37"
FT                   /db_xref="InterPro:IPR025169"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K5UN37"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000216653.1"
FT                   /protein_id="AMW41060.1"
FT                   /translation="MTVKLRLTVAALLLFLVVMVDFTSRIMSVLADGVLVCGIVVLLWP
FT                   VIKRNSLHNA"
FT   gene            334689..334817
FT                   /locus_tag="ARC77_01800"
FT   CDS_pept        334689..334817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01800"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01800"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3V7M7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001304197.1"
FT                   /protein_id="AMW41061.1"
FT                   /translation="MLCHKSVISVFLKLSSLSLYFRLRMARPFFYDQPLADGHPVI"
FT   gene            334866..336716
FT                   /locus_tag="ARC77_01805"
FT   CDS_pept        334866..336716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01805"
FT                   /product="9-O-acetyl-N-acetylneuraminic acid deacetylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01805"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWA0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000874307.1"
FT                   /protein_id="AMW41062.1"
FT                   /translation="MSIKHYDVVRAASPSDLAEKLTHKLKEGWQPFGSPVAITPYTLMQ
FT                   AITAEGDVVVSGATEPDWYYVIVLAGQSNAMAYGEGLPLPDSYDAPDPRIKQLARRSTV
FT                   TPGGAACRYNDIIPADHCLHDVQDMSTLNHPKADLSKGQYGCVGQGLHIAKKLLPYIPN
FT                   NAGILLVPCCRGGSAFTQGAEGTFSESTGASQDSARWGVGKPLYQDLISRTKAALQKNP
FT                   KNVLLAVCWMQGEFDMSAATHAQQPALFTAMLAQFRADLSVFNAQCHGGSAADVPWICG
FT                   DTTYYWKNTYATQYDTVYGGYKNRESEGVYFVPFMTDGNGVNTATNAPAEDPDIPASGY
FT                   YGAASRTNGNQVSSNRPTHFSSWARRSIIPDRLATAILNAAGRTSAFISGKAPEIKPSP
FT                   GGNTPSGPSADTSVRTISLLPAAGEAAAQGWSIKDGGIQLSDGVFKITRQSNKTWSLTH
FT                   PVDDAITLLTQGGRLTCKFRLSGALTNNQFGLGIYLYTDAPVPDGVAMTGTGNPFLMSY
FT                   FTQTTDGRVNLMHHRKAGNTKLGEFGDYGNDWQTLELVFTAGSATVTPKLNGVAGPAFQ
FT                   VIKDSLTLGLNALTLTDVTKNAAYGVEIESLVLEINAPAA"
FT   gene            complement(336995..337157)
FT                   /pseudo
FT                   /locus_tag="ARC77_01810"
FT   CDS_pept        complement(336995..337157)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01810"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000075196.1"
FT   gene            337165..337371
FT                   /locus_tag="ARC77_01815"
FT   CDS_pept        337165..337371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01815"
FT                   /product="holin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01815"
FT                   /db_xref="GOA:A0A143DWG5"
FT                   /db_xref="InterPro:IPR007054"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWG5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001453420.1"
FT                   /protein_id="AMW41063.1"
FT                   /translation="MEKITTGVSYTTSAVGTGYWLLQLLDKVSPSQWVAIGVLGSLLFG
FT                   LLTYLTNLYFKIKEDRRKAARGE"
FT   gene            337376..337720
FT                   /locus_tag="ARC77_01820"
FT   CDS_pept        337376..337720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01820"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01820"
FT                   /db_xref="InterPro:IPR009759"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3U2E4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:YP_002274180.1"
FT                   /protein_id="AMW41064.1"
FT                   /translation="MKKKYELVVKGINNYPDKITVTVALEIGGYPSLLLPDVAISLDRT
FT                   EGATLEFYEAEAKKQAKQFFMDVAAGLCEGDGPLPEKRPVILEAQDVLITYRGKLPGII
FT                   TGSLKTPPLA"
FT   gene            337771..338304
FT                   /locus_tag="ARC77_01825"
FT   CDS_pept        337771..338304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01825"
FT                   /product="lysozyme"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01825"
FT                   /db_xref="GOA:A0A143DV04"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DV04"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001537093.1"
FT                   /protein_id="AMW41065.1"
FT                   /translation="MNAKIRYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTTAYRDG
FT                   AGIWTICRGATRGDGKPVIPGMKLSKEKCDRVNAIERDKALAWVEKNIRVPLTEPQKAG
FT                   IASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVSR
FT                   RDQESALACWGIDR"
FT   gene            338575..339144
FT                   /locus_tag="ARC77_01830"
FT   CDS_pept        338575..339144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01830"
FT                   /product="antirepressor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01830"
FT                   /db_xref="InterPro:IPR018875"
FT                   /db_xref="InterPro:IPR018877"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3VBR9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001056806.1"
FT                   /protein_id="AMW41066.1"
FT                   /translation="MNMMAVPFHGNSLYVVNHNGEPYVPMKPVVAGMGLAWQSQLAKLR
FT                   QRFASTITEIVMVAEDGKQRNMVSMPLRKLAGWLQTINPNKVKPEIRDKVIRYQEECDD
FT                   VLYEYWTKGFVVNPRKMSVMEELNQACADMKRDKNIASVFATGLNEWKQVKAAHVSKIR
FT                   TLVNEANMLIDFVLADTGKGKITKAD"
FT   gene            339144..339290
FT                   /locus_tag="ARC77_01835"
FT   CDS_pept        339144..339290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01835"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01835"
FT                   /db_xref="GOA:A0A0D6ZI54"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZI54"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000539782.1"
FT                   /protein_id="AMW41067.1"
FT                   /translation="MGWLMISDKLITLVKSLCVLVGISFLVMLVAIFFSTAWRVLTLSG
FT                   LVG"
FT   gene            339298..339765
FT                   /locus_tag="ARC77_01840"
FT   CDS_pept        339298..339765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01840"
FT                   /product="endopeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01840"
FT                   /db_xref="GOA:A0A143DYT6"
FT                   /db_xref="InterPro:IPR004929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DYT6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001082609.1"
FT                   /protein_id="AMW41068.1"
FT                   /translation="MNRVLCVVIIVLAVGYGALWLATNHYRDNALTYKAQRDKKARELE
FT                   QANATITDMQVRQRDVAALDAKYSRELADARAENETLRADVAAGRKRLRINATCSGTVR
FT                   EATGTSGVDNATGPRLADTAERDYFILRERLMTMQKQLEGAQDYIRTQCLN"
FT   gene            complement(340128..340355)
FT                   /locus_tag="ARC77_01845"
FT   CDS_pept        complement(340128..340355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01845"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01845"
FT                   /db_xref="InterPro:IPR025030"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7BWU6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000095736.1"
FT                   /protein_id="AMW41069.1"
FT                   /translation="MSSKNRPRRTTTRNIRFPNQMIEQINIALDQKGSENFSAWVIESC
FT                   RRELAADIKYARQLTIKKNDTQYALRWLFI"
FT   gene            340397..340762
FT                   /locus_tag="ARC77_01850"
FT   CDS_pept        340397..340762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01850"
FT                   /product="HNH nuclease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01850"
FT                   /db_xref="GOA:A0A0F4HW41"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F4HW41"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001427183.1"
FT                   /protein_id="AMW41070.1"
FT                   /translation="MAVLRTLPGRIKTLNTRRVNILKGEQRRVSGSARVSLKRHIWLRD
FT                   AGQCCLCGRVVDLCDSELDHRIALQFGGGNEETNLWTLCTECHRQKSAREAAGGMPDPT
FT                   LPEVSGGHGRADDIIGL"
FT   gene            341052..341615
FT                   /locus_tag="ARC77_01855"
FT   CDS_pept        341052..341615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01855"
FT                   /product="terminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01855"
FT                   /db_xref="GOA:A0A143DVA8"
FT                   /db_xref="InterPro:IPR005335"
FT                   /db_xref="InterPro:IPR038713"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DVA8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000958360.1"
FT                   /protein_id="AMW41071.1"
FT                   /translation="MLTTQKRKFALALMSGKNKTASAIAAGYSAKTARVKGSQLAKDPE
FT                   VLAFIARKQCETVEVDEVPVYRQKKSEPEDKPRRREAAAIPQPDETNPEMPPPVVISPG
FT                   IEYMEDGLPDPVKAMGRLLVENINTDPRLALDAAYKLAQFTHHKKGDAGKKSAKGDAAK
FT                   KAANRFAVPPPPRLVVNNDNEGNG"
FT   gene            341612..343273
FT                   /locus_tag="ARC77_01860"
FT   CDS_pept        341612..343273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01860"
FT                   /product="terminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01860"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UJR7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001301491.1"
FT                   /protein_id="AMW41072.1"
FT                   /translation="MIPVWSTACPDWAERLKKGLSIIPAPIYPEQAAHALAIFKQLRIV
FT                   DAPGSPTFGESCAQWVFDLVAALFGSYDAQTGVRHIKEVFILIPKKNSKSTLAAGIMMT
FT                   ALLLNWRQAAGYTILAPTVEVAANAFNPARDMVRRDDDLDDLCQVQTHIRTITHRVTDT
FT                   TLKVVAADPNTVSGIKSVGTLIDELWLFGKQYKAEDMLREAIGGLASRPEGFVVYTTTQ
FT                   SNEPPAGVFRQKLQYARDVRDGKIHDPHFLPVIFEHPPEMVESGAHLLMENLAMVNPNL
FT                   GYSVDEAFLYREYRKAREAGEEAFRGFMSKHANVEIGLALRSDRWAGADFWEQQGRRVS
FT                   LDDILQRADVVTVGIDGGGLDDLLGMYVIGRDRETREWLGWGHAWAHETAVVRRKSEAS
FT                   RFQDLVACGDMTIVRRVGDDTAEVAEYVRRIHEAELLDHIGIDPSGVGQILDSLAEAGI
FT                   PDGIVVGISQGWKLGGAIKTTERKLAEGVLVHGDQPLMAWCVGNARVEPKGNAILITKQ
FT                   ASGRGKIDPLMALFNAVSLMSLNPEPKKKEYAVFFI"
FT   gene            343337..345274
FT                   /locus_tag="ARC77_01865"
FT   CDS_pept        343337..345274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01865"
FT                   /product="phage capsid protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01865"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J2HUA1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000173030.1"
FT                   /protein_id="AMW41073.1"
FT                   /translation="MTLKRACSLLTVKSFSEDERVITGIASTPSPDRDGDILEPEGAEF
FT                   GSAIPFLWQHDHSRPVGQCTVRRVSEGLEITATLVKPVPDMPSQLAARLDEVWAAIKTG
FT                   LVRGLSVGFRPHEYTFLDGGGLHFLRWELMEVSAVTVPANAECTIRTIKSYDRPFSAAS
FT                   GNRKPVVKIASSAGAAAQSTTVFHKEKTIMNIGEQIKSFENKRAALAASLEEVMTKAAE
FT                   EGRTLDVEEEEHYDNTAAEIRQVDAHLKRLRELEAGKAATAQPVKQAGNGNVAAVASAP
FT                   VIRVEQKLDKGIGFARFAKSLAAAKGVRSEALEVARRQYPDDSRLHHVLKSAVGAGTTT
FT                   DPQWAGSLSEYQEYAQDFIDYLRPQTIIGRFGQGGIPALRQVPFNIRVHAQVSGGAAGW
FT                   VGEGKAKPLTKFDFESITFSHAKVSAIAVLTEELIRFSSPAADALVRNALAEAVVARLD
FT                   TDFVDPKKAAVADVSPASITHDVKGTASTGNPDADAEAAFGQFVAANLQPTGAVWLMSS
FT                   TNALALSMRKNALGQKEYPDMTLLGGSFQGLPVIVSQYVGDQLVLVNAPDIYLADDGGV
FT                   AVDMSREASLEMQSEPGGDSTTPSPVELVSMFQTGSVAIRAERWINWRRRRTAAVAVIT
FT                   GVNYGSASGG"
FT   gene            345319..345540
FT                   /locus_tag="ARC77_01870"
FT   CDS_pept        345319..345540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01870"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066R009"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001063104.1"
FT                   /protein_id="AMW45905.1"
FT                   /translation="MAKIRYLQGTHDARAGDIRDVAQPCAEVLVRLGKAEYITVRRPAG
FT                   QKKKRDAEHGECGTFYGEPEKTRNQDVT"
FT   gene            345486..348065
FT                   /locus_tag="ARC77_01875"
FT   CDS_pept        345486..348065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01875"
FT                   /product="phage portal protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01875"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTR6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001365916.1"
FT                   /protein_id="AMW41074.1"
FT                   /translation="MWNLLRRTRKNQKSGRDVREAGWTSLFQAVAEPFSGAWQQGVKAD
FT                   PEAVLSFHAVFACISLISQDIAKMRLRLMQTDAHGIRRETRRGDIARLCRRPNAQQNRI
FT                   QFFELWLNAKLRHGNTVVLKIRNARWQIKELRILDWSRVEPLVADDGEVFYRITPDRNC
FT                   GITEAVTVPAREVIHDRFNCFFHPLIGLPPVYAAGLAATQGHHIQENSTSFFRNGGRPS
FT                   GVIEIPGSITEENAKKLKSNWDSGYTGENAGKTAILSNGAKYNPTTFSPVDAQTVEQLK
FT                   MTAEIVCSVFRVPAYKIGVGQPPSSDNVEALEQQYYSQCLQTLIESIELLLDEALETGE
FT                   NESTEFDVTTLLRMDSERRMKTLGDAVKNTLLTPNEARKRENLPPLAGGDALYLQQQNY
FT                   SLEALSRRDAREDPFASAGKTVSSQLPDGASDGNKAISETEHDAVKAMFRGDTEKMTER
FT                   ELSIIRALGEEFSTVLADLQRTFEEKIAAQAQTFEEKLASQSVVLQKHVTVDEVRPVLQ
FT                   AMVDDAVGAIPVPRDGRDYDPDVLQQAVNDAVANIPQPADGKSLTPDDVRPMLEQMVKE
FT                   AVSHIPVPRDGRDYDPEVLQKAVNDAVANIPQPADGKSLTPDDVRPMLEQMVKEAVSHI
FT                   PVPRDGRDYDPEVLQKAVNDAVANIPQPADGKSLTPDDVRPMLEQMVKEAVSHIPVPRD
FT                   GRDYDPDVLQKAVLDAVSALPAPQDGRDATALEILPAIDDQKSFPRGTYATHQGGLWRA
FT                   YEKTHGMRGWECLVDGVADIDVSMTGERLFSVVVRQSSGQRTEKTFSLPVMLYRGVFRA
FT                   GETYHPGDTVTWGGSLWHCNSMTEDKPGEAHSSAWTLAAKRGRDAGG"
FT   gene            348068..348394
FT                   /locus_tag="ARC77_01880"
FT   CDS_pept        348068..348394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01880"
FT                   /product="DNA-packaging protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01880"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZMZ5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000125984.1"
FT                   /protein_id="AMW41075.1"
FT                   /translation="MTALLTLEEIKAHLRVDHDADDDMLMDKVRQATAVLLAYIQGSRD
FT                   KVIREDGELIPGEALTRMKGAAMRLTGMLYRNPDLAEREELIQGELPFSVSVLIYDLRC
FT                   PTVL"
FT   gene            348404..348754
FT                   /locus_tag="ARC77_01885"
FT   CDS_pept        348404..348754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01885"
FT                   /product="head-tail adaptor protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01885"
FT                   /db_xref="GOA:A0A066R719"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066R719"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001007894.1"
FT                   /protein_id="AMW41076.1"
FT                   /translation="MAISAGRLTQMISVLNPVLTRNAAGEMTEEWVSCGKIHADIRGRS
FT                   SRERMQSGAEMAQAEIRIWVRGQSGREITAASRLHVLSGPWRDRILNVVGLPVPDATGG
FT                   RLEILCRLGGEK"
FT   gene            348751..349197
FT                   /locus_tag="ARC77_01890"
FT   CDS_pept        348751..349197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01890"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01890"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A061KUE4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000573485.1"
FT                   /protein_id="AMW41077.1"
FT                   /translation="MIETLLDFSGLEDISRDLQLLSGAENNRVLREATRAGANVLKEEV
FT                   VSRAPVRRGKLRRNVVVLSRRSRDGGMESGVHIRGVNPDTGNSDNTMKADNPRNAFYWR
FT                   FVEMGTVNMPPHPFVRPAFDVRSEQAAQVAIARMNRAIDEVLRR"
FT   gene            349194..349538
FT                   /locus_tag="ARC77_01895"
FT   CDS_pept        349194..349538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01895"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01895"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A061KTK7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000133388.1"
FT                   /protein_id="AMW41078.1"
FT                   /translation="MTEADLYPHLAHLAGGQVYPYVVPLLDGRPSVALPWVVFSLISSV
FT                   SADVMGGQAESSVSVQIDVYAGTVTQARQIRQDAREAIMLLAPGSVSEMQDYIPENRCY
FT                   RATLEFQVTV"
FT   gene            349604..350320
FT                   /locus_tag="ARC77_01900"
FT   CDS_pept        349604..350320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01900"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01900"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0P7T8X5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001275434.1"
FT                   /protein_id="AMW41079.1"
FT                   /translation="MSALYERSQLTQVMISSAPATAETMDKAEYLRLDCTIKEVQFTAG
FT                   QKQDIDVTTLCSTEQENINGLGASSEISMSGNFYLNQAQNALRDAYDNDALYAFKVLFP
FT                   SGKGFKFLAEVRQHTWSSGTNGVVAATFSLRLKGKPVSFVVPLAFVKNLDKTLTVNTGA
FT                   LLTMSVSANGGTPPYKYAWKKDGQPVDGQTTDTFSKPGAQSADAGKYTCVVTDSAEKAQ
FT                   SVTSVECTVTVSAAAG"
FT   gene            350335..350709
FT                   /locus_tag="ARC77_01905"
FT   CDS_pept        350335..350709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01905"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01905"
FT                   /db_xref="InterPro:IPR010411"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR038556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H0KTB2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:YP_001449302.1"
FT                   /protein_id="AMW41080.1"
FT                   /translation="MKKDLKTLALARLSGFRHKTVKVPEWGNVSVVLREPSAEAWYLWQ
FT                   EVLNGDGEDDDTLSVVAKTRRNLEADVTLFCDVLCDTDLQRVFTPDDREQVLAVYGPVH
FT                   ARLLRQALELIADAESARKK"
FT   gene            350733..351014
FT                   /locus_tag="ARC77_01910"
FT   CDS_pept        350733..351014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01910"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01910"
FT                   /db_xref="InterPro:IPR025116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A093DB24"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001234258.1"
FT                   /protein_id="AMW41081.1"
FT                   /translation="MRLALRLGRTLSELRHSLSASEAMMWMEFDRISPLGDERGDIRNA
FT                   QIVKAVFGAQGMNVALKDAMLCWGEDEDKPEVDPFAALEDALSLAAQS"
FT   gene            351062..354304
FT                   /locus_tag="ARC77_01915"
FT   CDS_pept        351062..354304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01915"
FT                   /product="phage tail tape measure protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01915"
FT                   /db_xref="InterPro:IPR006431"
FT                   /db_xref="InterPro:IPR009302"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWB9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000212822.1"
FT                   /protein_id="AMW41082.1"
FT                   /translation="MATLRELIIKISANSQSFQSEIQRASRMGSEYYRTLQNGGRQAAA
FT                   AAREQRRALAELHSQLTEIRASAVGMTGAFAGAFATGHLISLADEWSSVNARLKQASQS
FT                   SDEFASSQKVLMDISQRTGTAFSDNAALFARSAASMREYGYSADDVLKVTEAISTGLKI
FT                   SGASTAEAGSVITQFSQALAQGVLRGEEFNSVNESGDRIVRALAAGMGVARKDLKAMAD
FT                   DGKLTADKVVPALISQLGILRDEYAAMPETVSSSITKVENAFMAWVGGANEASGVTKTL
FT                   SGMLNGVAGQIDNVATAVGALVAVGVARYFGNMASGAMSATAGLVTAARNEVALAEAQF
FT                   RGTQIATARARAAVYRAQQAVAAARGTEMQIAAEARLAATQERLNRNIAARSAAQNALN
FT                   STTAVGSRLMSGALGLVGGVPGLVMLGAAAWYTLYQNQEQARESARQYALTIDEIAHKT
FT                   PSMSLPEASDNEGRTRAALTEQNRLIDEQASRVKSLQEKIAGYQYVLANPGWTTGDGFM
FT                   INHLTSVKTVTEGLAQATEQLAVEQSRLAQMQEKAQSIQDVLAGLEDRRVALIRQQAAE
FT                   QNKVYQSMLVMNGQHTEFNRLLGLGNELLQQRQGLVNVPLRLPQATLDDKQQSALTKTE
FT                   RELALSRLKGEEKERVRLGYAADDLGFVGDPYQEARQRYISNALEAWRNNEANKPKSRG
FT                   GKSETEKAEDSFSRLLKQQKEQLALAGQNTELAKLKYQTALGELKTLTEIQKQELLRNA
FT                   ALIDQQKIREQLRYREETLKNDNVAARASNESELLGYGQGERARERMRELQQIRDSFRQ
FT                   KDADLQSQYQTGDISEDFYRQALAQNAQYLSERLKDQAVFYAESDVQRADWQKGLQEGF
FT                   SNWVDNASDYASQAAQLATEGISGMVNNITEMLNGNKVEWRSWASSVLQEISKVLMNAA
FT                   IVNGIKTAANGMSGAGGFLGSIGDWLGGAVANAKGGVYTSANLSAYSNSIVDTPTYFAF
FT                   AKGAGLMGEAGPEAIMPLTRAADGSLGVRAVGSMNGSAGLVYSPVYHIAIQNDGANGQI
FT                   GPEAAGSLVQLIDQRVQAVMLSMRRDGGMLSG"
FT   gene            354297..354638
FT                   /locus_tag="ARC77_01920"
FT   CDS_pept        354297..354638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01920"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01920"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F0AC58"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000807959.1"
FT                   /protein_id="AMW41083.1"
FT                   /translation="MAEIKTLHLVPREGMQVSEKPSVVRVRFGDGYEQRRPTGLNPQLK
FT                   TFQAVFRVTDESTRRWLDEFLSWHGGYRAFLWRPPKHNRTVRVVCREWSVTDNARYSDF
FT                   SCTIEQVVN"
FT   gene            354638..355000
FT                   /pseudo
FT                   /locus_tag="ARC77_01925"
FT   CDS_pept        354638..355000
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01925"
FT                   /product="phage tail protein"
FT                   /note="incomplete; partial on complete genome; missing
FT                   stop; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:YP_001449306.1"
FT   gene            355263..358739
FT                   /locus_tag="ARC77_01930"
FT   CDS_pept        355263..358739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01930"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01930"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015406"
FT                   /db_xref="InterPro:IPR021034"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTS4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000514729.1"
FT                   /protein_id="AMW41084.1"
FT                   /translation="MGKGGGKAHTPVEAKDNLKSTQMMSVIDAIGEGPIEGPVKGLQSI
FT                   LVNKTPLTDTDGNPVIHGVTAVWRAGEQEQTPPEGFESSGAETALGVEVTKAKPVTRTI
FT                   TSANIDRLRVTFGVQSLLETTSKGDRNHSSVRLLIQLQRNGNWVTEKDVTINGKTTSQF
FT                   LASVILDNLPERPFNIRMVRETADSTSDQLQNKTLWSSYTEIIDVKQCYPNTAIVGLQV
FT                   DAEQFGGQQMTVNYHIRGRIIQVPSNYDPEKRTYSGIWDGSLKPAYSNNPAWCLWDMLT
FT                   HPRYGMGKRLGAADVDKWALYAIAQYCDQTVPDGFGGTEPRMTFNAYLSQQRKAWDVLS
FT                   DFCSAMRCMPVWNGQTLTFVQDRPSDVVWPYTSSDVVVDDNGVGFRYSFSALKDRHTAV
FT                   EVNYTDPQNGWQTSTELVEDPEAILRYGRNLLKMDAFGCTSRGQAHRAGLWVIKTGLLE
FT                   TQTVDFTLGSQGLRHTPGDIIEICDNDYAGTMTGGRILSIDAASRTLTLDREVTLPETG
FT                   AATVNLINGSGKPVSVAITAHPAPDRIQVSTLPDGVETYGVWGLSLPSLRRRLFRCVSV
FT                   RENTDGTFAITAVQHVPEKEAIVDNGARFEPQSGTLNSVIPPAVQHLTVEVSAADGQYL
FT                   AQAKWDTPKVVKGVSFMLRLTVAADDGSERLVSTARTTETTYRFTQLAPGNYRLTVRAV
FT                   NAWGQQGDPASVSFRIAAPAAPSQIELTPGYFQITAVPRLAVYDPTVQFEFWFSETRIT
FT                   DIRQVETTARYLGTGLYWIAASINIKPGHDYYFYIRSVNTVGKSAFVEAVGQPSDDASG
FT                   YLDFFKGEIGKTHLAQELWTQIDNGQLAPDLAEIRTSITDVSNEITQTVNKKLEDQSAA
FT                   IQQIQKVQVDTNNNLNSMWAVKLQQMQDGRLYIAGIGAGIENTSDGMQSQVLLAADRIA
FT                   MINPANGNTKPMFVGQGDQIFMNEVFLKYLTAPTITSGGNPPAFSLTSDGKLTAKNADI
FT                   SGSVNANSGTLNNVTINENCRVLGKLSANQIEGDLVKTVGKAFPRDSRAPERWPSGTIT
FT                   VRVYDNQPFDRQIVIPAVAFSGAKHEREHTDIYSSCRLIVRKNGAEIYNRTALDNTLIY
FT                   SGVIDMPAGHGHMTLEFSVSAWLVNNWYPTASISDLLVVVMKKATAGISIS"
FT   gene            358807..359406
FT                   /locus_tag="ARC77_01935"
FT   CDS_pept        358807..359406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01935"
FT                   /product="enterobacterial Ail/Lom family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01935"
FT                   /db_xref="GOA:A0A143DV23"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DV23"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001230282.1"
FT                   /protein_id="AMW41085.1"
FT                   /translation="MRKLYAAILSAAICLAVSGAPAWASEQQATLSAGYLHARTSAPGS
FT                   DNLNGINVKYRYEFTDTLGLVTSFSYAGDKNRQLTRYSDTRWHEDSVRNRWFSVMAGPS
FT                   VRVNEWFSAYAMAGVAYSRVSTFSGDYLRVTDNKGKTHDVLTGSDDGRHSNTSLAWGAG
FT                   VQFNPTESVAIDIAYEGSGSGDWRTDGFIVGVGYKF"
FT   gene            359471..360694
FT                   /locus_tag="ARC77_01940"
FT   CDS_pept        359471..360694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01940"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01940"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR009640"
FT                   /db_xref="InterPro:IPR013609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DU65"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000279093.1"
FT                   /protein_id="AMW41086.1"
FT                   /translation="MAVKISGVLKDGTGKPVENCTIQLKARRNSATVVVNTVASENPDE
FT                   AGRYSMDVEYGQYSVILLVEGFPPSHAGTITVYEDSQPGTLNDFLGAMSEDDVRPEALR
FT                   RFELMVEEAARHAEEAKKNAGEAETSARNAGISASQAEESAANADTSAGDASESARQAA
FT                   ESAAAAKQSEEASSSSASAAAQKASESSQSAADAELSKKTAESAAGNAARDATTATEKA
FT                   RESAESAQSAEQSRIAAEEAVNRIPTVVGPPGPKGEPGPAGPQGPKGDKGERGDTGPAG
FT                   ATGERGPAGDAGPAGPAGPAGPQGPKGETGAAGPVGATGPQGPKGDPGETQIRFRLGPG
FT                   NIIETNSHGWFPDTDGALITGLTFLDPKDATRVQGFFQHLQVRFGDGPWQDVKGLDEVG
FT                   SDTGRTGE"
FT   gene            360696..360965
FT                   /locus_tag="ARC77_01945"
FT   CDS_pept        360696..360965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01945"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01945"
FT                   /db_xref="InterPro:IPR009640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DUC5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001358861.1"
FT                   /protein_id="AMW41087.1"
FT                   /translation="MNILKKIMQRLCGCGKHDDRENGELLTAQLRLGPADILESDENGI
FT                   IPEQDRVITQVVILDADKKQIQCVVRPLQILRADGTWENIGGMK"
FT   gene            361079..361654
FT                   /locus_tag="ARC77_01950"
FT   CDS_pept        361079..361654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01950"
FT                   /product="T3SS effector NleG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01950"
FT                   /db_xref="GOA:A0A0F3VU11"
FT                   /db_xref="InterPro:IPR010489"
FT                   /db_xref="InterPro:IPR038436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3VU11"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001131642.1"
FT                   /protein_id="AMW41088.1"
FT                   /translation="MPLTSAIASNSFSTGMQVLRAQMAASGGGEITVGGQTVRITYSET
FT                   DGRFLASGGNNSLLSGLLLTGLNGGPEALRDIMLRMVSGSGNTQSHGDIEGKISQCKFS
FT                   VNTESLQCPSEAVRCPIILDKPEEGVFVKNSEGSLVCTLFDSVSFSHLVRDGGKHPLTR
FT                   EPITSSMIVSQEQCIYDQTKGNFVIKDK"
FT   gene            362033..362380
FT                   /locus_tag="ARC77_01955"
FT   CDS_pept        362033..362380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01955"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01955"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTU9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010917823.1"
FT                   /protein_id="AMW41089.1"
FT                   /translation="MDFSWEGRELEFLIYFNCINILNGLHRVNVSSTPYSLAYNTCCNL
FT                   HLSAMKKHHLSLYEILDLPSANLSFQSTFKYCIYLPTRSYFRKLNMNDNIPTARNHKQS
FT                   TCITEKTCLYF"
FT   gene            362365..363015
FT                   /locus_tag="ARC77_01960"
FT   CDS_pept        362365..363015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01960"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01960"
FT                   /db_xref="GOA:C1KUX2"
FT                   /db_xref="InterPro:IPR010489"
FT                   /db_xref="InterPro:IPR038436"
FT                   /db_xref="UniProtKB/TrEMBL:C1KUX2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001121226.1"
FT                   /protein_id="AMW41090.1"
FT                   /translation="MPIFLNFTAGSILPENELASLRYIVQQNQNDTVIIKERYKMDIRY
FT                   IESVNGFTVNPVCSNHFSIFMARQNTIARNLEQQINNGRSFAQISQDFMLQLSSNIGWK
FT                   KGAENALKNKIHSHSFVVNPDEFSCDTQFLKCPITLCVPEKGVFVKNALNSNICTLYDK
FT                   SAFMNLTREHLPHPLSREKIVKEMIIERNMCYFDTISQHFIIMDADQQKQHCK"
FT   gene            363165..363587
FT                   /locus_tag="ARC77_01965"
FT   CDS_pept        363165..363587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01965"
FT                   /product="transposase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01965"
FT                   /db_xref="GOA:A0A143DVC8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DVC8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000343737.1"
FT                   /protein_id="AMW41091.1"
FT                   /translation="MDEKQLQALANELAKNLKTPEDLSQFDRLLKKISVEAALNAEMSH
FT                   HLGYDKNQPKPGANSRNGYSTKTVITGDGHLELRTPRDRDGSFEPQLVKKNQTRITGMD
FT                   NQILSLYAKGLTTREIAAAFKELYDADVVSVQRGPY"
FT   gene            complement(363598..365136)
FT                   /locus_tag="ARC77_01970"
FT   CDS_pept        complement(363598..365136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01970"
FT                   /product="transposase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01970"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:O85621"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000998059.1"
FT                   /protein_id="AMW41092.1"
FT                   /translation="MNDISSDDIFLLKQRLAEQEALIHALQEKLSNREREIDHLQAQLD
FT                   KLRRMNFGSRSEKVSRRIAQMEADLNRLQKESDTLTGRVYDPAVQRPLRQTRTRKPFPE
FT                   SLPRDEKRLLPAAPCCPNCGGSLSYLGEDTAEQLELMRSAFRVIRTVREKHACTQCDAI
FT                   VQAPAPSRPIERGIAGPGLLARVLTSKYAEHTPLYRQSEIYGRQGVELRRSLLSGWVDA
FT                   CCRLLSPLEEALHGYVMTDGKLHADDTPVQVLLPGNKKTKTGRLWAYVRDDRNAGSALA
FT                   PAVWFAYSPDRKGIHPQTHLACFSGVLQADAYAGFNELYRNGGITEAACWAHARRKIHD
FT                   VHVRIPSALTEEALEQIGQLYAIEADIRGMPAEQRLAERQRKTKPLLKSLESWLREKMK
FT                   TLSRHSELAKAFAYALNQWPALTYYANDGWVEIDNNIAENALRAVSLGRKNFLFFGSDH
FT                   GGERGALLYSLIGTCKLNDVDPESYLRHVLGVIADWPVNRVSELLPWRIALPAE"
FT   gene            complement(365186..365533)
FT                   /locus_tag="ARC77_01975"
FT   CDS_pept        complement(365186..365533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01975"
FT                   /product="isocitrate lyase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01975"
FT                   /db_xref="GOA:O88118"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:O88118"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001402532.1"
FT                   /protein_id="AMW41093.1"
FT                   /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFI
FT                   FRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTQAQLAMLLEGIDWRQ
FT                   PKRLLTSLTML"
FT   gene            complement(365530..365910)
FT                   /locus_tag="ARC77_01980"
FT   CDS_pept        complement(365530..365910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01980"
FT                   /product="transposase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01980"
FT                   /db_xref="GOA:Q8RLA3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RLA3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001171554.1"
FT                   /protein_id="AMW41094.1"
FT                   /translation="MQKNVTPGRRKGCPNYPPEFKQQLVAASCEPGISISKLALENGIN
FT                   ANLLFKWRQQWREGKLLLPSSESPQLLPVTLDAAAEQPESLAEDPETLSISCEVTFRHG
FT                   TLRFNGNVSEKLLTLLIQELKR"
FT   gene            366572..366823
FT                   /locus_tag="ARC77_01985"
FT   CDS_pept        366572..366823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01985"
FT                   /product="transposase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01985"
FT                   /db_xref="GOA:A0A143E824"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143E824"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000640719.1"
FT                   /protein_id="AMW45906.1"
FT                   /translation="MFFAYPADIRKVIYTTNAIESLNSVIRHAIKKRKVFPTDDSVKKV
FT                   VWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRLDGHF"
FT   gene            complement(366873..367079)
FT                   /locus_tag="ARC77_01990"
FT   CDS_pept        complement(366873..367079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01990"
FT                   /product="damage-inducible protein DinI"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_01990"
FT                   /db_xref="InterPro:IPR010391"
FT                   /db_xref="InterPro:IPR036687"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7A0X4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001123911.1"
FT                   /protein_id="AMW41095.1"
FT                   /translation="MPKGSVPALQQEMLRRVSKRYDDVEVIIKSTSNDGLSVTRTADKD
FT                   SAKTFVQETLKDTWESADEWFVR"
FT   gene            complement(367293..367844)
FT                   /pseudo
FT                   /locus_tag="ARC77_01995"
FT   CDS_pept        complement(367293..367844)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_01995"
FT                   /product="integrase"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000876982.1"
FT   gene            complement(367826..369070)
FT                   /locus_tag="ARC77_02000"
FT   CDS_pept        complement(367826..369070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02000"
FT                   /product="exonuclease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02000"
FT                   /db_xref="GOA:A0A152UI33"
FT                   /db_xref="InterPro:IPR010584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UI33"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000102123.1"
FT                   /protein_id="AMW41096.1"
FT                   /translation="MSTDKEEFALYCEAKNDKVRKRLGIKGGFYWTTAKKLSVAISRCI
FT                   TAMDDNDYDEDDFKKPVRVHLPVVNDLPPEGVFDTEFCNRYEKGGEDGITMVFIAPSPS
FT                   VQEKPASTDNTNVNGEDMTEIEENMLLPVSGQELPIRWLAQHGSEKPVTHVAREELQAL
FT                   HIARAEELPAVTALAISHKTKLLDPLEIRDLHKLVRDTDKVFPNPGNSDLGLITAFFEA
FT                   YLDADYTDRGLLTKEWMKGNRVSRITRTASGANAGGGNKTDRNPNLVHTFDTLDVEIAA
FT                   ATLPMDFNIYEIPGSVYRRAKEIVLKRESPFKEWSAALRATPGILDYSRAAIFALIRSA
FT                   HPEFYHYPGRLQGYINAYLTETDHENPSKETLTAARHTPEKDILEEVNRELSAKQETEE
FT                   ENDEEKPQPSCAMAE"
FT   gene            complement(369163..369351)
FT                   /locus_tag="ARC77_02005"
FT   CDS_pept        complement(369163..369351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02005"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02005"
FT                   /db_xref="InterPro:IPR009954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7C451"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000199475.1"
FT                   /protein_id="AMW41097.1"
FT                   /translation="MTSAFALMMTVFLITGESQNVITGIYASKESCLQARDEQKISGEC
FT                   LPVKKVSLYLNNETPAG"
FT   gene            complement(369348..369536)
FT                   /locus_tag="ARC77_02010"
FT   CDS_pept        complement(369348..369536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02010"
FT                   /product="cell division inhibitor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02010"
FT                   /db_xref="GOA:A0A0D7C1S6"
FT                   /db_xref="InterPro:IPR008022"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7C1S6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000449167.1"
FT                   /protein_id="AMW41098.1"
FT                   /translation="METLLPNVNTSEGCFDIGVLLSNREFTEDAINMRKYEPYLLNDNS
FT                   ILSRIALLELGIFGERQ"
FT   gene            369807..370052
FT                   /locus_tag="ARC77_02015"
FT   CDS_pept        369807..370052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02015"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02015"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UIB8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012817786.1"
FT                   /protein_id="AMW41099.1"
FT                   /translation="MVNLTTRCPQWGRNNPAILTAAPFRGVPQPEAHVRRNLTTSLLRE
FT                   RASPYAFALCTDFSGKYPFSKLSVPDSYPCPAHDHT"
FT   gene            370101..370310
FT                   /locus_tag="ARC77_02020"
FT   CDS_pept        370101..370310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02020"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02020"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZJX7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001133037.1"
FT                   /protein_id="AMW41100.1"
FT                   /translation="MPNKKRNPLIEKQIECLVNQLRQSGLLKTHSELRLTESAFDDKLN
FT                   NVLYNGIIDFNRSVGRRGPAGVSL"
FT   gene            complement(370311..370949)
FT                   /locus_tag="ARC77_02025"
FT   CDS_pept        complement(370311..370949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02025"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZJB0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000394548.1"
FT                   /protein_id="AMW45907.1"
FT                   /translation="MEFKDLPPSIQEIAAHTLRHRLNELELESVTKKDTDNMARNVRDA
FT                   FTGLYFCASINKHDSESVANKIAETTAQNINTKPTEEEIDQFAHDAGLKNKKEKSPYAG
FT                   NMFVYDNLIRIRGEIPAEYLARVHQALLKNLETELFDGNTNGFFMVSGLEKDWDAEKRW
FT                   NVATWLFSNRAAALEASACICGLFLTDHKYNLDVYSYIYAEHGPLWIDW"
FT   gene            complement(370961..371194)
FT                   /locus_tag="ARC77_02030"
FT   CDS_pept        complement(370961..371194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02030"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02030"
FT                   /db_xref="InterPro:IPR009821"
FT                   /db_xref="UniProtKB/TrEMBL:A0A153E7D0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000123833.1"
FT                   /protein_id="AMW41101.1"
FT                   /translation="MTAGFNFNNYAAGFCSATPALRGNEVNMDTLNLGNNESLVCGVFP
FT                   NQDGTFTAMTYTKSKTFKTEAGARRWLARNTD"
FT   gene            complement(371406..372044)
FT                   /locus_tag="ARC77_02035"
FT   CDS_pept        complement(371406..372044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02035"
FT                   /product="repressor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02035"
FT                   /db_xref="GOA:A0A143DWE5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWE5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001041864.1"
FT                   /protein_id="AMW41102.1"
FT                   /translation="MNKQTISERITQRMHALNLKGKDLVNATGASKGSVSQWMNGGGAP
FT                   SSRYISSLAKILKVNENWLLNGGELNTGDSLDLSLPPIKTVPLLSLQQAASWSDYMKNS
FT                   SITSCVQLVGEIPANTFAVVLESDSMSTSGGGVSIPNGSTVFVDPDRIVQPGNIVLALP
FT                   KGTTTPVIRKLEIEGPDILLVPTNPRYPSIMLDDLSCILGVCFKIQQDI"
FT   gene            372136..372378
FT                   /locus_tag="ARC77_02040"
FT   CDS_pept        372136..372378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02040"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02040"
FT                   /db_xref="GOA:A0A0D6ZI43"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZI43"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000747948.1"
FT                   /protein_id="AMW41103.1"
FT                   /translation="MKKSEVLGYFGGVVKTAAALGTSKTTVSMWGEDVPWKWALLIQAV
FT                   TAGALKYELHIPTVVIPDSDHNPPSNQGGIHENQA"
FT   gene            372362..372787
FT                   /locus_tag="ARC77_02045"
FT   CDS_pept        372362..372787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02045"
FT                   /product="Rha family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02045"
FT                   /db_xref="InterPro:IPR009364"
FT                   /db_xref="InterPro:IPR037042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTU6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000693843.1"
FT                   /protein_id="AMW41104.1"
FT                   /translation="MKIKHEHIRMAMNAWARPDGEKVPAAGITQAYFELGMTFPELYDD
FT                   SHPEALARNTQKIFRWIEKDTPDAVEKMQALLPAIEKAMPPLLVARMRSHSSEYYREIV
FT                   ERRDRLVKDVDDFVAAAIAWGTLTNSGGQPGNAVVVH"
FT   gene            372856..373911
FT                   /locus_tag="ARC77_02050"
FT   CDS_pept        372856..373911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02050"
FT                   /product="phage replisome organizer"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02050"
FT                   /db_xref="InterPro:IPR040480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DV37"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001262326.1"
FT                   /protein_id="AMW41105.1"
FT                   /translation="MANAWLRLWHDMPNDPKWRTIARVSGQPIATVMAVYIHLLVSASR
FT                   NVTTCHGVSLRGHIDVTTEDLASALDVTEDVIDSILHAMQGRVLDGDLISGWEKRQVLK
FT                   EDNGNVSQTAKSPAERKRAQREREKLRKHNADCHDESRRVTHLSRQVTTDKDTDKDTDK
FT                   DTDTELNPTHNARESIPTSESNGAPLQTAEPEYLDGLSEPIGKFSMTTVWQPSPDFRQR
FT                   AAVWGMALPEPEFTPAELAAFRDYWMAEGKVFTQVQWEQKFARHVQHVRAQVKPVSKGG
FT                   SHAASGGTASRAVQEIRAAREQWERDNGFISNGNGLEAVGAHGGGVFEPLDSEERGRTF
FT                   EALDCPDWCDD"
FT   gene            373943..374365
FT                   /locus_tag="ARC77_02055"
FT   CDS_pept        373943..374365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02055"
FT                   /product="replication protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02055"
FT                   /db_xref="GOA:A0A085P3R6"
FT                   /db_xref="InterPro:IPR009731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085P3R6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001360670.1"
FT                   /protein_id="AMW45908.1"
FT                   /translation="MDRCRAGETWPPDLAEFVALISESGANPFGLTVDAVMEEYRRWRN
FT                   ESWRYDGSDKYPWPQPVLYHICLEMRTRGIERQMTQGELKRLAERQLTKWAKHVGNGMS
FT                   VPPVRRQLEGAKHPQGPTPIERLKQEYERRKAAGFI"
FT   gene            374399..375115
FT                   /locus_tag="ARC77_02060"
FT   CDS_pept        374399..375115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02060"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02060"
FT                   /db_xref="InterPro:IPR012432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UIA4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000450613.1"
FT                   /protein_id="AMW41106.1"
FT                   /translation="METVFDALKALKKASSQVVASRLGISREDAVNELWKLKRRGEADN
FT                   KGSMWWLTQTGESEPVSPVPKVTAQMLTEAIEHHGPQTADELALMFGITSRRANSSLAM
FT                   AISKGRLIRVNQGGKFRYCIPGADLPAEPKAASITETDGKAFPQPAGVALPVGEAETQE
FT                   EIKTESVAVTVQSQPSFTRKHPDGLILPSLHVANRELRRAKGQVQKWERVCAALRELNK
FT                   CRDILRDITATREQQR"
FT   gene            375148..375429
FT                   /locus_tag="ARC77_02065"
FT   CDS_pept        375148..375429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02065"
FT                   /product="DNA-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02065"
FT                   /db_xref="GOA:A0A0H0MF88"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H0MF88"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000603384.1"
FT                   /protein_id="AMW45909.1"
FT                   /translation="MILRQCAGTMKVKSVGALIGRTEAAVRTKARELGISMMLRGDFHP
FT                   SAKYSQRDIELARQLHQRGMQRREIARKLGMPLRIVNNYVYFDRRVSA"
FT   gene            375426..375653
FT                   /locus_tag="ARC77_02070"
FT   CDS_pept        375426..375653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02070"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7C1T7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000699809.1"
FT                   /protein_id="AMW41107.1"
FT                   /translation="MKILYQDYGPVGQVVISSTVMEFRKHNRVVDAVLLTCPGISASRA
FT                   GVFIMKTKLYGSKAWIKKAYRVALQEVNSE"
FT   gene            375646..375957
FT                   /locus_tag="ARC77_02075"
FT   CDS_pept        375646..375957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02075"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02075"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152BIK7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001289673.1"
FT                   /protein_id="AMW41108.1"
FT                   /translation="MSEIKEMPVVRDGYGYWTHPEYEKFCDGREYISTEEFNAWMEENN
FT                   LQYVLCFRDEGCADLDACDADISAWEPERPEGDGWFIGSIHDTEDGPVCVWLRNKAEA"
FT   gene            376085..376303
FT                   /locus_tag="ARC77_02080"
FT   CDS_pept        376085..376303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02080"
FT                   /product="sugar acetyltransferase inhibitor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02080"
FT                   /db_xref="GOA:A0A0D6ZJY5"
FT                   /db_xref="InterPro:IPR025096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZJY5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000683609.1"
FT                   /protein_id="AMW41109.1"
FT                   /translation="MKHYLEKNYPRKSRTTEFLFFILFIVLMIPISPLLLVWIIGRTFE
FT                   PVIELYTDVTWESFSALHNKINPYKEN"
FT   gene            376305..376862
FT                   /locus_tag="ARC77_02085"
FT   CDS_pept        376305..376862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02085"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02085"
FT                   /db_xref="InterPro:IPR007539"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZJB3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000104474.1"
FT                   /protein_id="AMW41110.1"
FT                   /translation="MSTITRERAEIKSYITGFLSDSAHDNKSSDSLLANVFRIALASLE
FT                   AEPIAMVVPDEMDLLTCHLDGVTKTYADGWNACRVAMLQAGNFRENKNSSTNNFREISE
FT                   TSTRSPITLDGWISCTERMPEKSQNVLISMNIDSEAGPLIYSARYLGGTFRRGGIAVSP
FT                   GNDLRQATHWMSLPEPPQEVNQ"
FT   gene            377096..377308
FT                   /locus_tag="ARC77_02090"
FT   CDS_pept        377096..377308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02090"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02090"
FT                   /db_xref="GOA:A0A0D7C492"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7C492"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000882662.1"
FT                   /protein_id="AMW41111.1"
FT                   /translation="MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTR
FT                   KDLCEVRIRTGQTEVAVFVDYESEK"
FT   gene            377428..377772
FT                   /locus_tag="ARC77_02095"
FT   CDS_pept        377428..377772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02095"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02095"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZI51"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010846093.1"
FT                   /protein_id="AMW41112.1"
FT                   /translation="MKKVLIAALISGVSFGAFAQQGGFQGPEAERSTVAQAKELKDDAW
FT                   VILEGSIVKKVGDERYEFRDNSGTIVTDIDDSVWAGQNVSPKDKVRIEGEIDKDLSSVE
FT                   VDVKALKLLK"
FT   gene            377894..378166
FT                   /locus_tag="ARC77_02100"
FT   CDS_pept        377894..378166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02100"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DW99"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000191872.1"
FT                   /protein_id="AMW41113.1"
FT                   /translation="MTQHIKSHNSEADPEIKQGRRFRAPQYGWFHYLFCTIDEADMLQE
FT                   AYLRRGVCVERSLNADRLTWTVSVYLPVRAHLPRTHACYRQRVWR"
FT   gene            378168..379217
FT                   /locus_tag="ARC77_02105"
FT   CDS_pept        378168..379217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02105"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02105"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR010373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A140RTH5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016241288.1"
FT                   /protein_id="AMW41114.1"
FT                   /translation="MRVLLRPVLVPELGLVVLKPGRESLPVFHRGRVLVEPEPKNMRAL
FT                   PSGAVPAVRQPLAEDKSLLPFFSDERVIRAAGGAGALSDWLLRHVKSCQWPHGDYHHSE
FT                   TVIHSYGAGAMVLCWHCDNQLRDQTSESLEQLTQQNLTAWMIDVIRHVMNGTQERELSL
FT                   AELSWWAVCNQVVDALPEAVSRRSLGLPAEKIRSVYRESDIIPGEQTATSILKQRTKNI
FT                   ALPPHTHQQQNPPQEKTVVSIAVDPESPESFMKRPKRRRWVNEKYTRWVKTQPCACCGK
FT                   PADDPHHLIGHGQGGMGTKSHDIFTLPLCREHHNELHADPLAFEEKHGSQVDLIFRFLD
FT                   HAFATGVLG"
FT   gene            379230..379535
FT                   /locus_tag="ARC77_02110"
FT   CDS_pept        379230..379535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02110"
FT                   /product="endodeoxyribonuclease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02110"
FT                   /db_xref="GOA:A0A143DV53"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR016281"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DV53"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001686798.1"
FT                   /protein_id="AMW41115.1"
FT                   /translation="MRIEFVLPYPPTVNTYWRRRGSTYFVSKAGERYRRDVALIVRQQR
FT                   LKLNLSGRLAIKIIAEPPDKRRRDLDNILKAPLDALTHAGLLIDDEQFDEINIVRG"
FT   gene            379598..380152
FT                   /locus_tag="ARC77_02115"
FT   CDS_pept        379598..380152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02115"
FT                   /product="antiterminator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02115"
FT                   /db_xref="InterPro:IPR010557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3S6U2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000640035.1"
FT                   /protein_id="AMW41116.1"
FT                   /translation="MIYPEITGKSGEHLRLKTLESVWIQGKLRMWGRWSYIGDGKTGNM
FT                   FNQLLTSKKLTKTAINEALRRMKKAGLDKPELEAFLRDMINGNQKSWLAHCTDSEALII
FT                   DRVIGEVLAGYPGLLNVLSQRYVGRGMTKRKMAELLNDAHPEWSLRTCERRIEHWLKVA
FT                   EFILYKPMVMAFGIEKKVIAF"
FT   gene            380254..380574
FT                   /locus_tag="ARC77_02120"
FT   CDS_pept        380254..380574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02120"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02120"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZVB4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001302122.1"
FT                   /protein_id="AMW41117.1"
FT                   /translation="MTEKRHGALNALVVANTGLSTCWLFRQELLVCHVNRKREKDMLKQ
FT                   QDMTETARVVFNELSVTEPATVGEIAQNTYLSRERCQLILTQLVMAGLADYQCGCYRRI
FT                   QS"
FT   gene            380836..381423
FT                   /locus_tag="ARC77_02125"
FT   CDS_pept        380836..381423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02125"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02125"
FT                   /db_xref="GOA:A0A0D7C6E6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7C6E6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000558952.1"
FT                   /protein_id="AMW45910.1"
FT                   /translation="MHYGKVKIVDISESVVSQYLESQHKLTRTRLTDIPLYLLLEPNNP
FT                   ALAAALITSQGFSGEVTDMFLMMACLSLFETDERMSLFLSGCLSSISAKVRAIIQTDIS
FT                   ASWTLGAIALQLHMSESLLKTKLKNEGGMFSRLLLEERMRVAVNMLCSRYGYGQAVAEK
FT                   CGYSSRSYFISVFHRYYGFPPDRYVSRQGLDY"
FT   gene            381452..381527
FT                   /locus_tag="ARC77_02130"
FT   tRNA            381452..381527
FT                   /locus_tag="ARC77_02130"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:381485..381487,aa:Met,seq:cat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            381628..381704
FT                   /locus_tag="ARC77_02135"
FT   tRNA            381628..381704
FT                   /locus_tag="ARC77_02135"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:381662..381664,aa:Arg,seq:tct)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            381874..382305
FT                   /locus_tag="ARC77_02140"
FT   CDS_pept        381874..382305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02140"
FT                   /product="tellurite resistance protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02140"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTW2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000466957.1"
FT                   /protein_id="AMW41118.1"
FT                   /translation="MFGIFKKKTRRAATEIKKFEKRDLAQVVINAAYLVACADGECEAS
FT                   EKAKIEQVLRNQPALSAFTSEINAISATIIGQLDTNFKTGRRAALREIEDVKHDTREAE
FT                   DVLDVAVAIAEADGEIEPEERKVLEEIAGVLGLRLENHL"
FT   gene            382302..382469
FT                   /locus_tag="ARC77_02145"
FT   CDS_pept        382302..382469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02145"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02145"
FT                   /db_xref="GOA:A0A0D7BZP2"
FT                   /db_xref="InterPro:IPR025169"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7BZP2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000216636.1"
FT                   /protein_id="AMW41119.1"
FT                   /translation="MTVKLRLAVAALLLFLVVMVDFTSRIMSVLADGVLVCGIVVLLWP
FT                   VIKRNSLHNA"
FT   gene            382783..384633
FT                   /locus_tag="ARC77_02150"
FT   CDS_pept        382783..384633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02150"
FT                   /product="9-O-acetyl-N-acetylneuraminic acid deacetylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02150"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWP7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001358067.1"
FT                   /protein_id="AMW41120.1"
FT                   /translation="MSIKHYDVVRAASPSDLAEKLTHKLKEGWQPFGSPVAITPYTLMQ
FT                   AITAEGDVVVSGATEPDWYYVIVLAGQSNAMAYGEGLPLPDSYDAPDPRIKQLARRSTV
FT                   TPGGAACRYNDIIPADHCLHDVQDMSTLNHPKADLSKGQYGCVGQGLHIAKKLLPYIPN
FT                   NAGILLVPCCRGGSAFTQGAEGIFSESTGASQDSARWGVGKPLYQDLIARTKAALQKNP
FT                   KNVLLAVCWMQGEFDMSAATHAQQPALFTAMLTQFRADLSVFNAQCHGGSAADVPWICG
FT                   DTTYYWKNTYATQYDTVYGGYKNRESEGVYFVPFMTDGNGVNTATNAPAEDPDIPASGY
FT                   YGAASRTNGNQVSSNRPTHFSSWARRSIIPDRLATAILNAAGRTSAFISGKAPEIKPSP
FT                   GGNTPSGPSADTSVRTISLLPAAGEAAAQGWSIKDGGIQLSDGVFKITRQSNKTWSLTH
FT                   PVDDAITLLTQGGRLTCKFRLSGALTNNQFGLGIYLYTDAPVPDGVAMTGTGNPFLMSY
FT                   FTQTTDGRVNLMHHRKAGNTKLGEFGDYGNDWQTLELVFTAGSATVTPKLNGVAGPAFQ
FT                   VIKDSLTLGLNALTLTDVTKNAAYGVEIESLMLEINAPAA"
FT   gene            complement(384912..385073)
FT                   /locus_tag="ARC77_02155"
FT   CDS_pept        complement(384912..385073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02155"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DVF1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000075213.1"
FT                   /protein_id="AMW41121.1"
FT                   /translation="MSPSPPTENESKGKQKSRQCHPLTANAGSRDYGIQALLKMPDNIP
FT                   ASPDSGYK"
FT   gene            385081..385287
FT                   /locus_tag="ARC77_02160"
FT   CDS_pept        385081..385287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02160"
FT                   /product="holin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02160"
FT                   /db_xref="GOA:A0A143DWG5"
FT                   /db_xref="InterPro:IPR007054"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWG5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001453420.1"
FT                   /protein_id="AMW41122.1"
FT                   /translation="MEKITTGVSYTTSAVGTGYWLLQLLDKVSPSQWVAIGVLGSLLFG
FT                   LLTYLTNLYFKIKEDRRKAARGE"
FT   gene            385292..385636
FT                   /locus_tag="ARC77_02165"
FT   CDS_pept        385292..385636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02165"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02165"
FT                   /db_xref="InterPro:IPR009759"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3U2E4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:YP_002274180.1"
FT                   /protein_id="AMW41123.1"
FT                   /translation="MKKKYELVVKGINNYPDKITVTVALEIGGYPSLLLPDVAISLDRT
FT                   EGATLEFYEAEAKKQAKQFFMDVAAGLCEGDGPLPEKRPVILEAQDVLITYRGKLPGII
FT                   TGSLKTPPLA"
FT   gene            385687..386220
FT                   /locus_tag="ARC77_02170"
FT   CDS_pept        385687..386220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02170"
FT                   /product="lysozyme"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02170"
FT                   /db_xref="GOA:A0A143E900"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143E900"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001092971.1"
FT                   /protein_id="AMW41124.1"
FT                   /translation="MNAKIRYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTTAYRDG
FT                   AGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAIERDKALAWVEKNIRVPLTEPQKAG
FT                   IASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVSR
FT                   RDQESALACWGIDR"
FT   gene            386491..387060
FT                   /locus_tag="ARC77_02175"
FT   CDS_pept        386491..387060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02175"
FT                   /product="antirepressor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02175"
FT                   /db_xref="InterPro:IPR018875"
FT                   /db_xref="InterPro:IPR018877"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3VBR9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001056803.1"
FT                   /protein_id="AMW41125.1"
FT                   /translation="MNMMAVPFHGNSLYVVNHNGEPYVPMKPVVAGMGLAWQSQLAKLR
FT                   QRFASTITEIVMVAEDGKQRNMVSMPLRKLAGWLQTINPNKVKPEIRDKVIRYQEECDD
FT                   VLYEYWTKGFVVNPRKMSVMEELNQACADMKRDKNIASVFATGLNEWKQVKAAHVSKIR
FT                   TLVNEANMLIDFVLADTGKGKITKAD"
FT   gene            387060..387206
FT                   /locus_tag="ARC77_02180"
FT   CDS_pept        387060..387206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02180"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02180"
FT                   /db_xref="GOA:A0A0D6ZI54"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZI54"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000539782.1"
FT                   /protein_id="AMW41126.1"
FT                   /translation="MGWLMISDKLITLVKSLCVLVGISFLVMLVAIFFSTAWRVLTLSG
FT                   LVG"
FT   gene            387214..387681
FT                   /locus_tag="ARC77_02185"
FT   CDS_pept        387214..387681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02185"
FT                   /product="endopeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02185"
FT                   /db_xref="GOA:A0A143DYT6"
FT                   /db_xref="InterPro:IPR004929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DYT6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001082565.1"
FT                   /protein_id="AMW41127.1"
FT                   /translation="MNRVLCVVIIVLAVGYGALWLATNHYRDNALTYKAQRDKKARELE
FT                   QANATITDMQVRQRDVAALDAKYSRELADARAENETLRADVAAGRKRLRINATCSGTVR
FT                   EATGTSGVDNATGPRLADTAERDYFILRERLMTMQKQLEGAQDYIRTQCLN"
FT   gene            complement(388044..388271)
FT                   /locus_tag="ARC77_02190"
FT   CDS_pept        complement(388044..388271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02190"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02190"
FT                   /db_xref="InterPro:IPR025030"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7BWU6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000095656.1"
FT                   /protein_id="AMW41128.1"
FT                   /translation="MSSKNRPRRTTTRNIRFPNQMIEQINIALDQKGSENFSAWVIESC
FT                   RRELAADIKYARQLTIKKNDTQYALRWLFI"
FT   gene            388313..388678
FT                   /locus_tag="ARC77_02195"
FT   CDS_pept        388313..388678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02195"
FT                   /product="HNH nuclease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02195"
FT                   /db_xref="GOA:A0A0J5ZVX5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J5ZVX5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001427183.1"
FT                   /protein_id="AMW41129.1"
FT                   /translation="MAVLRTLPGRIKTLNTRRINVLRGEQRRVSGSARVSLKRRIWRRD
FT                   AGHCCLCRRVVDLCDSELDHRIALQFGGGNEETNLWTLCTECHRQKSASEAASGMPDPT
FT                   LPELPDGTLRADGITGL"
FT   gene            388641..388784
FT                   /locus_tag="ARC77_02200"
FT   CDS_pept        388641..388784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02200"
FT                   /product="DNase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02200"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWQ6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303919.1"
FT                   /protein_id="AMW41130.1"
FT                   /translation="MARSGPTESLACDQTRGGSSGEKKRSPWTPRPLSRREKIPVSGQL
FT                   TC"
FT   gene            388968..389531
FT                   /locus_tag="ARC77_02205"
FT   CDS_pept        388968..389531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02205"
FT                   /product="terminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02205"
FT                   /db_xref="GOA:A0A152IRG9"
FT                   /db_xref="InterPro:IPR005335"
FT                   /db_xref="InterPro:IPR038713"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152IRG9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000958360.1"
FT                   /protein_id="AMW41131.1"
FT                   /translation="MLTTQKRKFALALMSGKNKTASAIAAGYSAKTARVKGSQLAKDPE
FT                   VLAFIARKQCETVEVDEVPVYRQKKSEQEDKPRRREVAAIPQPDEKNPEMPPPAVISHG
FT                   IEYMEDGLPDPVKAMGQILVENLIIDPKLALDAAWRLAQFTHHKKGDAGKKSAKGDAAK
FT                   KAANRFAVPPPPRLVVNNQNEESG"
FT   gene            389528..391189
FT                   /locus_tag="ARC77_02210"
FT   CDS_pept        389528..391189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02210"
FT                   /product="terminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02210"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWH3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001299891.1"
FT                   /protein_id="AMW41132.1"
FT                   /translation="MIPVWSTACPDWAERLKKGLSIIPAPIYPDQAAHALAIFKQLRIV
FT                   DAPGSPTFGESCAPWVFDLVAALFGSYDAQTGVRHIKEVFILIPKKNSKSTLAAGIMMT
FT                   ALLLNWRQAAGYTILAPTVEVAANAFNPARDMVRRDDDLDDLCQVQTHIRTITHRVTDT
FT                   TLKVVAADPNTVSGIKSVGTLIDELWLFGKQYKAEDMLREAIGGLASRPEGFVVYTTTQ
FT                   SNEPPAGVFRQKLQYARDVRDGKIHDPHFLPVIFEHPPEMVESGAHLLMENLAMVNPNL
FT                   GYSVDEAFLYREYRKAREAGEETFRGFMSKHANVEIGLALRSDRWAGADFWEEQGRCIS
FT                   LDDILRRADVVTVGIDGGGLDDLLGMYVIGRDRETREWLGWGHAWAHETAVVRRKSEAS
FT                   RFQDFVACGDMTIVRRVGDDTAEVAEYVRRIHEAELLDHIGIDPSGVGQILDSLAEAGI
FT                   PDESVVGISQGWKLGGAIKTTERKLAEGVLIHGDQPLMAWCVGNARVEPKGNAILITKQ
FT                   ASGRGKIDPLMALFNAVSLMSLNPEPKKKAYEVFFI"
FT   gene            391253..393190
FT                   /locus_tag="ARC77_02215"
FT   CDS_pept        391253..393190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02215"
FT                   /product="phage capsid protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02215"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWC3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000173046.1"
FT                   /protein_id="AMW41133.1"
FT                   /translation="MTLKRACSLLTVKSFSEDERVITGIASTPSPDRDGDILEPEGAEF
FT                   GSTIPFLWQHDHSRPVGQCTVRRVREGLEITAMLVKPEPGMPSQMAARLDEAWAAIKTG
FT                   LVRGLSVGFRPHEYTYLDGGGLHFLRWELMEVSAVTVPANAECTIRTIKSFDRPFSAAS
FT                   GNRRPVVKIASSAGASAQSITSFHKEKSAMNTGEQIKSFENKRAALAASLEEIMNKAAE
FT                   EGRTLDVEEEEHYDNTAAEIRQVDAHLKRLRELETSKAATAQPVKQAGNGNVATVASAP
FT                   VIRVEQKLEKGIGFARFAKSLAAAKGVRSEALEVARRQYPDDSRLHHVLKSAVGVGTTT
FT                   DPQWAGSLSEYQEYAQDFIDYLRPQTIIGRFGQGGIPALRQVPFNIRVHAQVSGGAAGW
FT                   VGEGKAKPLTKFDFESITFSHAKVSAIAVLTEELIRFSSPAADALVRNALAEAVVARLD
FT                   TDFVDPKKAAVADVSPASITHDVKGTASSGNPDADAEAAFGQFVTANLQPTGAVWLMSS
FT                   TNALALSMRKNALGQKEYPDMTLLGGTFQGLPVIVSQYVGDQLVLVNAPDIYLADDGGV
FT                   AVDMSREASLEMQSEPTSDSSTPSPVELVSMFQTGSVAIRAERWINWRRRRTAAVAVIT
FT                   GVNYGTASGG"
FT   gene            393235..393456
FT                   /locus_tag="ARC77_02220"
FT   CDS_pept        393235..393456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02220"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02220"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143E8T1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001063105.1"
FT                   /protein_id="AMW45911.1"
FT                   /translation="MAKIQYLQGTHDARAGDIRDVAQPCAEVLVRLGKAEYITARRPAG
FT                   QKKKRDAEHGECGTFCGDPEKTRNQDVM"
FT   gene            393402..394766
FT                   /locus_tag="ARC77_02225"
FT   CDS_pept        393402..394766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02225"
FT                   /product="phage portal protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02225"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTX6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013009259.1"
FT                   /protein_id="AMW41134.1"
FT                   /translation="MWNLLRRPRKNQKSGRDVKEVGWTSLFQAVAEPFAGAWQQGVKAD
FT                   PESVLSFHAVFSCISLISQDIAKMRLRLMQTDTQGIRREKRQGDIARLCRRPNAQQNRI
FT                   QFFELWLNAKLRHGNTVVLKIRNSRGQIKELRILDWSRVEPLVADDGEVFYRITPDRNC
FT                   GITEAVTVPAREVIHDRFNCFFHPLVGLPPVYAAGLAATQGYHIQANSTSFFRNGGRPS
FT                   GVIEIPGSITEENAKKLKSNWDSGYTGENAGKTAILSNGAKYNPTTFSPVDAQTVEQLK
FT                   MTAEIVCSVFRVPAYKIGVGQPPSSDNVEALEQQYYSQCLQTLIESIELLLDEALETGE
FT                   NESTEFDVTTLLRMDSERRMKTLGESVKNTLLTPNEARKRENLPPLAGGDALYLQQQNY
FT                   SLEALSRRDAREDPFASSGKTVSAQLPDGASDGNKAISETEHDAVKAMFRGILRK"
FT   gene            394763..395500
FT                   /locus_tag="ARC77_02230"
FT   CDS_pept        394763..395500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02230"
FT                   /product="phage portal protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02230"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DV70"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000139870.1"
FT                   /protein_id="AMW41135.1"
FT                   /translation="MTERELSIIRALGEEFAMVLADLQRTFEEKIAAQAQTFEEKLASQ
FT                   SVVLQKCVTGDDVRPMLEQMVKEAVSHIPVPRDGRDYDPDVLQKAVNDAVSALPAPQDG
FT                   RDATALEILPAIDDQKSFPRGSYATHQGGLWRAYEKTYGMRGWECLVDGVADIDVSMTG
FT                   ERSFSVVVRQSSGQRTEKTFSLPVMLYRGVFRIGETYHPGDTVTWGGSLWHCNSMTGDK
FT                   PGEAHSSGWTLAAKRGRDAGGGK"
FT   gene            395497..395823
FT                   /locus_tag="ARC77_02235"
FT   CDS_pept        395497..395823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02235"
FT                   /product="DNA-packaging protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02235"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D6ZMZ5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000126020.1"
FT                   /protein_id="AMW41136.1"
FT                   /translation="MTALLTLEEIKAHLRVDHDADDDMLMDKVRQATAVLLAYIQGSRD
FT                   KVIREDGELIPGEALTRMKGAAMRLTGMLYRNPDLAEREELIQGELPFSVSVLIYDLRC
FT                   PTVL"
FT   gene            395833..396183
FT                   /locus_tag="ARC77_02240"
FT   CDS_pept        395833..396183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02240"
FT                   /product="head-tail adaptor protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02240"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DUI5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001007901.1"
FT                   /protein_id="AMW41137.1"
FT                   /translation="MAISAGRLTQMISVLNPVLTRNAAGEMTEEWVSCGKIHADIRGRS
FT                   SRERMQSGAEMAQAEIRIWVRGQSGREITAASRLHVLSGPWRDHVLNVVGVPVPDATGG
FT                   RLEILCRLGGEK"
FT   gene            396180..396626
FT                   /locus_tag="ARC77_02245"
FT   CDS_pept        396180..396626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02245"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02245"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H0PE89"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000573485.1"
FT                   /protein_id="AMW41138.1"
FT                   /translation="MIETLLDFSGLEDISRDLQLLSGAENNRVLREATRAGANVLKEEV
FT                   VSRAPVRRGKLRRNVVVLSRCSRDGGMESGVHIRGVNPDTGNSDNTMKADNPRNAFYWR
FT                   FVEMGTVNMPPHPFVRPAFDVRSEQAAQVAIARMNRAIDEVLRR"
FT   gene            396623..396967
FT                   /pseudo
FT                   /locus_tag="ARC77_02250"
FT   CDS_pept        396623..396967
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02250"
FT                   /product="hypothetical protein"
FT                   /note="internal stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000133390.1"
FT   gene            397026..397742
FT                   /locus_tag="ARC77_02255"
FT   CDS_pept        397026..397742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02255"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02255"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H0EMZ3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001275508.1"
FT                   /protein_id="AMW41139.1"
FT                   /translation="MSALYERSQLTQVMISSAPATAETMEKAEYLRLDCTIKEVQFTAG
FT                   QKQDIDVTTLCSTEQENINGLGASSEISMSGNFYLNQAQNALRDAYDNDTVYAFKVQFP
FT                   SGKGFKFLAEVRQHTWSSGTNGVVAATFSLRLKGKPVSYVVPLAFVKNLEKTLTVNTGA
FT                   LLTMSVSVNGGTPPYKHAWKKDGQPVEGQTTDTFSKANTQSGDKGAYTCEVTDSAEQPQ
FT                   SITSDACTVTVNGAGG"
FT   gene            397748..398122
FT                   /locus_tag="ARC77_02260"
FT   CDS_pept        397748..398122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02260"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02260"
FT                   /db_xref="InterPro:IPR010411"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR038556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3W3U5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:YP_001449302.1"
FT                   /protein_id="AMW41140.1"
FT                   /translation="MAKDLKTLALARLSGFRHKTVKVPEWRNVSVVLREPSAEAWYLWQ
FT                   EVLNGDGEDDDTLSVVAKTRRNLEADVTLFCDVLCDTDLQRVFTPDDREQVLAVYGPVH
FT                   ARLLRQALELIADAESARKK"
FT   gene            398146..398427
FT                   /locus_tag="ARC77_02265"
FT   CDS_pept        398146..398427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02265"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02265"
FT                   /db_xref="InterPro:IPR025116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3W4L5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001234272.1"
FT                   /protein_id="AMW41141.1"
FT                   /translation="MRLALRLGRTLSELRHSLSASEAMMWMEFDRVSPLGDERGDIRNA
FT                   QIVKAVFGAQGMNVALKDAMLCWGEDEDKPEVDPFAALEDALSLAAMS"
FT   gene            398479..401721
FT                   /locus_tag="ARC77_02270"
FT   CDS_pept        398479..401721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02270"
FT                   /product="phage tail tape measure protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02270"
FT                   /db_xref="InterPro:IPR006431"
FT                   /db_xref="InterPro:IPR009302"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWH9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000212852.1"
FT                   /protein_id="AMW41142.1"
FT                   /translation="MATLRELIIKISANSQSFQSEIQRASRMGSEYYRTLQNGGRQAAA
FT                   AAREQRRALAELNSQLTEIRGSAVGMAGAFAGAFASGHLISLADEWSSVNARLKQASQS
FT                   SDEFSSSQKVLMDISQRTGTAFSDNAALFARSAASMREYGYSAGDVLKVTEAISTGLKI
FT                   SGASTAEAGSVITQFSQALAQGVLRGEEFNSVNESGDRIVRALAAGMGVARKDLKAMAD
FT                   DGKLTADKVVPALISQLGILRDEYAAMPETVSSSITKVENAFMAWVGGANEASGVTKTL
FT                   SGMLNGVAGQIDNVATAVGALVAVGVARYFGNMASGAMSATAGLVTAARNEVALAEAQF
FT                   RGTQIATARARAAVYRAQQAVAAARGTEMQIAAEARLAATQERLNRNIAARTAAQNALN
FT                   STTAVGSRLMSGALGLVGGVPGLVMLGAAAWYTLYQNQEQARESARQYALTIDEIAHKT
FT                   PSMSLPEASDNEGRTRAALTEQNRLIDEQASRVKSLQEKIAGYQYVLANPGWTTGDGFM
FT                   INHLTSVKTVTEGLAQATEQLAVEQSRLAQMQEKAQSIQDVLAGLEDRRVALIRQQAAE
FT                   QNKVYQSMLVMNGQYTEFNRLLGLGNELLQQRQGLVNVPLRLPQATLDDKQQSALTKTE
FT                   RELALSRLKGEEKERVRLGYAADDLGFVGDPYQEARQRYISNALEAWRNNEVNKPKSRG
FT                   GKSETEKAEDSFSRLLKQQKEQLALVGQNTELAKLKYQTALGELKTLTEMQKQELLRNA
FT                   TLIDQQKIREQLRSREETLKNENAAARASNDAELLGYGQGERARERMRELQQIRDSFRQ
FT                   KDADLQSQYQTGDISEDFYRQALAQNAQYLSERLKDQAVFYAESDVQRADWQKGLQEGF
FT                   SNWVDNASDYASQAAQLATEGISGMVNNITEMLNGNKVEWRSWASSVLQEISKVLMNAA
FT                   IVNGIKTAANGMSGAGGFLGSIGDWLGGAVANAKGGVYTSANLSAYSNSIVDTPTYFAF
FT                   AKGAGLMGEAGPEAIMPLTRAADGSLGVRAVGSMNGSAGLVYSPVYHIAIQNDGANGQI
FT                   GPEAAGSLVQLIDQRVQAVMLSMRRDGGMLSG"
FT   gene            401714..402055
FT                   /locus_tag="ARC77_02275"
FT   CDS_pept        401714..402055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02275"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02275"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F0AC58"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000807959.1"
FT                   /protein_id="AMW41143.1"
FT                   /translation="MAEIKTLHLVPREGMQVSEKPSVVRVRFGDGYEQRRPTGLNPQLK
FT                   TFQAVFRVTDESTRRWLDEFLSWHGGYRAFLWRPPKHNRTVRVVCREWSVTDNARYSDF
FT                   SCTIEQVVN"
FT   gene            402055..402753
FT                   /locus_tag="ARC77_02280"
FT   CDS_pept        402055..402753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02280"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02280"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTY6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:YP_001449306.1"
FT                   /protein_id="AMW41144.1"
FT                   /translation="MQNIHEESLNESVKSEQSPRVVLWEIDLTVQGGERYFFCNELNEK
FT                   REPVTWQGRQYQAYPIEGSGFEMNGKGSSARPSLTVSNLFGLVTGMAEDLQRLVGATVV
FT                   RRRVYARFLDAVNFVAGNPEADPEQELRDRWVVEQMSELTAMTASFVLATPTETDGALF
FT                   PGRIMLANTCMWTYRSDECGYTGGAVADEFDNPTTDIRKDRCSKCMRGCEMRSMVANFG
FT                   GFLSINKLSQ"
FT   gene            402764..403507
FT                   /locus_tag="ARC77_02285"
FT   CDS_pept        402764..403507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02285"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02285"
FT                   /db_xref="GOA:A0A143DV79"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DV79"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001429645.1"
FT                   /protein_id="AMW41145.1"
FT                   /translation="MTQTESAILAHARRCAPAESCGFVISTPEGEWYIPCVNISAEPEA
FT                   YFRIAPEDWLRAEMQGEIVALVHSHPGGLPWLSEADRRLQIKSALPWWLVCRGDIHKFR
FT                   CVPHLTGRRFEHGVTDCYTLFRDAYHLAGTDMPDFEREDDWWRNGQNLYLDNMEATGFY
FT                   RISLPSAQPGDILLCCFGASVANHAAIYCGNGELLHHLPEQLSKRERYSEKWQRRTHSA
FT                   WRHRHWHVSAFTGIYNDLAAASACM"
FT   gene            403504..404085
FT                   /locus_tag="ARC77_02290"
FT   CDS_pept        403504..404085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02290"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02290"
FT                   /db_xref="GOA:A0A0F3VS49"
FT                   /db_xref="InterPro:IPR010654"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3VS49"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016247647.1"
FT                   /protein_id="AMW41146.1"
FT                   /translation="MNTAAEAIRALSLQVPGFRRQMNEGWYQIRIAGYDTAPEAVYARL
FT                   HEQLGEGTVIHIVPRLAGAGKGGLQIVLGAAAIVGSFFTAGASMALWGSALAAGGFSAT
FT                   TMLFSLGASMILGGVAQMLAPKAKTPDYRATDNGRQNTYFSSLDNMIAQGNPMPVPYGE
FT                   MLVGSRRISQDISTRDEGGGGTVVVVGRQG"
FT   gene            404428..405939
FT                   /pseudo
FT                   /locus_tag="ARC77_02295"
FT   CDS_pept        404428..405939
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02295"
FT                   /product="phage tail protein"
FT                   /note="incomplete; partial on complete genome; missing
FT                   stop; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000514848.1"
FT   gene            405942..408506
FT                   /pseudo
FT                   /locus_tag="ARC77_02300"
FT   CDS_pept        405942..408506
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02300"
FT                   /product="phage tail protein"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000514870.1"
FT   gene            408574..409173
FT                   /locus_tag="ARC77_02305"
FT   CDS_pept        408574..409173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02305"
FT                   /product="enterobacterial Ail/Lom family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02305"
FT                   /db_xref="GOA:A0A143DV23"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DV23"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001230282.1"
FT                   /protein_id="AMW41147.1"
FT                   /translation="MRKLYAAILSAAICLAVSGAPAWASEQQATLSAGYLHARTSAPGS
FT                   DNLNGINVKYRYEFTDTLGLVTSFSYAGDKNRQLTRYSDTRWHEDSVRNRWFSVMAGPS
FT                   VRVNEWFSAYAMAGVAYSRVSTFSGDYLRVTDNKGKTHDVLTGSDDGRHSNTSLAWGAG
FT                   VQFNPTESVAIDIAYEGSGSGDWRTDGFIVGVGYKF"
FT   gene            409238..410551
FT                   /locus_tag="ARC77_02310"
FT   CDS_pept        409238..410551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02310"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02310"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR009640"
FT                   /db_xref="InterPro:IPR013609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DTZ1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000279191.1"
FT                   /protein_id="AMW41148.1"
FT                   /translation="MAVKISGVLKDGTGKPVENCTIQLKARRNSATVVVNTVASENPDE
FT                   AGRYSMDVEYGQYSVILLVEGFPPSHAGTITVYEDSQPGTLNDFLGAMSEDDVRPEALR
FT                   RFELMVEEAARHAEEAKKNAGEAETSARNAGISASQAEESAANADTSAGDASESARQAA
FT                   ESAAAAKQSEEASSSSASAAAQKASESLQSATDAELSKKTAESAAGNAARDATTAAEKA
FT                   RESAESAQSAEQSRIAAEEAVNRIPTVVGPPGPKGEPGPAGPQGPKGDKGERGDTGPAG
FT                   ATGERGPAGDAGPAGPQGPKGDRGERGETGLTGNAGPQGPKGDTGAAGPAGPQGPKGET
FT                   GAAGPVGATGPQGPKGDPGETQIRFRLGPGNIIETNSNGWFPDTDGALITGLTFLAPKD
FT                   ATRVQVFFQHLQVRFGDGPWQDVKGLDEVGSDTGRTGE"
FT   gene            410553..410822
FT                   /locus_tag="ARC77_02315"
FT   CDS_pept        410553..410822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02315"
FT                   /product="phage tail protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02315"
FT                   /db_xref="InterPro:IPR009640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7C2R5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001358861.1"
FT                   /protein_id="AMW41149.1"
FT                   /translation="MNILKKLMQRLCGCGKHDDREHGELLTAQLRLGPADILESDENGI
FT                   IPEQDRVITQVVILDADKKQIQCVVRPLQILRADGTWENIGGMK"
FT   gene            410936..411511
FT                   /locus_tag="ARC77_02320"
FT   CDS_pept        410936..411511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02320"
FT                   /product="T3SS effector NleG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02320"
FT                   /db_xref="GOA:A0A152VQ51"
FT                   /db_xref="InterPro:IPR010489"
FT                   /db_xref="InterPro:IPR038436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152VQ51"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001131658.1"
FT                   /protein_id="AMW41150.1"
FT                   /translation="MPLTSDIRSHSFNLGVEVVRARIVANGRGDITVGGETVSIVYDST
FT                   NGRFSSSGGNGGLLSELLLLGFNSGPRALGERMLSMLSDSGEAQSQESIQNKISQCKFS
FT                   VCPERLQCPLEAIQCPITLEQPEKGIFVKNSDGSDVCTLFDAAAFSRLVGEGLPHPLTR
FT                   EPITASIIVKHEECIYDDTRGNFIIKGN"
FT   gene            411812..412213
FT                   /locus_tag="ARC77_02325"
FT   CDS_pept        411812..412213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02325"
FT                   /product="T3SS effector protein NleG8"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02325"
FT                   /db_xref="GOA:A0A152VQA1"
FT                   /db_xref="InterPro:IPR010489"
FT                   /db_xref="InterPro:IPR038436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152VQA1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001301906.1"
FT                   /protein_id="AMW45912.1"
FT                   /translation="MALERQLNGGVDFLSSVNNYFQSVMAEHRENKTGNKILMEKINSC
FT                   VFGTDSNHFSCPESFLTCPITLDTPETGVFMRNSRGAEICSLYDKDALVQLVETGGTHP
FT                   LSREPITESMIMRKDECHFDAKREAFCCK"
FT   gene            412295..412936
FT                   /locus_tag="ARC77_02330"
FT   CDS_pept        412295..412936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02330"
FT                   /product="T3SS effector NleG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02330"
FT                   /db_xref="GOA:A0A143DVH5"
FT                   /db_xref="InterPro:IPR010489"
FT                   /db_xref="InterPro:IPR038436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DVH5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:YP_002274209.1"
FT                   /protein_id="AMW41151.1"
FT                   /translation="MPVDLTPYILPGVSFLSDIPQETLSEIRNQTIRGEAQVRLGELMV
FT                   SIRPMQVNGYFMGSLNQDGLSNDNIQIGLQYIEHIERTLNHGSLTSREVTVLREIEMLE
FT                   NMELLSNYQLEELLDKIEVCAFNVEHAQLQVPESLRTCPVTLCEPEDGVFMRNSMNSNV
FT                   CMLYDKMALIYLVKTRAAHPLSRESIAVSMIVGRDNCAFDSDRGNFVLKN"
FT   gene            complement(413098..413304)
FT                   /locus_tag="ARC77_02335"
FT   CDS_pept        complement(413098..413304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02335"
FT                   /product="damage-inducible protein DinI"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02335"
FT                   /db_xref="InterPro:IPR010391"
FT                   /db_xref="InterPro:IPR036687"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7A0X4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001123911.1"
FT                   /protein_id="AMW41152.1"
FT                   /translation="MPKGSVPALQQEMLRRVSKRYDDVEVIIKSTSNDGLSVTRTADKD
FT                   SAKTFVQETLKDTWESADEWFVR"
FT   gene            413472..414755
FT                   /locus_tag="ARC77_02340"
FT   CDS_pept        413472..414755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02340"
FT                   /product="symporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02340"
FT                   /db_xref="GOA:C3T9I8"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9I8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000347465.1"
FT                   /protein_id="AMW41153.1"
FT                   /translation="MDFQLYSLGAALVFHEIFFPESSTAMALILAMGTYGAGYVARIVG
FT                   AFIFGKMGDRIGRKKVLFITITMMGICTTLIGVLPTYAQIGVFAPILLVTLRIIQGLGA
FT                   GAEISGAGTMLAEYAPKGKRGIISSFVAMGTNCGTLSATAIWAFMFFILSKEELLAWGW
FT                   RIPFLASVVVMVFAIWLRMNLKESPVFEKVNDSNQPTAKPAPAGSIFQSKSFWLATGLR
FT                   FGQAGNSGLIQTFLAGYLVQTLLFNKAIPTDALMISSIPGFMTIPFLGWLSDKIGRRIP
FT                   YIIMNTSAIVLAWPMLSIIVDKSYAPSTIMVALIVIHNCAVLGLFALENITMAEMFGCK
FT                   NRFTRMAISKEIGGLIASGFGPILAGIFCTMTESWYPIAIMIMAYSVIGLISALKMPEV
FT                   KDRDLSALEDAAEDQPRVVRAAQPSRSL"
FT   gene            414844..416304
FT                   /locus_tag="ARC77_02345"
FT   CDS_pept        414844..416304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02345"
FT                   /product="D-mannonate oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02345"
FT                   /db_xref="GOA:C3T9J2"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9J2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000527796.1"
FT                   /protein_id="AMW41154.1"
FT                   /translation="MGNNLLSAKATLPVYDRNNLAPRIVHLGFGAFHRAHQGVYADILA
FT                   TEHFSDWGYYEVNLIGGEQQIADLHQQDNLYTVAEMSADAWTARVVGVVKKALHVQIDG
FT                   LETVLAAMCEPQIAIVSLTITEKGYFHSPATGQLMLDHPMVAADVQNPHQPKTATGVIV
FT                   EALARRKAAGLPAFTVMSCDNMPENGHVMRDVVTSYAQAVDVKLAQWIEDNVTFPSTMV
FT                   DRIVPAVTEDTLAKIEQLTGVRDPAGVACEPFRQWVIEDNFVAGRPEWEKAGAELVSDV
FT                   LPYEEMKLRMLNGSHSFLAYLGYLAGYQHINDCMEDEHYRHAAYALMLQEQAPTLKVQG
FT                   VDLQDYANRLIARYSNPALRHRTWQIAMDGSQKLPQRMLDSVRWHLAHDSKFDLLALGV
FT                   AGWMRYVGGVDEQGNPIEISDPLLPVIQKAVQSSAEGKARVQSLLAIKAIFGGDLPDNS
FT                   LFTAKVTEAYLSLLAHGAKATVAKYSVK"
FT   gene            complement(416340..416543)
FT                   /locus_tag="ARC77_02350"
FT   CDS_pept        complement(416340..416543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02350"
FT                   /product="selenoprotein YdfZ"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02350"
FT                   /db_xref="InterPro:IPR017704"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9J7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014883679.1"
FT                   /protein_id="AMW41155.1"
FT                   /translation="MTTYDRNRNAITTGSRVMVSGTGHTGKILSIDTEGLTAEQIRRGK
FT                   TVVVEGCEEKLAPLDLIRLGMN"
FT   gene            complement(416720..417406)
FT                   /locus_tag="ARC77_02355"
FT   CDS_pept        complement(416720..417406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02355"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02355"
FT                   /db_xref="GOA:C3T9K2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9K2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005121143.1"
FT                   /protein_id="AMW41156.1"
FT                   /translation="MTVETQLNPTQPVNQQIYRILRRDIVHCLIAPGTPLSEKEVSVRF
FT                   NVSRQPVREAFIKLAENGLIQIRPQRGSYVNKISMAQVRNGSFIRQAIECAVARRAASM
FT                   ITESQCYQLEQNLHQQRIAIERKQLDDFFELDDNFHQLLTQIADCQLAWDTIENLKATV
FT                   DRVRYMSFDHVSPPEMLLRQHLDIFSALQKRDGDAVERAMTQHLQEISESVRQIRQENS
FT                   DWFSEE"
FT   gene            complement(417495..418241)
FT                   /locus_tag="ARC77_02360"
FT   CDS_pept        complement(417495..418241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02360"
FT                   /product="NAD(P)-dependent oxidoreductase"
FT                   /note="NADP(+)-dependent; catalyzes the formation of
FT                   3-hydroxypropionate from the toxic malonic semialdehyde,
FT                   catalyzes the formation of 2-aminomalonate-semialdehyde
FT                   from L-serine; can also use 3-hydroxybutyrate,
FT                   3-hydroxy-isobutyrate, D-threonine,
FT                   L-allo-threonine,D-serine; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02360"
FT                   /db_xref="GOA:C3T9K7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9K7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000636568.1"
FT                   /protein_id="AMW41157.1"
FT                   /translation="MIVLVTGATAGFGECITRRFIQQGHKVIATGRRQERLQELKDELG
FT                   DNLYIAQLDVRNRAAIEEMLASLPAEWCNIDILVNNAGLALGMEPAHKASIEDWETMID
FT                   TNNKGLVYMTRAVLPGMVERNHGHIINIGSTAGSWPYAGGNVYGATKAFVRQFSLNLRT
FT                   DLHGTAVRVTDIEPGLVGGTEFSNVRFKGDDGKAEKTYQNTVALTPEDVSEAVWWVSTL
FT                   PAHVNINTLEMMPVTQSYAGLNVHRQ"
FT   gene            418378..420423
FT                   /locus_tag="ARC77_02365"
FT   CDS_pept        418378..420423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02365"
FT                   /product="dipeptidyl carboxypeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02365"
FT                   /db_xref="GOA:C3T9L3"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9L3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001355378.1"
FT                   /protein_id="AMW41158.1"
FT                   /translation="MTTINPFLVQSTLPYLAPHFDQIANHHYRPAFDEGIQQKRAEIAA
FT                   IALNPQTPDFNNTILALEQSGELLTRVTSVFFAMTAAHTNDELQRLDEQFSAELAELAN
FT                   DIYLNGELFARVDAVWQRRESLGLDSESIRLVEVIHQRFVLAGAKLAQADKAKLKVLNT
FT                   EAATLTSQFNQRLLAANKSGGLVVNDIAQLAGMSEQEIALAAEAAREKGLDNKWLIPLL
FT                   NTTQQPALAEMRDRATREKLFIAGWTRAEKNDANDTRAIIQRLVEIRAQQATLLGFPHY
FT                   AAWKIADQMAKTPEAALNFMREIVPAARQRASDELASIQAVIDKQQGGFSAQPWDWAFY
FT                   AEQVRREKFDLDEAQLKPYFELNTVLNEGVFWTANQLFGIKFVERFDIPVYHPDVRVWE
FT                   IFDHNGVGLALFYGDFFARDSKSGGAWMGNFVEQSTLNETHPVIYNVCNYQKPAAGEPA
FT                   LLLWDDVITLFHEFGHTLHGLFARQRYATLSGTNTPRDFVEFPSQINEHWATHPQVFAR
FT                   YARHYQSGAAMPDELQQKMRNASLFNKGYEMSELLSAALLDMRWHCLEENEAMQDVDDF
FT                   ELRALVAENMDLPAIPPRYRSSYFAHIFGGGYAAGYYAYLWTQMLADDGYQWFVEQGGL
FT                   TRENGLRFREAILSRGNSEDLERLYRQWRGKAPQIMPMLQHRGLNI"
FT   gene            complement(420468..420986)
FT                   /locus_tag="ARC77_02370"
FT   CDS_pept        complement(420468..420986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02370"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02370"
FT                   /db_xref="GOA:C3T9L7"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9L7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001024558.1"
FT                   /protein_id="AMW41159.1"
FT                   /translation="MNINRNKIVQLADTDTIENLTSALSQRLIADQLRLTTAESCTGGK
FT                   LASALCAAEDTPKFYGAGFVTFTDQAKMKILSVSQQSLERYSAVSEKVAAEMATGAIER
FT                   ADADVSIAITGYGGPEGGEDGTPAGTVWFAWHIKGQNYTAVMHFAGDCETVLALAVRFA
FT                   LAQLLQLLL"
FT   gene            421262..421654
FT                   /locus_tag="ARC77_02375"
FT   CDS_pept        421262..421654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02375"
FT                   /product="TIGR00156 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02375"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9M2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000671724.1"
FT                   /protein_id="AMW41160.1"
FT                   /translation="MKFQAIVLASFLVIPYALADDQGGLKQDAAPPPPHAIEDGYRGTD
FT                   DAKKMTVDFAKTMHDGASVSLRGNLISHKGEDRYVFRDKSGEINVVIPATVFDGREVQP
FT                   DQMINISGSLDKKSAPAVVRVTHLQK"
FT   gene            421909..422799
FT                   /locus_tag="ARC77_02380"
FT   CDS_pept        421909..422799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02380"
FT                   /product="diguanylate cyclase"
FT                   /note="required for pgaD induction; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02380"
FT                   /db_xref="GOA:C3T9M8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9M8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016247232.1"
FT                   /protein_id="AMW41161.1"
FT                   /translation="MIKKTTEIDAILLNLNKAIDAHYQWLVSMFHSVVARDASKPEITD
FT                   NHSYGLCQFGRWIDHLRPLDNDELPYVRLMDSAHQHMHNCGRELMLAIVENHWQDAHFD
FT                   AFQEGVLSFTAALTDYKIYLLTIRSNMDVLTGLPGRRVLDESFDHQLRNTEPLNLYLML
FT                   LDIDRFKLVNDTYGHLIGDVVLRTLATYLASWTRDYETVYRYGGEEFIIIVKAANDEEA
FT                   CRAGVRICQLVDNHAITHSEGHINITVTAGVSRAFPEETLDVVIGRADRAMYEGKQTGR
FT                   NRCMFIDEQNVINRV"
FT   gene            complement(423018..423113)
FT                   /locus_tag="ARC77_02385"
FT   CDS_pept        complement(423018..423113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02385"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02385"
FT                   /db_xref="GOA:A0A152VQV3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152VQV3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003032406.1"
FT                   /protein_id="AMW41162.1"
FT                   /translation="MLGNMNVFMAILGIILFSGFLAAYFSHKWDD"
FT   gene            complement(423221..424213)
FT                   /gene="ftrA"
FT                   /locus_tag="ARC77_02390"
FT   CDS_pept        complement(423221..424213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftrA"
FT                   /locus_tag="ARC77_02390"
FT                   /product="transcriptional regulator"
FT                   /note="upregulated by FixLJ/FixK under oxygen limitation;
FT                   involved in regulation of genes involved in carbon and
FT                   amino acid metabolism; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02390"
FT                   /db_xref="GOA:A0A143DWE9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWE9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001688544.1"
FT                   /protein_id="AMW41163.1"
FT                   /translation="MPEMSKMMTTLQRPLVIALAYDGLCTFEFGVAVEIFGLPRPELGD
FT                   NWYRFAVAAVEPGALQATGGIHVVADGGLELLPNADMIIIPGWRGIDAKVPEMLCQSLR
FT                   EAHQRGTRLVSICSGVFVLAAAGLLHQRKATTHWRYTEQLQHRYPSISVSDNVLYQDEG
FT                   QVMTSAGSAAGIDLCLHIVRKDFGHEIANNVARRLVIQPHRQGDQPQNLTRPMASPRES
FT                   QTLGALFDFLQQNLAQTHTVSSLAERVNMSPRTFLRRFEALTGMTPARWLLNERLIRVQ
FT                   DYLQNSVFNIEKIAELTGFGNSALLRHHFHQRFLLSPSQYRKNSRSPSQ"
FT   gene            424287..424682
FT                   /locus_tag="ARC77_02395"
FT   CDS_pept        424287..424682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02395"
FT                   /product="rhodanese"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02395"
FT                   /db_xref="GOA:A0A085NXC2"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085NXC2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001271101.1"
FT                   /protein_id="AMW41164.1"
FT                   /translation="MRYVTEFTTAKPEVAEAHFLARLSVETDCADVHDSLAYIGDDFVL
FT                   LHVVGREEDFARRHIPGALHLPHKQMTAERMAEWPDDTLFVVYCAGPHCNGADRAALKL
FT                   ARLGKPVKIMLGGITGWEDEGYAFASE"
FT   gene            complement(424723..425910)
FT                   /locus_tag="ARC77_02400"
FT   CDS_pept        complement(424723..425910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02400"
FT                   /product="transporter"
FT                   /note="YdeF; uncharacterized member of the major
FT                   facilitator superfamily (MFS) of transporters; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02400"
FT                   /db_xref="GOA:C3T9N2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9N2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001357328.1"
FT                   /protein_id="AMW41165.1"
FT                   /translation="MNLSLRRSTSALLASSLLLTIGRGATLPFMTIYLSRQYSLSVDLI
FT                   GYAMTIALTIGVVFSLGFGILADKFDKKRYMLLAITAFASGFIAIPLVNNVTLVVLFFA
FT                   LINCAYSVFATVLKAWFADNLSSTSKTKIFSINYTMLNIGWTVGPPLGTLLVMQSINLP
FT                   FWLAAICSAFPMFFIQIWVKRSEKIIATETGSVWSPKVLLQDKALLWFTCSGFLASFVS
FT                   GAFASCISQYVMVIADGDFAEKVVAVVLPVNAAMVVTLQYSVGRRLNPANIRALMTAGT
FT                   LCFVIGLIGFIFSGNSLLLWGMSAAVFTVGEIIYAPGEYMLIDHIAPPGMKASYFSAQS
FT                   LGWLGAAVNPLVSGVVLTTLPSSSLFIILALVIIAAWALMLKGINARPQRQPALC"
FT   gene            426105..427004
FT                   /locus_tag="ARC77_02405"
FT   CDS_pept        426105..427004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02405"
FT                   /product="acetylserine transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02405"
FT                   /db_xref="GOA:C3T9N8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9N8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000087230.1"
FT                   /protein_id="AMW41166.1"
FT                   /translation="MSRKDGVLALLVVVVWGLNFVVIKVGLHNMPPLMLAGLRFMLVAF
FT                   PAIFFVARPKVPLNLLLGYGLTISFAQFAFLFCAINFGMPAGLASLVLQAQAFFTIVLG
FT                   AFTFGERLHGKQLAGIALAISGVLVLIEDSFNGQHVAMLGFMLTLAAAFSWASGNIFNK
FT                   KIMSHSSRPAVMSLVVWSALIPIIPFFVASLILDGSGKMIHSLVTIDMTTILALMYLAF
FT                   VATIVGYGIWGTLLGRYETWRVAPLSLLVPVVGLASAALLLDERLTGLQFLGAVLIMAG
FT                   LYINVFGLQWRKAVKVRG"
FT   gene            complement(427035..427253)
FT                   /locus_tag="ARC77_02410"
FT   CDS_pept        complement(427035..427253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02410"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02410"
FT                   /db_xref="InterPro:IPR025732"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9P2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016240862.1"
FT                   /protein_id="AMW41167.1"
FT                   /translation="MKPLLSAIAAALILFSAQGVAEQTQQPLVTSCGDVVVVPPSQEQP
FT                   PFDLNHMGTGSDKSDALGVPYYNQQAM"
FT   gene            complement(427285..427668)
FT                   /locus_tag="ARC77_02415"
FT   CDS_pept        complement(427285..427668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02415"
FT                   /product="transcriptional regulator"
FT                   /note="transcriptional activator of genes involved in the
FT                   multiple antibiotic resistance (Mar) phenotype; also
FT                   activates sodA, zwf and micF; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02415"
FT                   /db_xref="GOA:W8T1J8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:W8T1J8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005757329.1"
FT                   /protein_id="AMW41168.1"
FT                   /translation="MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRM
FT                   FKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPP
FT                   HKYRMTNMQGESRFLHPLNHYNS"
FT   gene            complement(427688..428122)
FT                   /locus_tag="ARC77_02420"
FT   CDS_pept        complement(427688..428122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02420"
FT                   /product="transcriptional regulator"
FT                   /note="Repressor of the marRAB operon which is involved in
FT                   the activation of both antibiotic resistance and oxidative
FT                   stress genes; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02420"
FT                   /db_xref="GOA:Q9AGA4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AGA4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003857182.1"
FT                   /protein_id="AMW41169.1"
FT                   /translation="MKSTSDLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKV
FT                   LCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTSG
FT                   AAICEQCHQLVGQDLHQELTKNLTADEVATLEHLLKKVLP"
FT   gene            428334..428999
FT                   /locus_tag="ARC77_02425"
FT   CDS_pept        428334..428999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02425"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02425"
FT                   /db_xref="GOA:C3T9Q8"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9Q8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000885036.1"
FT                   /protein_id="AMW41170.1"
FT                   /translation="MLDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNGAERNRQSL
FT                   MASVYVFAIMMVAYYAGQLVMDTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAIDSPEA
FT                   KSKSEELEDEPSANIAFVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLI
FT                   FFLVAVILWGSLRSSGAIMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEIIKTNH"
FT   gene            complement(429024..430214)
FT                   /locus_tag="ARC77_02430"
FT   CDS_pept        complement(429024..430214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02430"
FT                   /product="sugar transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02430"
FT                   /db_xref="GOA:C3T9R4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023495"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9R4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001524721.1"
FT                   /protein_id="AMW41171.1"
FT                   /translation="MTTNTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHM
FT                   QTAQVGIMLTIYAWVVALMSLPFMLMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVL
FT                   VISRIGVAFAHAIFWSITASLAIRMAPAGKRAQALSLIATGTALAMVLGLPLGRIVGQY
FT                   FGWRMTFFAIGIGALITLLCLIKLLPLLPSEHSGSLKSLPLLFRRPALMSIYLLTVVVV
FT                   TAHYTAYSYIEPFVQNIAGFSANFATALLLLLGGAGIIGSVIFGKLGNQYASALVSTAI
FT                   ALLLVCLALLLPAANSEIHLGVLSIFWGIAMMIIGLGMQVKVLALAPDATDVAMALFSG
FT                   IFNIGIGAGALVGNQVSLHLSMSMIGYVGTVPAFAALIWSIIIFRRWPVTLEEQTQ"
FT   gene            complement(430365..430634)
FT                   /locus_tag="ARC77_02435"
FT   CDS_pept        complement(430365..430634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02435"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02435"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152VQW2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001356459.1"
FT                   /protein_id="AMW41172.1"
FT                   /translation="MFLFFANMLLHYHQFMNPNESDLNDVLMPASLSDDKIIKHMARKT
FT                   LKLFVKNETPPKVTHEDLVKNRPRSPVRPPIPATSKTPDIPDRH"
FT   gene            complement(430692..431480)
FT                   /locus_tag="ARC77_02440"
FT   CDS_pept        complement(430692..431480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02440"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02440"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9R7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000258593.1"
FT                   /protein_id="AMW41173.1"
FT                   /translation="MVTPVSISNYISLPDDFPVRNIAPQVKEVLKDFIDALSTIICNEE
FT                   WRTSLNINSATKKIFNNLDNLSYIQRTSFRGNDTLYNEKVQFKLTYPARNGRHKENIEF
FT                   QVVINLSPIYLDNFRHDGEINIFCAPNPKPVTMGRVFQTGVERVLFLFLNDFIEQFPMI
FT                   NPGVPIKRAHTPHIEPLPPDHHTAADYLRQFDLLVLNFISRGNFVILPRLWNNSEVHRW
FT                   FVNKDPNLITAILDITDSELKEDLLQSLMDSLGSNKHVLP"
FT   gene            complement(431558..432439)
FT                   /locus_tag="ARC77_02445"
FT   CDS_pept        complement(431558..432439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02445"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02445"
FT                   /db_xref="GOA:C3T9S2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9S2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000366516.1"
FT                   /protein_id="AMW41174.1"
FT                   /translation="MDLTQLEMFNAVAEAGSITQAAAIVHRVPSNLTTRLRQLETELGV
FT                   DLFIRENQRLRLSPAGHNFLRYSQQILALVDEARSVVAGDEPQGLFSLGSLESTAAVRI
FT                   PATLAEFNRRYPKIQFSLSTGPSGTMLEGVLEGKLNAAFIDGPINHTAIDGIPVYREEL
FT                   MIVTPQGHAPVIRASQVNGSNIYAFRANCSYRRHFESWFHADGAAPGTIHEMESYHGML
FT                   ACVVAGAGIALIPRSMLESMPGHHQVEAWPLAEQWCWLTTWLVWRRGAKTRPLEAFIQL
FT                   LDVPDSTKQGYQ"
FT   gene            432540..433928
FT                   /locus_tag="ARC77_02450"
FT   CDS_pept        432540..433928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02450"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02450"
FT                   /db_xref="GOA:A0A152VR41"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152VR41"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000156785.1"
FT                   /protein_id="AMW41175.1"
FT                   /translation="MTITPATHAISINPATGEQLSVLPWAGADDIENALQLAAAGFRDW
FT                   RETNIDYRAEKLRDIGKALRARSEEMAQMITREMGKPINQARAEVAKSANLCDWYAEHG
FT                   PAMLKAEPTLVENQQAVIEYRPLGTILAIMPWNFPLWQVMRGAVPIILAGNGYLLKHAP
FT                   NVMGCAQLIAQVFKDAGIPQGVYGWLNADNDGVTQMIKDSRIAAITVTGSVRAGAAIGA
FT                   QAGAALKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIIEEGIA
FT                   SAFTERFVAAAAALKMDDPRDEENALGPMARFDLRDELHHQVEKTLAQGARLLLGGEKM
FT                   AGAGNYYPPTVLANVTPEMTAFREEMFGPVAAITIAKDAEHALELANDSEFGLSATIFT
FT                   TDETQARQMAARLECGGVFINGYCASDARVAFGGVKKSGFGRELSHFGLHEFCNIQTVW
FT                   KDRI"
FT   gene            433992..434918
FT                   /locus_tag="ARC77_02455"
FT   CDS_pept        433992..434918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02455"
FT                   /product="glutaminase"
FT                   /note="catalyzes the formation of glutamate from glutamine;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02455"
FT                   /db_xref="GOA:C3T9T2"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9T2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016153077.1"
FT                   /protein_id="AMW41176.1"
FT                   /translation="MAVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAI
FT                   CTVDGQLFQAGDAQERFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQL
FT                   EMEQGIPRNPFINAGALVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFE
FT                   HSARNAAIAWLMKSFGNFHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHID
FT                   EPVVTPMQARQINALMATSGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSP
FT                   ELDDAGNSLAGIAVLEQLTKQLGRSVY"
FT   gene            434918..435277
FT                   /locus_tag="ARC77_02460"
FT   CDS_pept        434918..435277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02460"
FT                   /product="DUF4186 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02460"
FT                   /db_xref="InterPro:IPR020378"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9T8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016153078.1"
FT                   /protein_id="AMW41177.1"
FT                   /translation="MQSLDPLFARLSRSKFRSRFRLGMKERQYCLEKGAPVIEQHAADF
FT                   VAKRLAPALPANDGKQTPMRGHPVFIAQHATATCCRGCLAKWHNIPHGVSLSEEQQRYI
FT                   VAVIYHWLVVQMNQP"
FT   gene            435416..436834
FT                   /locus_tag="ARC77_02465"
FT   CDS_pept        435416..436834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02465"
FT                   /product="diguanylate cyclase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02465"
FT                   /db_xref="GOA:A0A143DU20"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DU20"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000558031.1"
FT                   /protein_id="AMW41178.1"
FT                   /translation="MHVHPISTFRVFQEGHLLRNSIAIFALTTLFYFIGAELRLVHELS
FT                   LFWPLNGVMAGVFARYVWLNRLHYYAISYVAMLVYDAITTEWGLVSLAINFSNMMFIVT
FT                   VALLVVRDKRLGKNKYEPVSALRLFNYCLIAALLCAIVGAIGSVSIDSLDFWPLLADWF
FT                   SEQFSTGVLIVPCMLTLAIPGVLPRFKAEQMMPAIALIVSVIASVVIGGAGSLAFPLPA
FT                   LIWCAVRYTPQVTCLLTFVTGAVEIVLVANSVIDISVGSPFSIPQMFSARLGIATMAIC
FT                   PIMVSFSVAAINSLMKQVALRADFDFLTQVYSRSGLYEALKSPSLKQTQHLTVMLLDID
FT                   YFKSINDNYGHECGDKVLSVFARHIQKIVGDKGLVARMGGEEFAVAVPSVNPVDGLLMA
FT                   EKIRKGVELQPFTWQQKTLYLTVSIGVGSGRASYRTLTDDFNKLMVEADTCLYRSKKDG
FT                   RNRTSTMRYGEEVV"
FT   gene            437061..438512
FT                   /locus_tag="ARC77_02470"
FT   CDS_pept        437061..438512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02470"
FT                   /product="altronate oxidoreductase"
FT                   /note="catalyzes the formation of D-tagaturonate from
FT                   D-altronate; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02470"
FT                   /db_xref="GOA:A0A143DU37"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023668"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DU37"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016248689.1"
FT                   /protein_id="AMW41179.1"
FT                   /translation="MKTLNRRDFPGAQYPERIIQFGEGNFLRAFVDWQIDLLNEHTDLN
FT                   SGVVVVRPIETSFPPSLSTQDGLYTTIIRGLNEKGEAVSDARLIRSVNREISVYSEYDE
FT                   FLKLAHNPEMRFVFSNTTEAGISYHAGDKFDDAPAVSYPAKLTRLLFERFSHFNGALDK
FT                   GWIIIPCELIDYNGDALRELVLRYAQEWALPEAFIQWLDQANSFCSTLVDRIVTGYPRD
FT                   EVAKLEEEPGYHDGFLDTAEHFYLFVIQGPKSLATELRLDKYPLNVLIVDDIKPYKERK
FT                   VAILNGAHTALVPVAFQAGLDTVGEAMNDAEICAFVEKAIYEEIIPVLDLPRDELESFA
FT                   SAVTGRFRNPYIKHQLLSIALNGMTKFRTRILPQLLAGQKANGTLPARLTFALAALIAF
FT                   YRGERNGETYPVQDDAHWLERYQQLWSQHRDRVIGTQELVAIVLAEKDHWEQDLTQVPG
FT                   LVEQVANDLDAILEKGMREAVRPLC"
FT   gene            complement(438559..438759)
FT                   /locus_tag="ARC77_02475"
FT   CDS_pept        complement(438559..438759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02475"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02475"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152VQX5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012602350.1"
FT                   /protein_id="AMW41180.1"
FT                   /translation="MPDKNTAQPVLLWTNNHGYLQAWKSRPIKRDYDHILKTLLTNYLQ
FT                   NYNINRCCMWHLLMIKAYRML"
FT   gene            438709..439623
FT                   /locus_tag="ARC77_02480"
FT   CDS_pept        438709..439623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02480"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02480"
FT                   /db_xref="GOA:A0A0K3WXL3"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3WXL3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005122709.1"
FT                   /protein_id="AMW41181.1"
FT                   /translation="MIVRPQQHWLRRIFVWHGSVLSKISSRLLLNFLFSIAVIFMLPWY
FT                   THLGIKFTLAPFSILGVAIAIFLGFRNNAGYARYVEARKLWGQLMIASRSLLREVKTTL
FT                   PDSASVREFARLQIAFAHCLRMTLRKQPQVEVLAHYLKTEDLQRVLASNSPANRILLIM
FT                   GEWLAVQRRNGQLSDILFISLNDRLNDISAVLAGCERIAYTPIPFAYTLILHRTVYLFC
FT                   IMLPFALVVDLHYMTPFISVLISYTFISLDCLAEELEDPFGTENNDLPLDAICNAIEID
FT                   LLQMNDEAEIPAKVLPDRHYQLT"
FT   gene            complement(439627..440385)
FT                   /locus_tag="ARC77_02485"
FT   CDS_pept        complement(439627..440385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02485"
FT                   /product="trans-aconitate 2-methyltransferase"
FT                   /note="catalyzes the formation of
FT                   (E)-3-(methoxycarbonyl)pent-2-enedioate and
FT                   S-adenosyl-L-homocysteine from S-adenosyl-L-methionine and
FT                   trans-aconitate; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02485"
FT                   /db_xref="GOA:C3T9V7"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9V7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001665426.1"
FT                   /protein_id="AMW41182.1"
FT                   /translation="MSDWNPSLYLHFAAERSRPAVELLARVPLENVDYVADLGCGPGNS
FT                   TALLHQRWPAARITGIDSSPAMIAEARSALPDCQFVEADIRNWQPEQALDLIFANASLQ
FT                   WLPDHYELFPHLVSLLNPQGVLAVQMPDNWLEPTHVLMREVAWEQNYPDRGRESLAGVH
FT                   AYYDILSEAGCEVDIWRTTYYHQMPSHQAIIDWVTATGLRPWLQDLTESEQQLFLTRYH
FT                   QMLKEQYPLQENGQILLAFPRLFIVARRTE"
FT   gene            complement(440442..440732)
FT                   /locus_tag="ARC77_02490"
FT   CDS_pept        complement(440442..440732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02490"
FT                   /product="autoinducer-2 (AI-2) modifying protein LsrG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02490"
FT                   /db_xref="GOA:C3T9W2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR033672"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9W2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016244618.1"
FT                   /protein_id="AMW41183.1"
FT                   /translation="MHVTLVEINVHEDKVDEFIEVFRQNHLGSVQEEGNLRFDVLQDPE
FT                   VNSRFYIYEAYKDEDAVAFHKTTPHYKTCVAKLESLMTGPRKKRLFNGLMP"
FT   gene            complement(440756..441631)
FT                   /locus_tag="ARC77_02495"
FT   CDS_pept        complement(440756..441631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02495"
FT                   /product="autoinducer 2 aldolase"
FT                   /note="involved in autoinducer 2 transport and processing;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02495"
FT                   /db_xref="GOA:C3T9W8"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033673"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9W8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000774161.1"
FT                   /protein_id="AMW41184.1"
FT                   /translation="MADLDDIKDGKDFRTDQPQKNIPFTLKGCGALDWGMQSRLSRIFN
FT                   PKTGKTVMLAFDHGYFQGPTTGLERIDINIAPLFEHADVLMCTRGILRSVVPPATNKPV
FT                   VLRASGANSILAELSNEAVALSMDDAVRLNSCAVAAQVYIGSEYEHQSIKNIIQLVDAG
FT                   MKVGMPTMAVTGVGKDMVRDQRYFSLATRIAAEMGTQIIKTYYVEKGFERIVAGCPVPI
FT                   VIAGGKKLPEREALEMCWQAIDQGASGVDMGRNIFQSDHPVAMMKAVQAVVHHNETADR
FT                   AYELYLSEKQ"
FT   gene            complement(441658..442680)
FT                   /locus_tag="ARC77_02500"
FT   CDS_pept        complement(441658..442680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02500"
FT                   /product="autoinducer 2-binding protein lsrB"
FT                   /note="with lsrACD is involved in the transport of
FT                   autoinducer 2 into the cell; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02500"
FT                   /db_xref="GOA:C3T9X2"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9X2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000172455.1"
FT                   /protein_id="AMW41185.1"
FT                   /translation="MTLHRFKKIALLSALGIAAISMNVQAAERIAFIPKLVGVGFFTSG
FT                   GNGAQQAGKELGVDVTYDGPTEPSVSGQVQLINNFVNQGYNAIIVSAVSPDGLCPALKR
FT                   AMQRGVRVLTWDSDTKPECRSYYINQGTPAQLGGMLVDMAARQVNKDKAKVAFFYSSPT
FT                   VTDQNQWVKEAKAKIAKEHPGWEIVTTQFGYNDATKSLQTAEGILKAYSDLDAIIAPDA
FT                   NALPAAAQAAENLKNDKVAIVGFSTPNVMRPYVERGTVKEFGLWDVVQQGKISVYVADA
FT                   LLKKGSMKTGDKLDIQGVGQVEVSPNSVQGYDYEADGNGIVLLPERVIFNKENIGKYDF
FT                   "
FT   gene            complement(442692..443684)
FT                   /locus_tag="ARC77_02505"
FT   CDS_pept        complement(442692..443684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02505"
FT                   /product="histidine kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02505"
FT                   /db_xref="GOA:C3T9X7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9X7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001222721.1"
FT                   /protein_id="AMW41186.1"
FT                   /translation="MRIRYGWELALAALLVIEIVSFGAINPRMLDLNMLLFSTSDFICI
FT                   GIVALPLTMVIVSGGIDISFGSTIGLCAIALGVLFQSGVPMPLAILLTLLLGALCGLIN
FT                   AGLIIYTKVNPLVITLGTLYLFAGSALLLSGMAGATGYEGIGGFPMAFTDFANLDVLGL
FT                   PVPLIIFLICLLVFWLWLHKTHAGRNVFLIGQSPRVALYSAIPVNRTLCALYAMTGLAS
FT                   AVAAVLLVSYFGSARSDLGASFLMPAITAVVLGGANIYGGSGAIIGTAIAVLLVGYLQQ
FT                   GLQMAGVPNQVSSALSGALLIVVVVGRSVSLHRQQIKEWLARRANNPLP"
FT   gene            complement(443684..444712)
FT                   /locus_tag="ARC77_02510"
FT   CDS_pept        complement(443684..444712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02510"
FT                   /product="ABC transporter permease"
FT                   /note="with LsrADB is involved in the transport of
FT                   autoindiuce 2; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02510"
FT                   /db_xref="GOA:C3T9Y2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9Y2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000911140.1"
FT                   /protein_id="AMW41187.1"
FT                   /translation="MLKFIQNNREITALLAVLLLFVLPGFLDRQYLSVQTLTMVYSSAQ
FT                   ILILLAMGATLVMLTRNIDVSVGSITGMCAVLLGMLLNAGYSLPVACVATLLLGLLAGF
FT                   FNGVLVAWLKIPAIVATLGTLGLYRGIMLLWTGGKWIEGLPAELKQLSAPLLLGVSAIG
FT                   WLTIILVAFMAWLLAKTAFGRSFYATGDNLQGARQLGVRTEAIRIVAFSLNGCMAALAG
FT                   IVFASQIGFIPNQTGTGLEMKAIAACVLGGISLLGGSGAIIGAVLGAWFLTQIDSVLVL
FT                   LRIPAWWNDFIAGLVLLAVLVFDGRLRCALELNLRRQKYARFMTPPPSVKPASSGKKRE
FT                   AA"
FT   gene            complement(444706..446241)
FT                   /locus_tag="ARC77_02515"
FT   CDS_pept        complement(444706..446241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02515"
FT                   /product="autoinducer 2 ABC transporter ATP-binding protein
FT                   LsrA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02515"
FT                   /db_xref="GOA:C3SDJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030281"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDJ1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016244613.1"
FT                   /protein_id="AMW41188.1"
FT                   /translation="MQTSDTRALPLLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGG
FT                   NGAGKSTLMKIIAGITSADSGTLEIGGNNYARLTPVHAHQLGIYLVPQEPLLFPSLSIK
FT                   ENILFGLAKKQLSMQKMKNLLAALGCQFDLHSLAGSLDVADRQMVEILRGLMRDSRILI
FT                   LDEPTASLTPAETERLFTRLQELLATGVGIVFISHKLPEIRQIADRISVMRDGTIALSG
FT                   KTSELSTDDIIQAITPAVREKSLSASQKLWLELPGNRPQHAAGTSVLTLENLTGEGFRN
FT                   VSLTLNAGEILGLAGLVGAGRTELAETLYGLRTLRGGRIMLNDKEINRLSTGERLLRGL
FT                   VYLPEDRQSSGLNLDASLAWNVCALTHNLRGFWAKTAKDNATLELYRRALNIKYNQPEQ
FT                   AARTLSGGNQQKILIAKCLEASPQVLIVDEPTRGVDVSARNDIYQLLRSIAAQNVAVLL
FT                   ISSDLEEIELMADRVYVMHQGEITHSALTGRDINVETIMRVAFGDSQRQEAAC"
FT   gene            446490..447443
FT                   /locus_tag="ARC77_02520"
FT   CDS_pept        446490..447443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02520"
FT                   /product="transcriptional regulator LsrR"
FT                   /note="regulates the transcription of lsr genes; involved
FT                   in autoinducer 2 uptake, biofilm formation and stress
FT                   responses; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02520"
FT                   /db_xref="GOA:C3T9Y7"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9Y7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000154339.1"
FT                   /protein_id="AMW41189.1"
FT                   /translation="MTINDSVISEQGMCEEEQVARIAWFYYHDGLTQSEISDRLGLTRL
FT                   KVSRLLEKGHQSGIIRVQINSRFEGCLEYETQLRRQFSLQHVRVIPGLADADVGGRLGI
FT                   GAAHMLMSLLQPQQMLAIGFGEATMNTLQRLSGFISSQQIRLVTLSGGVGSYMTGIGQL
FT                   NAACSVNIIPAPLRASSADIARTLKNENCVKDVLLAAQAADVAIVGIGAVSQQDDATII
FT                   RSGYISQGEQLMIGRKGAVGDILGYFFDAKGDVVTDIKIHNELIGLPLSALKTIPVRVG
FT                   VAGGENKAEAIAAAMKGGYINALVTDQDTAAAILRS"
FT   gene            447522..449114
FT                   /locus_tag="ARC77_02525"
FT   CDS_pept        447522..449114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02525"
FT                   /product="autoinducer-2 kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02525"
FT                   /db_xref="GOA:C3T9Z2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR033676"
FT                   /db_xref="UniProtKB/TrEMBL:C3T9Z2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000113137.1"
FT                   /protein_id="AMW41190.1"
FT                   /translation="MARLFTPSESKYYLMALDAGTGSIRAVIFDLEGNQIAVGQAEWRH
FT                   LAVPDVPGSMEFDLNKNWQLACECMRQALHNAGIAPEYIAAVSACSMREGIVLYNNEGT
FT                   PIWACANVDARAAREVSELKELHNNTFENEVYRATGQTLALSAIPRLLWLAHHRSDIYR
FT                   QASTITMISDWLAYMLSGELAVDPSNAGTTGLLDLTIRDWKPALLDMAGLRADILSPVK
FT                   ETGTLLGVVSSQAAELCGLKVGTPVVVGGGDVQLGCLGLGVVRPAQTAVLGGTFWQQVV
FT                   NLAAPVTDPEMNVRVNPHVIPGMVQAESISFFTGLTMRWFRDAFCAEEKLIAERLGIDT
FT                   YTLLEEMASRVPPGSWGVMPIFSDRMRFKTWYHAAPSFINLSIDPDKCNKATLFRALEE
FT                   NAAIVSACNLQQIADFSTIHPSSLVFAGGGSKGKLWSQILADVSGLPVNIPVVKEATAL
FT                   GCAIAAGVGAGIFSSMAETGERLVRWERTHTPDPEKHELYQDSRDKWQAVYQDQLGLVD
FT                   HGLTTSLWKAPGL"
FT   gene            449783..453676
FT                   /locus_tag="ARC77_02530"
FT   CDS_pept        449783..453676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02530"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02530"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR030895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DVK7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001302139.1"
FT                   /protein_id="AMW41191.1"
FT                   /translation="MTLGVLLALSGSVSGASLEVDNGQITNIDTDVAYDAYLVGWYGTG
FT                   VLNILAGGNASLTTITTSVIGGNEDSEGTVNVLGGTWRLYDSGNNARPLNVGQSGTGTL
FT                   NIKQKGHVDGGYLRLGTQAAGVGTVNVEGEDSVLTTELFEIGSYGTGSLNITDKGYVTS
FT                   SIVAILGYQANSNGKVVVEKGGEWLIKNNDSSIEFQIGNQGTGEATIREGGLITAENTI
FT                   IGGNATGVGTLNVQDQDSVITVRRLYNGYFGNGAVNISNNGLINNKEYSLVGVQDGSHG
FT                   VVNVTDKGHWNFLGTGEAFRYIYIGDAGDGELNVSREGKVDSGIITAGMKETGTGNLTV
FT                   KDKNSVITNLGTNLGYDGHGEMNISNEGLVVSNGGSSLGYGETGVGKVSITTGGIWEVN
FT                   KNVYTTIGVAGVGNLNISDGGKFVSQNITFLGDKASGIGTLNLMDATSSFDTVGINVGN
FT                   FGSGIVNVSNGATLNSTGYGFIGGNASGKGIVNISTDSLWNLKTSSTNAQLLQVGVLGT
FT                   GELNITTGGIVKARDTQIALNDKSKGDVRVDGQNSLLETFNMYVGTSGTGTLTLTNSGT
FT                   LNVEGGEVYLGVFEPAVGTLNIGAAHGEAAADAGFITNATKVEFGSGEGVFVFNHTNNS
FT                   DAGYQVDMLITGDDKDGKVIHDAGHTVFNAGNTYSGKTLVNDGLLTIASHTADGVTGMG
FT                   SSEVTIASPGTLDILASTNSAGDYTLTNALKGDGLMRVQLSSSDKMFGFTHATGTEFAG
FT                   VAQLKDSTFTLERDNTAALTHAMLQSDIENTTSVNVGEQSIGGLAMNGGTLIFDTDIPA
FT                   ATLAEGYISVDTLVVGASDYTWKGRNYQVNGTGDVLIGVPKPWNDPMANNPLTTLNLLE
FT                   HDDNHVGVQLVKAQTVIGSGGSLTLRDLQGDEVEADKTLHIAQNGTVVAEGDYGFRLTT
FT                   APGDGLYVNYGLKALNIHGGQKLTLAEHGGAYGATADMSAKIGGEGDLAINTVRQVSLS
FT                   NGQNDYQGATYVQMGTLRTDADGALGNTRELNISNAAIVDLNGSTQTVETFTGQMGSTV
FT                   LFKEGSLTVNKGGISQGELTGGGNLNVTGGTLAVEGLNARYNALTSVSPNAEVSLDNTQ
FT                   GLGRGNIANDGLLTLKNVTGELRNSISGKGIVSATARTDVELDGDNSRFVGQFNIDTGS
FT                   ALSVNEQKNLGDASVINNGLLTISTERSWAMTHSISGSGDLTKLGTGILTLNNDSSAYQ
FT                   GTTDIVGGEIAFGSDSAINTASQHINIHNSGVMSGNVTTAGDVNVMSGGTLRVAKTTIG
FT                   ESAATWRMAARFK"
FT   gene            453673..455073
FT                   /locus_tag="ARC77_02535"
FT   CDS_pept        453673..455073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02535"
FT                   /product="autotransporter outer membrane beta-barrel
FT                   domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02535"
FT                   /db_xref="GOA:C3SDJ7"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDJ7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001083593.1"
FT                   /protein_id="AMW41192.1"
FT                   /translation="MNSEGGKPGNVLTVNGNYTGNNGLMTFNATLGGDNSPTDKMNVKG
FT                   DTQGNTRVRVDNIGGVGAQTVNGIELIEVGGNSAGNFALTTGTVEAGAYVYTLAKGKGN
FT                   DEKNWYLTSKWDGVTPADTPDPINNPPVVDPEGPSVYRPEAGSYISNIAAANSLFSHRL
FT                   HDRLGEPQYTDSLHSQDSASSMWMRHVGGHERSSAGDGQLNTQANRYVLQLGGDLAQWS
FT                   SNAQDRWHLGVMAGYANQHSNTQSNRVGYKSDGRISGYSAGLYATWYQNDANKTGAYVD
FT                   SWALYNWFDNSVSSDNRSADDYDSRGVTASVEGGYTFEAGTCSGSEGTLNTWYVQPQAQ
FT                   ITWMGVKDSDHARKDGTRIETEGDGNVQTRLGVKTYLNSHHQRDDGKQREFQPYIEANW
FT                   INNSKVYAVKMNGQTVSRDGARNLGEVRTGVEAKVNNNLSLWGNVGVQLGDKGYSDTQG
FT                   MLGVKYSW"
FT   gene            455693..456253
FT                   /locus_tag="ARC77_02540"
FT   CDS_pept        455693..456253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02540"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02540"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143E9X6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001449057.1"
FT                   /protein_id="AMW45913.1"
FT                   /translation="MCQTFGLPSSVKYESDGGPGIARIMAFLMGFSEALRDRYDFMKFQ
FT                   VFQWLIGATDGHAKNFSVFIQAGGSYRLTPFYDIISAFPVLGGTGIHISDLKLAMGLNA
FT                   SKGKKTAIDKIYPRHFLATAKVLRFPEVQMHEILSDFARMIPAALDNVKTSLPTDFPEN
FT                   VVTAVETNVLRLHGRLSREYGIK"
FT   gene            456590..456770
FT                   /pseudo
FT                   /locus_tag="ARC77_02545"
FT   CDS_pept        456590..456770
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02545"
FT                   /product="transcriptional regulator"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P76138.1"
FT   gene            457227..457790
FT                   /locus_tag="ARC77_02550"
FT   CDS_pept        457227..457790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02550"
FT                   /product="fimbrial protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02550"
FT                   /db_xref="GOA:J7QR22"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:J7QR22"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001373493.1"
FT                   /protein_id="AMW41193.1"
FT                   /translation="MKLKHVGMIVVSVLAMSSAAVSAAEGDESVTTTVNGGVIHFKGEV
FT                   VNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLG
FT                   TTVTSNDDTLALQSSAAGSAQNVGIQILDRTGEVLILDGATFSAKTDLIDGTNILPFQA
FT                   RYIALGQSVAGTANADATFKVQYL"
FT   gene            458151..458861
FT                   /locus_tag="ARC77_02555"
FT   CDS_pept        458151..458861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02555"
FT                   /product="fimbrial chaperone protein FimC"
FT                   /note="involved in type 1 fimbriae biosynthesis, interacts
FT                   with FimH; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02555"
FT                   /db_xref="GOA:A0A0K6EC02"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K6EC02"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001195156.1"
FT                   /protein_id="AMW41194.1"
FT                   /translation="MQTTRTPYSISFMATVLLLLLFACHSTVANAAVALGATRVIYPAN
FT                   QKQVLLPVTNNDPASVYLIQSWIENAGDQKDTQFVITPPLFSMQGKKENTLRIINATNH
FT                   QLPGDRESLFWVNVKAIPAMEKDQKNENTLQLAIISRIKMFYRPTNLAMAPEEAPAMLR
FT                   FRRSGSNLTLINPTPYFITVTNMKAGNSNLPNTMVPPKGEVSVDIPHAATGDISFQTIN
FT                   DYGALTPRIKATMQ"
FT   gene            458903..461554
FT                   /locus_tag="ARC77_02560"
FT   CDS_pept        458903..461554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02560"
FT                   /product="fimbrial protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02560"
FT                   /db_xref="GOA:C3SDK3"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDK3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001774455.1"
FT                   /protein_id="AMW41195.1"
FT                   /translation="MTAFRAAFKAYRMHQVLLLPRFARLTIALSLATAVFPVDAEYYFN
FT                   PRFLSNDLAESVDLSAFTKGREAPPGTYRVDIYLNDEFMTSRDITFITDDNNADLIPCL
FT                   STDLLVSLGIKKSALLDNKEHSAEKHVPDNSACTPLQDRLVDASTEFDVGQQHLSLSVP
FT                   QIYVGRMARGYVSPDLWEEGINAGLLNYSFNGNSINNRSNHNAGKSNYAYLNLQSGINI
FT                   GSWRLRDNSTWSYNSGSSNSSDSNKWQHINTSAERDIIPLRSRLTVGDSYTDGDIFDSV
FT                   NFRGLKINSTEAMLPDSQHGFAPVIHGIARGTAQVSVKQNGYDVYQTTVPPGPFTIDDI
FT                   NSAANGGDLQVTIKEADGSIQTLYVPYSSVPVLQRAGYTRYALAMGEYRSGNNLQSSPR
FT                   FIQGSLMHGLEGNWTPYGGMQIAEDYQAFNLGIGKDLGLFGAFSFDITQANTTLADGTR
FT                   HSGQSVKSVYSKSFYQTGTNIQVAGYRYSTQGFYNLSDSAYSRMSGYTVKPPTGDSNEQ
FT                   TQFIDYFNLFYSKRGQEQISISQQLGNYGATFFSASRQSYWNTSRSDQQISFGLNVPFG
FT                   DITTSLNYSYSNNIWQNDRDHLLAFTLNVPFSHWMRTDSQSAFRNSNASYSMSNDLKGG
FT                   MTNLSGVYGTLLPDNNLNYSVQVGNTHGGNTSSGTSGYSTLNYRGAYGNTNVGYSRSGD
FT                   SSQIYYGMSGGIIAHADGITFGQPLGDTMVLVKAPGADNVKIENQTGIHTDWRGYAILP
FT                   FATEYRENRVALNANSLADNVELDETVVTVIPTHGAIARATFNAQIGGKVLMTLKYGNK
FT                   SVPFGAIVTHGENKNGSIVAENGQVYLTGLPQSGKLQVSWGNDKNSNCIVDYKLPEVSP
FT                   GTLLNQQTAICR"
FT   gene            461568..462098
FT                   /locus_tag="ARC77_02565"
FT   CDS_pept        461568..462098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02565"
FT                   /product="fimbrial protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02565"
FT                   /db_xref="GOA:C3TA02"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA02"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000876770.1"
FT                   /protein_id="AMW41196.1"
FT                   /translation="MKYNNIIFLGLCLGLTTYSALSADSVIKISGRVLDYGCTVSSDSL
FT                   NFTVDLQKNSARQFPTTGSTSPAVPFQITLSECSKGTTGVRVAFNGIEDAENNTLLKLD
FT                   EGSNTASGLGIEILDGNMRPVKLNDLHAGMQWIPLVPEQNNILPYSARLKSTQKSVNPG
FT                   LVRASATFTLEFQ"
FT   gene            462111..462614
FT                   /locus_tag="ARC77_02570"
FT   CDS_pept        462111..462614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02570"
FT                   /product="fimbrial protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02570"
FT                   /db_xref="GOA:C3TA08"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA08"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016247200.1"
FT                   /protein_id="AMW41197.1"
FT                   /translation="MKRLHKRFLLATFCALLTATLQAADVTITVNGRVVAKPCTIQTKE
FT                   ANVNLGDLYTRNLQQPGSASGWHNITLSLTDCPAETSAVTAIVTGSTDNTGYYKNEGTA
FT                   ENIQIELRDDQDATLKNGDSKTVIVDEITRNAQFPLKARAITVNGNASQGTIEALINVI
FT                   YTWQ"
FT   gene            462674..463588
FT                   /locus_tag="ARC77_02575"
FT   CDS_pept        462674..463588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02575"
FT                   /product="fimbrial protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02575"
FT                   /db_xref="GOA:C3TA12"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR015243"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA12"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000520675.1"
FT                   /protein_id="AMW41198.1"
FT                   /translation="MGKTISIKVLFGIYLLLMAGKVFAFSCNVDGGSSIGAGTTSVYVN
FT                   LDPVIQPGQNLVVDLSQHISCWNDYGGWYDTDHINLVQGSAFAGSLQSYKGSLYWNNVT
FT                   YPFPLTTNTNVLDIGDKTPMPLPLKLYITPVGAAGGVVIKAGEVIARIHMYKIATLGSG
FT                   NPRNFTWNIISNNSVVMPTGGCTVDSRNVTVNLPDFPGSAEIPLGVYCSSEQKLSFYLS
FT                   GTTTDSARQVFANTAPDATKASGVGVSLMRNGKILATGENVSLGTVNKSKVPLGLSATY
FT                   GQTGNKVSAGTVQSVIGVTFIYE"
FT   gene            463922..466201
FT                   /locus_tag="ARC77_02580"
FT   CDS_pept        463922..466201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02580"
FT                   /product="oxidoreductase"
FT                   /note="in Escherichia coli it may be involved in repression
FT                   of type III secretion system (TTSS) genes of the host cell;
FT                   involved with increased resistance to low pH; member of the
FT                   prokaryotic molybdopterin-containing oxidoreductase family;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02580"
FT                   /db_xref="GOA:C3TA18"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA18"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q8FHF8.1"
FT                   /protein_id="AMW41199.1"
FT                   /translation="MKKKIESYQGAAGGWGAVKSVANAVRKQMDIRQDVIAMFDMNKPE
FT                   GFDCPGCAWPDPKHSASFDICENGAKAIAWEVTDKQVNASFFAQNTVQSLLTWGDHELE
FT                   AAGRLTQPLKYDAVSDCYKPLSWQQAFDEIGARLQSYSDPNQVEFYTSGRTSNEAAFLY
FT                   QLFAREYGSNNFPDCSNMCHEPTSVGLAASIGVGKGTVLLEDFEKCDLVICIGHNPGTN
FT                   HPRMLTSLRALVKRGAKMIAINPLQERGLERFTAPQNPFEMLTNSETQLASAYYNVRIG
FT                   GDMALLKGMMRLLIERDDAASAAGRPSLLDDEFIQTHTVGFDELRRDVLNSEWKDIERI
FT                   SGLSQTQIAELADAYAAAERTIICYGMGITQHEHGTQNVQQLVNLLLMKGNIGKPGAGI
FT                   CPLRGHSNVQGDRTVGITEKPSVEFLARLGERYGFTPPHVPGHAAIASMQAICTGQARA
FT                   LICMGGNFALAMPDREASAVPLTQLDLAVHVATKLNRSHLLTARHSYILPVLGRSEIDM
FT                   QKSGAQAVTVEDSMSMIHASRGVLKPAGVMLKSECAVVAGIAQATLPQSVVAWEYLVED
FT                   YDRIRNDIEAVLPEFADYNQRIRHPGGFHLINAAAERRWMTPSGKANFITSKGLLEDPS
FT                   SAFNSKLVMATVRSHDQYNTTIYGMDDRYRGVFGQRDVVFMSAKQAKICRVKNGERVNL
FT                   IALTPDGKRSSRRMDRLKVVIYPMADRSLVTYFPESNHMLTLDNHDPLSGIPGYKSIPV
FT                   ELEPSN"
FT   gene            466449..466646
FT                   /locus_tag="ARC77_02585"
FT   CDS_pept        466449..466646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02585"
FT                   /product="Two-protein-system connector protein SafA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02585"
FT                   /db_xref="GOA:C3TA22"
FT                   /db_xref="InterPro:IPR031411"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA22"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000543386.1"
FT                   /protein_id="AMW41200.1"
FT                   /translation="MHATTVKNKITQRDNYKEIMSVIVVILLLTLTLIAIFSAIDQLGI
FT                   SEMGRIARDLTHFIVNSLQD"
FT   gene            466720..467481
FT                   /locus_tag="ARC77_02590"
FT   CDS_pept        466720..467481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02590"
FT                   /product="transcriptional regulator YdeO"
FT                   /note="regulates the cellular response to acid resistance;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02590"
FT                   /db_xref="GOA:C3TA27"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA27"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P76135.1"
FT                   /protein_id="AMW41201.1"
FT                   /translation="MSLVCSVIFIHHAFNANILDKDYAFSDGEILMVDNAVRTHFEPYE
FT                   RHFKEIGFNENTIKKYLQCTNIQTVTMPVPAKFLRASNVPTGLLNEMIAYLNSEERNHH
FT                   NFSELLLFSCLSIFATCKGFITLLTNGVLSVSGKVRNIVNMKLAHPWKLKDICDCLYIS
FT                   ESLLKKKLKQEQTTFSQILLDARMQHAKNLIRVEGSVNKIAEQCGYASTSYFIYAFRKH
FT                   FGNSPKRVSKEYRCQRHTGMNTGNTMNALAI"
FT   gene            467885..469567
FT                   /locus_tag="ARC77_02595"
FT   CDS_pept        467885..469567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02595"
FT                   /product="sulfatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02595"
FT                   /db_xref="GOA:A0A023L2F3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A023L2F3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001295684.1"
FT                   /protein_id="AMW41202.1"
FT                   /translation="MKSALKKSVVSTSISLILASGMAAFAAHAADDVKLKATKTNVAFS
FT                   DFTPTEYSTKGKPNIIVLTMDDLGYGQLPFDKGSFDPKTMENREVVDTYKIGIDKAIEA
FT                   AQKSTPTLLSLMDEGVRFTNGYVAHGVSGPSRAAIMTGRAPARFGVYSNTDAQDGIPLT
FT                   ETFLPELFQNHGYYTAAVGKWHLSKISNVPVPEDKQTRDYHDNFTTFSAEEWQPQNRGF
FT                   DYFMGFHAAGTAYYNSPSLFKNRERVPAKGYISDQLTDEAIGVVDRAKTLDQPFMLYLA
FT                   YNAPHLPNDNPAPEQYQKQFNTGSQTADNYYASVYSVDQGVKRILEQLKKNGQYDNTII
FT                   LFTSDNGAVIDGPLPLNGAQKGYKSQTYPGGTHTPMFMWWKGKLQPGNYDKLISAMDFY
FT                   PTALDAADISIPKDLKLDGVSLLPWLQDKKQGEPHKNLTWITSYSHWFDEENIPFWDNY
FT                   HKFVRHQSDDYPHNPNTEDLSQFSYTVRNNDYSLVYTVENNQLGLYKLTDLQQKDNLAA
FT                   ANPQVVKEMQGVVREFIDSSQPPLSEVNQEKFNNIKKALSEAK"
FT   gene            469619..470776
FT                   /locus_tag="ARC77_02600"
FT   CDS_pept        469619..470776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02600"
FT                   /product="anaerobic sulfatase maturase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02600"
FT                   /db_xref="GOA:A0A143DWI7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWI7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001299007.1"
FT                   /protein_id="AMW41203.1"
FT                   /translation="MHVTAKPSSFQCNLKCDYCFYLEKESQFTHEKWMDDSTLKEFIKQ
FT                   YIAASGNQVYFTWQGGEPTLAGLDFFRKVIHYQQRYAGQKRIFNALQTNGILLNNEWCA
FT                   FLKEHEFLVGISIDGPQELHDRYRRSNSGNGTFAKVIAAIERLKSYQVEFNTLTVINNV
FT                   NVHYPLEVYHFLKSIGSKHMQFIELLETGTPNIDFSGHSENTFRIIDFSVPPTAYGKFM
FT                   STIFMQWVKNDVGEIFIRQFESFVSRFLGNGHTSCIFQESCKDNLVVESNGDIYECDHF
FT                   VYPQYKLGNINKSELKTMNSVQLTAQKKRISAKCQQCAYKPICNGGCPKHRITKVNDET
FT                   VSYFCEGYKILFSTMVPYMNAMVELAKNRVPLYHIMDVAKQMENN"
FT   gene            471067..472752
FT                   /locus_tag="ARC77_02605"
FT   CDS_pept        471067..472752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02605"
FT                   /product="multidrug ABC transporter ATP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02605"
FT                   /db_xref="GOA:C3TA39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA39"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000628555.1"
FT                   /protein_id="AMW41204.1"
FT                   /translation="MITIPITFCMLIAKYLCLLKPFWLRKNNKTSVLLIIIILAMILGV
FT                   VKIQVWLNDWNNDFFNALSQKETDKLWQLVLWFPALLGIFVLISVNKTWLIKLLTIRWR
FT                   EWLTDYYLNRWFADKNYYFTQIYGEHKNTDNPDQRIAEDILLLISKTLSLSFGFIQSLS
FT                   MLITFTVILWQSAGMLSFTVGGTEWNIQGYMVYTVVLIVIGGTLFTHKVGKRIRPLNVE
FT                   KQRSEATFRTNLVQHNKQAELIALSNAESLQRQELSDNFHTIKENWHRLMNRQRWLDYW
FT                   QNIYSRSLSVLPYFLLLPQFISGQINLGGLMKSRQAFMLVSNNLSWFIYKYDELAELAA
FT                   VIDRLYEFHQLTEQRPTNKPKNCQHAVQVADASIRTPDNKIILENLNFHVSPGKWLLLK
FT                   GYSGAGKTTLLKTLSHCWPWFKGDISSPADSWYASQTPLIKTGLLKEIICKALPLPVDD
FT                   KSLSEVLHQVGLGKLAARIHDHDRWGDILSSGEKQRIALARLILRRPKWIFLDETTSHL
FT                   EEQEAIRLLRLVREKLPTSGVIMVTHQPGVWNLADDICDISAVL"
FT   gene            472790..475162
FT                   /locus_tag="ARC77_02610"
FT   CDS_pept        472790..475162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02610"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02610"
FT                   /db_xref="GOA:C3TA42"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA42"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001726050.1"
FT                   /protein_id="AMW41205.1"
FT                   /translation="MKRVLIPGVILCGADVAQAVDDKNMYMHFFEEMTVYAPVPVPVNG
FT                   NTHYTSESIERLPTGNGNISDLLRTNPAVRMDSTQSTSLNQGDIRPEKISIHGASPYQN
FT                   AYLIDGISATNNLNPANESDASSATNISGMSQGYYLDVSLLDNVTLYDSFVPVEFGRFN
FT                   GGVIDAKFKRFNADDSSVKLGYRTTRSDWLTSHINENNKSAFNQGSSGSTYYSPDFKKN
FT                   FYTLSFNQELADNFGVTAGLSRRQSDITRADYVSNDGIVAGRAQYKNVIDTALSKFTWF
FT                   ASDRFTHDLTLKYTGSSRDYNTSTFPQSDREMGNKSYGMAWDMDTQLAWAKLRTTVGWD
FT                   HISDYTRHDHDIWYTELSCTYGDITGRCTRGGLGHISQAVDNYTFKTRLDWQKFAVGNV
FT                   SHQPYFGAEYIYSDAWTERHNQSESYVINAAGKKTNHTIYHKGKGSLGIDNYTLYMADR
FT                   ISWRNVSLMPGVRYDYDNYLSNHNISPRFMTEWDIFADQTSMITAGYNRYYGGNILDMG
FT                   LRDIRNSWTESVSGNKTLTRYQDLKTPYNDELAMGLQQKIGKNVIARANYVYREAHDQI
FT                   SKSSRTDSATKTTITEYNNDGKTKTHSFNLSFELAEPLHISQVDINPQIVFSYIKSKGN
FT                   LSLNNGYEESNTGDNQVVYNGNLVSYDSVPVADFNNPLKISLNMDFTHQPSGLVWANTL
FT                   AWQEARKARIILGKTNAQYISEYSDYKQYVDEKLDSSLTWDTRLSWTPQFLKQQNLTIS
FT                   ADILNVLDSKTAVDTTNTGVATYASGRTFWLDVSMKF"
FT   gene            475219..478002
FT                   /locus_tag="ARC77_02615"
FT   CDS_pept        475219..478002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02615"
FT                   /product="zinc protease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02615"
FT                   /db_xref="GOA:A0A152VR65"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152VR65"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001462531.1"
FT                   /protein_id="AMW41206.1"
FT                   /translation="MRNLCFLLTLVATLLLPGRLIAAALPQDEKLITGQLDNGLRYMIY
FT                   PHAHPKDQVNLWLQIHTGSLQEEDNERGVAHFVEHMMFNGTKTWPGNKVIETFESMGLR
FT                   FGRDVNAYTSYDETVYQVSLPTTQKQNLQQVMAIFSEWSNAATFEKLEVDAERGVITEE
FT                   WRAHQDAKWRTSQARRPFLLANTRNLDREPIGLMDTVATVTPAQLLQFYQRWYQPNNMT
FT                   FIVVGDIDSKEALALIKDNLSKLPANKAAENRVWPTKAENHLRFNIINDKENRVNGIAL
FT                   YYRLPMVQVNDEQSFIEQAEWSMLVQLFNQRLQERIQSGELKTISGGTARSVKIAPDYQ
FT                   SLFFRVNARDDNMQDAANALMEELATIDQHGFSAEELDDVKSTRLTWLKNAVDQQAERD
FT                   LRMLTSRLASSSLNNTPFLSPEETYQLSKRLWQQITVQSLAEKWQQLRKNQDAFWEQMV
FT                   NNEVAAKKALSPAAILALEKEYANKKLAAYIFPGRNLSLTVDADPQAEISSKETLAENL
FT                   TSLTLSNGARVILAKSAGEEQKLQIIAVSNKGDLSFPAQQKSLIALANKAVSGSGVGEL
FT                   SSSSLKRWSAENSVTMSSKVSGMNTLLSVSARTNNPEPGFQLINQRITHSTINDNIWAS
FT                   LQNAQIQALKTLDQRPAEKFAQQMYETRYADDRTKLLQENQIAQFTAADALAADRQLFS
FT                   SPADITFVIVGNVAEDKLVALITRYLGSIKHSDSPLAAGKPLTRATDNASVTVKEQNEP
FT                   VAQVSQWKRYDSRTPVNLATRMALDAFNVALAKDLRVNIREQASGAYSVSSRLSVDPQA
FT                   KDISHLLAFTCQPERHDELLTLANEVMVKRLTKGISEQELNEYQQNVQRSLDIQQRSVQ
FT                   QLANTIVNSLIQYDDPAAWTEQEQLLKQMTVENVNTAVKQYLSHPVNTYTGVLLPK"
FT   gene            478230..478352
FT                   /locus_tag="ARC77_02620"
FT   CDS_pept        478230..478352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02620"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DUP8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001418970.1"
FT                   /protein_id="AMW41207.1"
FT                   /translation="MLFTQYLTINNIRILLFKHESFALAYFIDKSYFFNAIQSF"
FT   gene            478363..479763
FT                   /locus_tag="ARC77_02625"
FT   CDS_pept        478363..479763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02625"
FT                   /product="glutamate decarboxylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02625"
FT                   /db_xref="GOA:A5YKJ2"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:A5YKJ2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000358851.1"
FT                   /protein_id="AMW41208.1"
FT                   /translation="MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQI
FT                   INDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMV
FT                   ADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQ
FT                   ICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQP
FT                   LHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAP
FT                   LGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYT
FT                   KVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERL
FT                   RLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIA
FT                   QQNSFKHT"
FT   gene            479919..481454
FT                   /locus_tag="ARC77_02630"
FT   CDS_pept        479919..481454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02630"
FT                   /product="glutamate:gamma-aminobutyrate antiporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02630"
FT                   /db_xref="GOA:C3TA53"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004759"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA53"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P58229.1"
FT                   /protein_id="AMW41209.1"
FT                   /translation="MATLVQTGKAKQLTLLGFFAITASMVMAVYEYPTFATSGFSLVFF
FT                   LLLGGILWFIPVGLCAAEMATVDGWEEGGVFAWVSNTLGPRWGFAAISFGYLQIAIGFI
FT                   PMLYFVLGALSYILKWPALNEDPITKTIAALIILWALALTQFGGTKYTARIAKVGFFAG
FT                   ILLPAFILIALAAIYLHSGAPVAIEMDSKTFFPDFSKVGTLVVFVAFILSYMGVEASAT
FT                   HVNEMSNPGRDYPLAMLLLMVAAICLSSVGGLSIAMVIPGNEINLSAGVMQTFTVLMSH
FT                   VAPEIEWTVRVISALLLLGVLAEIASWIVGPSRGMYVTAQKNLLPAAFAKMNKNGVPVT
FT                   LVISQLVITSIALIILTNTGGGNNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKHPDL
FT                   KRTFNIPGGKGVKLVVAIVGLLTSIMAFIVSFLPPDNIQGDSTDMYVELLVVSFLVVLA
FT                   LPFILYAVHDRKGKANTGVTLEPINSQNAPKGHFFLHPRARSPHYIVMNDKKH"
FT   gene            481750..482904
FT                   /locus_tag="ARC77_02635"
FT   CDS_pept        481750..482904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02635"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02635"
FT                   /db_xref="GOA:A0A090JEV1"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A090JEV1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001322370.1"
FT                   /protein_id="AMW41210.1"
FT                   /translation="MRGIWLATVSRLDWPPVSSVNISNPTSRARVQQQAMIDKLDHLQR
FT                   LGINTVFFQVKPDGTALWPSKILPWSDLMTGKIGENPGYDPLQFMLDEAHKRGMKVHAW
FT                   FNPYRVSVNTKPGTIRELNSTLSQQPASVYVQHRDWIRTSGDRFVLDPGIPEVQDWITS
FT                   IVAEVVSRYPVDGVQFDDYFYTESPGSRLNDNETYRKYGGAFASKADWRRNNTQQLIAK
FT                   VSHTIKSIKPGVEFGVSPAGVWRNRSHDPLGSDTRGAAAYDESYADTRRWVEQGLLDYI
FT                   APQIYWPFSRSAARYDVLAKWWADVVKPTRTRLYIGIAFYKVGEPSKIEPDWMINGGVP
FT                   ELKKQLDLNDAVPEISGTILFREDYLNKPQTQQAVSYLQSRWGS"
FT   gene            483281..484663
FT                   /locus_tag="ARC77_02640"
FT   CDS_pept        483281..484663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02640"
FT                   /product="diguanylate cyclase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02640"
FT                   /db_xref="GOA:C3TA62"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR039435"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA62"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P0AA89.1"
FT                   /protein_id="AMW41211.1"
FT                   /translation="MEMYFKRMKDEWTGLVEQADPPIRAKAAEIAVAHAHYLSIEFYRI
FT                   VRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDDVERLIQIQHTVAEVHARIGIP
FT                   VEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFTFSDSSAS
FT                   KEDENYRIFSLLENAEEEKERQIASILSWEIDIIYKILLDSDLGSSLPLSQADFGLWFN
FT                   HKGRHYFSGIAEVGHISRLIQDFDGIFNQTMRNTRNLNNRSLRVKFLLQIRNTVSQIIT
FT                   LLRELFEEVSRHEVGMDVLTKLLNRRFLPTIFKREIAHANRTGTPLSVLIIDVDKFKEI
FT                   NDTWGHNTGDEILRKVSQAFYDNVRSSDYVFRYGGDEFIIVLTEASENETLRTAERIRS
FT                   RVEKTKLKAANGEDIALSLSIGAAMFNGHPDYERLIQIADEALYIAKRRGRNRVELWKA
FT                   SL"
FT   gene            484664..487077
FT                   /pseudo
FT                   /locus_tag="ARC77_02645"
FT   CDS_pept        484664..487077
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02645"
FT                   /product="c-di-GMP phosphodiesterase"
FT                   /note="heme-regulated phosphodiesterase with
FT                   phosphodiesterase activity with cGMP; cold- and stationary
FT                   phase-induced bioflim regulator; oxygen sensor;
FT                   frameshifted; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019841606.1"
FT   gene            487335..487916
FT                   /locus_tag="ARC77_02650"
FT   CDS_pept        487335..487916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02650"
FT                   /product="D-alanyl-D-alanine dipeptidase"
FT                   /note="catalyzes the hydrolysis of D-alanyl-D-alanine
FT                   dipeptide: Zn dependent; involved in peptidoglycan
FT                   synthesis; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02650"
FT                   /db_xref="GOA:C3TA67"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA67"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001285833.1"
FT                   /protein_id="AMW41212.1"
FT                   /translation="MSDTTELVDLAVIFPDLEIELKYACADNITGKAIYQQARCLLHKD
FT                   AITALAKSISIAQLSGLQLVIYDAYRPQQAQAMLWQACPDPQYVVDVTVGSNHSRGTAI
FT                   DLTLRDEHGNILDMGAGFDEMHERSHAYHPSVPPAAQRNRLLLNAIMTGGGFVGISSEW
FT                   WHFELPQAASYPLLADQFTCFISPGTQHVS"
FT   gene            487930..489480
FT                   /locus_tag="ARC77_02655"
FT   CDS_pept        487930..489480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02655"
FT                   /product="peptide ABC transporter substrate-binding
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02655"
FT                   /db_xref="GOA:C3TA72"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA72"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000830516.1"
FT                   /protein_id="AMW41213.1"
FT                   /translation="MKRSISFRPTLLALVLATTFPVAHAAVPKDMLVIGKAADPQTLDP
FT                   AVTIDNNDWTVTYPSYQRLVQYKTDGDKGSTDVEGDLASSWKASNDQKEWTFTLKDNAK
FT                   FADGTPVTAEAVKLSFERLLKIGQGPAEAFPKDLKIDAPDEHTVKFTLSQPFAPFLYTL
FT                   ANDGASIINPAVLKEHAADDARGFLAQNTAGSGPFMLKSWQKGQQLVLVPNPHYPGNKP
FT                   NFKRVSVKIIGESASRRLQLSRGDIDIADALPVDQLNALKQENKVNVAEYPSLRVTYLY
FT                   LNNSKAPLNQADLRRAISWSTDYQGMVNGILSGNGKQMRGPIPEGMWGYDATAMQYNHD
FT                   ETKAKAEWDKVTSKPTSLTFLYSDNDPNWEPIALATQSSLNKLGINVKLEKLANATMRD
FT                   RVGKGDYDIAIGNWSPDFADPYMFMNYWFESDKKGLPGNRSFYENSEVDKLLRNALATT
FT                   DQTQRTRDYQQAQKIVIDDAAYVYLFQKNYQLAMNKEVKGFVFNPMLEQVFNINTMSK"
FT   gene            489482..490504
FT                   /locus_tag="ARC77_02660"
FT   CDS_pept        489482..490504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02660"
FT                   /product="peptide ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02660"
FT                   /db_xref="GOA:A0A093E465"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A093E465"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003020008.1"
FT                   /protein_id="AMW41214.1"
FT                   /translation="MTFWSILRQRCWGLVLVVAGVCVITFIISHLIPGDPARLLAGDRA
FT                   SDAIVENIRQQLGLDQPLYVQFYRYVSDLFHGDLGTSIRTGRPVLEELRIFFPATLELA
FT                   FCALLLALLIGIPLGILSAVWRNRWLDHLVRIMAITGISTPAFWLGLGVIVLFYGHLQI
FT                   LPGGGRLDDWLDPPTHVTGFYLLDALLEGNGEVFFNALQHLILPALTLAFVHLGIVARQ
FT                   IRSAMLEQLSEDYIRTARASGLPGWYIVLCYALPNALIPSITVLGLALGDLLYGAVLTE
FT                   TVFAWPGMGAWVVTSIQALDFPAVMGFAVVVSFAYVLVNLVVDLLYLWIDPRIGRGGGE
FT                   "
FT   gene            490501..491397
FT                   /locus_tag="ARC77_02665"
FT   CDS_pept        490501..491397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02665"
FT                   /product="D-ala-D-ala transporter subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02665"
FT                   /db_xref="GOA:C3TA84"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA84"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000979593.1"
FT                   /protein_id="AMW41215.1"
FT                   /translation="MMLSEETSAVRPQKQTRFNGAKLVWMLKGSPLTVTGAVIIVLMLL
FT                   MMIFSPWLATHDPNAIDLTARLLPPSAAHWFGTDEVGRDLFSRVLVGSQQSILAGLVVV
FT                   AIAGMIGSLLGCLSGVLGGRADAIIMRIMDIMLSIPSLVLTMALAAALGPSLFNAMLAI
FT                   AIVRIPFYVRLARGQALVVRQYTYVQAAKTFGASRWHLINWHILRNSLPPLIVQVSLDI
FT                   GSAILMAATLGFIGLGAQQPSAEWGAMVANGRNYVLDQWWYCAFPGAAILLTAVGFNLF
FT                   GDGIRDLLDPKAGGKQS"
FT   gene            491394..492380
FT                   /locus_tag="ARC77_02670"
FT   CDS_pept        491394..492380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02670"
FT                   /product="peptide ABC transporter substrate-binding
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02670"
FT                   /db_xref="GOA:C3TA88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA88"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001587322.1"
FT                   /protein_id="AMW41216.1"
FT                   /translation="MTQPVLDIQQLHLSFPGFNGDVHALNNVSLQINRGEIVGLVGESG
FT                   SGKSVTAMLIMRLLPTGSYCVHRGQISLLGDDVLNAREKQLRQWRGARVAMIFQEPMTA
FT                   LNPTRRIGLQMMDVIRHHQPISRREARAKAIALLEEMQIPDTVEVMSRYPFELSGGMRQ
FT                   RVMIALAFSCEPQLIIADEPTTALDVTVQLQVLRLLKHKARDSGTAVLFISHDMAVVSQ
FT                   LCDSVYVMYAGSVIESGVTADVIHHPRHPYTIGLLQCAPEHGVPRQPLPAIPGTVPNLT
FT                   HLPDGCAFRDRCYAAGAQCENVPALTACGDNNQRCACWYPQQEVISV"
FT   gene            492373..493299
FT                   /locus_tag="ARC77_02675"
FT   CDS_pept        492373..493299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02675"
FT                   /product="peptide ABC transporter ATP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02675"
FT                   /db_xref="GOA:C3TA93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA93"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001285518.1"
FT                   /protein_id="AMW41217.1"
FT                   /translation="MSDTLLTLRDVHINFPARKNWLGKTTEHVHAINGIDLQIRRGETL
FT                   GIVGESGCGKSTLAQLLMGMLQPSHGQYIRSGSQRIMQMMFQDPLSSLNPRLPVWRIIT
FT                   EPLWIAKHSSEQQRRALAEELAVQVGIRPEYLDRLPHAFSGGQRQRIAIARALSSQPDV
FT                   IVLDEPTSALDISVQAQILNLLVTLQENHGLTYVLISHNVSVIRHMSDRVAVMYLGQIV
FT                   ELGEAQQVLTAPAHPYTRLLLDSLPAIDKPLEEEWALRKTDLPGNRTLPQGCFFRERCP
FT                   LATSGCEVRQSLTTRADGREIRCWRAL"
FT   gene            complement(493355..493786)
FT                   /locus_tag="ARC77_02680"
FT   CDS_pept        complement(493355..493786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02680"
FT                   /product="osmotically inducible protein OsmC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02680"
FT                   /db_xref="GOA:C3TA98"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C3TA98"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005126807.1"
FT                   /protein_id="AMW41218.1"
FT                   /translation="MTIHKKGQAHWESDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKG
FT                   TNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEV
FT                   AVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS"
FT   gene            494131..494346
FT                   /locus_tag="ARC77_02685"
FT   CDS_pept        494131..494346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02685"
FT                   /product="biofilm-dependent modulation protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02685"
FT                   /db_xref="InterPro:IPR019625"
FT                   /db_xref="UniProtKB/TrEMBL:E2QM35"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000495701.1"
FT                   /protein_id="AMW41219.1"
FT                   /translation="MFTYYQAENSTAEPALVNAIEQGLRAEHGVVTEDDILMELTKWVE
FT                   ASDNDILSDIYQQTINYVVSGQHPTL"
FT   gene            494448..494585
FT                   /gene="rpsV"
FT                   /locus_tag="ARC77_02690"
FT   CDS_pept        494448..494585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsV"
FT                   /locus_tag="ARC77_02690"
FT                   /product="30S ribosomal subunit S22"
FT                   /note="protein D; stationary-phase-induced
FT                   ribosome-associated; in Escherichia coli this protein
FT                   becomes associated with the ribosome; expression increases
FT                   during stationary phase; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02690"
FT                   /db_xref="GOA:C3TAA7"
FT                   /db_xref="InterPro:IPR012607"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAA7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001394269.1"
FT                   /protein_id="AMW41220.1"
FT                   /translation="MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAEK
FT                   "
FT   gene            494742..496439
FT                   /locus_tag="ARC77_02695"
FT   CDS_pept        494742..496439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02695"
FT                   /product="NAD-dependent malic enzyme"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02695"
FT                   /db_xref="GOA:A0A152VR11"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR023667"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152VR11"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001594064.1"
FT                   /protein_id="AMW41221.1"
FT                   /translation="MEPKTKKQRSLYIPYAGPVLLEFPLLNKGSAFSMEERRNFNLLGL
FT                   LPEVVETIEEQAERAWIQYQGFKTEIDKHIYLRNIQDTNETLFYRLVNNHLDEMMPVIY
FT                   TPTVGAACERFSEIYRRSRGVFISYQNRHNMDDILQNVPNHNIKVIVVTDGERILGLGD
FT                   QGIGGMGIPIGKLSLYTACGGISPAYTLPVVLDVGTNNQQLLNDPLYMGWRNPRITDDE
FT                   YYEFVDEFIQAVKQRWPDVLLQFEDFAQKNAMPLLNRYRNEICSFNDDIQGTAAVTVGT
FT                   LIAASRAAGGQLSEKKIVFLGAGSAGCGIAEMIIAQTQREGLSEEAARQKVFMVDRFGL
FT                   LTDKMPNLLPFQTKLVQKRENLSDRDTDSDVLSLLDVVRNVKPDILIGVSGQTGLFTEE
FT                   IIREMHKHCPRPIVMPLSNPTSRVEATPQDIIAWTEGNALVATGSPFNPVVWKDKIYPI
FT                   AQCNNAFIFPGIGLGVIASGASRITDEMLMSASETLAQYSPLVLNGEGLVLPELKDIQK
FT                   VSRAIAFAVGKMAQQQGVAVKTSAEALQQAIDDNFWQAEYRDYRRTSI"
FT   gene            496573..497583
FT                   /gene="adhP"
FT                   /locus_tag="ARC77_02700"
FT   CDS_pept        496573..497583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="ARC77_02700"
FT                   /product="alcohol dehydrogenase AdhP"
FT                   /note="similar to zinc-dependent eukaryotic ADH enzymes and
FT                   distinct from fermentative ADHs; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02700"
FT                   /db_xref="GOA:A0A066RLJ9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066RLJ9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014838434.1"
FT                   /protein_id="AMW41222.1"
FT                   /translation="MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKN
FT                   GDFGDKTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCR
FT                   SVKNAGYSVDGGMAEECIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQ
FT                   WIAIYGLGGLGNLALQYAKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIV
FT                   QEKTGGAHAAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVG
FT                   SLVGTRQDLTEAFQFAAEGKVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR"
FT   gene            497729..498013
FT                   /locus_tag="ARC77_02705"
FT   CDS_pept        497729..498013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02705"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02705"
FT                   /db_xref="GOA:A0A0K4QWT7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K4QWT7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001532767.1"
FT                   /protein_id="AMW41223.1"
FT                   /translation="MKMANHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGK
FT                   AALTPEMAIKLSVVIGSSPQMWLNLQNAWSLAEAAKTVDVSRLRRLVAQ"
FT   gene            complement(498063..498716)
FT                   /locus_tag="ARC77_02710"
FT   CDS_pept        complement(498063..498716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02710"
FT                   /product="formate dehydrogenase"
FT                   /note="cytochrome b556(FDO) component; heme containing;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02710"
FT                   /db_xref="GOA:C3TAC7"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAC7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000045641.1"
FT                   /protein_id="AMW41224.1"
FT                   /translation="MSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQ
FT                   TFGTPQMGRILHPFFGIAIFVALMFMFVRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVA
FT                   DVGKYNAGQKMMFWSIMSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILI
FT                   HAILIHMYMAFWVKGSIKGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI"
FT   gene            complement(498709..499593)
FT                   /locus_tag="ARC77_02715"
FT   CDS_pept        complement(498709..499593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02715"
FT                   /product="formate dehydrogenase subunit beta"
FT                   /note="beta subunit; involved in the use of formate as an
FT                   electron donor during aerobic respiration; acts to transfer
FT                   electrons from the major(alpha subunit) to the cytochrome
FT                   b556(gamma subunit); Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02715"
FT                   /db_xref="GOA:C3TAD2"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAD2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000061603.1"
FT                   /protein_id="AMW41225.1"
FT                   /translation="MAMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKAC
FT                   QVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQSGKLEWLIRKDGCMHCE
FT                   DPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLC
FT                   VDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGT
FT                   HVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGP
FT                   NKEVDDDEEDHHE"
FT   gene            complement(499606..502017)
FT                   /locus_tag="ARC77_02720"
FT   CDS_pept        complement(499606..502017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02720"
FT                   /product="formate dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02720"
FT                   /db_xref="GOA:A0A143DUI8"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DUI8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016247187.1"
FT                   /protein_id="AMW41226.1"
FT                   /translation="MTNHWVDIKNANVVMVMGGNAAEAHPVGFRWAMEAKNNNDATLIV
FT                   VDPRFTRTASVADIYAPIRSGTDITFLSGVLRYLIENNKINAEYVKHYTNASLLVRDDF
FT                   AFEDGLFSGYDAEKRQYDKSSWNYQFDENGYAKRDETLTHPRCVWNLLKEHVSRYTPDV
FT                   VENICGTPKADFLKVCEVLASTSAPDRTTTFLYALGWTQHTVGAQNIRTMAMIQLLLGN
FT                   MGMAGGGVNALRGHSNIQGLTDLGLLSTSLPGYLTLPSEKQVDLQSYLEANTPKATLAG
FT                   QVNYWSNYPKFFVSLMKSFYGDAAQKENNWGYDWLPKWDQTYDVIKYFNMMDEGKVTGY
FT                   FCQGFNPVASFPDKNKVVSCLSKLKYMVVIDPLVTETSTFWQNHGESNDVDPASIQTEV
FT                   FRLPSTCFAEEDGSIANSGRWLQWHWKGQDAPGEARNDGEILAGIYHHLRELYQAEGGK
FT                   GVEPLMKMSWNYKQPHEPQSDEVAKENNGYALEDLYDANGVLIAKKGQLLSSFAHLRDD
FT                   GTTASSCWIYTGSWTEQGNQMANRDNSDPSGLGNTLGWAWAWPLNRRVLYNRASADING
FT                   KPWDPKRMLIQWNGSKWTGNDIPDFGNAAPGTPTGPFIMQPEGMGRLFAINKMAEGPFP
FT                   EHYEPIETPLGTNPLHPNVVSNPVVRLYEQDALRMGKKEQFPYVGTTYRLTEHFHTWTK
FT                   HALLNAIAQPEQFVEISETLAAAKGINNGDRVTVSSKRGFIRAVAVVTRRLKPLNVNGQ
FT                   QVETVGIPIHWGFEGVARKGYIANTLTPNVGDANSQTPEYKAFLVNIEKA"
FT   gene            complement(502066..502653)
FT                   /locus_tag="ARC77_02725"
FT   CDS_pept        complement(502066..502653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02725"
FT                   /product="sulfate ABC transporter substrate-binding
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02725"
FT                   /db_xref="GOA:W8SZ39"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:W8SZ39"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005126799.1"
FT                   /protein_id="AMW41227.1"
FT                   /translation="MDVSRRQFFKICAGGMAGTTVAALGFAPKQALAQARNYKLLRAKE
FT                   IRNTCTYCSVGCGLLMYSLGDGAKNAREAIYHIEGDPDHPVSRGALCPKGAGLLDYVNS
FT                   ENRLRYPEYRAPGSDKWQRISWEEAFSRIAKLMKADRDANFIEKNEQGVTVNRWLSTGM
FT                   LCASGASNETGMLTQKFARSLGMLAVDNQARV"
FT   gene            502942..503766
FT                   /locus_tag="ARC77_02730"
FT   CDS_pept        502942..503766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02730"
FT                   /product="aromatic amino acid transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02730"
FT                   /db_xref="GOA:A0A061KGI7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A061KGI7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005025913.1"
FT                   /protein_id="AMW41228.1"
FT                   /translation="MVGLIRGVSEGLGPVGGAAAIYSLSGLLLIFTVGFPRIRQIPKGY
FT                   LLAGSLLFVSYEICLALSLGYAATRHQAIEVGMVNYLWPSLTILFAILFNGQKTNWLIV
FT                   PGLLLALVGVCWVLGGDNGLHYDEIINNITTSPLSYFLAFIGAFIWAAYCTVTNKYARG
FT                   FNGITVFVLLTGASLWVYYFLTPQPEMVFSTPVMIKLISAAFTLGFAYAAWNVGILHGN
FT                   VTIMAVGSYFTPVLSSALAAVLLSAPLSFSFWQGALMVCGGSLLCWLATRRG"
FT   gene            504025..505125
FT                   /locus_tag="ARC77_02735"
FT   CDS_pept        504025..505125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02735"
FT                   /product="porin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02735"
FT                   /db_xref="GOA:A0A152VR19"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152VR19"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000768382.1"
FT                   /protein_id="AMW41229.1"
FT                   /translation="MKLKIVAVVVTGLLAANVAHAAEVYNKDGNKLDLYGKVTALRYFT
FT                   DDKRDDGDKTYARLGFKGETQINDQMIGFGHWEYDFKGYNDEANGSRDNKTRLAYAGLK
FT                   ISEFGSLDYGRNYGVGYDIGSWTDMLPEFGGDTWSQKDVFMTYRTTGVATYRNYDFFGL
FT                   IEGLNFAAQYQGKNERTDNSHLYGADYTRANGDGFGISSTYVYDGFGIGAVYTKSDRTN
FT                   AQERAAANPLNASGKNAELWATGIKYDANNIYFAANYAETLNMTTYGDGYISNKAQSFE
FT                   VVAQYQFDFGLRPSLAYLKSKGIDLGRYGDQDMIEYIDVGATYFFNKNMSTYVDYKINL
FT                   IDESDFTRAVDIRTDNIVATGITYQF"
FT   gene            505294..505797
FT                   /locus_tag="ARC77_02740"
FT   CDS_pept        505294..505797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02740"
FT                   /product="IpaH-like protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02740"
FT                   /db_xref="GOA:A0A143DWY6"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWY6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303498.1"
FT                   /protein_id="AMW41230.1"
FT                   /translation="MTNINTACVKNNASYQFNNALPNKETISSNFCERLEQWGNKSLNN
FT                   GEERAIAVERIKEAYNSNMASLDLSYLDLSELPPIPSTVNTLNLENNCLTCLDFTDNAS
FT                   LVNINLSFNKINTITFPNESNLENIYIDHNNLESLDLKNQHSLVNLEAQNNNLKKLIFL
FT                   IVIN"
FT   gene            505884..506552
FT                   /locus_tag="ARC77_02745"
FT   CDS_pept        505884..506552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02745"
FT                   /product="leucine Rich Repeat family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02745"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAE2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303497.1"
FT                   /protein_id="AMW41231.1"
FT                   /translation="MITDLILHNHPRMKTITLNDNHIAHLNTKTTTKLEYLNLSNNNLL
FT                   PTNDIDQLISSKHLWHVLVNGINNDSLAQMQYWTAVRNIIDDTNEVTIDLSYNLAITNI
FT                   DTSDEHLVEVSDNSEGNYIKDNDSMSIRYRSKYYSRDSALIEEETIFSDAELKAILPMR
FT                   RMYGVSDYKSNSSSLSSHSGLKDPTGTPVCYYIHNESKPSLGYGPTSNNWLSQSFTTEL
FT                   "
FT   gene            506615..507874
FT                   /locus_tag="ARC77_02750"
FT   CDS_pept        506615..507874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02750"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02750"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAE8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000671689.1"
FT                   /protein_id="AMW41232.1"
FT                   /translation="MKFPSIFNKIKPQSIQQHPEKNQLNWMLELNKWKEERILTGEIHR
FT                   PECRNEAAKRINCAFLSKQNDIDLSGLNLSTQPPGLQNFTSINLDNNQLTHFDATNYDR
FT                   LVKLSLNSNTLESINIHQGRNVSITHISMNNNCLRNIDIDRLSSITYFSAAHNKLEFVQ
FT                   LESCEWLQYLNLSHNQLTDIVTGNKEELLLLDLSHNKLASLHNALFPNLNTLLINNNLL
FT                   SEIKMFYSNFCKVQTLNAANNQLEKINLHFLTYLSSIKSLRLDNNKITRIDTENTSDIR
FT                   SLFPIIKKSESLNFLNISGENNCPTIQLMLFNLFSPALKLNTGLAILSPGAFEDHSDGL
FT                   DVDNELFHYTINKAYTPYNIHTYKTEEVVNQRNIKIKNMTLDEINNTYCNNDYYNEAIR
FT                   EEPIDFLDRSFSSSSWPFYH"
FT   gene            508180..509568
FT                   /locus_tag="ARC77_02755"
FT   CDS_pept        508180..509568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02755"
FT                   /product="nitrate/nitrite transporter NarK"
FT                   /note="involved in the transport of nitrate and nitrite;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02755"
FT                   /db_xref="GOA:C3TAF3"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAF3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016158273.1"
FT                   /protein_id="AMW41233.1"
FT                   /translation="MALQNEKNSRYLLRDWKPENPAFWKNKGKHIARRNLWISVSCLLL
FT                   AFCVWMLFSAVTVNLNKIGFNFTTDQLFLLTALPSVSGALLRVPYSFMVPIFGGRRWTV
FT                   FSTAILIIPCVWLGIAVQNPNTPFGIFIVIALLCGFAGANFASSMGNISFFFPKARQGS
FT                   ALGINGGLGNLGVSVMQLVAPLVIFVPVFAFLGVNGVPQADGSVMSLANAAWIWVPLLA
FT                   IATIAAWSGMNDIASSRASIADQLPVLQRLHLWLLSLLYLATFGSFIGFSAGFAMLAKT
FT                   QFPDVNILRLAFFGPFIGAIARSVGGAISDKFGGVRVTLINFIFMAIFSALLFLTLPGT
FT                   GSGNFIAFYAVFMGLFLTAGLGSGSTFQMIAVIFRQITIYRMKMKGGSDEQAQREAVTE
FT                   TAAALGFISAIGAVGGFFIPQAFGMSLNMTGSPVGAMKVFLIFYIVCVLLTWLVYGRRK
FT                   FSQK"
FT   gene            509650..513390
FT                   /gene="narZ"
FT                   /locus_tag="ARC77_02760"
FT   CDS_pept        509650..513390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narZ"
FT                   /locus_tag="ARC77_02760"
FT                   /product="nitrate reductase subunit alpha"
FT                   /note="with NarYV catalyzes the reduction of nitrate; the
FT                   beta subunit is an iron sulfur cluster containing electron
FT                   transfer subunit; one of 3 nitrate reductases in E. coli;
FT                   expression of nitrate reductase Z is not dependent on
FT                   nitrate levels; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02760"
FT                   /db_xref="GOA:C3TAF8"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAF8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001668598.1"
FT                   /protein_id="AMW41234.1"
FT                   /translation="MSKLLDRFRYFKQKGDTFADGHGQVMHSNRDWEDSYRQRWQFDKI
FT                   VRSTHGVNCTGSCSWKIYVKNGLVTWEIQQTDYPRTRPDLPNHEPRGCPRGASYSWYLY
FT                   SANRLKYPLIRKRLIELWREALKQHSDPVLAWASIMNDPQKSLSYKQVRGRGGFIRSNW
FT                   PELNQLIAAANVWTIKTYGPDRVAGFSPIPAMSMVSYAAGTRYLSLLGGTCLSFYDWYC
FT                   DLPPASPMTWGEQTDVPESADWYNSSYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTIAI
FT                   TPDYSEVAKLCDQWLAPKQGTDSALAMAMGHVILKEFHLDNPSDYFINYCRRYSDMPML
FT                   VMLEPRDDGSYVPGRMIRASDLVDGLGESNNPQWKTVAVNTAGELVVPNGSIGFRWGEK
FT                   GKWNLESIAAGKETELSLTLLGQHDAVAGVAFPYFGGIENPHFRSVKHNPVLVRQLPVK
FT                   NLTLAGGSTCPVVSVYDLVLANYGLDRGLEDENSAKDYAEIKPYTPAWGEQITGVPRQY
FT                   IETIAREFADTAHKTHGRSMIILGAGVNHWYHMDMNYRGMINMLIFCGCVGQSGGGWAH
FT                   YVGQEKLRPQTGWLPLAFALDWNRPPRQMNSTSFFYNHSSQWRYEKVSAQELLSPLADA
FT                   SKYSGHLIDFNVRAERMGWLPSAPQLGRNPLGIKAEADKAGLSPTEFTAQALKSGDLRM
FT                   ACEQPDSGSNHPRNLFVWRSNLLGSSGKGHEYMQKYLLGTESGIQGEELGASDGIKPEE
FT                   VEWQTAAIEGKLDLLVTLDFRMSSTCLFSDIVLPTATWYEKDDMNTSDMHPFIHPLSAA
FT                   VDPAWESRSDWEIYKGIAKAFSQVCVGHLGKETDVVLQPLLHDSPAELSQPCEVLDWRK
FT                   GECDLSPGKTAPNIVAVERDYPATYERFTSLGPLMDKLGNGGKGISWNTQDEIDFLGKL
FT                   NYTKRDGPAQGRPLIDTAIDASEVILALAPETNGHVAVKAWQALGEITGREHTHLALHK
FT                   EDEKIRFRDIQAQPRKIISSPTWSGLESDHVSYNAGYTNVHELIPWRTLSGRQQLYQDH
FT                   PWMRAFGESLVAYRPPIDTRSVSEMRQIPPNGFPEKALNFLTPHQKWGIHSTYSENLLM
FT                   LTLSRGGPIVWISETDARELTIVDNDWVEVFNANGALTARAVVSQRVPPGMTMMYHAQE
FT                   RIMNIPGSEVTGMRGGIHNSVTRICPKPTHMIGGYAQLAWGFNYYGTVGSNRDEFIMIR
FT                   KMKNVNWLDDEGRDQVQEAKK"
FT   gene            513387..514931
FT                   /gene="narH"
FT                   /locus_tag="ARC77_02765"
FT   CDS_pept        513387..514931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narH"
FT                   /locus_tag="ARC77_02765"
FT                   /product="nitrate reductase subunit beta"
FT                   /note="with NarGJI catalyzes the reduction of nitrate; the
FT                   beta subunit is an iron sulfur cluster containing electron
FT                   transfer subunit; one of 3 nitrate reductases in E. coli
FT                   and in E. coli is expressed when nitrate levels are high;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02765"
FT                   /db_xref="GOA:C3TAG2"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAG2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008784807.1"
FT                   /protein_id="AMW41235.1"
FT                   /translation="MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTGREGMEYAWFNNVE
FT                   TKPGIGYPKNWEDQEEWQGGWVRDVNGKIRPRLGSKMGVITKIFANPVVPQIDDYYEPF
FT                   TFDYEHLHSAPEGKHIPTARPRSLIDGKRMDKVIWGPNWEELLGGEFEKRARDRNFEAM
FT                   QKEMYGQFENTFMMYLPRLCEHCLNPSCVATCPSGAIYKREEDGIVLIDQDKCRGWRLC
FT                   ISGCPYKKIYFNWKSGKSEKCIFCYPRIESGQPTVCSETCVGRIRYLGVLLYDADRIEE
FT                   AASTEREVDLYERQCEVFLDPHDPSVIEEALKQGIPQNVIDAAQRSPVYKMAMDWKLAL
FT                   PLHPEYRTLPMVWYVPPLSPIQSYADAGGLPKSEGVLPAIESLRIPVQYLANMLSAGDT
FT                   GPVLRALKRMMAMRHYMRSQTVEGVTDTRAIDEVGLSIAQVEEMYRYLAIANYEDRFVI
FT                   PTSHREMAGDAFAERNGCGFTFGDGCHGSDSKFNLFNSSRIDAINITEVRDKAEGE"
FT   gene            514931..515626
FT                   /locus_tag="ARC77_02770"
FT   CDS_pept        514931..515626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02770"
FT                   /product="nitrate reductase"
FT                   /note="delta subunit of nitrate reductase 1; chaperone for
FT                   the insertion of the molybdenum cofactor and assembly of
FT                   nitrate reductase 1; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02770"
FT                   /db_xref="GOA:C3TAG7"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAG7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005126790.1"
FT                   /protein_id="AMW41236.1"
FT                   /translation="MQILKVIGLLMEYPDEMLWECKEDALALIRRDAPMLTDFTRNLLN
FT                   APLLDKQAEWCEVFDRGRTTSLLLFEHVHAESRDRGQAMVDLLAEYEKVGLQLDCRELP
FT                   DYLPLYLEYLSVLPDDQAKEGLLNVAPILALLGGRLKQREAPWYALFDALLQLAGSTLS
FT                   SDSVTKQVNSEERDDTRQALDAVWEEEQVKFIEDNATACDSSPLNQYQRRFSQDVAPQY
FT                   VDISAGGGK"
FT   gene            515623..516303
FT                   /gene="narI"
FT                   /locus_tag="ARC77_02775"
FT   CDS_pept        515623..516303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narI"
FT                   /locus_tag="ARC77_02775"
FT                   /product="respiratory nitrate reductase subunit gamma"
FT                   /note="with NarGJH catalyzes the reduction of nitrate; the
FT                   gamma subunit localizes NarGHI to the membrane; one of 3
FT                   nitrate reductases in E. coli and in E. coli is expressed
FT                   when nitrate levels are high; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02775"
FT                   /db_xref="GOA:C3TAH2"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAH2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020802161.1"
FT                   /protein_id="AMW41237.1"
FT                   /translation="MIQYLNVFFYDIYPYICATVFFLGSWLRYDYGQYTWRASSSQMLD
FT                   KRGMVIWSNLFHIGILGIFFGHLFGMLTPHWMYAWFLPVAAKQLMAMVLGGICGVLTLI
FT                   GGAGLLWRRLTNQRVRATSTTPDIIIMSILLIQCLLGLSTIPFSAQYPDGSEMMKLVGW
FT                   AQSIVTFRGGSSEMLNGVAFVFRLHLVLGMTIFLLFPFTRLVHVWSAPFEYFTRRYQIV
FT                   RSRR"
FT   gene            516382..517275
FT                   /locus_tag="ARC77_02780"
FT   CDS_pept        516382..517275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02780"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02780"
FT                   /db_xref="GOA:C3TAH7"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAH7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000804420.1"
FT                   /protein_id="AMW41238.1"
FT                   /translation="MKPQVYHVDAFTSQPFRGNSAGVVFPADNLSEAQMQLIARELGHS
FT                   ETAFLLHSDDSDVRIRYFTPTVEVPICGHATVAAHYVRAKVLGLGNCTVWQTSLAGKHR
FT                   VTIEKHHDGYRISLEQGTPGFEPPLEGETRAAIINALHLTEDDILPGLPIQVATTGHSK
FT                   VMIPLKPEVDIDALSPDLNALTAISKQIGCNGFFPFQIRPGKNETDGRMFSPAIGIVED
FT                   PVTGNANGPMGAWLVHHNVLPHDGNVLRVKGHQGRALGRDGMIEVTVTIRDNQPEKVTI
FT                   SGAAVILFHAEWAIKL"
FT   gene            complement(517371..517484)
FT                   /locus_tag="ARC77_02785"
FT   CDS_pept        complement(517371..517484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02785"
FT                   /product="arylamine N-acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02785"
FT                   /db_xref="GOA:A0A152VR33"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152VR33"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001304166.1"
FT                   /protein_id="AMW41239.1"
FT                   /translation="MMQEQFGLGVDDAKHGFTVDELALVMAAFDTHPEAGK"
FT   gene            complement(517481..518215)
FT                   /locus_tag="ARC77_02790"
FT   CDS_pept        complement(517481..518215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02790"
FT                   /product="N-hydroxyarylamine O-acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02790"
FT                   /db_xref="GOA:C3SDL2"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDL2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303496.1"
FT                   /protein_id="AMW41240.1"
FT                   /translation="MTPILNHYFARINWSGAAAVNIDTLRALHLKHNCTIPFENLDVLL
FT                   PREMQLDDQSLEEKLVIARRGGYCFEQNGVFERVLRELGFNVRSLLGRVVLSNPPALPP
FT                   RTHRLLLVELEEEKWIADVGFGGQTLTAPIRLVPDLVQTTPHGEYRLLQEGDDWVLQFN
FT                   HHQHWQSMYRFDLCEQQQSDYVMGNFWSAHWPQSHFRHHLLMCRHLPDGGKLTLTNFHF
FT                   PIMKMGTRWSSEIYRMWRRYML"
FT   gene            518514..518957
FT                   /locus_tag="ARC77_02795"
FT   CDS_pept        518514..518957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02795"
FT                   /product="flavin reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02795"
FT                   /db_xref="GOA:C3SDL5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDL5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001143832.1"
FT                   /protein_id="AMW41241.1"
FT                   /translation="MPVEFEPPRVTIVVDKSTWTRELIERNGKFGIVIPGVAATNWTWA
FT                   VGSVSGREEDKFNCYGIPVVRGPVFGLPLVEEKCLAWMECRLLPATSAQEEYDTLFGEV
FT                   VSAAADARVFVEGRWQFDDDKLNTLHHLGAGTFVTSGKRVTAG"
FT   gene            complement(518961..519188)
FT                   /locus_tag="ARC77_02800"
FT   CDS_pept        complement(518961..519188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02800"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="4-OT; member of subfamily 5; forms a dimer; the
FT                   function in the Escherichia coli cell is unknown; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02800"
FT                   /db_xref="GOA:J7R4B0"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR017284"
FT                   /db_xref="UniProtKB/TrEMBL:J7R4B0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001120141.1"
FT                   /protein_id="AMW41242.1"
FT                   /translation="MPHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQ
FT                   QIQPESWQAIWDAEIAPQMEALIKKPGYSM"
FT   gene            complement(519287..520177)
FT                   /locus_tag="ARC77_02805"
FT   CDS_pept        complement(519287..520177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02805"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02805"
FT                   /db_xref="GOA:A0A143DWM7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWM7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001455049.1"
FT                   /protein_id="AMW41243.1"
FT                   /translation="MRDCHSSDDKDVIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSL
FT                   VIGQIKTDEKSNEITAIPELLNMLDIKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKG
FT                   NQGRLNKAFEEKFPLKELNNPEHDSYAISEKSHGREEIRLHIVCDVPDELIDFTFEWKG
FT                   LKKLCVAVSFRSIIAEQQNSRTAEQQNKRKSQKMTVRYYISSADLTAEKFATAIRNHWH
FT                   VENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIAINILTNDKVFKAGLRRKMRKAAM
FT                   DRNYLASVLAGSGLS"
FT   gene            complement(520277..520456)
FT                   /locus_tag="ARC77_02810"
FT   CDS_pept        complement(520277..520456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02810"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02810"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:W8TAC6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000420876.1"
FT                   /protein_id="AMW41244.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDFGETHPDVLK"
FT   gene            complement(520964..521173)
FT                   /locus_tag="ARC77_02815"
FT   CDS_pept        complement(520964..521173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02815"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7C5J0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001001073.1"
FT                   /protein_id="AMW41245.1"
FT                   /translation="MNEAKEKDLGTYKKSTLKTEKITRGLFSNDEITLIYFSEYSKRIV
FT                   QEVFVFNVEDKKVKLKGYRYDSIN"
FT   gene            complement(521173..521358)
FT                   /locus_tag="ARC77_02820"
FT   CDS_pept        complement(521173..521358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02820"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02820"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K4UGF7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000759878.1"
FT                   /protein_id="AMW41246.1"
FT                   /translation="MKKYIFLVLFLLYGCSPVDIEPARQEVNIFRGLYQTGKYSDIYKI
FT                   TSSDFQTATSEKNLST"
FT   gene            complement(521370..525572)
FT                   /locus_tag="ARC77_02825"
FT   CDS_pept        complement(521370..525572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02825"
FT                   /product="RHS element protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02825"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C7BAE2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000014860.1"
FT                   /protein_id="AMW41247.1"
FT                   /translation="MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTS
FT                   GNPVNPLLGAKVLPGETDLALPGPLPFILSRTYSSYRTRTPAPVGIFGPGWKAPSDIRL
FT                   QLRDDALVLNDNGGRSIHFEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWGALP
FT                   PDIRLSPHLYLATNSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGMADRFGRTLTY
FT                   RREAAGDLAGEITGVTDGAGREFRLVLTTQAQRAEEARKQHTASLSSPDTPRPLSDSAF
FT                   PDTLPGTEYGPDRGIRLSAVWLTHDPAYPESLPGAPLARYTYTEAGELLAVYDRSNTQV
FT                   RAFTYDAQHPGRMVAHRYAGRPEMRYRYDDTGRVVEQLNPAGLSYRYQYEQDRITVTDS
FT                   LNRREVLHTEGGAGLKRVVKKELADGSVTHSGYDAAGRLTAQTDAAGRRTEYGLNVVSG
FT                   DITDITTPDGRETKFYYNDGNQLTAVVSPDGLESRRAYDEPGRLVSETSRCGDVIRYAY
FT                   DNPHSELPATTTDATGSTRQMTWSRYGQLLAFTDCSGYQTRYEYDRFGQMTAVHREEGI
FT                   SRYRRYDNRGRLTSVKDAQGHETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQ
FT                   GGLTRSMEYDLAGRITTLTNENGSRSEFTYDALDRLVQQRGFDGRTQRYHYDLTGKLTQ
FT                   SEDEGLVTLWHYDESDRLTHRTVNGEPAEQWQYDEHGWLTEISHLSEGHQVAVHYGYDD
FT                   KGRLAGERQTVHNPETGELLWQHETEHAYNEQGLANRVTPDSLPRVEWLTYGSGYLAGM
FT                   KLGGTPLVEFTRDRLHRETVRSFGNNAYELTSTYTPAGHLQSQRLNSQVYDRDYDWNDN
FT                   GDLVRISGPRQTWEYGYSATGRLESVRTLASDLDIRIPYATDPAGNRLPDPELHPDSTL
FT                   TAWPDNRIAEDAHYVYRHDEYGRLTEKTDRIPAGVIRTDDERTHHYHYDSQHRLVFYTR
FT                   IQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEVTWYGWDGDRLTTVQT
FT                   DTTRIQTVYEPGSFTPLIRVETENGEREKAQRRSLAETLQQEGSENGHGVVFPAELVRL
FT                   LDRLEEEIRADRVSSESRAWLAQCGLTVEQLARQVEPEYTPARKVHFYHCDHRGLPLAL
FT                   ISEDGNTAWRGEYDEWGNQLNEENPYYLHQPYRLPGQQHDEESGLYYNRNRYYDPLQGR
FT                   YITQDPIGLAGGWNLYNYPLNPIIRMDPLGLYNLYQLLYDVWHDDSYGTSSIDITGSGD
FT                   LISLGGHAGLGVAFAKKKGEMLSDICIYATACGHAGIGGGINAAITYSETKSLPTSGVS
FT                   NSVGVTVGGGVGGHFAYTYVVDVDNPESSTESVGIGAGVDASVMTLACRTWQECWVN"
FT   gene            complement(525639..527747)
FT                   /locus_tag="ARC77_02830"
FT   CDS_pept        complement(525639..527747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02830"
FT                   /product="type IV secretion protein Rhs"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02830"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DU92"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000103288.1"
FT                   /protein_id="AMW41248.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQF
FT                   LSLEFAQVLDKMAYLTVWQGDDVQRRVKGVVTWFELGENDKNQMLYSMKVCPPLWRTGL
FT                   RQNFRIFQNEDIESILATILKENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAQKSIDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWR
FT                   NNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTT
FT                   LNNHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNP
FT                   SNQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKNYKGSGFNELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNH
FT                   AETIGNNQMIAVTNNQIQTVGVNQIETVGSNQIINVGSVQVETIGLVRALTVGVAYQTT
FT                   VGGIMNTSVALMQSSQIGLHKSLRVGLGYDVKVGNNVTFTVGKTKKDDTGQTAIYSAGE
FT                   HLELCCGKARLVLTKDGQIFLNGTKIHLQGKEQVNGDSLLINWNCAASKSPPKTPDEKQ
FT                   DTPDMREY"
FT   gene            complement(528568..528780)
FT                   /locus_tag="ARC77_02835"
FT   CDS_pept        complement(528568..528780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02835"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02835"
FT                   /db_xref="InterPro:IPR020099"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAI7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000882235.1"
FT                   /protein_id="AMW41249.1"
FT                   /translation="MLCFLIYITLPFIQLVYFISSEKKLTIHIVQMFHLLSQVFYNLKM
FT                   FLMMDMLGVGDAININTNKNIRQVC"
FT   gene            complement(528856..529473)
FT                   /locus_tag="ARC77_02840"
FT   CDS_pept        complement(528856..529473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02840"
FT                   /product="glutathione S-transferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02840"
FT                   /db_xref="GOA:C3TAJ3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAJ3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020233886.1"
FT                   /protein_id="AMW41250.1"
FT                   /translation="MIKVYGVPGWGSTISELMLTLADIPYQFVDVSGFDHEGTSRELLK
FT                   TLNPLCQVPTLALENDEIMTETAAIALMVLDRRPDLAPPVGRAERQQFQRLLVWLVANV
FT                   YPTFTFADYPERWASDAPEQLKKNVIEYRKSLYVWLNSQLTAEPYAFGEQLTLVDCYLC
FT                   TMRTWGPGHEWFQDNATNISAIADAVCQLPTLQEILKRNEII"
FT   gene            529740..531239
FT                   /locus_tag="ARC77_02845"
FT   CDS_pept        529740..531239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02845"
FT                   /product="amino acid permease"
FT                   /note="involved in the transporte of L-asparagine; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02845"
FT                   /db_xref="GOA:A0A024L3Q1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024L3Q1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P77610.2"
FT                   /protein_id="AMW41251.1"
FT                   /translation="MSKHDTDTSDQHAAKRRWLNAHEEGYHKAMGNRQVQMIAIGGAIG
FT                   TGLFLGAGARLQMAGPALALVYLICGLFSFFILRALGELVLHRPSSGSFVSYAREFLGE
FT                   KAAYVAGWMYFINWAMTGIVDITAVALYMHYWGAFGGVPQWVFALAALTIVGTMNMIGV
FT                   KWFAEMEFWFALIKVLAIVTFLVVGTVFLGSGQPLDGNTTGFHLITDNGGFFPHGLLPA
FT                   LVLIQGVVFAFASIEMVGTAAGECKDPQTMVPKAINSVIWRIGLFYVGSVVLLVMLLPW
FT                   SAYQAGQSPFVTFFSKLGVPYIGSIMNIVVLTAALSSLNSGLYCTGRILRSMAMGGSAP
FT                   SFMAKMSRQHVPYAGILATLVVYVVGVFLNYLVPSRVFEIVLNFASLGIIASWAFIIVC
FT                   QMRLRKAIKEGKAADVSFKLPGAPFTSWLTLLFLLSVLVLMAFDYPNGTYTIAALPIIG
FT                   ILLVIGWFGVRKRVAEIHSTAPVVEEDEEKQEIVFKPETAS"
FT   gene            complement(531354..532415)
FT                   /locus_tag="ARC77_02850"
FT   CDS_pept        complement(531354..532415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02850"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02850"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAK2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001489490.1"
FT                   /protein_id="AMW41252.1"
FT                   /translation="MHLRHLFSLRLRGSLLLGSLLVASSFSTQAAEEMLRKAVGKGAYE
FT                   MAYSQQENALWLATSQSRKLDKGGVVYRLDPVTLEVTQAIHNDLKPFGATINNTTQTLW
FT                   FGNTVNSAVTAIDAKTGEVKGRLVLDDRKRTEEVRPLQPRELVADDATNTVYISGIGKD
FT                   SVIWVVDGENIKLKTAIQNTGKMSTGLALDSKGKRLYTTNADGELITIDTADNKILSRK
FT                   KLLDDGKEHFFINISLDTARQRAFITDSKAAEVLVVDTRNGNILAKVAAPESLAVLFNP
FT                   ARNEAYVTHRQAGKVSVIDAKSYKVVKTFDTPTHPNSLALSADGKTLYVSVKQKSTKQQ
FT                   EATQPDDVIRIAL"
FT   gene            532657..534759
FT                   /locus_tag="ARC77_02855"
FT   CDS_pept        532657..534759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02855"
FT                   /product="TonB-dependent receptor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02855"
FT                   /db_xref="GOA:C3TAK7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAK7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000689312.1"
FT                   /protein_id="AMW41253.1"
FT                   /translation="MKIVFVRQTVLPALLVLSPVVFAADEQTMIVSAAPQVVSELDTPA
FT                   AVSVVDGEEMRLATPRINLSESLTGVPGLQVQNRQNYAQDLQLSIRGFGSRSTYGIRGI
FT                   RLYVDGIPATMPDGQGQTSNIDLSSVQNVEVLRGPFSALYGNASGGVMNVTTQTGQQPP
FT                   TIEASSYYGSFGSWRYGLKATGATGDGTQPGDVDYTVSTTRFTTHGYRDHSGAQKNLAN
FT                   AKLGVRIDDASKLSLIFNSVDIKADDPGGLTKAEWKANPQQAPRAEQYDTRKTIKQTQA
FT                   GLRYERSLSSRDDMSVMMYAGERETTQYQSIPMAPQLNPSHAGSVITLQRHYQGIDSRW
FT                   THRGELGVPVTFTTGLNYENMSENRKGYNNFRLNSGMPEYGQKGELRRDERNLMWNIDP
FT                   YLQTQWQLSEKLSLDAGVRYSSVWFDSNDHYVTPGNGDDSGDASYHKWLPAGSLKYAMT
FT                   DAWNIYLAAGRGFETPTINELSYRADGQSGMNFGLKPSTNDTIEIGSKTRIGDGLLSLA
FT                   LFQTDTDDEIVVDSSSGGRTTYKNAGKTRRQGAELAWDQRFAGDFRVNASWTWLDATYR
FT                   SNVCNEQDCNGNRMPGIARNMGFASIGYVPEDGWYAGMEARYMGDIMADDENTAKAPSY
FT                   TLVGLFTGYKYNYHNLTVDLFGRVDNLFDKEYVGSVIVNESNGRYYEPAPGRNYGVGVN
FT                   IAWRFE"
FT   gene            complement(534795..535460)
FT                   /locus_tag="ARC77_02860"
FT   CDS_pept        complement(534795..535460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02860"
FT                   /product="colanic acid/biofilm transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02860"
FT                   /db_xref="GOA:A0A085NXL6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085NXL6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001299369.1"
FT                   /protein_id="AMW41254.1"
FT                   /translation="MPGTEKMKHVSLTLQVENDLKHQLSIGALKPGARLITKNLAEQLG
FT                   MSITPVREALLRLVSVNALSVAPAQAFTVPEVGKRQLDEINRIRYELELMAVALAVENL
FT                   TPQDLAELQELLEKLQQAQEKGDMEQIINVNRLFRLAIYHRSNMPILCEMIEQLWVRMG
FT                   PGLHYLYEAINPAELREHIENYHLLLAALKAKDKEGCRHCLAEIMQQNIAILYQQYNR"
FT   gene            complement(535658..536695)
FT                   /locus_tag="ARC77_02865"
FT   CDS_pept        complement(535658..536695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02865"
FT                   /product="NADP-dependent oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02865"
FT                   /db_xref="GOA:A0A037YEC2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A037YEC2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_004030924.1"
FT                   /protein_id="AMW41255.1"
FT                   /translation="MGQQKQRNRRWVLASRPHGAPVPENFRLEEDDVATPGEGQVLLRT
FT                   VYLSLDPYMRGRMSDEPSYSPPVDIGGVMVGGTVSRVVESNHPDYQSGDWVLGYSGWQD
FT                   YDISSGDDLVKLGDHPQNPSWSLGVLGMPGFTAYMGLLDIGQPKEGETLVVAAATGPVG
FT                   ATVGQIGKLKGCRVVGVAGGAEKCRHATEVLGFDVCLDHHADDFAEQLAKACPKGIDIY
FT                   YENVGGKVFDAVLPLLNTSARIPVCGLVSSYNATELPPGPDRLPLLMATVLKKRIRLQG
FT                   FIIAQDYGHRIHEFQREMGQWVKEDKIHYREEITDGLENAPQTFIGLLKGKNFGKVVIR
FT                   VAGDD"
FT   gene            536876..537394
FT                   /locus_tag="ARC77_02870"
FT   CDS_pept        536876..537394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02870"
FT                   /product="acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02870"
FT                   /db_xref="GOA:C3TAM2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAM2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016235637.1"
FT                   /protein_id="AMW45914.1"
FT                   /translation="MSIRFARKADCAAIAEIYNHAVLYTAAIWNDQTVDADNRIAWFEA
FT                   RTIAGYPVLVSEEDGVVTGYASFGDWRSFDGFRHTVEHSVYVHPDHQGKGLGRKLLSRL
FT                   IDEARDCGKHVMVAGIESQNQASLHLHQSLGFVVTAQMPQVGTKFGRWLDLTFMQLQLD
FT                   ERTEPDAIG"
FT   gene            537391..537840
FT                   /locus_tag="ARC77_02875"
FT   CDS_pept        537391..537840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02875"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02875"
FT                   /db_xref="GOA:C3TAM8"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAM8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008501299.1"
FT                   /protein_id="AMW41256.1"
FT                   /translation="MNQSLTLAFLIAAGIGLVVQNSLMVRITQTSSTILIAMLLNSLVG
FT                   IVLFVSILWFKQGMAGFGELVSSVRWWTLIPGLLGSFFVFASISGYQNVGAATTIAVLV
FT                   ASQLIGGLVLDIFRSHGVPLRALFGPICGAILLVVGAWLVARRSF"
FT   gene            complement(537841..538074)
FT                   /locus_tag="ARC77_02880"
FT   CDS_pept        complement(537841..538074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02880"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02880"
FT                   /db_xref="InterPro:IPR019671"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAN2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006684482.1"
FT                   /protein_id="AMW41257.1"
FT                   /translation="MSHLDEVIARVDAAIEESVIAHMNELLIALSDDAELSREDRYTQQ
FT                   QRLRTAIAHHGRKHKEDMEARHEQLTKGGTIL"
FT   gene            complement(538160..538333)
FT                   /locus_tag="ARC77_02885"
FT   CDS_pept        complement(538160..538333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02885"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02885"
FT                   /db_xref="GOA:A0A094VRB6"
FT                   /db_xref="InterPro:IPR019689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A094VRB6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000061178.1"
FT                   /protein_id="AMW45915.1"
FT                   /translation="MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWP
FT                   MSFPVALLFSLF"
FT   gene            complement(538492..538689)
FT                   /locus_tag="ARC77_02890"
FT   CDS_pept        complement(538492..538689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02890"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02890"
FT                   /db_xref="UniProtKB/TrEMBL:W8TAD5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001306888.1"
FT                   /protein_id="AMW41258.1"
FT                   /translation="MILRTVRALISLTVRAACKITTSNKPAKSHRDKSKQTNSSKDIYQ
FT                   YYSSTGNIHFCHLLSLPLCV"
FT   gene            complement(538720..540144)
FT                   /locus_tag="ARC77_02895"
FT   CDS_pept        complement(538720..540144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02895"
FT                   /product="gamma-aminobutyraldehyde dehydrogenase"
FT                   /note="catalyzes the formation of 4-aminobutanoate from
FT                   4-aminobutanal; involved in putrescine degradation; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02895"
FT                   /db_xref="GOA:C3TAP2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017749"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAP2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006819884.1"
FT                   /protein_id="AMW41259.1"
FT                   /translation="MQHKLLINGELVSGEGEKQPVYNPATGDVLLEIAEASAEQVDAAV
FT                   RAADAAFAEWGQTTPKVRAECLLKLADVIEENGQVFAELESRNCGKPLHSAFNDEIPAI
FT                   VDVFRFFAGAARCLNGLAAGEYLEGHTSMIRRDPLGVVASIAPWNYPLMMAAWKLAPAL
FT                   AAGNCVVLKPSEITPLTALKLAELAKDIFPAGVINVLFGRGKTVGDPLTGHPKVRMVSL
FT                   TGSIATGEHIISHTAPSIKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCT
FT                   VACRIYAQKGIYDTLVEKLGAAVATLKSGAPDDESTELGPLSSLAHLERVSKAVEEAKA
FT                   TGHIKVITGGEKRKGNGYYYAPTLLAGALQDDAIVQKEVFGPVVSVTLFDNEEQVVNWA
FT                   NDSQYGLASSVWTKDVGRAHRVSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSL
FT                   YGLEDYTVVRHVMVKH"
FT   gene            complement(540166..540960)
FT                   /locus_tag="ARC77_02900"
FT   CDS_pept        complement(540166..540960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02900"
FT                   /product="spermidine/putrescine ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02900"
FT                   /db_xref="GOA:C3SDL9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3SDL9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000555464.1"
FT                   /protein_id="AMW41260.1"
FT                   /translation="MHSERAPFFLKLAAWGGVVFLHFPILIIAAYAFNTEDAAFSFPPQ
FT                   GLTLRWFSVAAQRSDILDAVTLSLKVAALATLMALVLGTLAAAALWRRDFFGKNAISLL
FT                   LLLPIALPGIVTGLALLTAFKTINLESGFFTIVVGHATFCVVVVFNNVIARFRRTSWSL
FT                   VEASMDLGANGWQTFRYVVLPNLSSALLAGGMLAFALSFDEIIVTTFTAGHERTLPLWL
FT                   LNQLGRPRDVPVTNVVALLVMLVTTLPILGAWWLTREGDNGQ"
FT   gene            complement(540950..541891)
FT                   /locus_tag="ARC77_02905"
FT   CDS_pept        complement(540950..541891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02905"
FT                   /product="spermidine/putrescine ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02905"
FT                   /db_xref="GOA:C3TAP7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAP7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016153152.1"
FT                   /protein_id="AMW41261.1"
FT                   /translation="MAMNVLQSPSRPGLGKVSGFFWRNPGLGLFLLLLGPLMWFGIVYF
FT                   GSLLTLLWQGFYTFDDFTMSVTPELTLANIRALFNPANYDIILRTLTMAVAVTIASAIL
FT                   AFPMAWYMARYTSGKMKAFFYIAVMLPMWASYIVKAYAWTLLLAKDGVAQWFLQHLGLE
FT                   PLLTAFLTLPAVGGNTLSTSGLGRFLVFLYIWLPFMILPVQAALERLPPSLLQASADLG
FT                   ARPRQTFRYVVLPLAIPGIAAGSIFTFSLTLGDFIVPQLVGPPGYFIGNMVYSQQGAIG
FT                   NMPMAAAFTLVPIVLIALYLAFVKRLGAFDAL"
FT   gene            complement(541892..542905)
FT                   /locus_tag="ARC77_02910"
FT   CDS_pept        complement(541892..542905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02910"
FT                   /product="polyamine ABC transporter ATP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02910"
FT                   /db_xref="GOA:C3TAQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAQ2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001524661.1"
FT                   /protein_id="AMW41262.1"
FT                   /translation="MTYAVEFDNVSRLYGDVRAVDGVSIAIKDGEFFSMLGPSGSGKTT
FT                   CLRLIAGFEQLSGGAISIFGKPASNLPPWERDVNTVFQDYALFPHMSILDNVAYGLMVK
FT                   GVNKKQRHAMAQEALEKVALGFVQQRKPSQLSGGQRQRVAIARALVNEPRVLLLDEPLG
FT                   ALDLKLREQMQLELKKLQQSLGITFICVTHDQGEALSMSDRVAVFNNGRIEQVDSPRDL
FT                   YMRPRTPFVAGFVGTSNVFDGLMAEKLCGMTGSFALRPEHIRLNTPGELQANGTIQAVQ
FT                   YQGAATRFELKLNGGEKLLVSQANMTGEELPATLTPGQQVMVSWSRDVMVPLVEER"
FT   gene            complement(542923..544068)
FT                   /locus_tag="ARC77_02915"
FT   CDS_pept        complement(542923..544068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02915"
FT                   /product="spermidine/putrescine ABC transporter
FT                   substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02915"
FT                   /db_xref="GOA:C3TAQ7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAQ7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005126748.1"
FT                   /protein_id="AMW41263.1"
FT                   /translation="MSKTFARSSLCALSMTIMTAHAAEPPTNLDKPEGRLDIIAWPGYI
FT                   ERGQTDKQYDWVTQFEKETGCAVNVKTAATSDEMVSLMTKGGYDLVTASGDASLRLIMG
FT                   KRVQPINTALIPNWKTLDPRVVKGDWFNVGGKVYGTPYQWGPNLLMYNTKTFPTPPDSW
FT                   QVVFVEQNLQDGKSNKGRVQAYDGPIYIADAALFVKATQPQLGISDPYQLTEEQYQAVL
FT                   KVLRDQHSLIHRYWHDTTVQMSDFKNEGVVASSAWPYQTNALKAEGQPVATVFPKEGVT
FT                   GWADTTMLHSEAKHPVCAYKWMNWSLTPKVQGDVAAWFGSLPVVPEGCKASSLLGEKGC
FT                   ETNGFNYFDKIAFWKTPIAEGGKFVPYSRWTQDYIAIMGGR"
FT   gene            complement(544313..545719)
FT                   /locus_tag="ARC77_02920"
FT   CDS_pept        complement(544313..545719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02920"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02920"
FT                   /db_xref="GOA:C3TAR2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAR2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000760654.1"
FT                   /protein_id="AMW41264.1"
FT                   /translation="MKKYQQLAEQLREQIASGIWQPGDRLPSLRDQVALSGMSFMTVSH
FT                   AYQLLESQGYIIARPQSGYYVAPQAIKMPKVPVIPVTRDEAVDINTYIFDMLQASRDPS
FT                   VVPFASAFPDPRLFPLQQLNRSLAQVSKTATAMSVIENLPPGNAELRQAIARRYALQGI
FT                   TISPDEIVITAGALEALNLSLQAVTEPGDWVIVENPCFYGALQALERLRLKALSVATDV
FT                   KEGIDLQALELALQEYPVKACWLMTNSQNPLGFTLTPQKKAQLVALLNQYNVTLIEDDV
FT                   YSELYFGREKPLPAKAWDRHDGVLHCSSFSKCLVPGFRIGWVAAGKHARKIQRLQLMST
FT                   LSTSSPMQLALVDYLSTRRYDAHLRRLRRQLAERKQRAWQALLRYLPAEVKIHHNDSGY
FT                   FLWLELPEPLDAGELSLAALTHHISIAPGKMFSTGENWSRFFRFNTAWLWGEREEQAVK
FT                   QLGKLIQERL"
FT   gene            complement(545798..546235)
FT                   /locus_tag="ARC77_02925"
FT   CDS_pept        complement(545798..546235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02925"
FT                   /product="antitoxin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02925"
FT                   /db_xref="GOA:C3TAR7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAR7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001209403.1"
FT                   /protein_id="AMW41265.1"
FT                   /translation="MRETVEIMRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEA
FT                   AKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKVLLLNAFLQSEITQQELA
FT                   RRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV"
FT   gene            complement(546260..546436)
FT                   /locus_tag="ARC77_02930"
FT   CDS_pept        complement(546260..546436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02930"
FT                   /product="mRNA interferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02930"
FT                   /db_xref="GOA:A0A023L2A4"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A023L2A4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000813793.1"
FT                   /protein_id="AMW41266.1"
FT                   /translation="MKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKE
FT                   PLRKAILKQLGLS"
FT   gene            546718..546888
FT                   /locus_tag="ARC77_02935"
FT   CDS_pept        546718..546888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02935"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02935"
FT                   /db_xref="InterPro:IPR020117"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024L334"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000907220.1"
FT                   /protein_id="AMW45916.1"
FT                   /translation="MAGHKGHEFVWVKNVDHQLRHEADSDELRAVAEESAEGLREHFYW
FT                   QKSRKPEAGQR"
FT   gene            complement(546980..548941)
FT                   /locus_tag="ARC77_02940"
FT   CDS_pept        complement(546980..548941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02940"
FT                   /product="protease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02940"
FT                   /db_xref="GOA:A0A037Y4M4"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A037Y4M4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001350637.1"
FT                   /protein_id="AMW41267.1"
FT                   /translation="MTVSSHRLELLSPARDAAIAREAILHGADAVYIGGPGFGARHNAS
FT                   NSLKDIAELVPFAHRYGAKIFVTLNTILHDDELEPAQRLITDLYQTGVDALIVQDMGIL
FT                   ELDIPPIELHASTQCDIRTVEKAKFLSDVGFTQIVLARELNLDQIRAIHQATDATIEFF
FT                   IHGALCVAYSGQCYISHAQTGRSANRGDCSQACRLPYTLKDDQGRVVSYEKHLLSMKDN
FT                   DQTANLGALIDAGVRSFKIEGRYKDMSYVKNITAHYRQMLDAIIEERGDLARASSGRTE
FT                   HFFVPSTEKTFHRGSTDYFVNARKGDIGAFDSPKFIGLPVGEVVKVAKDHLDVAVTEPL
FT                   ANGDGLNVLIKREVVGFRANTVEKTGENQYRVWPNEMPADLHKIRPHHPLNRNLDHNWQ
FT                   QALTKTSSERRVAVDIELGGWQEQLILTLTSEEGVSITHTLDGQFDEANNAEKAMNNLK
FT                   DGLAKLGQTLYYARDVQINLPGALFVPNSLLNQFRREAADMLDAARLASYQRGSRKPVA
FT                   DPAPVYPQTHLSFLANVYNQKAREFYHRYGVQLIDAAYEAHEEKGEVPVMITKHCLRFA
FT                   FNLCPKQAKGNIKSWKATPMQLVNGDEVLTLKFDCRPCEMHVIGKIKNHILKMPLPGSV
FT                   VASVSPDELLKTLPKRKG"
FT   gene            complement(549014..549550)
FT                   /locus_tag="ARC77_02945"
FT   CDS_pept        complement(549014..549550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02945"
FT                   /product="XRE family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02945"
FT                   /db_xref="GOA:C3TAU2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAU2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P77626.1"
FT                   /protein_id="AMW41268.1"
FT                   /translation="MENLARFLSTTLKQLRQQRGWSLSRLAEATGVSKAMLGQIERNES
FT                   SPTVATLWKIATGLNVPFSTFISPPQSATPSVYDPQQQAMVIISLFPYDPQLCFEHFSI
FT                   QMAPGAISESTPHEKGVIEHVVVIDGQLDLCVDGEWQTLNCGEGVRFAADVTHIYRNGG
FT                   EQTVHFHSLIHYPRS"
FT   gene            549642..550815
FT                   /pseudo
FT                   /locus_tag="ARC77_02950"
FT   CDS_pept        549642..550815
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02950"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001710283.1"
FT   gene            complement(550850..551518)
FT                   /locus_tag="ARC77_02955"
FT   CDS_pept        complement(550850..551518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02955"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02955"
FT                   /db_xref="InterPro:IPR021747"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAU7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016247171.1"
FT                   /protein_id="AMW41269.1"
FT                   /translation="MRTTSFAKVAALCGLLALSGCASKITQPDKYSGFLNNYSDLKETT
FT                   SATGKPVLRWVDPSFDQSKYDSIVWNPITYYPVPKPSTQVGQKVLDKILNYTNTEMKEA
FT                   IAQRKPLVTTAGPRSLIFRGAITGVDTSKEGLQFYEVVPVALVVAGTQMATGHRTMDTR
FT                   LYFEGELIDAATNKPVIKVVRQGEGKDLNNESTPMAFENIKQVIDDMATDATMFDVNKK
FT                   "
FT   gene            complement(551822..552415)
FT                   /locus_tag="ARC77_02960"
FT   CDS_pept        complement(551822..552415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02960"
FT                   /product="tellurite resistance methyltransferase TehB"
FT                   /note="with TehA confers resistance to tellurite; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02960"
FT                   /db_xref="GOA:C3TAV2"
FT                   /db_xref="InterPro:IPR004537"
FT                   /db_xref="InterPro:IPR015985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAV2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001494176.1"
FT                   /protein_id="AMW41270.1"
FT                   /translation="MIIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNS
FT                   LYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDGEYDFILSTVV
FT                   LMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGW
FT                   EMVKYNEDVGELHRTDANGNRIKLRFATMLARKK"
FT   gene            complement(552412..553404)
FT                   /locus_tag="ARC77_02965"
FT   CDS_pept        complement(552412..553404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02965"
FT                   /product="potassium-tellurite ethidium and proflavin
FT                   transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02965"
FT                   /db_xref="GOA:C3TAV7"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR011552"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="InterPro:IPR039264"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAV7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P25396.1"
FT                   /protein_id="AMW41271.1"
FT                   /translation="MQSDKVLNLPAGYFGIVLGTIGMGFAWRYASQVWQVSHWLGDGLV
FT                   ILAMIIWGLLTSAFITRLIRFPHSVLAEVRHPVLSSFVSLFPATTMLVAIGFVPWFRPL
FT                   AVCLFSFGVVVQLAYAAWQTAGLWRGSHPEEATTPGLYLPTVANNFISAMACGALGYTD
FT                   AGLVFLGAGVFSWLSLEPVILQRLRSSGELPTALRTSLGIQLAPALVACSAWLSVNGGE
FT                   GDTLAKMLFGYGLLQLLFMLRLMPWYLSQPFNASFWSFSFGVSALATTGLHLGSGSDNG
FT                   FFHTLAVPLFIFTNFIIAILLIRTLALLMQGKLLVRTERAVLMKAEDKE"
FT   gene            553528..554508
FT                   /locus_tag="ARC77_02970"
FT   CDS_pept        553528..554508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02970"
FT                   /product="acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02970"
FT                   /db_xref="GOA:C3TAW2"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR040831"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAW2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001625184.1"
FT                   /protein_id="AMW41272.1"
FT                   /translation="MRKYRLSEEQRAFSYQEDGTKKNVLLRQIIAISDFNDVIAGTAGG
FT                   WIDRETVLAQEGNCWIYDQNAIAFGGTVISGNTRITGTSVLWGEVYATDNVWIDNSEIN
FT                   QGAYISDSVTIHDSLVCGQCRIFGHALIDQHSMIVAAQGLTPDHQLLLQIYDRARVSAS
FT                   RIVHQAQIYGDAVIRYAFIEHRAEVFDFASIEGNEENNVWLCDCAKVYGHAQVKAGIEE
FT                   DAIPTIHYSSQVAEYAIVEGNCVLKHHVLIGGNAVVRGGPILLDEHVVIQGESRITGAV
FT                   IIENHVELTDHAVVEAFDGDTVHVRGPKVINGEERITRTPLAGLL"
FT   gene            complement(554503..555039)
FT                   /pseudo
FT                   /locus_tag="ARC77_02975"
FT   CDS_pept        complement(554503..555039)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02975"
FT                   /product="ribosomal-protein-serine acetyltransferase"
FT                   /note="internal stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001736281.1"
FT   gene            complement(555102..555326)
FT                   /locus_tag="ARC77_02980"
FT   CDS_pept        complement(555102..555326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02980"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02980"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWQ9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010351400.1"
FT                   /protein_id="AMW41273.1"
FT                   /translation="MFPEYRDLISRLKNENPRFMSLFDKHNKLDHEIARKEGSDDRGYN
FT                   AEVVRMKKQKLQLKDEMLKILQHESVKEV"
FT   gene            555342..555545
FT                   /locus_tag="ARC77_02985"
FT   CDS_pept        555342..555545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02985"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02985"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAX2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303281.1"
FT                   /protein_id="AMW41274.1"
FT                   /translation="MADKVYLKYTPSDYSFNLGKNASGIVFNQTAPPEEGAEEKTINSS
FT                   RGRQHTDVYPALAGNTDTAMFH"
FT   gene            complement(555466..557121)
FT                   /gene="mdoD"
FT                   /locus_tag="ARC77_02990"
FT   CDS_pept        complement(555466..557121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdoD"
FT                   /locus_tag="ARC77_02990"
FT                   /product="glucan biosynthesis protein D"
FT                   /note="involved in the control of the structural glucose
FT                   backbone of osmoregulated periplasmic glucans; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02990"
FT                   /db_xref="GOA:C3TAX7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR023724"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAX7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q8CW34.1"
FT                   /protein_id="AMW41275.1"
FT                   /translation="MDRRRFIKGSMAMAAVCGTSGIASLFSQAAFAADSDIADGQTQRF
FT                   DFSILQSMAHDLAQTAWRGAPRPLPDTLATMTPQAYNSIQYDAEKSLWHNVENRQLDAQ
FT                   FFHMGMGFRRRVRMFSVDPATHLAREIHFRPELFKYNDAGVDTKQLEGQSDLGFAGFRV
FT                   FKAPELARRDVVSFLGASYFRAVDDTYQYGLSARGLAIDTYTDSKEEFPDFTAFWFDTV
FT                   KPGATTFTVYALLDSASITGAYKFTIHCEKSQVIMDVENHLYARKDIKQLGIAPMTSMF
FT                   SCGTNERRMCDTIHPQIHDSDRLSMWRGNGEWICRPLNNPQKLQFNAYTDNNPKGFGLL
FT                   QLDRDFSHYQDIMGWYNKRPSLWVEPRNKWGKGTIGLMEIPTTGETLDNIVCFWQPEKA
FT                   VKAGDEFAFQYRLYWSAQPPVHCPLARVMATRTGMGGFPEGWAPGEHYPEKWARRFAVD
FT                   FVGGDLKAAAPKGIEPVITLSSGEAKQIEILYIEPIDGYRIQFDWYPTSDSTDPVDMRM
FT                   YLRCQGDAISETWLYQYFPPAPDKRQYVDDRVMS"
FT   gene            complement(557346..558689)
FT                   /locus_tag="ARC77_02995"
FT   CDS_pept        complement(557346..558689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_02995"
FT                   /product="DUF1338 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_02995"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3RZD5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005126726.1"
FT                   /protein_id="AMW41276.1"
FT                   /translation="MANSITADEIREQFSQAMSAMYQQEVPQYGTLLELVADVNLAVLE
FT                   NNPQLHEKMVNADELARLNVERHGAIRVGTAQELATLRRMFAIMGMYPVSYYDLSQAGV
FT                   PVHSTAFRPIDDASLARNPFRVFTSLLRLELIENEILRQKAAEILRQRDIFTPRCRQLL
FT                   EEYDQRGGFNETQAQEFVQEALETFRWHQSATVDEETYRALHNEHRLIADVVCFPGCHI
FT                   NHLTPRTLDIDRVQSMMPECGIEPKILIEGPPRREVPILLRQTSFKALEETVLFAGQKQ
FT                   GTHTARFGEIEQRGVALTPKGRQLYDDLLRNAGTGQDNLTHQMHLQETFRTFPDSEFLM
FT                   RQQGLAWFRYRLTPSGEAHRQAIHPGDDPQPLIERGWVAAQPITYEDFLPVSAAGIFQS
FT                   NLGNETQARSHGNASREAFEQALGCPVLDEFQLYQEAEERSKRRCGLL"
FT   gene            558906..559829
FT                   /locus_tag="ARC77_03000"
FT   CDS_pept        558906..559829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03000"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03000"
FT                   /db_xref="GOA:A0A085NXP3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085NXP3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001356191.1"
FT                   /protein_id="AMW41277.1"
FT                   /translation="MEKNSLFSQRIRLRHLHTFVAVAQQGTLGRAAETLNLSQPALSKT
FT                   LNELEQLTGARLFERGRQGAQLTLPGEQFLTHAVRVLDAINTAGQSLHRKEGPNNDVVR
FT                   VGALPTAALGILPSVIGQFHQQQKETTLQVATMSNPMILAGLKTGEIDIGIGRMSDPEL
FT                   MTGLNYELLFLESLKLVVRPNHPLLQENVTLSRVLEWPVVVSPEGTAPRQHSDALVQSQ
FT                   GCKIPSGCIETLSASLSRQLTVEYDYVWFVPSGAVKDDLRHATLVALPVPGHGAGEPIG
FT                   ILTRVDATFSSGCQLMINAIRKSMPF"
FT   gene            complement(559867..561507)
FT                   /locus_tag="ARC77_03005"
FT   CDS_pept        complement(559867..561507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03005"
FT                   /product="chemotaxis protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03005"
FT                   /db_xref="GOA:C3TAY8"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR004091"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAY8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001599833.1"
FT                   /protein_id="AMW41278.1"
FT                   /translation="MNTTPSQRLGFLHHIRLVPLFACILGGILVLFALSSALAGYFLWQ
FT                   ADRDQRDVTAEIEIRTGLANSSDFLRSARINMIQAGAASRIAEMEAMKRNIAQAESEIK
FT                   QSQQGYRAYQNRPVKTPADEALDTELNQRFQAYITGMQPMLKYAKNGMFEAIINHESEQ
FT                   IRTLDNAYTDILNKAVKIRSTRANQLAELAHQRTRLGGMFMIGAFVLALVMTLITFMVL
FT                   RRIVIRPLQHAAQRIEKIASGDLTMKDEPAGRNEIGRLSRHLQQMQHSLGMTVGTVRQG
FT                   AEEIYRGTSEISAGNADLSSRTEEQAAAIEQTAASMEQLTATVKQNADNAHYASKLAQE
FT                   ASIKASDGGQTVSGVVKTMGAISTSSKKISEITAVINSIAFQTNILALNAAVEAARAGE
FT                   QGRGFAVVASEVRTLASRSAQAAKEIEGLISESVRLIDLGSDEVATAGKTMSTIVDAVA
FT                   SVTHIMQEIAAASDEQSRGITQVSQAISEMDKVTQQNASLVEEASAAAVSLEEQAARLT
FT                   EAVDVFRLNKQSVLAEPRGAGEPVSFAPV"
FT   gene            561906..562055
FT                   /locus_tag="ARC77_03010"
FT   CDS_pept        561906..562055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03010"
FT                   /product="small toxic polypeptide"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03010"
FT                   /db_xref="GOA:A0A143DUC3"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DUC3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P77494.2"
FT                   /protein_id="AMW41279.1"
FT                   /translation="MKRNPLVVCLLIICITILTFTLLTRQTLYELRFRDSDKEVAALMA
FT                   CTSR"
FT   gene            complement(562127..562300)
FT                   /locus_tag="ARC77_03015"
FT   CDS_pept        complement(562127..562300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03015"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03015"
FT                   /db_xref="UniProtKB/TrEMBL:C3TAZ8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000736410.1"
FT                   /protein_id="AMW41280.1"
FT                   /translation="MKKLALILFMGALVSFYADAGRKPCSGSKGGISHCTAGGKFVCND
FT                   GSISASKKTCTN"
FT   gene            complement(562545..563075)
FT                   /locus_tag="ARC77_03020"
FT   CDS_pept        complement(562545..563075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03020"
FT                   /product="cytochrome B"
FT                   /note="B-type di-heme cytochrome with a major
FT                   alpha-absorption peak at 561 nm and a minor peak at 555 nm;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03020"
FT                   /db_xref="GOA:W8SZ83"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:W8SZ83"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014639181.1"
FT                   /protein_id="AMW45917.1"
FT                   /translation="MENKYSRLQISIHWLVFLLVIAAYCAMEFRGFFPRSDRPLINMIH
FT                   VSCGISILVLMVVRLLLRLKYPTPPIIPKPKPMMTGLAHLGHLVIYLLFIALPVIGLVM
FT                   MYNRGNPWFAFGLTMPYASEANFERVDSLKSWHETLANLGYFVIGLHAAAALAHHYFWK
FT                   DNTLLRMMPRKRS"
FT   gene            563264..564265
FT                   /locus_tag="ARC77_03025"
FT   CDS_pept        563264..564265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03025"
FT                   /product="type I glyceraldehyde-3-phosphate dehydrogenase"
FT                   /note="NAD-dependent; catalyzes the formation of
FT                   3-phospho-D-glyceroyl phosphate from D-glyceraldehyde
FT                   3-phosphate; active during glycolysis; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03025"
FT                   /db_xref="GOA:C3TB07"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB07"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003833184.1"
FT                   /protein_id="AMW41281.1"
FT                   /translation="MSKVGINGFGRIGRLVLRRLLEVKSNIDVVAINDLTSPKILAYLL
FT                   KHDSNYGPFPWSVDFTEDSLIVDGKSIAVYAEKEAKNIPWKAKGAEIIVECTGFYTSAE
FT                   KSQAHLDAGAKKVLISAPAGEMKTIVYKVNDDTLDGNDTIVSVASCTTNCLAPMAKALH
FT                   DSFGIEVGTMTTIHAYTGTQSLVDGPRGKDLRASRAAAENIIPHTTGAAKAIGLVIPEL
FT                   SGKLKGHAQRVPVKTGSVTELVSILGKKVTAEEVNNALKQATTNNESFGYTDEEIVSSD
FT                   IIGSHFGSVFDATQTEITAVGDLQLVKTVAWYDNEYGFVTQLIRTLEKFAKL"
FT   gene            complement(564307..565746)
FT                   /locus_tag="ARC77_03030"
FT   CDS_pept        complement(564307..565746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03030"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="NAD-linked; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03030"
FT                   /db_xref="GOA:C3TB12"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB12"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005126705.1"
FT                   /protein_id="AMW41282.1"
FT                   /translation="MSVPVQHPMYIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAED
FT                   ARKAIDAAERAQPEWEALPAIERASWLRKISAGIRERASEISALIVEEGGKIQQLAEVE
FT                   VAFTADYIDYMAEWARRYEGEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKM
FT                   APALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKV
FT                   AMVSMTGSVSAGEKIMATAAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINS
FT                   GQVCNCAERVYVQKGIYDQFVNRLGEAMQAVQFGNPAERNDIAMGPLINAAALERVEQK
FT                   VARAVEEGARVALGGKAVEGKGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLED
FT                   AISMANDSDYGLTSSIYTQNLNVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIG
FT                   GADGKHGLHEYLQTQVVYLQS"
FT   gene            complement(565943..566743)
FT                   /locus_tag="ARC77_03035"
FT   CDS_pept        complement(565943..566743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03035"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03035"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB17"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001027919.1"
FT                   /protein_id="AMW41283.1"
FT                   /translation="MNITPFPTLSTATIDAINVIGQWLAQDDFSGEVPYQADCVILAGN
FT                   AVMPTIDAACKIARDQQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRTTGRAEATILAD
FT                   IAHQFWHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQRRTMATF
FT                   RRMTGDNPDVPRWLSYPGFVPQLGNNADSVIFINQLQGLWPVERYLSLLTGELPRLRDD
FT                   SDGYGPRGRDFIVHVDFPAEVIHAWQTLKHDAVLIEAMESRSLR"
FT   gene            complement(566859..567236)
FT                   /locus_tag="ARC77_03040"
FT   CDS_pept        complement(566859..567236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03040"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03040"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V4P7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000344419.1"
FT                   /protein_id="AMW41284.1"
FT                   /translation="MDERFINITPTSLSFKHADLSGLSYKNARLELALICPAIKSEVKI
FT                   SFDWIHSFRVTDEGDLLGMSGKQGINQTGIYRVANSTYLTWFTMQSCEIHKNKMIEHYV
FT                   IATSNDVIDVLSTVSPQIVYD"
FT   gene            complement(567361..567792)
FT                   /locus_tag="ARC77_03045"
FT   CDS_pept        complement(567361..567792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03045"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K4AR83"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001102905.1"
FT                   /protein_id="AMW41285.1"
FT                   /translation="MNVRNVKFDNLSFYEEKIRWRMRRQISNAEAIFYENQEEHIRRFL
FT                   GRYTCRKPVLVYWESEQRWTSVNGLEVMSMFGEHCHHIYLDDIKKKIQTELPENKTLDF
FT                   KRQLQFIILGDDKIRIWVPEGKLYFALMNVLQMFPMKNG"
FT   gene            complement(567779..568117)
FT                   /locus_tag="ARC77_03050"
FT   CDS_pept        complement(567779..568117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03050"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03050"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6XVQ4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000799861.1"
FT                   /protein_id="AMW41286.1"
FT                   /translation="MKNVENIIWHDGVLVETRMECHHTEYNFILTAELYVDEFTAGRER
FT                   KRFEFTGVEHLSQVMDIAELIDNQNAGNIKDATIVYKAKKYKISLHLFGGFLSFTFKTM
FT                   RVIDNECA"
FT   gene            complement(568122..568547)
FT                   /locus_tag="ARC77_03055"
FT   CDS_pept        complement(568122..568547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03055"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3S0G5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000086434.1"
FT                   /protein_id="AMW41287.1"
FT                   /translation="MSRHDILLRSQFERIIEGDRVGQALISFYEKLPEENYRRALYILS
FT                   IIYPIKLNVGDDEFKFIFYIMSQKKFLRQQTISDFVRSINVIEFTETQKSVLRELIKKN
FT                   NDIIITQCTFELDCLLTRVSASSNQFRNSNGYLPENS"
FT   gene            complement(568693..572595)
FT                   /pseudo
FT                   /locus_tag="ARC77_03060"
FT   CDS_pept        complement(568693..572595)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03060"
FT                   /product="ATP-dependent RNA helicase HrpA"
FT                   /note="involved in the post-transcriptional processing of
FT                   the daa operon mRNA, which encodes proteins involved in
FT                   fimbrial biogenesis of an enteropathogenic E. coli strain;
FT                   internal stop; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000139501.1"
FT   gene            572796..573401
FT                   /locus_tag="ARC77_03065"
FT   CDS_pept        572796..573401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03065"
FT                   /product="FMN-dependent NADH-azoreductase"
FT                   /note="FMN-dependent; requires NADH; catalyzes the cleavage
FT                   of azo bond in aromatic azo compounds; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03065"
FT                   /db_xref="GOA:C3TB27"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB27"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_004861333.1"
FT                   /protein_id="AMW41288.1"
FT                   /translation="MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAA
FT                   NPIPVLDGELVGALRPSDAPLTTRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQ
FT                   LKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGF
FT                   IGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVAA"
FT   gene            complement(573452..574768)
FT                   /locus_tag="ARC77_03070"
FT   CDS_pept        complement(573452..574768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03070"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03070"
FT                   /db_xref="GOA:A0A152V4S0"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V4S0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000627360.1"
FT                   /protein_id="AMW41289.1"
FT                   /translation="MITERRNVLLQGAGWLLLLAPFFFFTYGSLNQFTAVQDFNSHDIP
FT                   SQVFGWETAIPFLPWTIVPYWSLDLLYGFSLFVCSSTFEQRRLVHRLILATVMACCGFF
FT                   LYPLKFSFIRPEVSGVTGWLFSQLELFDLPYNQSPSLHIVLCWLLWRHFRQHLAVRWRK
FT                   VCGGWFLLIAISMLTTWQHHFIDVITGLAVGMLIDWMIPVDRRWNYQKPDQRRIKIALP
FT                   YVVGACACIVLMELMMMVQLWWSVWLCWPVLSLLIIGRGYGGLGAITTGKDSQGKLPPA
FT                   VYWLTLPWRIGMWLSMRWFCRRLEPVSKMTAGVYLGAFPRHIPAQNAVLDVTFEFPRGR
FT                   ATKDRLYFCVPMLDLVVPEEGELRQAVAMLETLREEQGSVLVHCALGLSRSALVVAAWL
FT                   LCYGHCKTVDEAISFIRARRSHIVLKEEHKAMLKLWENR"
FT   gene            complement(574758..576515)
FT                   /locus_tag="ARC77_03075"
FT   CDS_pept        complement(574758..576515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03075"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03075"
FT                   /db_xref="GOA:C3TB38"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR022744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB38"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000431886.1"
FT                   /protein_id="AMW41290.1"
FT                   /translation="MENSRIPGEHFFTTSDNTALFYRHWPALQPGAKKVIVLFHRGHEH
FT                   SGRLQHIVDELAMPDTAFYAWDARGHGQTSGPRGYSPSLARSVRDVDEFVRFAASDSQV
FT                   GLEEVVVIAQSVGAVLVATWVHDYAPAIRGLVLASPAFKVKLYVPLARPALALWHRLRG
FT                   LFFINSYVKGRYLTHDRQRVASFNNDPLITRAIAVNILLDLYKTSERIVSDAAAITLPT
FT                   QLLISGDDYVVHRQPQIDFYHRLRSPLKELHLLPGFYHDTLGEENRAQAFEKMQSFISR
FT                   LYANKSQKFDYQHEDRTGPSADRWRLLSGGPVPLSPVDLAYRFMRKAMKLFGTHSAGLH
FT                   LGMSTGFDSGSSLDYVYQNQPQGSNAFGRLIDKIYLNSVGWRGIRQRKTHLQILIKQAV
FT                   ADLHAKGLAVRVVDIAAGHGRYVLDALANEPAVSDILLRDYSELNVAQGQEMIAQRGMS
FT                   GRVRFEQGDAFNPEELSALTPRPTLAIVSGLYELFPGNEQVKNSLAGLANAIEPGGILL
FT                   YTGQPWHPQLELIAGVLTSHKDGKPWVMRVRSQGEMDSLVRDAGFDKCTQRIDEWGIFT
FT                   VSMAVRRDN"
FT   gene            complement(576531..577427)
FT                   /locus_tag="ARC77_03080"
FT   CDS_pept        complement(576531..577427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03080"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03080"
FT                   /db_xref="GOA:C3TB42"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB42"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001405175.1"
FT                   /protein_id="AMW41291.1"
FT                   /translation="MLEKSLATLFALLILATLINRFRVWRLPERKGDEVTLRIRTWWGI
FT                   VICFSLVISGPRWMTLTFFALISFLALKEYCTLISVHFPRWLYWVIPLNYLLIGFSCFE
FT                   LFLLFIPLAGFLILTTWRVLVGDTSGFLHTVSAIFWGWIMTVFALSHAAWLLMLTTTNT
FT                   QGGALLVLFLLALTESNDIAQYLWGKSCGRRKVVPKVSPGKTLEGLVGGVITTMIASLI
FT                   IGPLLTPLNTLQALLAGLLIGISGFCGDVVMSAVKRDVGVKDSGKLLPGHGGLLDRIDS
FT                   LIFTAPVFFYFIRYCCY"
FT   gene            complement(577427..578032)
FT                   /locus_tag="ARC77_03085"
FT   CDS_pept        complement(577427..578032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03085"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03085"
FT                   /db_xref="GOA:A0A152V4S4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V4S4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000177529.1"
FT                   /protein_id="AMW41292.1"
FT                   /translation="MTLYQIKPLFQSLLRPTMFWLYKHHVTANHITLAALALSLITGLL
FT                   LMLVAQPILFLLLPIVLFIRMALNALDGMLARECNQQTRLGAILNETGDVISDIALYLP
FT                   FLFLPESNASLVILMLFCTILTEFCGLLAQTINGIRSYVGPFGKSDRALIFGLWGLAVA
FT                   IYPQWMQWNNLLWSIASILLLWTAINRCRSVLLMSAER"
FT   gene            complement(578203..580509)
FT                   /locus_tag="ARC77_03090"
FT   CDS_pept        complement(578203..580509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03090"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03090"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DWT1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001732909.1"
FT                   /protein_id="AMW41293.1"
FT                   /translation="MFKPRLCSWIGLLPLFMLSLPVQAELRCVANAVDIETFFSAATAE
FT                   DKQQVEQAINSSVNLVPFGLSASDWKVHRGDLVVEGNIESNQKLIVLGNLTVKGNISTF
FT                   SLSNPWVILGNVTATNIVTDSPLLITGSINASGLVFIDSYYDNPSTIKGSINARGIFIN
FT                   DIIAPVVASSTNSEFMVRASDKNDTENVKKALMIINPDAYYWGLINDEDALKEIFKRSN
FT                   IRMAGNVCNQMKKEALFRFKPSPELVQELQMLDEGNVAAFEGRDIATFDLAIMRTLPRL
FT                   KGISANLRKQLINSNDGQTIESMARYMPDNEILELTDQQLGYQPVVLGLLDREPLSVEI
FT                   MTRMSHLPDGVGPLNLALRENLPLDIVMTLAKRDWDMIIQELYKDAWLLPESIIDGYIR
FT                   SDDSSIRQVGAGGQLTYNQAMQLANDSSNDVVTSLALKLAEMKHHGQLLRMTPQESDKI
FT                   AVYLYQKFENDDDLIGALFLALPDNLQFNFVKRMEKKSPAYFCCRDMQIIHSDAALQRL
FT                   LTRFNDPEGWSNLAKNQYLSTSMKQKIWQRALSHRKNNPKADSDAYETSADMILSELIS
FT                   YGEVDDQMLLNATSLIRSDDWDFLESALISWDNLPAVVLKELQQNTPRNDIWAKFFLRQ
FT                   ENSSRAQVNEALRVYYALDPDALAQLDVLAKQPDRIWWSTLAKSNLTFFKFGALNNRHT
FT                   PPAVLAAEIDPEWWIVAMNNPRFPVDVLKARLKRDPLLALKLVNPELDLVRQLALNGKT
FT                   RAIREQAMRKLDELY"
FT   gene            complement(580573..581433)
FT                   /locus_tag="ARC77_03095"
FT   CDS_pept        complement(580573..581433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03095"
FT                   /product="oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03095"
FT                   /db_xref="GOA:C3TB57"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB57"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000097802.1"
FT                   /protein_id="AMW41294.1"
FT                   /translation="MSSNTFTLGTKSVNRLGYGAMQLAGPGVFGPPRDRHVAITVLREA
FT                   LALGVNHIDTSDFYGPHVTNQIIREALYPYSDDLTIVTKIGARRGEDASWLPAFSPAEL
FT                   QKAVHDNLRNLGLDVLDVVNLRVMMGDGHGPAEGSIEASLTVLAEMQQQGLVKHIGLSN
FT                   VTPTQVAEARKIAEIVCVQNEYNIAHRADDAMIEALARDGIAYVPFFPLGGFTPLQSST
FT                   LSDVAASLGATPMQVALAWLLQRSPNILLIPGTSSVAHLRENMAAEKLHLSEKVLSTLD
FT                   GISRE"
FT   gene            complement(581653..584112)
FT                   /locus_tag="ARC77_03100"
FT   CDS_pept        complement(581653..584112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03100"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03100"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V4T3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001001996.1"
FT                   /protein_id="AMW41295.1"
FT                   /translation="MNEGGALTNEGVLNTVTLEGGTFNNNGTLNDVVKIEKNSNAVINN
FT                   TGSLSTLQLHDGTVNNSGIASARVNAQGDAVFNNLAGGEARKGAILYNSAVVNNAGTWK
FT                   MGYQDENNNAGTLDIDDKSTFNNSGKLILDNSKNAIRFQGSNANATLYNTGEMTLDAAL
FT                   GAGAIHYDDGASEFINKGVVDAKVTVAVSTAGATESDAFLWNQDGGVINFDKDNASAVK
FT                   FTHNNYVALNDGVMNISGNNAVAMEGDKNAQLVNNGVINLGTEGTTDTGLTGMQLDANA
FT                   TADAVIENNGTINIFANDSFAFSVLGTEGHIVNNGTVVIADGVTGSGLIKQGDSVNVEG
FT                   VNGNSGNNTEVHYTDYTLPDMPNTYTTSPFSETTDSGSSDGSSNNLNGYIVGTNVDGSA
FT                   GKLKVNNASMNGVGINTGFAAGTADTTVSFDNVVEGINLTDADAITSTSVVWTAKGSTD
FT                   ASGNVDVIMSKNAYTDVATDASVNDVAKALDAGYTNNELYTSLNVGTTAELNSALKQVS
FT                   GSQATTVFREARVLSNRFSMLADAAPKVGNGLAFNVVAKGDPRAELGNNTEYDMLALRK
FT                   TVDLSESQSMSLEYGIARLDGDGAQKAGDNGVTGGYSQFFGLKHQMSFDNGMRWNNALR
FT                   YDVHNLDSSRSVAYGDVSKTADTDVKQQYLELRSEGAKTFEPREGLKITPYAGVKLRHS
FT                   LEGGYQERNAGDFNLSMNSGSETAVDSIVGLKLDYAGKGGWSANATLEGGPNLSYSKSQ
FT                   RTASLAGAGSQHFNVDDGQKGGGINSLASVGVKYSSKESSLNLDAYHWKEDGISDKGVM
FT                   LNFKKTF"
FT   gene            complement(584332..587220)
FT                   /locus_tag="ARC77_03105"
FT   CDS_pept        complement(584332..587220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03105"
FT                   /product="surface-exposed virulence protein BigA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03105"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143DUQ5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001303278.1"
FT                   /protein_id="AMW41296.1"
FT                   /translation="MQRKKLLSVCVAMALSSQTWAADTSIPDSTEKTRKSSKITCPANI
FT                   HSLSKEQLENLSAECRENKDSAVLPWAAAGLAAVATGIAIYTLSDDDNHHHNNSPVPDD
FT                   GGDTPVPPDDGGDTPVKHNPVVYKNGVTWDQDAKTVKIRETTFTYSQNADGSYTLTAPE
FT                   GKETIVKSWTVHDDSNTVVFDGVNTSGGITWSYDDDGLIHITKEAGVVVDGTTGNAIEF
FT                   GNAIITDQGGNTALNGGTVMTVDGDNISLNNDGKTTAIGEGSVVGILTGDNITINNNGE
FT                   TEVDGGTAVIINGDNTKLNTAGDSTITNGGTGSLINGDNARVDNQGTMSVDGENSTGSK
FT                   IVGDGATIKQEGDLYVSGGAHGIDVDGNDTFVSNKGNITVIEDNSIGMLLDGDGVSVIN
FT                   MGDLNVGQAAAGENAIGIQIDGDNATFVNVGDISATNAGTGVSVAGDKANISLAGGLDV
FT                   GDFSTGLDVSGNNNNMTLATYELNVTGQKATGVNVSGDGNTIEIAGSILVDKDQKADNA
FT                   QPYFFNPSTGVNISGDNNDVTLDGQLTVVADSKTTSRSYASYDGAQEHIAGIVIAGDDN
FT                   TFTLNGGVHFVGEKNVMDDGSKPSASRRGIGDTPLINVDGHSPVYLNGESTISGEFPLG
FT                   FENLIQLSHGAELEIGADATFDMSDVDSFTYYYRVALSTISIDSGAKATNNGEVELKNI
FT                   GFAAAWNKDSTVINNGSIGLAMYDFGTDPAPKVFDVEYGGIGVNNGTMTTKMMNQHSVL
FT                   NYPAEWNLSDGTSFNNKALGLTGMLASYSSSILNGETGIIDMYGRGSVGMLAIDKSTAD
FT                   NEGQITLDTLWVDENDETSLRNNVANSTAKDFGVGMASGTDAYNGALTKATATNHENGV
FT                   ITVYNAGAGMAAYGNTNTVINQGTINLEKNENYNDSLGVNKLVGMAVYHEGTAINDQTG
FT                   VININAENGQAFYNDGTGLIINYGTICTFGVC"
FT   gene            complement(587635..587958)
FT                   /locus_tag="ARC77_03110"
FT   CDS_pept        complement(587635..587958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03110"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03110"
FT                   /db_xref="InterPro:IPR008309"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V4R6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001296730.1"
FT                   /protein_id="AMW41297.1"
FT                   /translation="MKRTLLIAVWAIGLMSDSAMALTLNEARSQGRVGETLNGYLVALQ
FT                   TDAETQALVKDINEARNHSYQQLAKQNNVSTKEIAKLAGQKLVARAKSGQYVQGVNGKW
FT                   LRK"
FT   gene            complement(587966..588151)
FT                   /locus_tag="ARC77_03115"
FT   CDS_pept        complement(587966..588151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03115"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03115"
FT                   /db_xref="InterPro:IPR025985"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB62"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008784882.1"
FT                   /protein_id="AMW41298.1"
FT                   /translation="MKIVIAAFASSFMLVGCTPRIEVAAPKEPITINMNVKIEHEIIIK
FT                   ADKDVEDLLKTRSDLF"
FT   gene            complement(588148..590787)
FT                   /locus_tag="ARC77_03120"
FT   CDS_pept        complement(588148..590787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03120"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03120"
FT                   /db_xref="InterPro:IPR021730"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB67"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003843765.1"
FT                   /protein_id="AMW41299.1"
FT                   /translation="MLGKYKAVLALLLLIILVPLTLLMTLGLWVPTLAGIWLPLGTRIA
FT                   LDESPRITRKGLIIPDLRYLVGDCQLAHITNASLSHPSRWLLNVGTVELDSACLAKLPQ
FT                   TEQSPAAPKTLAQWQSMLPNTWINIDKLIFSPWQEWQGKLSLALTSDIQQLRYQGEKVK
FT                   FQGQLKGQQLTVSELDVVAFENQPSVKLVGEFTMPLMPDGLPVSGHATATLNLPQEPSL
FT                   VDAELDWQENSGQLIVLARDNGDPLLDLPWQITRQQLTVSDGRWSWPYAGFPLSGRLGV
FT                   KVDNWQAGLENALVSGRLSVLTQGQAGKGNAVLNFGPGKLSMDNSQLPLQLTGEAKQAD
FT                   LILYARLPAQLSGSLSDPTLTFEPGALLRSKGRVIDSLDIDEIRWPLAGVKVTQRGVDG
FT                   RLQAILQAHENELGDFVLHMDGLANDFLPDAGRWQWRYWGKGSFTPMNATWDVAGKGEW
FT                   HDSTITLTDLSTGFDQLQYGTMTVEKPRLILDKPVVWVRDAQHPSFSGALSLDAGQTLF
FT                   TGGSVLPPSTLKFSVDGRDPTYFLFKGDLHAGEIGPVRVNGRWDGIRLRGNAWWPKQSL
FT                   TVFQPLVPPDWKMNLRDGELYAQVAFSAAPEQGFRAGGHGVLKGGSAWMPDNQVNGVDF
FT                   VLPFRFADGAWHLGTRGPVTLRIAEVINLVTAKNITADLQGRYPWTEEEPLLLTDVSVD
FT                   VLGGNVLMKQLRMPQHDPALLRLNNLSSSELVSAVNPKQFAMSGAFSGALPLWLNNEKW
FT                   IVKDGWLANAGPMTLRLDKDTADAVAKDNMTAGTAINWLRYMEISRSSTRINLDNLGVL
FT                   TMQANISGTSRVDGKSGTVNLNYHHEENIFTLWRSLRFGDNLQVWLEQNAQLPETGCPS
FT                   GKECEEKQ"
FT   gene            590995..591984
FT                   /locus_tag="ARC77_03125"
FT   CDS_pept        590995..591984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03125"
FT                   /product="lactate dehydrogenase"
FT                   /note="fermentative; catalyzes the formationof pyruvate
FT                   from lactate; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03125"
FT                   /db_xref="GOA:C3TB72"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB72"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007723671.1"
FT                   /protein_id="AMW41300.1"
FT                   /translation="MKLAVYSTKQYDKKYLQQVNESFGFELEFFDFLLTEKTAKTANGC
FT                   EAVCIFVNDDGSRPVLEELKKHGVKYIALRCAGFNNVDLDAAKELGLKVVRVPAYDPEA
FT                   VAEHAIGMMMTLNRRIHRAYQRTRDANFSLEGLTGFTMYGKTAGVIGTGKIGVAMLRIL
FT                   KGFGMRLLAFDPYPSAAALELGVEYVDLPTLFSESDVISLHCPLTPENYHLLNEAAFDQ
FT                   MKNGVMIVNTSRGALIDSQAAIEALKNQKIGSLGMDVYENERDLFFEDKSNDVIQDDVF
FT                   RRLSACHNVLFTGHQAFLTAEALTSISQTTLQNLSNLEKGETCPNELV"
FT   gene            592095..592517
FT                   /locus_tag="ARC77_03130"
FT   CDS_pept        592095..592517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03130"
FT                   /product="heat-inducible protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03130"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB77"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001622082.1"
FT                   /protein_id="AMW41301.1"
FT                   /translation="MKKVAAFVALSLLMAGCVSNDKIAVTPEQLQHHRFVLESVNGKPV
FT                   TCDKNPPEISFGEKMMISGSMCNRFSGEGKLSNGELTAKGLAMTRMMCANPQLNELDNT
FT                   ISEMLKEGAQVDLTANQLTLATAKQTLTYKLADLMN"
FT   gene            complement(592514..592780)
FT                   /locus_tag="ARC77_03135"
FT   CDS_pept        complement(592514..592780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03135"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03135"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:E2QLV8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015964583.1"
FT                   /protein_id="AMW41302.1"
FT                   /translation="MRAAFWVGCAALLLSACSSEPVQQATAAHVAPGLKASMSSSGEAN
FT                   CAMIGGSLSVARQLDGTAIGMCALPNGKRCSEQSLAAGSCGSY"
FT   gene            593054..596578
FT                   /locus_tag="ARC77_03140"
FT   CDS_pept        593054..596578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03140"
FT                   /product="pyruvate:ferredoxin (flavodoxin) oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03140"
FT                   /db_xref="GOA:C3TB82"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:C3TB82"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006819788.1"
FT                   /protein_id="AMW41303.1"
FT                   /translation="MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLK
FT                   NVWGDTPRVVEMQSEAGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFV
FT                   LHVAARTVATHALSIFGDHSDVMAVRQTGCAMLCAANVQEAQDFALISHIATLKSRVPF
FT                   IHFFDGFRTSHEINKIVPLADDTILDLMPQAEIDAHRARALNPEHPVIRGTSANPDTYF
FT                   QSREATNPWYNAVYDHVEQAMNDFSAATGRQYQPFEYYGHPQAERVIILMGSAIGTCEE
FT                   VVDELLTRGEKVGVLKVRLYRPFSAKHLLQALPGSVRSVAVLDRTKEPGAQAEPLYLDV
FT                   MTALAEAFNNGERETLPRVIGGRYGLSSKEFGPDCVLAVFAELNAAKPKARFTVGIYDD
FT                   VTNLSLPLPENTLPNSAKLEALFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSK
FT                   KAGGLTVSHLRVSEQPIRSAYLISQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYS
FT                   ADEVWSRLPQEVQAVLNQKKARFYVINAAKIARECGLAARINTVMQMAFFHLTQILPGD
FT                   SALAELQGAIAKSYSSKGQDLVERNWQALALARESVEEVPLQPVNPHSANRPPVVSDAA
FT                   PAFVKTVTAAMLAGLGDALPVSALPPDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNH
FT                   CVAACPHSAIRAKVVPPEAMENAPASLHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVE
FT                   VCPAKDRQNPEIKAINMMSRLEHVEEEKINYDFFLNLPEIDRSKLERIDIRTSQLITPL
FT                   FEYSGACSGCGETPYIKLLTQLYGDRMLIANATGCSSIYGGNLPSTPYTTDANGRGPAW
FT                   ANSLFEDNAEFGLGFRLTVDQHRVRVLRLLDQFADKIPAELLTALKSDATPEVRREQVA
FT                   ALRQQLNDVAEAHELLRDADALVEKSIWLIGGDGWAYDIGFGGLDHVLSLTENVNILVL
FT                   DTQCYSNTGGQASKATPLGAVTKFGEHGKRKARKDLGVSMMMYGHVYVAQISLGAQLNQ
FT                   TVKAIQEAEAYPGPSLIIAYSPCEEHGYDLALSHDQMRQLTATGFWPLYRFDPRRADEG
FT                   KLPLALDSRPPSEALEETLLHEQRFRRLNSQQPEVAEQLWKDAAADLQKRYDFLAQMAG
FT                   KAEKSNTD"
FT   gene            596944..598057
FT                   /pseudo
FT                   /locus_tag="ARC77_03145"
FT   CDS_pept        596944..598057
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03145"
FT                   /product="porin"
FT                   /note="allows for ions and hydrophilic solutes to cross the
FT                   outer membrane; frameshifted; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P77747.1"
FT   gene            598198..598632
FT                   /locus_tag="ARC77_03150"
FT   CDS_pept        598198..598632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03150"
FT                   /product="universal stress protein F"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03150"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E2QLV5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001082294.1"
FT                   /protein_id="AMW41304.1"
FT                   /translation="MNRTILVPIDISDSELTQRVISHVEAEAKIDDAEVHFLTVIPSLP
FT                   YYASLGLAYSAELPAMDDLKAEAKSQLEEIIKKFKLPTDRVHVHVEEGSPKDRILELAK
FT                   KIPAHMIIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR"
FT   gene            598808..599743
FT                   /locus_tag="ARC77_03155"
FT   CDS_pept        598808..599743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ARC77_03155"
FT                   /product="tRNA 2-thiocytidine(32) synthetase TtcA"
FT                   /note="TtcA; YdaO; catalyzes the thiolation of cytosine 32
FT                   in specific tRNAs; forms 2-thiocytidine (s(2)C); Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="EnsemblGenomes-Gn:ARC77_03155"
FT                   /db_xref="GOA:J7R423"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xr